2W6JH

Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 5.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improving diffraction by humidity control: a novel device compatible with X-ray beamlines.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2w6jH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w6jH01
1FS0E 4QMAA 2E5TA 2E5YA 1E79H 4TLFA 3EFFK 1JEKA 2XNDH 2JDIH 4WVZA 4YXWH 2WSSH 3PJSK 4DJGA 1BSHA 3USSA 1AQTA 1BSNA 2CK3H 2W6JH 2V7QH 1IFPA 2QE7H
chains in the Genus database with same CATH superfamily
4YXDC 2WVRA 1OXZA 1GL2B 2O3OA 1W2BO 3L73D 2BU4A 2LKMA 4RO0A 4HOHA 2NRGA 1Q81Q 2GXFA 3PCRA 5H2FH 3H1HD 3TGUG 3H1IJ 4GSPA 1G0TA 1JB0J 1EZVD 1K28A 3CNMA 1I0XA 3L70D 4R4KA 4AUWA 2OARA 1RF1A 2RSXA 4HM1B 3NXJA 1TJDA 2F99A 3BASA 1HU9A 3L0RA 1DD3A 3M0AA 4H44D 1FDIA 4DT0A 1YJWP 3K0ZA 3GRDA 1NKNA 3AE9C 1HTLC 1SQPE 4CCVA 3ZG0A 1FUSA 2IBZG 2GEYA 1KD14 4BIRA 4NREA 1H89A 1K9MQ 2CK3H 4GB5A 3RK2B 1SQPK 4R9LA 1SQXK 2F56A 2ZVNB 4N3YB 1PPJG 2C11A 1NTMG 3K7CA 4WFOA 4XA4A 1SQPD 1T2HA 1X1XA 1RRHA 2YMYA 4TLFA 5CMZA 2QG4A 3P8MC 2OYIA 4N3VA 2BCCE 3AECC 3DGYA 3A0BH 3CPWO 5KAIH 1Z56A 3WMM0 3Q2PA 2JJLA 4NPFX 3CX5H 1RGCA 3PGBA 5GTHE 3KPEA 1H8AA 1E3VA 1KB9H 4WHAA 1RQVA 5CHXA 1IFDA 1KTMA 1HJBA 1NO4A 3DUKA 4RBNA 1L4AD 1LTTC 1OHOA 4PJ0E 4ORLA 3Q1CA 3CX5D 3RK3B 4J9AA 2NPSD 5CCGA 3CC73 2V7QH 5D81A 1QVG2 1FAVA 2VRSA 1IYYA 2R5BA 1Q814 1JMMA 3AEAC 1PGJA 4OGQD 2W9QA 3OJAB 4WY4B 1IVUA 2STDA 1J1EB 3H3HA 3H51A 2M3BA 2KF4A 3HUSB 2AXTH 5AVYB 3EHCA 1WMOA 1NU1D 2CX1A 1H88A 4U7JA 5E79H 2KSEA 2LQVA 3TDKA 2IY2A 2FFDB 2FXOA 1KC8Q 1KILC 2A45I 1T8ZA 1M1JB 1Q7Y4 1RGLA 1XTGB 3V98A 4EDFA 3HD7D 2B1XB 4IL6X 1GSPA 4YTPC 1D6ZA 1HF9A 3TDGA 3IAOA 3FKAA 2KSJA 3UL6A 1WNHA 2QM8A 3N4XA 4FMDA 3CCL3 4WWIA 3KCHA 2BMQB 1VZZA 3DM8A 3C9IA 3CC4P 3H1ID 3CCR3 4O2HA 3LTDA 2IUJA 1NAFA 1GY5A 3JCUH 2ZHXB 3VMXA 1NJIQ 2HODA 4ASVA 1N8R4 2WOFA 4EBGA 3IR9A 1L4AA 2HR3A 2FFDA 1RN7A 5AIFA 4FMBA 3FG3A 2HMNB 1JCCA 1NNVA 3JVCA 2JKVA 1OF5A 1ZXGA 3PCSA 1WT6A 4ZNCA 3CC2P 1LTBC 1SFCC 4RKUJ 2W9PA 8RNTA 3CCEP 2XDJA 3H32A 5CXOA 3GF3A 1SIHA 2ZT9C 3DGNA 3V2NA 1IVXA 5BVBA 4WY4C 1KFNA 3BNEA 3PRJA 3EFFK 3PYJA 1EZVE 1Q90D 1NKZB 2XNDH 1JN5A 1KV4A 1L0NK 2AXTE 2KI7B 2RMZA 3K5BA 1IFJA 1GOVA 3B7CA 2AEFA 3I55P 1BNEA 5AW3B 3HIIA 5TJHA 1AVLA 5E79E 1JY3O 2D2CC 3UIAA 1MV8A 1G96A 2OGUA 1FDOA 2W6AA 1CW5A 1SQBK 1NU3A 5IG3A 3L72G 3M0DC 5AEUB 1YQ3C 3V4QA 1IT7A 5CBOA 4H13D 1HBWA 4R4MA 4OGQB 2E75C 3M9HA 1T3BA 3LMLA 1RGFA 1MGRA 3RL0g 1YIJP 3CL3D 1VDFA 1W02A 1RKYA 1OW8A 1X8YA 3G8ZA 2R3SA 3DGOA 1EKMA 2A45G 4EW5A 1PFPA 4RJTA 2W2CA 2P38A 1J1DB 1I70A 1JM0A 1BSDA 1NVOA 4LMIA 2N1TA 1M7LA 2E74C 4PD4H 1SIIA 2GU1A 2GUVA 1FOSF 4Z1MH 1JB4A 1A2VA 2OTLP 4HH2A 1KILD 1SQBE 1RRLA 1Q824 2QJKC 3E1RA 3Q3FA 1TTOA 2BEZF 4HZ9B 1JB5A 3RL0D 3B4OA 4HM2B 1LRAA 5APWA 3U97A 2BASA 3D5GA 3W67A 2Z5IA 3LTCA 5AYRB 2CFGA 1I3FA 3CCS3 1SQQK 2FNQA 1PPJD 4K1UA 4FR9A 2WGOA 5AW7B 4K90B 3SWYA 1YGWA 3ITKA 2R4IA 2FYUJ 3CWBE 1JBTA 2CKFB 5ELJA 5AVXB 2NPSC 3G9RA 3M9BA 3BB9A 2FYUG 3VMAA 2RN0A 4AKYA 1E5WA 1MFTA 2XF3A 2LR2A 5AVQB 1RTUA 1SVFA 3A76A 1GL2A 1RJOA 1IK7A 1NTZG 3PJSK 1L0LG 1RE4C 4PEJA 1OACA 1X22A 3CCJP 4HYZA 5STDA 1DMQA 2WPRA 1FZGA 1L0LJ 2INXA 1BDCA 2HMLB 3DXOA 2P2UA 4JYCA 5KJ7C 1AFOA 4N6NB 2F98A 1PL5A 4ZMDA 1JTHA 2H7HA 1VQLP 1BE3E 1NTZD 4WBAA 1O7MB 3HD7C 3L37A 2IUKA 3ABVC 1CYVA 3AMOA 4FCJA 3EQQB 1S5LH 1W2ZA 2R41A 2KCDA 1OX3A 3Q1MA 2L5GB 2KNCA 4K61A 3RGUA 1UUVB 1LXEA 1AQTA 1YQ4C 1TP6A 1DEEG 1JMBA 1CSBA 4HM3B 3F40A 1RQUA 2QM7A 3EFGA 3L71J 3L72E 1RNTA 4WP5A 5AW8B 3U59A 1QX8A 1CI6A 3S4RA 1JB2A 2GU3A 2AEJA 2RBIA 4OUQA 1FZCA 2GBWB 1BIRA 4IOIH 1OH0A 2HFED 2WSSH 3HI7A 5LC7A 2MKVA 1KQFB 3WHOA 1QVFO 3CCM3 2J58A 4GOFA 5RNTA 5IENA 1NTKJ 2P0MA 2ZYAA 3V99A 3QH9A 1VQ7P 1S3JA 1V57A 3CC7P 4J5KA 1Y9BA 2XH9A 3ZG5A 5G1LA 1BNFA 2WSEJ 4EV5A 5B66H 1OW6A 1YHQ3 1UDII 1SQBJ 3SFDC 1LQGC 3H1HG 1A02J 3LIEA 1X1WA 4JF8A 1TRPA 2Y0CA 1OFCX 2F5MA 1T2KD 3ER7A 1LNIA 3L70J 3RK3D 1A67A 5AW6B 2WGQA 5AVRB 3M9QA 2NPSB 5D83A 1DETA 2E75B 3WUTA 1RMSA 3MD0A 2CFLA 4D6TJ 1KWIA 2ITAA 5HGRA 1W6GA 3D9RA 1W00A 4BXLA 6STDA 2A15A 2FYUE 3WA3A 1OHSA 1W2B2 4I7ZB 3GHGC 1PP9G 1PGQA 2ZYGA 3FWNA 2QVAA 2OOVA 1IQYA 3WU2E 3S29A 1JRQA 4R1KA 4FMAA 2GA1A 3LW5J 3VGNA 1RGHA 1E79H 2FYNC 3S1KA 2YFJB 1R4YA 1VF5C 2V4HA 5C39A 3X42A 2RGQA 3Q5SA 2XGNA 1T6AA 3FGAD 4EV2A 2RH0A 2P67A 2W6BA 2CWUA 4J5GA 3OW2O 1BE3G 2YFLB 2P58A 2YIUB 1RHLA 3FG4A 1VQ9P 1L0NG 4W7ZA 2L4VA 3GLMA 4FCZA 3RL0C 3AGOA 1SQQJ 1LNQA 3L75J 4C7NB 3D4AA 4UB6E 1BCCD 2Q5UA 5APVA 3EF8A 2KLUA 4GHOA 2E76C 2JWAA 3L74G 1AY7A 1EEJA 2JWDA 2P0XA 3TSIA 3V92A 1S72P 1SQVE 1ISKA 2CFWA 3A2AA 1G2CA 3G4S3 1PP9J 1GY6A 1LOXA 2JDIH 3A0HH 1JO5A 1ZW0A 3KYQA 1PYLA 1P84I 2POHA 1B2SA 4RZMA 3GZRA 1SJWA 2M8RA 4KHXA 1NHLA 5BVZA 4L8OA 5JBSA 1W6CA 2C10A 3U1WA 4JQ0D 1YTZT 1K73Q 2FXTA 1QVGO 3NMDA 1LT9A 3B8LA 2GSPA 3MHEA 2QJYB 2W6JH 2MC8A 2IFMA 3KXDA 3MSOA 4R4LA 1V58A 1SPUA 4FMCA 4HVNA 1LTGC 1R5SA 2UX0A 1JY3N 1Q864 2Y0EA 2IYJA 3PS8A 1OZHA 3UL5A 1OUNA 1DVCA 1LTJC 4H61A 2ML5A 2Q07A 2XGLA 4WYKB 2WOHA 5EVHA 2XSOB 1F8NA 1SQVK 4IPBA 2D1WA 1M57D 5BXQA 4N6UA 1FZUA 5FGOA 3AE1C 4H13B 5BU8B 1NTZJ 2IZ0A 1GD4A 3II6A 4CPKA 3Q3DA 2KK7A 5KKZC 3A5TA 3OAKA 1VQ5P 1K8A4 3RK3C 1FGMA 2KLVA 1K05A 1RE3A 1BCCG 3L35A 1BRIA 4RNYA 3JSVC 1JCDA 1DYUA 3Q2YA 2PZVA 3U1CA 2BCCD 4U3FE 3H32B 1IDPA 3EX9A 4K35A 4N6MA 4K1VA 1SQBG 3S28A 1M8OB 2Y74A 1AVOA 3CCRP 3JUOA 2JR8A 2XKMA 3U1AA 1OGZA 3G0KA 1RSNA 3GMAA 1UCIA 1NTMD 2J5UA 3AGNA 1QJGA 1KILB 3J7Yd 1OHPA 1MUUA 2HPCB 1US1A 1BNRA 2OTL3 3RL0B 1PU4A 5AIHA 1IU7A 1YJNP 1KQGB 1TUHA 1V74A 1OVRA 1BGYD 3GG2A 1LTSC 1C54A 1ZR4A 1YVSA 1K734 3NXSA 3CCQ3 2YO3A 2XU6A 3H1LD 3M0DA 4I2LC 5JPPA 5I97A 4LEHA 1U7MA 4LGDE 2QIYA 4W80A 1DIPA 2K37A 1JY3P 3NQYA 1L0LE 3AE2C 2IBZI 2QRXA 3PHLA 4D6TD 2PAJA 3V5BA 1NU1K 2H8PD 1T3JA 4L75A 1BSNA 1GW4A 1WMKA 3RBZA 3A7OA 1K41A 1NAYA 3HOHA 1U7JA 1N7SA 5KLVD 3MG3A 1BVIA 4O3VA 3CPW2 1Q9EA 4TX4A 2HPCA 1ZMEC 2QJKB 1SQXJ 1BU4A 4RESB 3CXHE 1Y4KA 4BL3A 1PP9E 1FGQA 3AMOB 4OWFA 1EQ7A 4OGQC 1UCKA 3CC43 4YXWH 1HGZA 3PP5A 3URPA 3F89A 3G713 1ZOYC 4EYYQ 1QAFA 1BGYE 1K8AQ 7STDA 3G4SP 2Z5HA 3KDPB 1IFPA 3DMCA 1M1JC 2ZT9D 4JYBA 3P8CE 3SEDA 1B21A 3MG1A 3DY5A 4L76A 4BL2A 1RF1B 1CQSA 5AEWB 5M19A 1CH0A 2DW3A 1EA2A 3MZWB 4HM6B 5AVTB 2WSFH 3WA2X 2ZVOB 3MG2A 1FUTA 3LIDA 2BNGA 2ZDJA 3KIIA 2XRXB 1BGYJ 1FGRA 1JY2N 4EI2A 1PIXA 3KSPA 1FYSA 3CXHI 1JNQA 1IV7A 5DJTB 5IG0A 5KLVK 2O3JA 2PRRA 1I2EA 1B2ZA 1IQ8A 3WUUA 3ZDMA 4JF7A 1GW3A 2GUSA 1P84D 3HD7B 3F7SA 1J2BA 2KNCB 1N9JA 3O8ZA 3LW5H 3X3ZA 1SQXE 5B5EH 1RGAA 3MIWA 1RDSA 3G16A 2K9YA 3OWYA 5TISH 5EEOA 3L71E 3L72J 2KP8A 1QAKA 1QL2A 1FGTA 2K3DA 1YJW3 3NTNA 3NM2A 1PFIA 5CCHA 3HD7A 2ML6A 1CZQA 1FBMA 4JPZB 3W68A 4CJNA 2OCTA 4RNZA 2FXMA 5BU5A 3F9SA 1NH4A 3VYIA 5GTIE 1KC84 3IMAB 3K9MC 4HB1A 3L75E 2O1JA 4XFJA 1SQQE 2BCCG 1FZCB 2ZJSE 1LOYA 1I2GA 2WSFJ 3N7NA 5AVWB 4N6OB 2OYHB 2AAEA 1M9GA 4GKGA 3OWSA 3B4SA 1OVVA 3NBJA 1H0TB 3H1KD 3CCMP 1IK3A 3WU2H 2K9JA 3BRVB 3I56P 1PGOA 1TU3F 1WRGA 1OGXA 1ULIB 1FC2C 3B71A 4ZKPA 2BEQD 2HMKB 3IPTA 4U3FG 2Z7AA 1USEA 4STDA 1VQ93 4HYTB 4U3FJ 1T2KC 1GD2E 3CCU3 4PD4D 1KYOI 3NUVA 3M8CA 1ZN5A 3H1JE 2Y0DA 1RCKA 1FE6A 2F5WA 2Q3IA 3KZIH 3EB8A 3SWFA 4XM4A 3PXMA 1VF5B 1FA3A 5AVUB 2WTYA 1H0TA 3DGLA 3Q90A 4PV1D 1NTME 5AW5B 2WMMA 1NTMJ 3ECFA 1DMNA 3QWOC 3MYTA 1EG9B 3MP7B 3VP9A 3D79A 3GZYB 4LYLB 3C1LA 5DJUB 4JBZA 1I8VA 3B5ND 7RNTA 1KB9D 1MKMA 2R32A 3QRDA 4C7NA 3PTZA 2MF7A 1QLED 2YFIB 1BUQA 1KSIA 1O7WB 2CX0A 5HOHA 4DCKA 2OOVC 3IF4A 1U57A 2AXCA 1HWTC 2O9UX 1IK9A 4KFFA 1URQD 3MHVA 1G2CB 5KAFE 1IC2A 2ZXXA 2G8YA 3CCVP 5AIIA 5M1AA 4Y28J 3L4FA 2SARA 1B20A 2E5YA 1R4CA 2B9BA 2QJPC 2AEMA 4IFFA 4KFEA 3HZPA 3OX9A 4IL6E 1YIJ3 2KF3A 1I0VA 1O7HB 1VQL3 1HH0A 2CHCA 3DGMA 1BRHA 1T2IA 4LZIA 2YKQA 3FSDA 3UB1A 1EZVG 2W8ZA 1HGVA 2LYXA 4I4KA 1NYHA 4BRYA 2RCDA 3KE7A 2KB7P 1MGWA 1LWUB 1PY3A 4BWNA 2HODB 1UI7A 2OYIC 5IF6A 4LLHA 1FJKA 3WDGB 2BO9B 1RF0C 2BHMA 2BT3A 3CMAP 2SPZA 1UUWB 4BTXA 1QVF2 1IFNA 2WZ7A 2UUGC 9RNTA 1ZV8A 1AQZA 5AW9B 1FUWA 3D6YA 2OWPA 3K63A 3CPOA 1LWUA 1P84E 1Y8AA 1VF5D 2QA43 1MNLA 3RK3E 2Z76A 4PV1B 1FU1A 3HX8A 5CJ4A 3LZAA 5AIGA 1CEWI 1UW1A 5KAFH 3NHXA 1Q7HA 1EUIC 3EQ2A 3T8UA 1N86A 3G71P 1JV2B 4B86A 1JUNA 5CCGC 2KXPB 1Q42A 2E74D 3HRNA 2CWTA 3O6QB 2OTJ3 1BRJA 1N7SB 5TGNA 3V6IA 4L8PA 2GBXB 1VQ83 4HJLB 1YJ9P 1Q7YQ 1RH5B 2JEEA 2HYNA 4OH8B 5B5EE 3CMEP 1VQ4P 1BRKA 1STFI 1GDTA 1RF1C 2O1KA 3RK2C 1USDA 3HK4A 3CWBD 1NTKE 1OW7A 1M90Q 1G1JA 2YXRB 3CCV3 1KILA 3LYGA 1IFMA 3X40A 2ZA4A 4OK0A 3IJEB 3S5CA 1T5YA 4D6TE 4MMYB 1VQN3 3G3ZA 2B87A 5AW2B 2PNCA 4OVMA 1MZ9A 1KQSO 4MJDA 2Q1KA 3IN6A 4ZM8A 2CC3A 3TK1A 1N8RQ 4AQRD 1EDJA 4HBRA 2A06G 3H1IE 2XFTA 1X1YA 2E75D 3CC23 3P7KA 2P7JA 4LC1A 1W5ZA 3RGRA 3T0UA 2C4BA 4L73A 2H0HA 6RNTA 1J1DC 3AE5C 1BOXA 1CI6B 1A2PA 2XNXA 2LXBA 3I553 2E76D 2K3RA 3BU4A 3FG1A 4XBTA 1GL2D 1E97A 4HM5B 8CHOA 1ROVA 1OWAA 2NZ2A 1BSEA 5KTBA 4HAAA 3L70G 1DVDA 4WWUC 2WPQA 4JRFA 2B87B 3D70A 1RHZB 3D71A 3M91A 2P05A 1AQ5A 2BMRB 4XE5B 1MOLA 1OIPA 5APQA 1VQ53 2YKOA 3L73G 1MWTA 1MWSA 1PGPA 3DH2A 1PZQA 1GS3A 5CJ0A 1BNGA 5KLIB 1JY2P 1YYCA 3SVAA 1GMJA 2V1LA 1EDLA 2KF6A 5IW9A 2KIKA 3CWBJ 1XTCC 3CX5I 1RN4A 5JPUA 2M5AA 3X41A 1KQS2 3H1LJ 5GTIH 2HMOB 1UGHI 5D82A 4IFMA 4ASWA 3L74E 3FXDA 1W6YA 2RKLA 4AEQA 5CCGD 1SQPG 1BSHA 5A0OB 1BE3D 1NTZE 1BNSA 3SX1A 3X3YA 3CCLP 4QWTA 2AADA 3AEEC 4TT3H 1NTZK 5AYSC 1ZRTD 5AVSB 1TRQA 3I0YA 2FBWC 1FJPA 3HIGA 5KP1A 3F5HA 4MN4C 4HJGH 1VQM3 1LNHA 2C9NY 3S27A 2QJPB 3CCSP 2E2TA 1AA0A 2QEX3 1RGEA 1W7CA 1N73C 3L75D 2KF5A 2M7OA 3I563 1SQQD 1EDKA 1EDIA 1D6UA 2FYNB 1R8EA 1DH3A 1SFCB 4HKVB 3AE3C 3FWLA 3ZFZA 2F4YA 2R44A 1ZO2A 1DMMA 1LT1A 5GTHH 1S5AA 3GZBA 1UCJA 3R2PA 3TGUE 2PGDA 1L4AC 3K5TA 3L36A 3CCUP 3MUDA 3O8YA 3L74J 2WQYC 4XDWA 1NTKD 1KN7A 3WMDA 3TNUB 1U5OA 4IL6H 4KJMA 2CH9A 1J1EC 1MWRA 3MWZA 4UB8E 1AVKA 2L91A 1NJI4 4LSOA 1SFCA 1B2MA 4UB6H 1RN1A 1OMIA 1X9VA 3CMA3 4IT7A 3ALAA 2UWJE 3CCJ3 2R3CA 5KLIC 2E76B 1N73B 2OYHA 2HLOA 1RGGA 4EOTA 1SQVJ 1EZVI 3B8EB 1L2PA 2NPSA 2W0QA 3EJVA 3F14A 5APTA 2YMKA 1E3RA 2L1SA 3TNUA 3JUPA 4R9KA 5G2GA 1MFZA 1YGEA 2QSIA 3CXHD 3A0HE 1GL2C 3B5NB 1G1IA 4U13A 1HYFA 2C0WA 2CWVA 1RE4A 1ULJB 5EQLA 1UCLA 3OA7A 3TGUD 3PH0A 3BRTB 3VP8A 5KJ7A 4NPDA 3MTUE 2R5DA 3FZWA 1NB5I 5APYA 1K9M4 3BCCJ 3H1KG 2FYZA 5KLVE 3KSED 4R80A 3NFQA 5TISE 3AE6C 4GIFA 3KN4A 4KFDA 5IG4A 4HM8B 3JCUE 4XB5A 1GYBA 4MEIA 4I7ZC 1BRNL 3ROBA 5ELUA 2C9LY 4M3LA 1QALA 1GMQA 3OV4A 3B5NA 2A06E 1IVVA 2N1TC 1W4NA 2YO2A 1HVVA 3AEFC 3S9OA 1N5PA 2WSEH 2UGIA 1B2XA 4GT1A 3HTKB 2WO0A 4NPEA 5AW1B 3SWKA 1O7NB 3V4WA 3JC22 2QA4P 2FXPA 2A06D 3CD6P 2D42A 2SBLA 1VQPP 4CPGA 3WODG 4ZKUA 1OVUA 1Y47A 1STDA 2BMOB 1BE3J 5M1BA 2B88A 3FLJA 3KQGA 2ZT9B 3HTKA 3L72D 4O9BA 4WVZA 5IEPA 5APSA 2E2VA 3FF0A 4XBYA 3JUMA 4H0LC 1QEXA 1IJDB 1SQPJ 5KP4A 1VQ73 4U3FD 1BGYG 1IV9A 3F7XA 1VQ43 3E99A 2Z4EA 3L73E 3VMZA 1L0LK 1X79B 1OF5B 1KYOH 2WT7A 1WMPA 3JUQA 3PZWA 1LT9B 4BRYB 4K3AA 3O6QA 4H0LD 1TIJA 3GHGB 3HUSA 3AHSA 3H25A 3L70E 2PFXA 2I9WA 5CF2A 4Q53A 1DX7A 3MKIA 1VQNP 2IPPA 1ZRTE 1URQC 1ASKA 1N7SD 1EXIA 1A90A 2F86B 2FKWB 1JN5B 2WPSA 2O01J 2WT7B 2Q3EA 4YPCA 5GSPA 3G6E3 2GM4A 3M06A 4DOJA 2E2UA 4I1LA 2YKPA 3GHGA 2J8XB 1UGIA 3KFQC 5L8RJ 3BVHA 2IA7A 1KQLA 4PD4E 2B24B 1EQKA 2N9YB 1ZR2A 5BU4A 1QL1A 1ZX2A 1BRSA 3SXXA 3H1IG 3GW6A 1NDOB 5AW4B 2JP3A 1S2EA 2I8DA 1RF0A 1L4AB 1M1KQ 3R4YA 3H1KE 2CG0A 2CFDA 3EE1A 1A02F 1BCCE 5K5GB 1MWUA 4MMXB 2YNYA 4XBXA 3H1LG 1FZFA 4GODA 2K0MA 2W56A 3NBBA 4J8TA 1LGHB 3D5IA 5M18A 2V7QJ 1AJYA 1FOSE 3WOFB 3HE4A 2OQEA 1S5LE 3A3YB 3L75G 3AEBC 1GU5A 4UB8H 4BTYA 4KZ1A 4WB4A 1KFMA 1NTMK 3AE8C 1GOUA 3FX0A 2P1JA 1HUCA 3GWRA 3C8VA 1BANA 1FZEA 1LQMB 4H44C 2ZFCA 3H1JD 2BCCJ 4DJGA 3LTAA 1VQKP 2QGUA 1GD3A 2Q6QA 1I2FA 1PP9D 5KJ7D 2LXCB 1Q86Q 4ILFA 3SSUA 2IYPA 1LT9C 1RY3A 1UIXA 3JUNA 3T8NA 1KZUB 1SQXG 1SQVD 3TF5A 2GEXA 3KKGA 1SQWA 2Z6BA 2C0XA 1NU1E 3VN0A 2OTJP 2JO1A 3LH4A 2WWWA 3BNCA 1BSAA 2I1JA 1VQQA 4CDLA 3HE4B 2OQQA 1IQXA 3H6PA 1HJ0A 4IFDK 4GDOA 3OW22 1M1K4 1KD1Q 1SQXD 4OVNF 4GOEA 3KZIE 5KLVG 2KS1B 1N2DC 1M904 1DD4A 2QJYC 2KRTA 1DE3A 3H1JJ 2O01N 7GSPA 3H1HJ 3VMYA 1KYOD 1BNJA 3BCCD 1L0NJ 3N9HA 3SYUA 1WQLB 5FW5A 6GSPA 2QIWA 2W90A 3L71G 1RE3C 1YVBI 2KZIA 1UI8A 3EWKA 1BSCA 3HE5B 3T97B 3F8HA 3B4PA 3BCCE 3FH1A 3RDEA 1N7LA 1UIIA 3E1IA 2QE7H 3SLUA 5AW0B 2FGTA 3I5CA 1JKGA 3D3LA 4L7KA 1VQ63 1IT8A 3D6ZA 1GK4A 1YHQP 1HKXA 1NO3A 2IYOA 1SFCD 1DEBA 3CCQP 3CME3 2Z77A 2P10A 1NB3I 4O02B 3EBYA 4EYCA 2E42A 1LP1A 1Q82Q 3SOYA 2O01H 2YXQB 3S67A 1KMIZ 3VF1A 4AYCA 3OXAA 2W03A 3KHUA 4RNTA 2K1AA 1TFOA 1JKGB 5H2FE 1KYOE 1NOHA 1RCLA 1FW7A 1LTIC 4G1MB 3L74D 4EC6A 1ZS7A 3HE5A 1NGMB 1LOVA 3GSPA 2Y9ZA 3WUVA 1AR0A 1LOWA 4BU4A 3VTPC 2CPBA 2OYIB 1KB9I 2ZAEB 1IO4A 1S5LX 4FCMA 3SOAA 2W27A 2KYVA 2WPVB 3CD63 2KZJA 4NPBA 1N7SC 4N6V0 1GOYA 3AEGC 3H1JG 1BDDA 1LTJA 3BNDA 4DZOA 1LP1B 3AE7C 1JZOA 2HMJB 2B89A 2ZL8A 1FDMA 4HM7B 3LTBA 4PV1C 1N73A 3TYYA 4X2HA 1C7HA 4BTWA 3GZXB 1BRGA 1X1UA 2K9JB 5CBNA 2FY8A 3UNLA 1B27A 3RNTA 2RNTA 4N6JA 1T3UA 2OYOA 3BIRA 5CLKA 1AVYA 5IERA 3RK2D 2JQ5A 3BLZA 3MUDC 2E74B 1UUGB 4PD4I 1TU5A 3BNBA 1SQVG 4X2OA 4NHFA 4HM0B 1D6YA 3FCSB 2D2CD 1JBRA 2WITA 3GF7A 1G02A 2RFRA 1IVWA 3H1LE 3GAXA 3AE4C 1LTJB 2CIUA 1PPJE 1BGSA 4QMAA 2OYHC 1O7PB 1X0TA 4C46A 1M56D 3CU3A 3X3XA 3LXUX 3NBRA 5EFWB 4GL6A 1VQ6P 2KXGA 1W01A 3CLQA 1GMRA 1BNIA 2IMJA 2CPSA 1GK6A 1JY2O 2H88C 3E7KA 5AVZB 1AV1A 3VOPA 1KILE 1SQBD 1W2EA 3EC9A 3QK9A 3EBTA 2FYUD 1Q40A 2M3EA 4O8SA 1LJ2A 1I3IA 1IZNB 4Y99B 5KLVJ 2ZYDA 1NU1J 1WMNA 2FYUK 3L71D 2CG1A 1BSBA 3F8XA 1FZBA 2FFDC 2N1TD 3FGYA 4LGQA 4EXRA 2P09A 4A7PA 3CI9A 3KZTA 1JEKA 3Q5PA 2PP6A 1N8QA 4EIJA 5CCHC 3MGNA 2HG5D 1NTKK 2IFNA 2XEPA 5KP3A 3P8CD 2HOHA 1GU4A 2YIUC 1CYUA 4HM4B 4H0LB 1FZAA 3N8BA 2H43A 2E43A 5CCHD 5APUA 3MPHA 3CXC2 1SLQA 4WY4A 2K54A 1VPCA 4WYKA 5APXA 1NWWA 4N6TA 5DRVA 3B5NC 2QEXP 3NX0A 1VQ8P 1Q40B 1HZ1A 3UJMA 1S9KD 2XFSA 2I1KA 1M1JA 2MJZA 3LT8A 1W5CE 3EN1B 1O7GB 3H1KJ 3NV0B 3WR2A 2KUBA 1VL2A 3H1HE 1OPYA 1U8CB 2XSHB 2E5TA 3G6EP 3BATA 4I6MC 3WOEB 1URQB 1EC5A 3LOYA 1JBSA 5G1KA 1NTKG 5BIRA 1YI2P 1PV3A 2A45H 2IX7C 1JZDA 5DREA 4AKZA 3USSA 2W56B 5IEOA 2CW9A 1FGOA 3SFEC 3NV0A 3RBXA 3VSYA 2XZRA 1N5HA 1LVNA 4I5QA 3AHWA 3CCE3 2CFKA 1FS0E 1BUJA 2D2CB 1OCVA 1VQOP 2WSCJ 1Q2NA 5KAIE 3CNXA 3A5EA 1M1XB 1A2KA 3LT9A 1J2JB 3BCCG 1TFKA 1WTHA 3HUSC 2H0GA 2H0IA 4H13C 1JNMA 1QMAA 1URQA 3CX5E 4HZBB 1SARA 2KOGA 4D6TG 1NWQA 1L0NE 2IBZD 4IIAA 3PLNA 2HMMB 3V2RA 1N9EA 4KT0J 3AEDC 4PJ0H 1NU1G 3CXHH 3L73J 4W7YA 1YNVX 1L5GB 3TGUJ 1GMPA 1Z1SA 1VQK3 2N1TB 2OTKE 1ZLLA 1L0ND 1ROAA 1ZP0C 4L74A 1SP4A 2IBZE 2M0BA 5CF1A 5LC6A 2KAAA 2KS1A 2W83C 4H44B 1B2UA 3P32A 3IFMA 2J59M 1QGKB 1RGKA 3NM7A 4KVHA 1R5LA 1L0LD 1ZGXA 4XDVA 1EXJA 3Q5RA 2Y9YA 2XR8B 1B3SA 1IFIA 1GZLA 3DZLA 2IZ1A 4N78E 3NQZA 4KT3B 1YI23 2IDBA 2H89C 1VQP3 1S723 1D7MA 5B66E 1P84H 3EN8A 4C7RA 2OQEC 1YIT3 2K88A 4MMZB 1YBKA 1YITP 5IG5A 3RGAA 2YX9A 1JTHB 4DKIA 2Q9IA 4N6LA 3FF2A 2WSCH 1S1CX 1VQMP 2Q7CA 1KB9E 4H3UA 1YJN3 2XV5A 2W04A 5AI1A 1KORA 4HKZH 1BCCJ 5CK6A 1SS1A 2N9BA 1S4XA 1S9KE 1BAOA 1LTAC 1FZCC 1JOCA 5KKZB 3STDA 4Y99C 1GY7A 3V2PA 1AV4A 3FXEA 1K04A 3N54B 4N78D 1LWUC 1VQO3 1RNBA 2G3AA 1GTWA 1YJ93 3A0BE 2Y73A 2ZXEB 1JJ22 1YTZI 1RLSA 3T97A 2BIRA 3V2QA 3CWBG 3OWUA 5AVVB 2M5AB 4WY4D 1SQQG
chains in the Genus database with same CATH topology
4BTYA 4KZ1A 2OOVA 1IQYA 3S29A 2LYXA 4I4KA 1JRQA 4R1KA 4FMAA 3VGNA 2O3OA 1E79H 2RCDA 3KE7A 2YFJB 3GWRA 2GXFA 1UI7A 2RGQA 3PCRA 4DJGA 3X42A 2XGNA 5IF6A 3LTAA 3WDGB 4EV2A 2QGUA 1GD3A 2BO9B 3CNMA 1K28A 2BHMA 2BT3A 2CWUA 2YFLB 4R4KA 3FG4A 1UUWB 3JUNA 3T8NA 4BTXA 1QVF2 2GEXA 3KKGA 1SQWA 2L4VA 2RSXA 4FCZA 4HM1B 3NXJA 2F99A 2Z6BA 1FUWA 2OWPA 3K63A 3CPOA 1HU9A 3L0RA 3BNCA 3EF8A 3LH4A 4CDLA 3K0ZA 1MNLA 2QA43 3GRDA 1IQXA 2P0XA 2Z76A 3HX8A 3V92A 3LZAA 4CCVA 3OW22 5AIGA 1M1K4 1ISKA 2CFWA 1CEWI 1UW1A 2GEYA 1KD14 3G4S3 3NHXA 4NREA 1M904 3T8UA 2CK3H 1GY6A 1LOXA 4GB5A 1JV2B 2KRTA 4R9LA 2JDIH 1Q42A 2OTJ3 2CWTA 5TGNA 2C11A 4WFOA 3K7CA 3N9HA 2GBXB 4L8PA 4RZMA 1VQ83 1RRHA 3GZRA 4TLFA 1SJWA 1WQLB 4HJLB 5FW5A 4N3VA 4L8OA 5JBSA 1W6CA 2C10A 1YVBI 1UI8A 3U1WA 2FXTA 1STFI 3B8LA 3F8HA 3B4PA 3Q2PA 3FH1A 3MHEA 3RDEA 2W6JH 2MC8A 3HK4A 3SLUA 2QE7H 3PGBA 3MSOA 3CCV3 3LYGA 3X40A 2FGTA 1SPUA 1E3VA 1JKGA 3D3LA 4FMCA 4HVNA 4OK0A 4L7KA 4WHAA 1IT8A 1VQ63 3IJEB 3S5CA 1T5YA 2UX0A 4MMYB 1VQN3 1HKXA 1NO3A 1Q864 3CME3 3PS8A 3UL5A 1OUNA 2Z77A 2PNCA 1DVCA 4OVMA 3DUKA 4RBNA 4H61A 1NB3I 2ML5A 2Q07A 4MJDA 2XGLA 4WYKB 4O02B 3EBYA 2WOHA 1OHOA 4ORLA 4ZM8A 5EVHA 2CC3A 1F8NA 2XSOB 3Q1CA 4EYCA 4HBRA 4J9AA 4IPBA 2D1WA 2XFTA 3SOYA 5BXQA 3CC73 3S67A 2V7QH 5D81A 4N6UA 5FGOA 3OXAA 2W03A 3VF1A 3CC23 1QVG2 1Q814 1TFOA 1JKGB 2W9QA 1GD4A 1W5ZA 3RGRA 3T0UA 4G1MB 1IVUA 2STDA 3H3HA 1K8A4 3H51A 4EC6A 1FGMA 4RNYA 3I553 3FG1A 1DYUA 3EHCA 2PZVA 1WMOA 1AR0A 4XBTA 1E97A 4HM5B 8CHOA 1IDPA 1ROVA 3EX9A 2LQVA 4N6MA 4K1VA 3S28A 4FCMA 3SOAA 1DVDA 1Q7Y4 2Y74A 4WWUC 3JUOA 3V98A 4JRFA 3CD63 2B1XB 1OGZA 4N6V0 3G0KA 1D6ZA 2P05A 2BMRB 3TDGA 1MOLA 3BNDA 3FKAA 3UL6A 1VQ53 1QJGA 1WNHA 4FMDA 3CCL3 3J7Yd 1OHPA 2HMJB 1US1A 2BMQB 1VZZA 3DM8A 2ZL8A 2OTL3 1GS3A 1PU4A 4HM7B 3LTBA 5AIHA 3CCR3 1IU7A 4X2HA 1TUHA 1V74A 4O2HA 3SVAA 1C7HA 2V1LA 3LTDA 3GZXB 2IUJA 4BTWA 5IW9A 1GY5A 3UNLA 5JPUA 1N8R4 3X41A 2WOFA 5CLKA 1K734 4EBGA 3CCQ3 1KQS2 2HMOB 5D82A 5IERA 2JQ5A 5JPPA 5I97A 1RN7A 4LEHA 3BLZA 5AIFA 4FMBA 3FG3A 2HMNB 2QIYA 3JVCA 1W6YA 1TU5A 3BNBA 4AEQA 1BSHA 5A0OB 1OF5A 3NQYA 4X2OA 3SX1A 3X3YA 3PCSA 4NHFA 4HM0B 4QWTA 1D6YA 3FCSB 5AYSC 1BSNA 2W9PA 2RFRA 1IVWA 1K41A 3GAXA 3I0YA 3MG3A 2CIUA 4O3VA 3CPW2 5CXOA 4TX4A 1SIHA 4QMAA 3DGNA 1IVXA 3HIGA 5BVBA 1O7PB 5KP1A 3CU3A 3X3XA 3LXUX 3NBRA 1Y4KA 3BNEA 3PYJA 3EFFK 1VQM3 1LNHA 4GL6A 3AMOB 1FGQA 2XNDH 1JN5A 2KXGA 3S27A 1W01A 2IMJA 2E2TA 3CC43 2QEX3 4YXWH 1W7CA 2M7OA 3B7CA 3I563 3HIIA 1AVLA 1D6UA 3EC9A 3G713 1QAFA 3QK9A 3EBTA 4HKVB 1Q40A 1G96A 4O8SA 7STDA 1ZO2A 1DMMA 1IFPA 1NU3A 1S5AA 3DMCA 3GZBA 1WMNA 5IG3A 3SEDA 2CG1A 3MG1A 3K5TA 3DY5A 3F8XA 5AEWB 1CQSA 5AEUB 3WA3A 3FGYA 3O8YA 4LGQA 1IT7A 1EA2A 4XDWA 4EXRA 2P09A 3WMDA 3KZTA 1U5OA 1JEKA 4HM6B 2CH9A 3WA2X 1N8QA 3MWZA 1AVKA 3LMLA 1NJI4 4LSOA 3MG2A 2XEPA 5KP3A 1W02A 3CMA3 2BNGA 4IT7A 1RKYA 3ALAA 3CCJ3 2ZDJA 3G8ZA 3KIIA 1CYUA 4HM4B 3DGOA 2XRXB 1EKMA 3N8BA 1PFPA 1FGRA 2W2CA 3KSPA 2W0QA 3MPHA 3CXC2 1JNQA 2P38A 3EJVA 1IV7A 3F14A 5IG0A 2K54A 1E3RA 4WYKA 1IQ8A 3JUPA 4R9KA 5G2GA 1NWWA 4N6TA 5DRVA 3NX0A 1Q40B 1YGEA 4LMIA 3F7SA 1J2BA 1N9JA 3X3ZA 1SIIA 2GU1A 4U13A 3UJMA 3G16A 1JB4A 1A2VA 2CWVA 2XFSA 1RRLA 1ULJB 3LT8A 5EQLA 1Q824 3EN1B 1O7GB 3OWYA 3NV0B 5EEOA 4HZ9B 1JB5A 3B4OA 4HM2B 1OPYA 1U8CB 2XSHB 2E5TA 3U97A 1QAKA 1FGTA 3WOEB 1YJW3 3FZWA 1NB5I 3NM2A 3LOYA 3LTCA 5AYRB 1K9M4 2CFGA 2ML6A 3CCS3 2FNQA 3KSED 4R80A 4K1UA 4FR9A 2WGOA 4K90B 3KN4A 4KFDA 2OCTA 4RNZA 5DREA 4AKZA 3USSA 2W56B 5IEOA 3F9SA 5IG4A 2CW9A 1FGOA 2R4IA 3NV0A 2CKFB 4HM8B 5ELJA 3VSYA 1KC84 1N5HA 3BB9A 3IMAB 1LVNA 3K9MC 4XB5A 4AKYA 1GYBA 3CCE3 4MEIA 2XF3A 2CFKA 3ROBA 1FS0E 5ELUA 1QALA 3OV4A 1OCVA 1IVVA 4N6OB 1W4NA 3A76A 1M9GA 1N5PA 3OWSA 3CNXA 3NBJA 1RJOA 1M1XB 1A2KA 3LT9A 1TFKA 1WTHA 1IK3A 2WO0A 3PJSK 4PEJA 1OACA 4HYZA 5STDA 1O7NB 1DMQA 2INXA 1OGXA 3DXOA 2HMLB 1ULIB 1QMAA 2SBLA 2D42A 4HZBB 4N6NB 2F98A 2HMKB 3IPTA 3WODG 1STDA 2Z7AA 1O7MB 2BMOB 4IIAA 4STDA 1VQ93 2HMMB 1N9EA 2IUKA 1CYVA 3CCU3 3FLJA 3AMOA 4FCJA 3EQQB 1W2ZA 1L5GB 3NUVA 2KCDA 1Z1SA 3M8CA 4WVZA 1VQK3 5IEPA 2E2VA 3FF0A 4K61A 4XBYA 3JUMA 1ROAA 1UUVB 5KP4A 1VQ73 1LXEA 1AQTA 1IV9A 3F7XA 5CF1A 5LC6A 1VQ43 1TP6A 3E99A 3EB8A 4XM4A 1OF5B 4HM3B 3PXMA 3F40A 3JUQA 1WMPA 1FA3A 3PZWA 3DGLA 3NM7A 3Q90A 4KVHA 4WP5A 4XDVA 1JB2A 1TIJA 2GU3A 2XR8B 4OUQA 3ECFA 1DMNA 2I9WA 5CF2A 2GBWB 3DZLA 1OH0A 4Q53A 2WSSH 1EG9B 3HI7A 3MKIA 3MYTA 5LC7A 3NQZA 1ASKA 1YI23 3CCM3 3GZYB 1VQP3 1A90A 2F86B 1S723 1JN5B 5IENA 2P0MA 3EN8A 3V99A 2OQEC 1YIT3 3G6E3 3QRDA 4MMZB 2E2UA 2MF7A 2YFIB 1BUQA 5IG5A 1KSIA 1O7WB 3RGAA 2YX9A 2XH9A 2OOVC 3KFQC 2IA7A 4N6LA 3FF2A 2B24B 4EV5A 1EQKA 4KFFA 2O9UX 1YHQ3 4H3UA 1YJN3 1ZX2A 2W04A 5AI1A 3SXXA 5AIIA 1NDOB 5CK6A 4JF8A 2E5YA 1R4CA 3STDA 2CG0A 2CFDA 3ER7A 1A67A 3EE1A 2WGQA 4KFEA 1GY7A 3HZPA 1AV4A 3OX9A 4MMXB 1VQO3 3N54B 5D83A 4XBXA 1YIJ3 2K0MA 2W56A 3NBBA 4J8TA 1YJ93 2Y73A 1JJ22 2CFLA 1O7HB 1KWIA 1VQL3 5HGRA 1W6GA 2CHCA 3D9RA 3WOFB 3OWUA 3DGMA 2OQEA 1W00A 6STDA 2A15A 4LZIA 3FSDA 3UB1A 1OHSA 1W2B2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FS0 E;  4QMA A;  2E5T A;  2E5Y A;  1E79 H;  4TLF A;  3EFF K;  1JEK A;  2XND H;  2JDI H;  4WVZ A;  4YXW H;  2WSS H;  3PJS K;  4DJG A;  1BSH A;  3USS A;  1AQT A;  1BSN A;  2CK3 H;  2W6J H;  2V7Q H;  1IFP A;  2QE7 H; 
#chains in the Genus database with same CATH topology
 4YXD C;  2WVR A;  1OXZ A;  1GL2 B;  2O3O A;  1W2B O;  3L73 D;  2BU4 A;  2LKM A;  4RO0 A;  4HOH A;  2NRG A;  1Q81 Q;  2GXF A;  3PCR A;  5H2F H;  3H1H D;  3TGU G;  3H1I J;  4GSP A;  1G0T A;  1JB0 J;  1EZV D;  1K28 A;  3CNM A;  1I0X A;  3L70 D;  4R4K A;  4AUW A;  2OAR A;  1RF1 A;  2RSX A;  4HM1 B;  3NXJ A;  1TJD A;  2F99 A;  3BAS A;  1HU9 A;  3L0R A;  1DD3 A;  3M0A A;  4H44 D;  1FDI A;  4DT0 A;  1YJW P;  3K0Z A;  3GRD A;  1NKN A;  3AE9 C;  1HTL C;  1SQP E;  4CCV A;  3ZG0 A;  1FUS A;  2IBZ G;  2GEY A;  1KD1 4;  4BIR A;  4NRE A;  1H89 A;  1K9M Q;  2CK3 H;  4GB5 A;  3RK2 B;  1SQP K;  4R9L A;  1SQX K;  2F56 A;  2ZVN B;  4N3Y B;  1PPJ G;  2C11 A;  1NTM G;  3K7C A;  4WFO A;  4XA4 A;  1SQP D;  1T2H A;  1X1X A;  1RRH A;  2YMY A;  4TLF A;  5CMZ A;  2QG4 A;  3P8M C;  2OYI A;  4N3V A;  2BCC E;  3AEC C;  3DGY A;  3A0B H;  3CPW O;  5KAI H;  1Z56 A;  3WMM 0;  3Q2P A;  2JJL A;  4NPF X;  3CX5 H;  1RGC A;  3PGB A;  5GTH E;  3KPE A;  1H8A A;  1E3V A;  1KB9 H;  4WHA A;  1RQV A;  5CHX A;  1IFD A;  1KTM A;  1HJB A;  1NO4 A;  3DUK A;  4RBN A;  1L4A D;  1LTT C;  1OHO A;  4PJ0 E;  4ORL A;  3Q1C A;  3CX5 D;  3RK3 B;  4J9A A;  2NPS D;  5CCG A;  3CC7 3;  2V7Q H;  5D81 A;  1QVG 2;  1FAV A;  2VRS A;  1IYY A;  2R5B A;  1Q81 4;  1JMM A;  3AEA C;  1PGJ A;  4OGQ D;  2W9Q A;  3OJA B;  4WY4 B;  1IVU A;  2STD A;  1J1E B;  3H3H A;  3H51 A;  2M3B A;  2KF4 A;  3HUS B;  2AXT H;  5AVY B;  3EHC A;  1WMO A;  1NU1 D;  2CX1 A;  1H88 A;  4U7J A;  5E79 H;  2KSE A;  2LQV A;  3TDK A;  2IY2 A;  2FFD B;  2FXO A;  1KC8 Q;  1KIL C;  2A45 I;  1T8Z A;  1M1J B;  1Q7Y 4;  1RGL A;  1XTG B;  3V98 A;  4EDF A;  3HD7 D;  2B1X B;  4IL6 X;  1GSP A;  4YTP C;  1D6Z A;  1HF9 A;  3TDG A;  3IAO A;  3FKA A;  2KSJ A;  3UL6 A;  1WNH A;  2QM8 A;  3N4X A;  4FMD A;  3CCL 3;  4WWI A;  3KCH A;  2BMQ B;  1VZZ A;  3DM8 A;  3C9I A;  3CC4 P;  3H1I D;  3CCR 3;  4O2H A;  3LTD A;  2IUJ A;  1NAF A;  1GY5 A;  3JCU H;  2ZHX B;  3VMX A;  1NJI Q;  2HOD A;  4ASV A;  1N8R 4;  2WOF A;  4EBG A;  3IR9 A;  1L4A A;  2HR3 A;  2FFD A;  1RN7 A;  5AIF A;  4FMB A;  3FG3 A;  2HMN B;  1JCC A;  1NNV A;  3JVC A;  2JKV A;  1OF5 A;  1ZXG A;  3PCS A;  1WT6 A;  4ZNC A;  3CC2 P;  1LTB C;  1SFC C;  4RKU J;  2W9P A;  8RNT A;  3CCE P;  2XDJ A;  3H32 A;  5CXO A;  3GF3 A;  1SIH A;  2ZT9 C;  3DGN A;  3V2N A;  1IVX A;  5BVB A;  4WY4 C;  1KFN A;  3BNE A;  3PRJ A;  3EFF K;  3PYJ A;  1EZV E;  1Q90 D;  1NKZ B;  2XND H;  1JN5 A;  1KV4 A;  1L0N K;  2AXT E;  2KI7 B;  2RMZ A;  3K5B A;  1IFJ A;  1GOV A;  3B7C A;  2AEF A;  3I55 P;  1BNE A;  5AW3 B;  3HII A;  5TJH A;  1AVL A;  5E79 E;  1JY3 O;  2D2C C;  3UIA A;  1MV8 A;  1G96 A;  2OGU A;  1FDO A;  2W6A A;  1CW5 A;  1SQB K;  1NU3 A;  5IG3 A;  3L72 G;  3M0D C;  5AEU B;  1YQ3 C;  3V4Q A;  1IT7 A;  5CBO A;  4H13 D;  1HBW A;  4R4M A;  4OGQ B;  2E75 C;  3M9H A;  1T3B A;  3LML A;  1RGF A;  1MGR A;  3RL0 g;  1YIJ P;  3CL3 D;  1VDF A;  1W02 A;  1RKY A;  1OW8 A;  1X8Y A;  3G8Z A;  2R3S A;  3DGO A;  1EKM A;  2A45 G;  4EW5 A;  1PFP A;  4RJT A;  2W2C A;  2P38 A;  1J1D B;  1I70 A;  1JM0 A;  1BSD A;  1NVO A;  4LMI A;  2N1T A;  1M7L A;  2E74 C;  4PD4 H;  1SII A;  2GU1 A;  2GUV A;  1FOS F;  4Z1M H;  1JB4 A;  1A2V A;  2OTL P;  4HH2 A;  1KIL D;  1SQB E;  1RRL A;  1Q82 4;  2QJK C;  3E1R A;  3Q3F A;  1TTO A;  2BEZ F;  4HZ9 B;  1JB5 A;  3RL0 D;  3B4O A;  4HM2 B;  1LRA A;  5APW A;  3U97 A;  2BAS A;  3D5G A;  3W67 A;  2Z5I A;  3LTC A;  5AYR B;  2CFG A;  1I3F A;  3CCS 3;  1SQQ K;  2FNQ A;  1PPJ D;  4K1U A;  4FR9 A;  2WGO A;  5AW7 B;  4K90 B;  3SWY A;  1YGW A;  3ITK A;  2R4I A;  2FYU J;  3CWB E;  1JBT A;  2CKF B;  5ELJ A;  5AVX B;  2NPS C;  3G9R A;  3M9B A;  3BB9 A;  2FYU G;  3VMA A;  2RN0 A;  4AKY A;  1E5W A;  1MFT A;  2XF3 A;  2LR2 A;  5AVQ B;  1RTU A;  1SVF A;  3A76 A;  1GL2 A;  1RJO A;  1IK7 A;  1NTZ G;  3PJS K;  1L0L G;  1RE4 C;  4PEJ A;  1OAC A;  1X22 A;  3CCJ P;  4HYZ A;  5STD A;  1DMQ A;  2WPR A;  1FZG A;  1L0L J;  2INX A;  1BDC A;  2HML B;  3DXO A;  2P2U A;  4JYC A;  5KJ7 C;  1AFO A;  4N6N B;  2F98 A;  1PL5 A;  4ZMD A;  1JTH A;  2H7H A;  1VQL P;  1BE3 E;  1NTZ D;  4WBA A;  1O7M B;  3HD7 C;  3L37 A;  2IUK A;  3ABV C;  1CYV A;  3AMO A;  4FCJ A;  3EQQ B;  1S5L H;  1W2Z A;  2R41 A;  2KCD A;  1OX3 A;  3Q1M A;  2L5G B;  2KNC A;  4K61 A;  3RGU A;  1UUV B;  1LXE A;  1AQT A;  1YQ4 C;  1TP6 A;  1DEE G;  1JMB A;  1CSB A;  4HM3 B;  3F40 A;  1RQU A;  2QM7 A;  3EFG A;  3L71 J;  3L72 E;  1RNT A;  4WP5 A;  5AW8 B;  3U59 A;  1QX8 A;  1CI6 A;  3S4R A;  1JB2 A;  2GU3 A;  2AEJ A;  2RBI A;  4OUQ A;  1FZC A;  2GBW B;  1BIR A;  4IOI H;  1OH0 A;  2HFE D;  2WSS H;  3HI7 A;  5LC7 A;  2MKV A;  1KQF B;  3WHO A;  1QVF O;  3CCM 3;  2J58 A;  4GOF A;  5RNT A;  5IEN A;  1NTK J;  2P0M A;  2ZYA A;  3V99 A;  3QH9 A;  1VQ7 P;  1S3J A;  1V57 A;  3CC7 P;  4J5K A;  1Y9B A;  2XH9 A;  3ZG5 A;  5G1L A;  1BNF A;  2WSE J;  4EV5 A;  5B66 H;  1OW6 A;  1YHQ 3;  1UDI I;  1SQB J;  3SFD C;  1LQG C;  3H1H G;  1A02 J;  3LIE A;  1X1W A;  4JF8 A;  1TRP A;  2Y0C A;  1OFC X;  2F5M A;  1T2K D;  3ER7 A;  1LNI A;  3L70 J;  3RK3 D;  1A67 A;  5AW6 B;  2WGQ A;  5AVR B;  3M9Q A;  2NPS B;  5D83 A;  1DET A;  2E75 B;  3WUT A;  1RMS A;  3MD0 A;  2CFL A;  4D6T J;  1KWI A;  2ITA A;  5HGR A;  1W6G A;  3D9R A;  1W00 A;  4BXL A;  6STD A;  2A15 A;  2FYU E;  3WA3 A;  1OHS A;  1W2B 2;  4I7Z B;  3GHG C;  1PP9 G;  1PGQ A;  2ZYG A;  3FWN A;  2QVA A;  2OOV A;  1IQY A;  3WU2 E;  3S29 A;  1JRQ A;  4R1K A;  4FMA A;  2GA1 A;  3LW5 J;  3VGN A;  1RGH A;  1E79 H;  2FYN C;  3S1K A;  2YFJ B;  1R4Y A;  1VF5 C;  2V4H A;  5C39 A;  3X42 A;  2RGQ A;  3Q5S A;  2XGN A;  1T6A A;  3FGA D;  4EV2 A;  2RH0 A;  2P67 A;  2W6B A;  2CWU A;  4J5G A;  3OW2 O;  1BE3 G;  2YFL B;  2P58 A;  2YIU B;  1RHL A;  3FG4 A;  1VQ9 P;  1L0N G;  4W7Z A;  2L4V A;  3GLM A;  4FCZ A;  3RL0 C;  3AGO A;  1SQQ J;  1LNQ A;  3L75 J;  4C7N B;  3D4A A;  4UB6 E;  1BCC D;  2Q5U A;  5APV A;  3EF8 A;  2KLU A;  4GHO A;  2E76 C;  2JWA A;  3L74 G;  1AY7 A;  1EEJ A;  2JWD A;  2P0X A;  3TSI A;  3V92 A;  1S72 P;  1SQV E;  1ISK A;  2CFW A;  3A2A A;  1G2C A;  3G4S 3;  1PP9 J;  1GY6 A;  1LOX A;  2JDI H;  3A0H H;  1JO5 A;  1ZW0 A;  3KYQ A;  1PYL A;  1P84 I;  2POH A;  1B2S A;  4RZM A;  3GZR A;  1SJW A;  2M8R A;  4KHX A;  1NHL A;  5BVZ A;  4L8O A;  5JBS A;  1W6C A;  2C10 A;  3U1W A;  4JQ0 D;  1YTZ T;  1K73 Q;  2FXT A;  1QVG O;  3NMD A;  1LT9 A;  3B8L A;  2GSP A;  3MHE A;  2QJY B;  2W6J H;  2MC8 A;  2IFM A;  3KXD A;  3MSO A;  4R4L A;  1V58 A;  1SPU A;  4FMC A;  4HVN A;  1LTG C;  1R5S A;  2UX0 A;  1JY3 N;  1Q86 4;  2Y0E A;  2IYJ A;  3PS8 A;  1OZH A;  3UL5 A;  1OUN A;  1DVC A;  1LTJ C;  4H61 A;  2ML5 A;  2Q07 A;  2XGL A;  4WYK B;  2WOH A;  5EVH A;  2XSO B;  1F8N A;  1SQV K;  4IPB A;  2D1W A;  1M57 D;  5BXQ A;  4N6U A;  1FZU A;  5FGO A;  3AE1 C;  4H13 B;  5BU8 B;  1NTZ J;  2IZ0 A;  1GD4 A;  3II6 A;  4CPK A;  3Q3D A;  2KK7 A;  5KKZ C;  3A5T A;  3OAK A;  1VQ5 P;  1K8A 4;  3RK3 C;  1FGM A;  2KLV A;  1K05 A;  1RE3 A;  1BCC G;  3L35 A;  1BRI A;  4RNY A;  3JSV C;  1JCD A;  1DYU A;  3Q2Y A;  2PZV A;  3U1C A;  2BCC D;  4U3F E;  3H32 B;  1IDP A;  3EX9 A;  4K35 A;  4N6M A;  4K1V A;  1SQB G;  3S28 A;  1M8O B;  2Y74 A;  1AVO A;  3CCR P;  3JUO A;  2JR8 A;  2XKM A;  3U1A A;  1OGZ A;  3G0K A;  1RSN A;  3GMA A;  1UCI A;  1NTM D;  2J5U A;  3AGN A;  1QJG A;  1KIL B;  3J7Y d;  1OHP A;  1MUU A;  2HPC B;  1US1 A;  1BNR A;  2OTL 3;  3RL0 B;  1PU4 A;  5AIH A;  1IU7 A;  1YJN P;  1KQG B;  1TUH A;  1V74 A;  1OVR A;  1BGY D;  3GG2 A;  1LTS C;  1C54 A;  1ZR4 A;  1YVS A;  1K73 4;  3NXS A;  3CCQ 3;  2YO3 A;  2XU6 A;  3H1L D;  3M0D A;  4I2L C;  5JPP A;  5I97 A;  4LEH A;  1U7M A;  4LGD E;  2QIY A;  4W80 A;  1DIP A;  2K37 A;  1JY3 P;  3NQY A;  1L0L E;  3AE2 C;  2IBZ I;  2QRX A;  3PHL A;  4D6T D;  2PAJ A;  3V5B A;  1NU1 K;  2H8P D;  1T3J A;  4L75 A;  1BSN A;  1GW4 A;  1WMK A;  3RBZ A;  3A7O A;  1K41 A;  1NAY A;  3HOH A;  1U7J A;  1N7S A;  5KLV D;  3MG3 A;  1BVI A;  4O3V A;  3CPW 2;  1Q9E A;  4TX4 A;  2HPC A;  1ZME C;  2QJK B;  1SQX J;  1BU4 A;  4RES B;  3CXH E;  1Y4K A;  4BL3 A;  1PP9 E;  1FGQ A;  3AMO B;  4OWF A;  1EQ7 A;  4OGQ C;  1UCK A;  3CC4 3;  4YXW H;  1HGZ A;  3PP5 A;  3URP A;  3F89 A;  3G71 3;  1ZOY C;  4EYY Q;  1QAF A;  1BGY E;  1K8A Q;  7STD A;  3G4S P;  2Z5H A;  3KDP B;  1IFP A;  3DMC A;  1M1J C;  2ZT9 D;  4JYB A;  3P8C E;  3SED A;  1B21 A;  3MG1 A;  3DY5 A;  4L76 A;  4BL2 A;  1RF1 B;  1CQS A;  5AEW B;  5M19 A;  1CH0 A;  2DW3 A;  1EA2 A;  3MZW B;  4HM6 B;  5AVT B;  2WSF H;  3WA2 X;  2ZVO B;  3MG2 A;  1FUT A;  3LID A;  2BNG A;  2ZDJ A;  3KII A;  2XRX B;  1BGY J;  1FGR A;  1JY2 N;  4EI2 A;  1PIX A;  3KSP A;  1FYS A;  3CXH I;  1JNQ A;  1IV7 A;  5DJT B;  5IG0 A;  5KLV K;  2O3J A;  2PRR A;  1I2E A;  1B2Z A;  1IQ8 A;  3WUU A;  3ZDM A;  4JF7 A;  1GW3 A;  2GUS A;  1P84 D;  3HD7 B;  3F7S A;  1J2B A;  2KNC B;  1N9J A;  3O8Z A;  3LW5 H;  3X3Z A;  1SQX E;  5B5E H;  1RGA A;  3MIW A;  1RDS A;  3G16 A;  2K9Y A;  3OWY A;  5TIS H;  5EEO A;  3L71 E;  3L72 J;  2KP8 A;  1QAK A;  1QL2 A;  1FGT A;  2K3D A;  1YJW 3;  3NTN A;  3NM2 A;  1PFI A;  5CCH A;  3HD7 A;  2ML6 A;  1CZQ A;  1FBM A;  4JPZ B;  3W68 A;  4CJN A;  2OCT A;  4RNZ A;  2FXM A;  5BU5 A;  3F9S A;  1NH4 A;  3VYI A;  5GTI E;  1KC8 4;  3IMA B;  3K9M C;  4HB1 A;  3L75 E;  2O1J A;  4XFJ A;  1SQQ E;  2BCC G;  1FZC B;  2ZJS E;  1LOY A;  1I2G A;  2WSF J;  3N7N A;  5AVW B;  4N6O B;  2OYH B;  2AAE A;  1M9G A;  4GKG A;  3OWS A;  3B4S A;  1OVV A;  3NBJ A;  1H0T B;  3H1K D;  3CCM P;  1IK3 A;  3WU2 H;  2K9J A;  3BRV B;  3I56 P;  1PGO A;  1TU3 F;  1WRG A;  1OGX A;  1ULI B;  1FC2 C;  3B71 A;  4ZKP A;  2BEQ D;  2HMK B;  3IPT A;  4U3F G;  2Z7A A;  1USE A;  4STD A;  1VQ9 3;  4HYT B;  4U3F J;  1T2K C;  1GD2 E;  3CCU 3;  4PD4 D;  1KYO I;  3NUV A;  3M8C A;  1ZN5 A;  3H1J E;  2Y0D A;  1RCK A;  1FE6 A;  2F5W A;  2Q3I A;  3KZI H;  3EB8 A;  3SWF A;  4XM4 A;  3PXM A;  1VF5 B;  1FA3 A;  5AVU B;  2WTY A;  1H0T A;  3DGL A;  3Q90 A;  4PV1 D;  1NTM E;  5AW5 B;  2WMM A;  1NTM J;  3ECF A;  1DMN A;  3QWO C;  3MYT A;  1EG9 B;  3MP7 B;  3VP9 A;  3D79 A;  3GZY B;  4LYL B;  3C1L A;  5DJU B;  4JBZ A;  1I8V A;  3B5N D;  7RNT A;  1KB9 D;  1MKM A;  2R32 A;  3QRD A;  4C7N A;  3PTZ A;  2MF7 A;  1QLE D;  2YFI B;  1BUQ A;  1KSI A;  1O7W B;  2CX0 A;  5HOH A;  4DCK A;  2OOV C;  3IF4 A;  1U57 A;  2AXC A;  1HWT C;  2O9U X;  1IK9 A;  4KFF A;  1URQ D;  3MHV A;  1G2C B;  5KAF E;  1IC2 A;  2ZXX A;  2G8Y A;  3CCV P;  5AII A;  5M1A A;  4Y28 J;  3L4F A;  2SAR A;  1B20 A;  2E5Y A;  1R4C A;  2B9B A;  2QJP C;  2AEM A;  4IFF A;  4KFE A;  3HZP A;  3OX9 A;  4IL6 E;  1YIJ 3;  2KF3 A;  1I0V A;  1O7H B;  1VQL 3;  1HH0 A;  2CHC A;  3DGM A;  1BRH A;  1T2I A;  4LZI A;  2YKQ A;  3FSD A;  3UB1 A;  1EZV G;  2W8Z A;  1HGV A;  2LYX A;  4I4K A;  1NYH A;  4BRY A;  2RCD A;  3KE7 A;  2KB7 P;  1MGW A;  1LWU B;  1PY3 A;  4BWN A;  2HOD B;  1UI7 A;  2OYI C;  5IF6 A;  4LLH A;  1FJK A;  3WDG B;  2BO9 B;  1RF0 C;  2BHM A;  2BT3 A;  3CMA P;  2SPZ A;  1UUW B;  4BTX A;  1QVF 2;  1IFN A;  2WZ7 A;  2UUG C;  9RNT A;  1ZV8 A;  1AQZ A;  5AW9 B;  1FUW A;  3D6Y A;  2OWP A;  3K63 A;  3CPO A;  1LWU A;  1P84 E;  1Y8A A;  1VF5 D;  2QA4 3;  1MNL A;  3RK3 E;  2Z76 A;  4PV1 B;  1FU1 A;  3HX8 A;  5CJ4 A;  3LZA A;  5AIG A;  1CEW I;  1UW1 A;  5KAF H;  3NHX A;  1Q7H A;  1EUI C;  3EQ2 A;  3T8U A;  1N86 A;  3G71 P;  1JV2 B;  4B86 A;  1JUN A;  5CCG C;  2KXP B;  1Q42 A;  2E74 D;  3HRN A;  2CWT A;  3O6Q B;  2OTJ 3;  1BRJ A;  1N7S B;  5TGN A;  3V6I A;  4L8P A;  2GBX B;  1VQ8 3;  4HJL B;  1YJ9 P;  1Q7Y Q;  1RH5 B;  2JEE A;  2HYN A;  4OH8 B;  5B5E E;  3CME P;  1VQ4 P;  1BRK A;  1STF I;  1GDT A;  1RF1 C;  2O1K A;  3RK2 C;  1USD A;  3HK4 A;  3CWB D;  1NTK E;  1OW7 A;  1M90 Q;  1G1J A;  2YXR B;  3CCV 3;  1KIL A;  3LYG A;  1IFM A;  3X40 A;  2ZA4 A;  4OK0 A;  3IJE B;  3S5C A;  1T5Y A;  4D6T E;  4MMY B;  1VQN 3;  3G3Z A;  2B87 A;  5AW2 B;  2PNC A;  4OVM A;  1MZ9 A;  1KQS O;  4MJD A;  2Q1K A;  3IN6 A;  4ZM8 A;  2CC3 A;  3TK1 A;  1N8R Q;  4AQR D;  1EDJ A;  4HBR A;  2A06 G;  3H1I E;  2XFT A;  1X1Y A;  2E75 D;  3CC2 3;  3P7K A;  2P7J A;  4LC1 A;  1W5Z A;  3RGR A;  3T0U A;  2C4B A;  4L73 A;  2H0H A;  6RNT A;  1J1D C;  3AE5 C;  1BOX A;  1CI6 B;  1A2P A;  2XNX A;  2LXB A;  3I55 3;  2E76 D;  2K3R A;  3BU4 A;  3FG1 A;  4XBT A;  1GL2 D;  1E97 A;  4HM5 B;  8CHO A;  1ROV A;  1OWA A;  2NZ2 A;  1BSE A;  5KTB A;  4HAA A;  3L70 G;  1DVD A;  4WWU C;  2WPQ A;  4JRF A;  2B87 B;  3D70 A;  1RHZ B;  3D71 A;  3M91 A;  2P05 A;  1AQ5 A;  2BMR B;  4XE5 B;  1MOL A;  1OIP A;  5APQ A;  1VQ5 3;  2YKO A;  3L73 G;  1MWT A;  1MWS A;  1PGP A;  3DH2 A;  1PZQ A;  1GS3 A;  5CJ0 A;  1BNG A;  5KLI B;  1JY2 P;  1YYC A;  3SVA A;  1GMJ A;  2V1L A;  1EDL A;  2KF6 A;  5IW9 A;  2KIK A;  3CWB J;  1XTC C;  3CX5 I;  1RN4 A;  5JPU A;  2M5A A;  3X41 A;  1KQS 2;  3H1L J;  5GTI H;  2HMO B;  1UGH I;  5D82 A;  4IFM A;  4ASW A;  3L74 E;  3FXD A;  1W6Y A;  2RKL A;  4AEQ A;  5CCG D;  1SQP G;  1BSH A;  5A0O B;  1BE3 D;  1NTZ E;  1BNS A;  3SX1 A;  3X3Y A;  3CCL P;  4QWT A;  2AAD A;  3AEE C;  4TT3 H;  1NTZ K;  5AYS C;  1ZRT D;  5AVS B;  1TRQ A;  3I0Y A;  2FBW C;  1FJP A;  3HIG A;  5KP1 A;  3F5H A;  4MN4 C;  4HJG H;  1VQM 3;  1LNH A;  2C9N Y;  3S27 A;  2QJP B;  3CCS P;  2E2T A;  1AA0 A;  2QEX 3;  1RGE A;  1W7C A;  1N73 C;  3L75 D;  2KF5 A;  2M7O A;  3I56 3;  1SQQ D;  1EDK A;  1EDI A;  1D6U A;  2FYN B;  1R8E A;  1DH3 A;  1SFC B;  4HKV B;  3AE3 C;  3FWL A;  3ZFZ A;  2F4Y A;  2R44 A;  1ZO2 A;  1DMM A;  1LT1 A;  5GTH H;  1S5A A;  3GZB A;  1UCJ A;  3R2P A;  3TGU E;  2PGD A;  1L4A C;  3K5T A;  3L36 A;  3CCU P;  3MUD A;  3O8Y A;  3L74 J;  2WQY C;  4XDW A;  1NTK D;  1KN7 A;  3WMD A;  3TNU B;  1U5O A;  4IL6 H;  4KJM A;  2CH9 A;  1J1E C;  1MWR A;  3MWZ A;  4UB8 E;  1AVK A;  2L91 A;  1NJI 4;  4LSO A;  1SFC A;  1B2M A;  4UB6 H;  1RN1 A;  1OMI A;  1X9V A;  3CMA 3;  4IT7 A;  3ALA A;  2UWJ E;  3CCJ 3;  2R3C A;  5KLI C;  2E76 B;  1N73 B;  2OYH A;  2HLO A;  1RGG A;  4EOT A;  1SQV J;  1EZV I;  3B8E B;  1L2P A;  2NPS A;  2W0Q A;  3EJV A;  3F14 A;  5APT A;  2YMK A;  1E3R A;  2L1S A;  3TNU A;  3JUP A;  4R9K A;  5G2G A;  1MFZ A;  1YGE A;  2QSI A;  3CXH D;  3A0H E;  1GL2 C;  3B5N B;  1G1I A;  4U13 A;  1HYF A;  2C0W A;  2CWV A;  1RE4 A;  1ULJ B;  5EQL A;  1UCL A;  3OA7 A;  3TGU D;  3PH0 A;  3BRT B;  3VP8 A;  5KJ7 A;  4NPD A;  3MTU E;  2R5D A;  3FZW A;  1NB5 I;  5APY A;  1K9M 4;  3BCC J;  3H1K G;  2FYZ A;  5KLV E;  3KSE D;  4R80 A;  3NFQ A;  5TIS E;  3AE6 C;  4GIF A;  3KN4 A;  4KFD A;  5IG4 A;  4HM8 B;  3JCU E;  4XB5 A;  1GYB A;  4MEI A;  4I7Z C;  1BRN L;  3ROB A;  5ELU A;  2C9L Y;  4M3L A;  1QAL A;  1GMQ A;  3OV4 A;  3B5N A;  2A06 E;  1IVV A;  2N1T C;  1W4N A;  2YO2 A;  1HVV A;  3AEF C;  3S9O A;  1N5P A;  2WSE H;  2UGI A;  1B2X A;  4GT1 A;  3HTK B;  2WO0 A;  4NPE A;  5AW1 B;  3SWK A;  1O7N B;  3V4W A;  3JC2 2;  2QA4 P;  2FXP A;  2A06 D;  3CD6 P;  2D42 A;  2SBL A;  1VQP P;  4CPG A;  3WOD G;  4ZKU A;  1OVU A;  1Y47 A;  1STD A;  2BMO B;  1BE3 J;  5M1B A;  2B88 A;  3FLJ A;  3KQG A;  2ZT9 B;  3HTK A;  3L72 D;  4O9B A;  4WVZ A;  5IEP A;  5APS A;  2E2V A;  3FF0 A;  4XBY A;  3JUM A;  4H0L C;  1QEX A;  1IJD B;  1SQP J;  5KP4 A;  1VQ7 3;  4U3F D;  1BGY G;  1IV9 A;  3F7X A;  1VQ4 3;  3E99 A;  2Z4E A;  3L73 E;  3VMZ A;  1L0L K;  1X79 B;  1OF5 B;  1KYO H;  2WT7 A;  1WMP A;  3JUQ A;  3PZW A;  1LT9 B;  4BRY B;  4K3A A;  3O6Q A;  4H0L D;  1TIJ A;  3GHG B;  3HUS A;  3AHS A;  3H25 A;  3L70 E;  2PFX A;  2I9W A;  5CF2 A;  4Q53 A;  1DX7 A;  3MKI A;  1VQN P;  2IPP A;  1ZRT E;  1URQ C;  1ASK A;  1N7S D;  1EXI A;  1A90 A;  2F86 B;  2FKW B;  1JN5 B;  2WPS A;  2O01 J;  2WT7 B;  2Q3E A;  4YPC A;  5GSP A;  3G6E 3;  2GM4 A;  3M06 A;  4DOJ A;  2E2U A;  4I1L A;  2YKP A;  3GHG A;  2J8X B;  1UGI A;  3KFQ C;  5L8R J;  3BVH A;  2IA7 A;  1KQL A;  4PD4 E;  2B24 B;  1EQK A;  2N9Y B;  1ZR2 A;  5BU4 A;  1QL1 A;  1ZX2 A;  1BRS A;  3SXX A;  3H1I G;  3GW6 A;  1NDO B;  5AW4 B;  2JP3 A;  1S2E A;  2I8D A;  1RF0 A;  1L4A B;  1M1K Q;  3R4Y A;  3H1K E;  2CG0 A;  2CFD A;  3EE1 A;  1A02 F;  1BCC E;  5K5G B;  1MWU A;  4MMX B;  2YNY A;  4XBX A;  3H1L G;  1FZF A;  4GOD A;  2K0M A;  2W56 A;  3NBB A;  4J8T A;  1LGH B;  3D5I A;  5M18 A;  2V7Q J;  1AJY A;  1FOS E;  3WOF B;  3HE4 A;  2OQE A;  1S5L E;  3A3Y B;  3L75 G;  3AEB C;  1GU5 A;  4UB8 H;  4BTY A;  4KZ1 A;  4WB4 A;  1KFM A;  1NTM K;  3AE8 C;  1GOU A;  3FX0 A;  2P1J A;  1HUC A;  3GWR A;  3C8V A;  1BAN A;  1FZE A;  1LQM B;  4H44 C;  2ZFC A;  3H1J D;  2BCC J;  4DJG A;  3LTA A;  1VQK P;  2QGU A;  1GD3 A;  2Q6Q A;  1I2F A;  1PP9 D;  5KJ7 D;  2LXC B;  1Q86 Q;  4ILF A;  3SSU A;  2IYP A;  1LT9 C;  1RY3 A;  1UIX A;  3JUN A;  3T8N A;  1KZU B;  1SQX G;  1SQV D;  3TF5 A;  2GEX A;  3KKG A;  1SQW A;  2Z6B A;  2C0X A;  1NU1 E;  3VN0 A;  2OTJ P;  2JO1 A;  3LH4 A;  2WWW A;  3BNC A;  1BSA A;  2I1J A;  1VQQ A;  4CDL A;  3HE4 B;  2OQQ A;  1IQX A;  3H6P A;  1HJ0 A;  4IFD K;  4GDO A;  3OW2 2;  1M1K 4;  1KD1 Q;  1SQX D;  4OVN F;  4GOE A;  3KZI E;  5KLV G;  2KS1 B;  1N2D C;  1M90 4;  1DD4 A;  2QJY C;  2KRT A;  1DE3 A;  3H1J J;  2O01 N;  7GSP A;  3H1H J;  3VMY A;  1KYO D;  1BNJ A;  3BCC D;  1L0N J;  3N9H A;  3SYU A;  1WQL B;  5FW5 A;  6GSP A;  2QIW A;  2W90 A;  3L71 G;  1RE3 C;  1YVB I;  2KZI A;  1UI8 A;  3EWK A;  1BSC A;  3HE5 B;  3T97 B;  3F8H A;  3B4P A;  3BCC E;  3FH1 A;  3RDE A;  1N7L A;  1UII A;  3E1I A;  2QE7 H;  3SLU A;  5AW0 B;  2FGT A;  3I5C A;  1JKG A;  3D3L A;  4L7K A;  1VQ6 3;  1IT8 A;  3D6Z A;  1GK4 A;  1YHQ P;  1HKX A;  1NO3 A;  2IYO A;  1SFC D;  1DEB A;  3CCQ P;  3CME 3;  2Z77 A;  2P10 A;  1NB3 I;  4O02 B;  3EBY A;  4EYC A;  2E42 A;  1LP1 A;  1Q82 Q;  3SOY A;  2O01 H;  2YXQ B;  3S67 A;  1KMI Z;  3VF1 A;  4AYC A;  3OXA A;  2W03 A;  3KHU A;  4RNT A;  2K1A A;  1TFO A;  1JKG B;  5H2F E;  1KYO E;  1NOH A;  1RCL A;  1FW7 A;  1LTI C;  4G1M B;  3L74 D;  4EC6 A;  1ZS7 A;  3HE5 A;  1NGM B;  1LOV A;  3GSP A;  2Y9Z A;  3WUV A;  1AR0 A;  1LOW A;  4BU4 A;  3VTP C;  2CPB A;  2OYI B;  1KB9 I;  2ZAE B;  1IO4 A;  1S5L X;  4FCM A;  3SOA A;  2W27 A;  2KYV A;  2WPV B;  3CD6 3;  2KZJ A;  4NPB A;  1N7S C;  4N6V 0;  1GOY A;  3AEG C;  3H1J G;  1BDD A;  1LTJ A;  3BND A;  4DZO A;  1LP1 B;  3AE7 C;  1JZO A;  2HMJ B;  2B89 A;  2ZL8 A;  1FDM A;  4HM7 B;  3LTB A;  4PV1 C;  1N73 A;  3TYY A;  4X2H A;  1C7H A;  4BTW A;  3GZX B;  1BRG A;  1X1U A;  2K9J B;  5CBN A;  2FY8 A;  3UNL A;  1B27 A;  3RNT A;  2RNT A;  4N6J A;  1T3U A;  2OYO A;  3BIR A;  5CLK A;  1AVY A;  5IER A;  3RK2 D;  2JQ5 A;  3BLZ A;  3MUD C;  2E74 B;  1UUG B;  4PD4 I;  1TU5 A;  3BNB A;  1SQV G;  4X2O A;  4NHF A;  4HM0 B;  1D6Y A;  3FCS B;  2D2C D;  1JBR A;  2WIT A;  3GF7 A;  1G02 A;  2RFR A;  1IVW A;  3H1L E;  3GAX A;  3AE4 C;  1LTJ B;  2CIU A;  1PPJ E;  1BGS A;  4QMA A;  2OYH C;  1O7P B;  1X0T A;  4C46 A;  1M56 D;  3CU3 A;  3X3X A;  3LXU X;  3NBR A;  5EFW B;  4GL6 A;  1VQ6 P;  2KXG A;  1W01 A;  3CLQ A;  1GMR A;  1BNI A;  2IMJ A;  2CPS A;  1GK6 A;  1JY2 O;  2H88 C;  3E7K A;  5AVZ B;  1AV1 A;  3VOP A;  1KIL E;  1SQB D;  1W2E A;  3EC9 A;  3QK9 A;  3EBT A;  2FYU D;  1Q40 A;  2M3E A;  4O8S A;  1LJ2 A;  1I3I A;  1IZN B;  4Y99 B;  5KLV J;  2ZYD A;  1NU1 J;  1WMN A;  2FYU K;  3L71 D;  2CG1 A;  1BSB A;  3F8X A;  1FZB A;  2FFD C;  2N1T D;  3FGY A;  4LGQ A;  4EXR A;  2P09 A;  4A7P A;  3CI9 A;  3KZT A;  1JEK A;  3Q5P A;  2PP6 A;  1N8Q A;  4EIJ A;  5CCH C;  3MGN A;  2HG5 D;  1NTK K;  2IFN A;  2XEP A;  5KP3 A;  3P8C D;  2HOH A;  1GU4 A;  2YIU C;  1CYU A;  4HM4 B;  4H0L B;  1FZA A;  3N8B A;  2H43 A;  2E43 A;  5CCH D;  5APU A;  3MPH A;  3CXC 2;  1SLQ A;  4WY4 A;  2K54 A;  1VPC A;  4WYK A;  5APX A;  1NWW A;  4N6T A;  5DRV A;  3B5N C;  2QEX P;  3NX0 A;  1VQ8 P;  1Q40 B;  1HZ1 A;  3UJM A;  1S9K D;  2XFS A;  2I1K A;  1M1J A;  2MJZ A;  3LT8 A;  1W5C E;  3EN1 B;  1O7G B;  3H1K J;  3NV0 B;  3WR2 A;  2KUB A;  1VL2 A;  3H1H E;  1OPY A;  1U8C B;  2XSH B;  2E5T A;  3G6E P;  3BAT A;  4I6M C;  3WOE B;  1URQ B;  1EC5 A;  3LOY A;  1JBS A;  5G1K A;  1NTK G;  5BIR A;  1YI2 P;  1PV3 A;  2A45 H;  2IX7 C;  1JZD A;  5DRE A;  4AKZ A;  3USS A;  2W56 B;  5IEO A;  2CW9 A;  1FGO A;  3SFE C;  3NV0 A;  3RBX A;  3VSY A;  2XZR A;  1N5H A;  1LVN A;  4I5Q A;  3AHW A;  3CCE 3;  2CFK A;  1FS0 E;  1BUJ A;  2D2C B;  1OCV A;  1VQO P;  2WSC J;  1Q2N A;  5KAI E;  3CNX A;  3A5E A;  1M1X B;  1A2K A;  3LT9 A;  1J2J B;  3BCC G;  1TFK A;  1WTH A;  3HUS C;  2H0G A;  2H0I A;  4H13 C;  1JNM A;  1QMA A;  1URQ A;  3CX5 E;  4HZB B;  1SAR A;  2KOG A;  4D6T G;  1NWQ A;  1L0N E;  2IBZ D;  4IIA A;  3PLN A;  2HMM B;  3V2R A;  1N9E A;  4KT0 J;  3AED C;  4PJ0 H;  1NU1 G;  3CXH H;  3L73 J;  4W7Y A;  1YNV X;  1L5G B;  3TGU J;  1GMP A;  1Z1S A;  1VQK 3;  2N1T B;  2OTK E;  1ZLL A;  1L0N D;  1ROA A;  1ZP0 C;  4L74 A;  1SP4 A;  2IBZ E;  2M0B A;  5CF1 A;  5LC6 A;  2KAA A;  2KS1 A;  2W83 C;  4H44 B;  1B2U A;  3P32 A;  3IFM A;  2J59 M;  1QGK B;  1RGK A;  3NM7 A;  4KVH A;  1R5L A;  1L0L D;  1ZGX A;  4XDV A;  1EXJ A;  3Q5R A;  2Y9Y A;  2XR8 B;  1B3S A;  1IFI A;  1GZL A;  3DZL A;  2IZ1 A;  4N78 E;  3NQZ A;  4KT3 B;  1YI2 3;  2IDB A;  2H89 C;  1VQP 3;  1S72 3;  1D7M A;  5B66 E;  1P84 H;  3EN8 A;  4C7R A;  2OQE C;  1YIT 3;  2K88 A;  4MMZ B;  1YBK A;  1YIT P;  5IG5 A;  3RGA A;  2YX9 A;  1JTH B;  4DKI A;  2Q9I A;  4N6L A;  3FF2 A;  2WSC H;  1S1C X;  1VQM P;  2Q7C A;  1KB9 E;  4H3U A;  1YJN 3;  2XV5 A;  2W04 A;  5AI1 A;  1KOR A;  4HKZ H;  1BCC J;  5CK6 A;  1SS1 A;  2N9B A;  1S4X A;  1S9K E;  1BAO A;  1LTA C;  1FZC C;  1JOC A;  5KKZ B;  3STD A;  4Y99 C;  1GY7 A;  3V2P A;  1AV4 A;  3FXE A;  1K04 A;  3N54 B;  4N78 D;  1LWU C;  1VQO 3;  1RNB A;  2G3A A;  1GTW A;  1YJ9 3;  3A0B E;  2Y73 A;  2ZXE B;  1JJ2 2;  1YTZ I;  1RLS A;  3T97 A;  2BIR A;  3V2Q A;  3CWB G;  3OWU A;  5AVV B;  2M5A B;  4WY4 D;  1SQQ G; 
#chains in the Genus database with same CATH homology
 4BTY A;  4KZ1 A;  2OOV A;  1IQY A;  3S29 A;  2LYX A;  4I4K A;  1JRQ A;  4R1K A;  4FMA A;  3VGN A;  2O3O A;  1E79 H;  2RCD A;  3KE7 A;  2YFJ B;  3GWR A;  2GXF A;  1UI7 A;  2RGQ A;  3PCR A;  4DJG A;  3X42 A;  2XGN A;  5IF6 A;  3LTA A;  3WDG B;  4EV2 A;  2QGU A;  1GD3 A;  2BO9 B;  3CNM A;  1K28 A;  2BHM A;  2BT3 A;  2CWU A;  2YFL B;  4R4K A;  3FG4 A;  1UUW B;  3JUN A;  3T8N A;  4BTX A;  1QVF 2;  2GEX A;  3KKG A;  1SQW A;  2L4V A;  2RSX A;  4FCZ A;  4HM1 B;  3NXJ A;  2F99 A;  2Z6B A;  1FUW A;  2OWP A;  3K63 A;  3CPO A;  1HU9 A;  3L0R A;  3BNC A;  3EF8 A;  3LH4 A;  4CDL A;  3K0Z A;  1MNL A;  2QA4 3;  3GRD A;  1IQX A;  2P0X A;  2Z76 A;  3HX8 A;  3V92 A;  3LZA A;  4CCV A;  3OW2 2;  5AIG A;  1M1K 4;  1ISK A;  2CFW A;  1CEW I;  1UW1 A;  2GEY A;  1KD1 4;  3G4S 3;  3NHX A;  4NRE A;  1M90 4;  3T8U A;  2CK3 H;  1GY6 A;  1LOX A;  4GB5 A;  1JV2 B;  2KRT A;  4R9L A;  2JDI H;  1Q42 A;  2OTJ 3;  2CWT A;  5TGN A;  2C11 A;  4WFO A;  3K7C A;  3N9H A;  2GBX B;  4L8P A;  4RZM A;  1VQ8 3;  1RRH A;  3GZR A;  4TLF A;  1SJW A;  1WQL B;  4HJL B;  5FW5 A;  4N3V A;  4L8O A;  5JBS A;  1W6C A;  2C10 A;  1YVB I;  1UI8 A;  3U1W A;  2FXT A;  1STF I;  3B8L A;  3F8H A;  3B4P A;  3Q2P A;  3FH1 A;  3MHE A;  3RDE A;  2W6J H;  2MC8 A;  3HK4 A;  3SLU A;  2QE7 H;  3PGB A;  3MSO A;  3CCV 3;  3LYG A;  3X40 A;  2FGT A;  1SPU A;  1E3V A;  1JKG A;  3D3L A;  4FMC A;  4HVN A;  4OK0 A;  4L7K A;  4WHA A;  1IT8 A;  1VQ6 3;  3IJE B;  3S5C A;  1T5Y A;  2UX0 A;  4MMY B;  1VQN 3;  1HKX A;  1NO3 A;  1Q86 4;  3CME 3;  3PS8 A;  3UL5 A;  1OUN A;  2Z77 A;  2PNC A;  1DVC A;  4OVM A;  3DUK A;  4RBN A;  4H61 A;  1NB3 I;  2ML5 A;  2Q07 A;  4MJD A;  2XGL A;  4WYK B;  4O02 B;  3EBY A;  2WOH A;  1OHO A;  4ORL A;  4ZM8 A;  5EVH A;  2CC3 A;  1F8N A;  2XSO B;  3Q1C A;  4EYC A;  4HBR A;  4J9A A;  4IPB A;  2D1W A;  2XFT A;  3SOY A;  5BXQ A;  3CC7 3;  3S67 A;  2V7Q H;  5D81 A;  4N6U A;  5FGO A;  3OXA A;  2W03 A;  3VF1 A;  3CC2 3;  1QVG 2;  1Q81 4;  1TFO A;  1JKG B;  2W9Q A;  1GD4 A;  1W5Z A;  3RGR A;  3T0U A;  4G1M B;  1IVU A;  2STD A;  3H3H A;  1K8A 4;  3H51 A;  4EC6 A;  1FGM A;  4RNY A;  3I55 3;  3FG1 A;  1DYU A;  3EHC A;  2PZV A;  1WMO A;  1AR0 A;  4XBT A;  1E97 A;  4HM5 B;  8CHO A;  1IDP A;  1ROV A;  3EX9 A;  2LQV A;  4N6M A;  4K1V A;  3S28 A;  4FCM A;  3SOA A;  1DVD A;  1Q7Y 4;  2Y74 A;  4WWU C;  3JUO A;  3V98 A;  4JRF A;  3CD6 3;  2B1X B;  1OGZ A;  4N6V 0;  3G0K A;  1D6Z A;  2P05 A;  2BMR B;  3TDG A;  1MOL A;  3BND A;  3FKA A;  3UL6 A;  1VQ5 3;  1QJG A;  1WNH A;  4FMD A;  3CCL 3;  3J7Y d;  1OHP A;  2HMJ B;  1US1 A;  2BMQ B;  1VZZ A;  3DM8 A;  2ZL8 A;  2OTL 3;  1GS3 A;  1PU4 A;  4HM7 B;  3LTB A;  5AIH A;  3CCR 3;  1IU7 A;  4X2H A;  1TUH A;  1V74 A;  4O2H A;  3SVA A;  1C7H A;  2V1L A;  3LTD A;  3GZX B;  2IUJ A;  4BTW A;  5IW9 A;  1GY5 A;  3UNL A;  5JPU A;  1N8R 4;  3X41 A;  2WOF A;  5CLK A;  1K73 4;  4EBG A;  3CCQ 3;  1KQS 2;  2HMO B;  5D82 A;  5IER A;  2JQ5 A;  5JPP A;  5I97 A;  1RN7 A;  4LEH A;  3BLZ A;  5AIF A;  4FMB A;  3FG3 A;  2HMN B;  2QIY A;  3JVC A;  1W6Y A;  1TU5 A;  3BNB A;  4AEQ A;  1BSH A;  5A0O B;  1OF5 A;  3NQY A;  4X2O A;  3SX1 A;  3X3Y A;  3PCS A;  4NHF A;  4HM0 B;  4QWT A;  1D6Y A;  3FCS B;  5AYS C;  1BSN A;  2W9P A;  2RFR A;  1IVW A;  1K41 A;  3GAX A;  3I0Y A;  3MG3 A;  2CIU A;  4O3V A;  3CPW 2;  5CXO A;  4TX4 A;  1SIH A;  4QMA A;  3DGN A;  1IVX A;  3HIG A;  5BVB A;  1O7P B;  5KP1 A;  3CU3 A;  3X3X A;  3LXU X;  3NBR A;  1Y4K A;  3BNE A;  3PYJ A;  3EFF K;  1VQM 3;  1LNH A;  4GL6 A;  3AMO B;  1FGQ A;  2XND H;  1JN5 A;  2KXG A;  3S27 A;  1W01 A;  2IMJ A;  2E2T A;  3CC4 3;  2QEX 3;  4YXW H;  1W7C A;  2M7O A;  3B7C A;  3I56 3;  3HII A;  1AVL A;  1D6U A;  3EC9 A;  3G71 3;  1QAF A;  3QK9 A;  3EBT A;  4HKV B;  1Q40 A;  1G96 A;  4O8S A;  7STD A;  1ZO2 A;  1DMM A;  1IFP A;  1NU3 A;  1S5A A;  3DMC A;  3GZB A;  1WMN A;  5IG3 A;  3SED A;  2CG1 A;  3MG1 A;  3K5T A;  3DY5 A;  3F8X A;  5AEW B;  1CQS A;  5AEU B;  3WA3 A;  3FGY A;  3O8Y A;  4LGQ A;  1IT7 A;  1EA2 A;  4XDW A;  4EXR A;  2P09 A;  3WMD A;  3KZT A;  1U5O A;  1JEK A;  4HM6 B;  2CH9 A;  3WA2 X;  1N8Q A;  3MWZ A;  1AVK A;  3LML A;  1NJI 4;  4LSO A;  3MG2 A;  2XEP A;  5KP3 A;  1W02 A;  3CMA 3;  2BNG A;  4IT7 A;  1RKY A;  3ALA A;  3CCJ 3;  2ZDJ A;  3G8Z A;  3KII A;  1CYU A;  4HM4 B;  3DGO A;  2XRX B;  1EKM A;  3N8B A;  1PFP A;  1FGR A;  2W2C A;  3KSP A;  2W0Q A;  3MPH A;  3CXC 2;  1JNQ A;  2P38 A;  3EJV A;  1IV7 A;  3F14 A;  5IG0 A;  2K54 A;  1E3R A;  4WYK A;  1IQ8 A;  3JUP A;  4R9K A;  5G2G A;  1NWW A;  4N6T A;  5DRV A;  3NX0 A;  1Q40 B;  1YGE A;  4LMI A;  3F7S A;  1J2B A;  1N9J A;  3X3Z A;  1SII A;  2GU1 A;  4U13 A;  3UJM A;  3G16 A;  1JB4 A;  1A2V A;  2CWV A;  2XFS A;  1RRL A;  1ULJ B;  3LT8 A;  5EQL A;  1Q82 4;  3EN1 B;  1O7G B;  3OWY A;  3NV0 B;  5EEO A;  4HZ9 B;  1JB5 A;  3B4O A;  4HM2 B;  1OPY A;  1U8C B;  2XSH B;  2E5T A;  3U97 A;  1QAK A;  1FGT A;  3WOE B;  1YJW 3;  3FZW A;  1NB5 I;  3NM2 A;  3LOY A;  3LTC A;  5AYR B;  1K9M 4;  2CFG A;  2ML6 A;  3CCS 3;  2FNQ A;  3KSE D;  4R80 A;  4K1U A;  4FR9 A;  2WGO A;  4K90 B;  3KN4 A;  4KFD A;  2OCT A;  4RNZ A;  5DRE A;  4AKZ A;  3USS A;  2W56 B;  5IEO A;  3F9S A;  5IG4 A;  2CW9 A;  1FGO A;  2R4I A;  3NV0 A;  2CKF B;  4HM8 B;  5ELJ A;  3VSY A;  1KC8 4;  1N5H A;  3BB9 A;  3IMA B;  1LVN A;  3K9M C;  4XB5 A;  4AKY A;  1GYB A;  3CCE 3;  4MEI A;  2XF3 A;  2CFK A;  3ROB A;  1FS0 E;  5ELU A;  1QAL A;  3OV4 A;  1OCV A;  1IVV A;  4N6O B;  1W4N A;  3A76 A;  1M9G A;  1N5P A;  3OWS A;  3CNX A;  3NBJ A;  1RJO A;  1M1X B;  1A2K A;  3LT9 A;  1TFK A;  1WTH A;  1IK3 A;  2WO0 A;  3PJS K;  4PEJ A;  1OAC A;  4HYZ A;  5STD A;  1O7N B;  1DMQ A;  2INX A;  1OGX A;  3DXO A;  2HML B;  1ULI B;  1QMA A;  2SBL A;  2D42 A;  4HZB B;  4N6N B;  2F98 A;  2HMK B;  3IPT A;  3WOD G;  1STD A;  2Z7A A;  1O7M B;  2BMO B;  4IIA A;  4STD A;  1VQ9 3;  2HMM B;  1N9E A;  2IUK A;  1CYV A;  3CCU 3;  3FLJ A;  3AMO A;  4FCJ A;  3EQQ B;  1W2Z A;  1L5G B;  3NUV A;  2KCD A;  1Z1S A;  3M8C A;  4WVZ A;  1VQK 3;  5IEP A;  2E2V A;  3FF0 A;  4K61 A;  4XBY A;  3JUM A;  1ROA A;  1UUV B;  5KP4 A;  1VQ7 3;  1LXE A;  1AQT A;  1IV9 A;  3F7X A;  5CF1 A;  5LC6 A;  1VQ4 3;  1TP6 A;  3E99 A;  3EB8 A;  4XM4 A;  1OF5 B;  4HM3 B;  3PXM A;  3F40 A;  3JUQ A;  1WMP A;  1FA3 A;  3PZW A;  3DGL A;  3NM7 A;  3Q90 A;  4KVH A;  4WP5 A;  4XDV A;  1JB2 A;  1TIJ A;  2GU3 A;  2XR8 B;  4OUQ A;  3ECF A;  1DMN A;  2I9W A;  5CF2 A;  2GBW B;  3DZL A;  1OH0 A;  4Q53 A;  2WSS H;  1EG9 B;  3HI7 A;  3MKI A;  3MYT A;  5LC7 A;  3NQZ A;  1ASK A;  1YI2 3;  3CCM 3;  3GZY B;  1VQP 3;  1A90 A;  2F86 B;  1S72 3;  1JN5 B;  5IEN A;  2P0M A;  3EN8 A;  3V99 A;  2OQE C;  1YIT 3;  3G6E 3;  3QRD A;  4MMZ B;  2E2U A;  2MF7 A;  2YFI B;  1BUQ A;  5IG5 A;  1KSI A;  1O7W B;  3RGA A;  2YX9 A;  2XH9 A;  2OOV C;  3KFQ C;  2IA7 A;  4N6L A;  3FF2 A;  2B24 B;  4EV5 A;  1EQK A;  4KFF A;  2O9U X;  1YHQ 3;  4H3U A;  1YJN 3;  1ZX2 A;  2W04 A;  5AI1 A;  3SXX A;  5AII A;  1NDO B;  5CK6 A;  4JF8 A;  2E5Y A;  1R4C A;  3STD A;  2CG0 A;  2CFD A;  3ER7 A;  1A67 A;  3EE1 A;  2WGQ A;  4KFE A;  1GY7 A;  3HZP A;  1AV4 A;  3OX9 A;  4MMX B;  1VQO 3;  3N54 B;  5D83 A;  4XBX A;  1YIJ 3;  2K0M A;  2W56 A;  3NBB A;  4J8T A;  1YJ9 3;  2Y73 A;  1JJ2 2;  2CFL A;  1O7H B;  1KWI A;  1VQL 3;  5HGR A;  1W6G A;  2CHC A;  3D9R A;  3WOF B;  3OWU A;  3DGM A;  2OQE A;  1W00 A;  6STD A;  2A15 A;  4LZI A;  3FSD A;  3UB1 A;  1OHS A;  1W2B 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...