2W6JH

Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 5.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL
publication title Improving diffraction by humidity control: a novel device compatible with X-ray beamlines.
pubmed doi rcsb
molecule tags Hydrolase
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2w6jH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w6jH01
3EFFK 1BSHA 4WVZA 2XNDH 2W6JH 4QMAA 2WSSH 3USSA 2V7QH 2E5YA 3PJSK 1E79H 2CK3H 1BSNA 1FS0E 1JEKA 4YXWH 4DJGA 1AQTA 2JDIH 2QE7H 1IFPA 4TLFA 2E5TA
chains in the Genus database with same CATH superfamily
3H1JG 2RNTA 3B5NB 4GB5A 3EFGA 1J2JB 1JMMA 1BE3E 2J58A 2O01J 2PFXA 4W7YA 2E2VA 1XTGB 3L75D 2E75B 1P84D 4H13B 2JEEA 1PP9G 1CW5A 4I5QA 1T8ZA 2HOHA 2AEFA 2SPZA 1HWTC 1I3FA 3FSDA 1IC2A 1W7CA 1ZP0C 1USDA 3GRDA 2KP8A 4EDFA 3L70D 1X1WA 1WQLB 1JMBA 1YGEA 1J1DB 2O9UX 2VRSA 1N7SD 3SOAA 1GDTA 1JCDA 3LXUX 1NO4A 5AW9B 3WMM0 1K734 1FZEA 4U3FD 3JC22 5AIFA 3HUSC 2WOHA 2WPSA 2IZ1A 1Z1SA 1M56D 1QLED 1RE3C 1QJGA 4K61A 1L0NE 1NU1D 5AVZB 4N6OB 2WPVB 4D6TG 2E74B 5M19A 2IYPA 2ZA4A 1O7PB 3RL0D 1T3BA 3RBXA 3M0AA 3TDKA 4WYKA 1URQB 4TX4A 1LWUC 1BUJA 1SQXE 3LYGA 4AKYA 1GMPA 2GU3A 3MWZA 5M18A 1SJWA 2AXTE 5AIGA 5KJ7D 2OQQA 5AVWB 3P7KA 1R4CA 1NB3I 3G713 1LNIA 1BRKA 1KILC 2PP6A 4HKZH 3V2QA 1BGSA 2ZVOB 4KFFA 4EIJA 2ZYGA 4AKZA 1N2DC 4EV2A 3S1KA 4H0LB 1G1IA 1IVVA 2FXOA 3WUUA 1B2SA 4BRYA 2A06D 1FAVA 1OHOA 2Q9IA 1RTUA 1OZHA 2KF6A 3QWOC 1N73B 4XDVA 2OOVA 1K04A 2HODB 1FC2C 2OYHA 2FXTA 1Y9BA 1AV4A 2BCCD 1XTCC 3GW6A 3L71J 3FG4A 3NM7A 1SFCB 2HMMB 2H0GA 3EBTA 1BIRA 3N9HA 3CC23 2LXCB 2N1TB 1GTWA 2XKMA 2POHA 3AE1C 3WOEB 3CMA3 5CJ0A 3HE4A 2W9QA 1I0VA 3AE9C 1N7LA 4H44B 3BCCD 3T0UA 3CCQ3 1PU4A 1B3SA 3A5TA 3VP8A 1X8YA 1RGGA 1QL2A 2I1JA 2A15A 1BNGA 2OGUA 2XSOB 3CCM3 1GD4A 5TGNA 3N7NA 3TSIA 2XNXA 3CCV3 3VMZA 3WUVA 1Q7YQ 1L4AB 5KAIH 1KILD 3WOFB 1NTKD 2XSHB 3H1JE 2OYIC 2FYZA 3R4YA 2CWTA 2P2UA 5APTA 2QG4A 3S5CA 1BSBA 1YGWA 1A2VA 1JTHB 2V7QH 4OGQB 1YIJP 3L73D 1MFZA 5FW5A 3AE7C 1FGQA 1C54A 3CMAP 1PP9E 1PZQA 1NWQA 3IN6A 2INXA 5APVA 1ZGXA 2JKVA 2YKPA 1U7MA 2AXCA 3G16A 1H0TA 4L74A 3CCQP 4FMCA 4MMXB 3B4SA 2K9JB 1GW3A 3Q3FA 1M1KQ 2XNDH 4EC6A 3CCE3 1W4NA 4EV5A 3MGNA 1PGPA 1FZFA 2SBLA 3JUPA 3FXDA 5ELJA 1KD1Q 1OH0A 1AQ5A 3CCVP 1VQ93 4I6MC 3MG1A 5DREA 1N7SA 3HX8A 2N9YB 4JYCA 4Y99B 2V7QJ 3LT9A 3VSYA 4GOEA 2YIUC 3OWYA 3U1CA 2F4YA 2SARA 4L7KA 4BL3A 2ZAEB 1W2B2 2R41A 4WWUC 5IG5A 1FZUA 1IFMA 4HB1A 3UIAA 4D6TE 1FOSE 3LTDA 1VZZA 1Z56A 1EQ7A 5AW8B 1RQUA 1NAYA 3X3ZA 3CME3 2PAJA 5AEUB 1LTJC 4K90B 2Q3IA 3BNCA 3CCEP 2PNCA 1QX8A 1PV3A 2HYNA 1VQO3 3B8EB 2ITAA 1VQ9P 2WGOA 2XR8B 2KNCB 1GZLA 1HZ1A 3JUNA 1B2XA 5KJ7A 3FLJA 2W6AA 3M0DC 2Q3EA 1VF5B 4GSPA 3CC7P 1SQVE 1WMOA 1YNVX 5GTIE 1GU4A 2BO9B 4AEQA 2FFDC 1AVLA 1N5PA 4ZMDA 3K7CA 1SQXJ 2YFJB 1YHQ3 1KC8Q 3G3ZA 2P05A 2GEXA 3EBYA 2BMRB 1DD3A 1VQLP 3CMEP 1I2FA 1KYOD 1FDOA 4NHFA 1CYUA 2ZVNB 2OTJP 3F8HA 4FMAA 3CI9A 2BCCE 3HUSA 1EA2A 3AEFC 1AVOA 1RF0C 3FWLA 3H1ID 1NOHA 3H1LD 1FS0E 4HM8B 1DEEG 1VQNP 3TGUD 1RE3A 5APXA 3WHOA 1IFPA 1TP6A 3IJEB 4YXDC 4I1LA 2KIKA 1FZGA 3MD0A 1TIJA 2I8DA 2BEZF 1NTMD 3EN8A 5D83A 1IK7A 4XBTA 1CI6B 1O7HB 2B24B 2ZT9C 1LWUA 1HVVA 1LTSC 4JRFA 3A3YB 4OVMA 1UDII 4EOTA 1A2KA 4HM2B 1BGYJ 5I97A 1S5LE 3AE3C 1FGMA 3OWUA 2KI7B 4WYKB 3MUDC 3CCSP 3MPHA 4IL6E 1NTKE 1KZUB 4STDA 1UGHI 1KILA 4K1UA 3SX1A 2OYOA 3L71G 3K0ZA 3CWBD 5BU5A 2Y9ZA 2KSEA 1T2KC 1UCJA 4K1VA 4X2HA 5JPUA 3VMXA 1VQ63 1W2EA 3L73E 3KPEA 1Q864 3AEGC 2B1XB 1NU1K 1DE3A 1PPJD 1EUIC 4I7ZC 1N9EA 3O8YA 2P0MA 1GL2C 2XDJA 3MYTA 1LP1A 1SQQE 4K3AA 2CPBA 3H1JJ 2P7JA 3T8NA 2QJKC 2QJYC 1MWSA 3QH9A 1JOCA 1IVXA 3EQ2A 2OYHB 5IG0A 3RL0g 3FF0A 5GSPA 7GSPA 3RK3E 1RMSA 1PP9J 1TUHA 1BRIA 1TU5A 2ZT9D 3IAOA 1UCKA 1EZVG 3Q5RA 1SARA 5M1BA 4MJDA 5APSA 3KN4A 2W9PA 1VQ6P 3LTAA 3BLZA 2RN0A 1X1XA 5KP1A 3L70J 3EN1B 5RNTA 3H32A 2MJZA 1KTMA 4LZIA 1EDIA 1BDCA 1BVIA 1IQYA 1BSDA 2CH9A 3VMYA 2YFIB 1KQS2 1YBKA 1N8R4 4DOJA 5CBOA 2OYIA 1S4XA 1H8AA 1RN1A 4PJ0H 1T2KD 1RDSA 3EJVA 1LT9C 4U3FJ 1SQPD 4NPDA 1RKYA 4DT0A 1GK4A 1MWTA 4DZOA 2NPSB 2K0MA 3NBRA 2UX0A 1O7WB 2R3CA 3T8UA 2K9YA 3WA3A 1F8NA 1NB5I 1NU1J 3OWSA 3NUVA 5GTIH 3L74D 5KAFE 5AW5B 2CX1A 3X41A 1NKZB 2HMKB 2ZL8A 5JBSA 1G96A 3O6QA 1W2BO 3A5EA 4HJGH 1BRGA 3SXXA 4IFDK 1CSBA 3X42A 2WMMA 1X9VA 1H0TB 2M3EA 3VF1A 1BRNL 1DMQA 2YO2A 3C8VA 1HH0A 1D6ZA 2W27A 1KYOE 4N3VA 3HOHA 2C4BA 3SVAA 5EVHA 1UCIA 3S67A 3WU2E 2H0IA 3H1LE 3NM2A 3WR2A 2P0XA 2RMZA 1SQVJ 3KSPA 1S5AA 3AE4C 2WO0A 1QAKA 1OX3A 3HD7C 3CXHD 4GHOA 2JJLA 2FY8A 2YXQB 1U8CB 4WBAA 4HBRA 2WZ7A 1RGAA 1S3JA 1JY3O 3FF2A 1NJI4 1LJ2A 2KOGA 3KIIA 4HAAA 1LTJA 2XZRA 3BNDA 1NTZD 2YKOA 1SQXG 2MF7A 4JYBA 4I4KA 1BCCD 1S5LH 2BCCJ 2MKVA 2CFLA 4N6MA 1C7HA 3H3HA 1RE4A 4IL6H 3HE5B 3MG2A 3DUKA 1BSHA 3W68A 1RGFA 1T3UA 3M0DA 1IVUA 2RFRA 3L71E 3B4OA 2K37A 5EQLA 1NO3A 3WA2X 3BCCJ 1FGOA 4IL6X 1L0LD 3GHGA 1VQ43 3KXDA 2ZYDA 2G3AA 1LTBC 1FU1A 3O8ZA 2C0WA 2F99A 2KYVA 4WVZA 1FJKA 4OK0A 2ML6A 1IFIA 3S27A 4XA4A 1NTKJ 1QVGO 1JUNA 3NHXA 4RNYA 1RF0A 4JF8A 2P38A 4IT7A 2D2CC 2WSCH 3HD7D 1BGYG 1I8VA 2E2TA 3CXC2 4GOFA 2H8PD 3L73J 4KZ1A 2KLVA 3OW22 1LTIC 1EDKA 1EZVE 1I2GA 2YXRB 3FX0A 3BVHA 4B86A 1GK6A 1V58A 2J5UA 3NV0A 1JNMA 1A2PA 3MKIA 2LR2A 1VQ4P 2A45G 3A76A 2H7HA 1SQQJ 5BVZA 3F7XA 3N8BA 1KFMA 1VL2A 3LW5H 4WY4D 4A7PA 1OVUA 3GZYB 3MUDA 3TDGA 4BTXA 2DW3A 3PH0A 4FCJA 2LYXA 1FZAA 1LXEA 1BNFA 2WSEH 3CCL3 2FYNB 3E1IA 3CX5E 4NREA 3CCR3 3P8MC 5BVBA 3Q1MA 4GT1A 3BNEA 3GMAA 3UL6A 3P8CD 4IFFA 4NPFX 1IT7A 2GBWB 5KAFH 4G1MB 1JZOA 1S723 1TFKA 1PL5A 3DGOA 1RH5B 3RDEA 1USEA 1NTMK 4OWFA 3CCUP 1NVOA 1Q90D 3V99A 3KSED 2C9LY 3AEBC 1S9KE 1NYHA 2D2CD 3LW5J 5IF6A 1LTGC 3L72D 1K9M4 1KB9E 1RQVA 4YPCA 3L70G 4R4KA 5CHXA 1HTLC 5APWA 3L4FA 1QAFA 3NXSA 4KVHA 1GD2E 1KYOH 3DMCA 3AGOA 5D81A 2WSEJ 2B87A 1GOYA 3A0BE 1KQSO 1X22A 4U3FG 3WU2H 2WITA 4HM5B 4KT3B 3CCLP 5AVVB 3CCRP 3RK2D 3FG3A 4DCKA 1FBMA 3M9BA 5AVYB 1OF5A 2Z7AA 2RKLA 1DEBA 1ZRTD 2B89A 5APUA 2L4VA 1NU1G 4N6TA 2BEQD 2AAEA 3RK3B 1S72P 1R8EA 4N3YB 1NHLA 4CDLA 5IERA 1MWRA 2XRXB 1BSCA 3JSVC 3LH4A 1AR0A 2KRTA 3H32B 5M1AA 4C7NA 1G1JA 2GU1A 1JB5A 3Q5PA 3H1IJ 1SVFA 3H1LJ 3D5GA 1EXIA 1OXZA 1SQBK 3TGUJ 1ZOYC 4WB4A 1AV1A 1LOVA 1YI2P 1RGCA 1GSPA 1LQMB 3CD63 3GG2A 3LTBA 2GUVA 4I2LC 1NTMJ 5AVSB 1SQVG 4BTWA 2W83C 1DETA 2JWDA 3B5NC 3V92A 1JN5A 1YQ4C 3EHCA 1IV7A 1M57D 1VQMP 4K35A 1AVKA 1M8OB 3K5BA 4H13C 3O6QB 1OW6A 4J8TA 4XBXA 1SQWA 2WT7A 1IZNB 5AVUB 1JKGB 3ZG5A 4HVNA 2JQ5A 2BCCG 3MSOA 1BGYE 4UB6H 3E1RA 1YIJ3 1SQPK 2Y0EA 3CWBJ 1YTZT 3HD7A 1J1DC 3PCRA 5KLIB 6STDA 2YIUB 3ZDMA 3CD6P 3DGMA 3AGNA 1EZVI 2IMJA 3BCCG 2KK7A 1V57A 3KQGA 1W02A 2L5GB 3FCSB 1H88A 3M9QA 2E43A 1ZR4A 2O3JA 2GUSA 3W67A 2HPCA 1J1EB 3H1KD 1LRAA 3RNTA 1JEKA 3H6PA 1Q40A 1T5YA 4CJNA 1PY3A 1QGKB 1IT8A 1HGVA 2CG1A 4C7RA 4WY4A 4HJLB 2E74C 1NTKG 3EC9A 3I55P 4QMAA 3CX5H 5BXQA 1URQC 1NDOB 5EFWB 1PFIA 3CX5I 1E79H 2FYUD 2KZIA 1K28A 3FGAD 2CWVA 1YJ93 3L73G 5AVTB 1VQ8P 1RGEA 2P58A 4NPEA 3L75E 3NBBA 1P84E 3BATA 1ASKA 4H13D 3CC43 5APQA 1DX7A 3OW2O 4LC1A 4CCVA 3EB8A 1RLSA 3GHGB 1KB9H 1ZS7A 2MC8A 2Z76A 1KB9I 2AADA 3L70E 1SQQG 1LGHB 4FCZA 1NTZK 1RJOA 4H0LC 2GSPA 3N4XA 2I1KA 1KV4A 4RBNA 3D3LA 1IV9A 3A0BH 4GKGA 1A90A 4O3VA 1WRGA 4U3FE 4PV1B 1N73C 3CC73 4H3UA 3L74J 1YJ9P 3L37A 5B5EE 1NU1E 1L0LK 1ZRTE 1GU5A 3CC4P 1W01A 3H1HD 1SFCC 1IK9A 1YJW3 2GEYA 6GSPA 2N1TC 1FZCB 1VQL3 2RH0A 4H44C 3IMAB 5KP4A 2OTJ3 2BMOB 3JVCA 4DJGA 2M8RA 4PJ0E 1N86A 5E79H 1VQN3 2J8XB 5JPPA 4XDWA 5G2GA 2Y0DA 3T97A 1JB4A 2KXPB 1L5GB 2HMNB 3Q90A 3PS8A 1FYSA 4N6UA 2QRXA 4PD4D 2KF4A 2IBZD 1L4AC 2E76B 3LOYA 1RHZB 3JUMA 1R5LA 4R9LA 4N6JA 3WMDA 1FOSF 4H0LD 1G0TA 1RN4A 4ZNCA 2A06E 4L8PA 4OGQC 1NTZJ 1YJWP 1Q81Q 3M06A 1MOLA 4RJTA 1BCCJ 2D42A 5CJ4A 1CQSA 4JQ0D 1I70A 3BB9A 4LEHA 2F5MA 3KCHA 3CCS3 3IPTA 1GMQA 5AIHA 4H61A 3CLQA 2WOFA 1Q7HA 4HYZA 2JR8A 2HLOA 3Q1CA 2XGLA 4U13A 2OTKE 3H1IG 3H1LG 1HU9A 3NX0A 1HGZA 1SFCD 3EWKA 3OA7A 3TGUG 1V74A 2E5TA 1K41A 3F9SA 2RCDA 2N1TD 4GL6A 1L0LJ 1OGZA 2W2CA 2UUGC 3M9HA 3BCCE 1NTMG 3FG1A 4Y99C 3OX9A 2G8YA 3V4WA 2A45H 1FDIA 1OF5B 1BSNA 2A45I 1QVG2 2KS1A 4ZKUA 1X79B 3GAXA 2QJPB 2IDBA 4FCMA 1TRQA 3VYIA 3DGNA 1VPCA 2CHCA 3BU4A 1W00A 1E5WA 3RBZA 3F14A 1KILE 1L4AD 1DVCA 5TISE 3LIEA 2XH9A 1NKNA 4C7NB 2M5AA 2K1AA 3MZWB 1FE6A 5D82A 4BU4A 2QA4P 1TFOA 1KWIA 3CWBG 1Q7Y4 4OGQD 1BRSA 1P84H 5KLVD 1EQKA 1N5HA 1Y47A 1P84I 1CYVA 5AW7B 1G02A 2Z5IA 1U7JA 1PPJG 3V4QA 5G1KA 2HG5D 3ROBA 4EW5A 4AYCA 2Q6QA 3CPW2 5AI1A 4BRYB 1NWWA 3SOYA 1SIIA 4C46A 3KKGA 3SWYA 3DGLA 1GY6A 3V5BA 1VQQA 3G4S3 1Y8AA 1PIXA 4O2HA 1KQFB 1SQBD 3GZRA 4L8OA 3AHWA 2CG0A 1US1A 2K88A 1OWAA 2WT7B 4U7JA 2ZHXB 1M1K4 3L75J 3C9IA 1IFNA 1IU7A 1I3IA 1KD14 1FUSA 1OVVA 2GBXB 5B5EH 3G8ZA 2R5DA 2GXFA 2WVRA 1ZXGA 3HE4B 3E99A 1JY2O 3L72J 5DJUB 3AE6C 3H1HE 5CCHC 3HRNA 5AW2B 2R32A 1X1UA 4EYCA 2R4IA 2ZFCA 1A02J 2WGQA 3QRDA 1X0TA 4YXWH 3M91A 1IQXA 2JDIH 1ZX2A 2CIUA 5AYSC 2E2UA 9RNTA 2HPCB 2Q7CA 1QVFO 1SS1A 3OJAB 3G4SP 1URQA 3D4AA 1OW7A 1SQPG 1CEWI 1YQ3C 1JM0A 3Q3DA 1RNBA 4WY4B 3A7OA 4XFJA 2O01N 5KKZB 1BSEA 1ZMEC 2QIWA 1BUQA 1GL2D 2ZJSE 2W8ZA 1NAFA 4Q53A 2ZYAA 5DJTB 2CPSA 4HM1B 3L74G 1PGQA 3AE5C 1JB2A 1ROVA 1BE3D 3SYUA 1TTOA 1VDFA 1T2HA 1UUWB 1BNSA 3SFDC 3Q2YA 3LT8A 3IF4A 1HYFA 2C0XA 2V4HA 5AVRB 5AEWB 1W6YA 3UNLA 2OWPA 3BIRA 2E5YA 3GLMA 3JCUH 5GTHE 2HMOB 3G9RA 1YYCA 3NTNA 1O7GB 1FGRA 1K73Q 1N73A 1MWUA 1KC84 1OGXA 3WDGB 3H1IE 4HKVB 2QEXP 1N7SB 3A0HE 2PRRA 3TGUE 1RHLA 1DYUA 1BDDA 5CCHD 2CKFB 1U57A 2FYUK 1OW8A 3G6EP 5K5GB 1W2ZA 3D6YA 1SFCA 1IQ8A 2WSSH 1OPYA 1EC5A 1EKMA 1UCLA 1NTME 2N1TA 1T3JA 1HJBA 3VN0A 3UB1A 4JBZA 1HJ0A 2CX0A 5IENA 5CK6A 3RK2B 4RZMA 3F89A 1NTZG 1L0ND 5H2FE 1RRLA 1D7MA 2FNQA 1BCCG 1JO5A 1TJDA 3OV4A 5TISH 3GSPA 3RL0B 1QMAA 8CHOA 3KHUA 2KF3A 1L4AA 2KZJA 2YO3A 1SQXD 2W04A 1D6YA 3D6ZA 1UGIA 3CWBE 5IEPA 1I0XA 1S5LX 4Y28J 3JUQA 2FFDA 3VTPC 3X40A 4XB5A 1GYBA 5AYRB 1B20A 1JTHA 1T2IA 1L0LG 3BRTB 1LQGC 3SEDA 1AQZA 1MZ9A 2IY2A 4EI2A 3GF7A 2OTLP 2NPSC 3DH2A 1PPJE 3H1KJ 5CCGC 2XU6A 3V2RA 3PGBA 3WUTA 2W6BA 4CPGA 3V6IA 1KN7A 1GOVA 3EQQB 3ZG0A 1J2BA 2K9JA 1AJYA 1KQGB 3SFEC 2H43A 1EXJA 3V98A 1SQBE 4UB6E 5LC6A 5KTBA 4N78D 3PRJA 1BNJA 4KJMA 2KAAA 4R80A 2AEMA 4TLFA 3HUSB 1FZBA 2P67A 3MHEA 1ROAA 3EF8A 2CFWA 1QL1A 1GMRA 5BIRA 2XF3A 1Q82Q 2HFED 3CCU3 3KE7A 4HYTB 4HH2A 4HOHA 4R9KA 4LGQA 2YFLB 2J59M 5B66E 4RNZA 1ZR2A 1UW1A 3D5IA 5AW6B 1I2EA 3LZAA 2CW9A 1LWUB 3HK4A 1QALA 1IFDA 1GOUA 5AW1B 1MKMA 5LC7A 3CPWO 1KORA 3U59A 3CU3A 1DH3A 1FUWA 2Q07A 1SQPE 3NBJA 5BU8B 4MEIA 2IYOA 1JBRA 2QGUA 1B2UA 4R4LA 5CBNA 3DXOA 4J5KA 2OARA 1KILB 5CCGD 3L75G 2M5AB 3P32A 2KNCA 2JWAA 4AUWA 3H1JD 3H1HJ 1R5SA 3L74E 4MMZB 2NZ2A 3FZWA 1GL2A 1YITP 2BNGA 2BIRA 1LNHA 3GF3A 3PYJA 3PXMA 4RNTA 2GM4A 2UWJE 3F7SA 4HM4B 3L72G 2NRGA 1PP9D 1RGKA 5KJ7C 2QM8A 1E97A 1UUGB 1Y4KA 5GTHH 3HZPA 1KYOI 1GY5A 1LP1B 1BANA 3KFQC 2OQEC 1OHSA 4HZ9B 4LMIA 1YI23 2R3SA 1BRHA 1K05A 3N54B 3A0HH 1G2CA 3U1AA 3PZWA 1D6UA 2KB7P 2WSFH 1O7NB 3SLUA 4NPBA 3CXHE 3DGYA 2ZXXA 5KLVK 1HF9A 5HOHA 1BSAA 3QK9A 2IX7C 5CCHA 1RF1C 1MV8A 1HBWA 1VQM3 2ZDJA 3FH1A 2Z5HA 1CZQA 3HI7A 1ZW0A 3MG3A 5H2FH 5DRVA 1LT9A 1NTZE 3PCSA 1CI6A 3HTKA 1NH4A 1BCCE 3AHSA 4D6TD 5CXOA 1LT1A 5E79E 5KP3A 2KCDA 1M1JC 1FW7A 2OYIB 1LVNA 1ULIB 2WSFJ 3D70A 3RGAA 4BTYA 3D71A 4L76A 1IVWA 3L35A 2HR3A 1BOXA 1OFCX 5AW4B 1OIPA 2XEPA 2FXMA 2QE7H 2PGDA 3J7Yd 1L0LE 1IK3A 2K3DA 3AE2C 2A06G 2FYNC 3BASA 1ISKA 1WMKA 1QEXA 2E75C 1ZLLA 2B88A 3K5TA 3KZTA 2ZXEB 2WTYA 1SQVD 1GW4A 4N6V0 3I553 1UIIA 1KSIA 1YVSA 2FKWB 1GD3A 1FJPA 4JF7A 2KXGA 4WP5A 1RCLA 4KFDA 1K8AQ 1VQ83 3CPOA 4N78E 1RCKA 5KLVJ 1PYLA 3F8XA 1YTZI 8RNTA 1OUNA 1WMNA 3V2PA 2YNYA 3NMDA 2F86B 2WQYC 5B66H 1AFOA 4KFEA 4CPKA 2YX9A 4DKIA 1RSNA 2PZVA 3X3XA 1R4YA 3TNUA 3H1KG 1U5OA 1Q824 1GS3A 3G71P 3FKAA 1LTJB 1SQBJ 4LSOA 3RK3C 4IFMA 3CNXA 3U97A 1MFTA 1H89A 2GA1A 4TT3H 4UB8E 3NXJA 2WPRA 3B5ND 3TK1A 1Q42A 2CK3H 4ZKPA 1W6CA 1EG9B 1M90Q 2IZ0A 2FYUG 3IFMA 3I5CA 3PLNA 1RGLA 3P8CE 2E75D 2BASA 2QVAA 3RGRA 4O8SA 2NPSA 1OACA 5CCGA 3F40A 1Q86Q 4WHAA 1LOWA 2FFDB 3ZFZA 3GWRA 2LQVA 1BU4A 1QVF2 2FBWC 3PTZA 1ZV8A 3L72E 3CC2P 3VGNA 4J5GA 1IJDB 4GODA 1UIXA 1L0NK 4BXLA 1SQPJ 2E42A 1YJN3 4KT0J 2L1SA 2O3OA 4QWTA 4OUQA 4O9BA 7STDA 1ZO2A 2M7OA 4OVNF 3SSUA 2KLUA 5A0OB 3MTUE 4X2OA 1SQQD 3LMLA 1SQXK 3CCMP 1MNLA 3CXHH 2V1LA 4ILFA 4N6LA 3CXHI 2JO1A 1BE3J 2W03A 1MGRA 3GZBA 4KHXA 2BU4A 3KDPB 3RK3D 3M8CA 3H1HG 2KUBA 2E74D 2ZT9B 1MUUA 3PP5A 3NV0B 1IFJA 5KLIC 2Y9YA 1AY7A 2KSJA 3X3YA 3TYYA 1URQD 2KF5A 5CMZA 1A02F 2P1JA 3AMOA 4WFOA 1EDLA 3CNMA 4BL2A 1SP4A 2RBIA 3VP9A 1JV2B 1N8RQ 1EDJA 1YJNP 1JB0J 2Y73A 1AVYA 3S4RA 1VQK3 1J1EC 2O1KA 2Q1KA 1LTTC 2N9BA 3F5HA 3V2NA 1B27A 1KMIZ 2CC3A 5IG4A 5ELUA 3HE5A 5BU4A 3D9RA 3FWNA 3K9MC 2IBZG 2AXTH 4ASVA 1IDPA 1KFNA 2O1JA 2RGQA 4FR9A 2CWUA 3HIGA 4HM7B 3ITKA 2H0HA 3DZLA 5IEOA 1LTAC 2R5BA 1RE4C 2IUKA 4I7ZB 3EX9A 1STFI 2W6JH 1L0NJ 1GL2B 3AEAC 4RO0A 1JZDA 2OQEA 2W56A 3KYQA 3JCUE 1KQLA 2QJKB 4L75A 2QJYB 1GY7A 1B2ZA 2QA43 3GHGC 1TRPA 4M3LA 1VQP3 2K54A 1PFPA 2B87B 3URPA 3D79A 1VQKP 2XFTA 2L91A 1DD4A 4OH8B 1RF1A 3FGYA 5L8RJ 1G2CB 4H44D 4W80A 4Z1MH 1WMPA 5C39A 2BT3A 1B21A 1VQOP 1K8A4 2YMKA 2FGTA 4XE5B 4EYYQ 4PV1C 2Y74A 5CF1A 1NJIQ 1FUTA 1E3VA 1TU3F 2RSXA 5FGOA 3H1KE 5HGRA 4EBGA 2QSIA 1M1JA 1BNIA 1STDA 3H51A 3KZIE 2HMLB 1OVRA 1B2MA 2Z4EA 3H25A 2QIYA 4UB8H 1LT9B 2WWWA 3HTKB 4BIRA 1FZCC 1VQPP 3G0KA 1SPUA 2BHMA 3K63A 3IR9A 4AQRD 2FYUE 1YHQP 1FGTA 3B5NA 3L36A 2M3BA 2K3RA 1WNHA 3AEDC 2B9BA 5KLVG 5AW0B 2P10A 1L2PA 5AVQB 1GMJA 2XGNA 1BAOA 3GZXB 3Q2PA 1JBTA 1W5CE 3U1WA 3AE8C 1BNRA 2R44A 4LYLB 3L71D 1LNQA 1W5ZA 1M904 2LXBA 4RKUJ 1DMNA 2Y0CA 1UUVB 1VQ53 1VF5C 4R1KA 2E76C 1JN5B 2H88C 5IW9A 1CH0A 2P09A 4EXRA 2BMQB 3BNBA 1SQBG 2QM7A 4IPBA 1AQTA 3JUOA 2F98A 1MGWA 4WWIA 3R2PA 4HM0B 3TF5A 1JY2P 1LOYA 1IYYA 4PV1D 2CFGA 1N9JA 3HD7B 1O7MB 3VOPA 2IFMA 1Q2NA 4BWNA 1DIPA 1HUCA 4W7ZA 1EEJA 5APYA 1X1YA 3NQYA 3I0YA 3L0RA 1S2EA 1EZVD 1VQ5P 3B7CA 5STDA 3OXAA 1SQVK 4ASWA 3TNUB 4IIAA 1Q40B 2Z77A 3ECFA 1T6AA 2QEX3 2YMYA 2IYJA 1RRHA 2QJPC 2CFKA 3ABVC 3G6E3 2C10A 4XBYA 5TJHA 1ZN5A 4PD4E 2Q5UA 2C9NY 1VF5D 2IBZE 2E76D 5CLKA 4MN4C 4RESB 1RGHA 1OHPA 3VMAA 3S29A 5EEOA 1BE3G 3CX5D 5AVXB 3A2AA 1OCVA 3RGUA 2OCTA 2IFNA 5G1LA 1UI7A 4FMDA 1PGJA 1K9MQ 2F5WA 3NQZA 1ULJB 2IA7A 4D6TJ 1WT6A 2JP3A 2D2CB 1S9KD 3B71A 3FXEA 2HODA 1Q814 1RY3A 1KB9D 1JNQA 1PGOA 1JKGA 3EFFK 1Q9EA 3CCJ3 1JJ22 1JY3P 1OMIA 3PHLA 1DVDA 3OAKA 1RN7A 4ZM8A 3DM8A 2ML5A 3EE1A 2OTL3 2OOVC 2OYHC 2M0BA 4MMYB 3SWKA 3MHVA 1NTKK 6RNTA 3AECC 4ORLA 3ALAA 3UJMA 1NGMB 2AEJA 1A67A 1LOXA 1L0NG 3Q5SA 2I9WA 1JCCA 3KZIH 2YKQA 4LGDE 1VQ73 5AW3B 3USSA 4JPZB 1SIHA 3DY5A 4XM4A 1FDMA 3AMOB 3HIIA 3S9OA 3UL5A 1HKXA 1JBSA 4PEJA 1SQQK 3T97B 2WPQA 3CCJP 2F56A 1JY2N 5KLVE 1DMMA 1UI8A 1NU3A 1M9GA 3STDA 3B4PA 4WY4C 1JRQA 1SLQA 7RNTA 5KKZC 1FA3A 3ER7A 4FMBA 2C11A 2STDA 2HMJB 4R4MA 1YVBI 4O02B 2IPPA 1N8QA 3S28A 1NNVA 1E3RA 1S1CX 1VQ7P 2FXPA 2UGIA 2W56B 2FYUJ 4LLHA 3I563 4L73A 2LKMA 4GIFA 4IOIH 2W0QA 4HM3B 4HM6B 2H89C 1BGYD 3PJSK 1YIT3 5AIIA 1RF1B 1M7LA 1N7SC 3B8LA 3AEEC 2XV5A 4YTPC 1W6GA 3SWFA 2O01H 4HZBB 2KS1B 4J9AA 3BRVB 3E7KA 4N6NB 2CFDA 3LTCA 1FZCA 3CL3D 1WTHA 3MP7B 1IO4A 2Z6BA 1AA0A 1M1JB 1BRJA 3RK2C 5IG3A 3MIWA 2NPSD 3C1LA 3I56P 1RNTA 3WODG 4PD4H 4GDOA 5CF2A 2XFSA 4PD4I 2WSCJ 3NFQA 1M1XB 2D1WA 1BNEA 1JY3N 2IBZI 2W90A 5KAIE 2IUJA 3LIDA 3RL0C 3II6A
chains in the Genus database with same CATH topology
1K41A 3F9SA 4LSOA 2RCDA 3CNXA 4GL6A 4GB5A 3SXXA 3U97A 1OGZA 2W2CA 3X42A 3VF1A 1DMQA 2E2VA 3FG1A 3NXJA 3OX9A 1Q42A 1OF5B 2CK3H 1D6ZA 1BSNA 1W6CA 1EG9B 4N3VA 1QVG2 3SVAA 3GAXA 5EVHA 4FCMA 3S67A 3FSDA 3RGRA 4O8SA 1W7CA 3NM2A 1OACA 3DGNA 2P0XA 3GRDA 2CHCA 3F40A 3KSPA 1W00A 1S5AA 4WHAA 2WO0A 1QAKA 1WQLB 3F14A 1DVCA 1YGEA 2O9UX 3GWRA 2XH9A 3SOAA 2LQVA 1QVF2 1U8CB 4HBRA 5D82A 3VGNA 3LXUX 3FF2A 1TFOA 1KWIA 1K734 1NJI4 3KIIA 1Q7Y4 3BNDA 1YJN3 2MF7A 1EQKA 1N5HA 5AIFA 4I4KA 2O3OA 4QWTA 1CYVA 4OUQA 2WOHA 1ZO2A 7STDA 2CFLA 2M7OA 4N6MA 1C7HA 3H3HA 1Z1SA 5A0OB 3MG2A 3DUKA 1QJGA 4K61A 4X2OA 1BSHA 3LMLA 3ROBA 4N6OB 3CPW2 5AI1A 1MNLA 2V1LA 1NWWA 4N6LA 1IVUA 1SIIA 3SOYA 2RFRA 1O7PB 2W03A 3B4OA 3KKGA 3DGLA 1GY6A 5EQLA 1NO3A 3G4S3 3GZBA 4O2HA 3WA2X 3M8CA 4WYKA 3GZRA 4TX4A 4L8OA 1FGOA 2CG0A 3LYGA 4AKYA 3NV0B 1US1A 1VQ43 2GU3A 1M1K4 3MWZA 3X3YA 1SJWA 5AIGA 1IU7A 3AMOA 4WFOA 1KD14 3CNMA 2F99A 4WVZA 1JV2B 2GBXB 2ML6A 4OK0A 3G8ZA 2GXFA 3S27A 1R4CA 1NB3I 2Y73A 3G713 3E99A 1VQK3 3NHXA 4RNYA 4JF8A 5IG4A 2CC3A 4KFFA 2P38A 4IT7A 5ELUA 4AKZA 4EV2A 3D9RA 1IVVA 2E2TA 4EYCA 2R4IA 3CXC2 3K9MC 2WGQA 1IDPA 2RGQA 3QRDA 4FR9A 4YXWH 4KZ1A 2CIUA 1IQXA 2JDIH 1ZX2A 2CWUA 3HIGA 5AYSC 2E2UA 4HM7B 3OW22 1OHOA 3DZLA 5IEOA 2IUKA 4XDVA 3EX9A 1STFI 1CEWI 2W6JH 2OOVA 2FXTA 3NV0A 1AV4A 3MKIA 3A76A 2OQEA 2W56A 3F7XA 3N8BA 3FG4A 3NM7A 1BUQA 2HMMB 3EBTA 1GY7A 3GZYB 3N9HA 3TDGA 4Q53A 4BTXA 3CC23 2QA43 4HM1B 1VQP3 2K54A 3WOEB 1PFPA 1JB2A 3CMA3 1ROVA 2W9QA 4FCJA 2LYXA 1UUWB 3T0UA 2XFTA 1LXEA 3LT8A 3FGYA 3CCQ3 1PU4A 5AEWB 1W6YA 3CCL3 3UNLA 2OWPA 5JBSA 4NREA 3CCR3 2E5YA 5BVBA 3BNEA 1WMPA 2A15A 3UL6A 2BT3A 2XSOB 1IT7A 3CCM3 2HMOB 2FGTA 1K8A4 2GBWB 4G1MB 1S723 1TFKA 2Y74A 1GD4A 5TGNA 1O7GB 1FGRA 5CF1A 3CCV3 3DGOA 3RDEA 1KC84 1E3VA 1OGXA 3WOFB 2RSXA 5FGOA 3WDGB 4HKVB 3V99A 3KSED 5HGRA 1DYUA 4EBGA 2XSHB 1STDA 5IF6A 2CKFB 3H51A 1K9M4 2CWTA 2HMLB 1W2ZA 4R4KA 2QIYA 3S5CA 1A2VA 2WSSH 1IQ8A 2V7QH 1OPYA 1QAFA 1EKMA 4KVHA 5FW5A 3DMCA 1FGQA 5D81A 3G0KA 3UB1A 1SPUA 2BHMA 3K63A 5IENA 2INXA 5CK6A 1FGTA 1WNHA 4RZMA 4HM5B 3G16A 1RRLA 2XGNA 4FMCA 3GZXB 3Q2PA 2FNQA 4MMXB 3U1WA 3FG3A 3OV4A 1OF5A 2XNDH 2Z7AA 4EC6A 1W4NA 1W5ZA 3CCE3 4EV5A 1DMNA 1M904 2L4VA 4N6TA 1QMAA 1UUVB 2SBLA 1VQ53 3JUPA 5ELJA 8CHOA 4R1KA 1JN5B 1OH0A 1VQ93 2W04A 1D6YA 3MG1A 5IW9A 5DREA 3HX8A 4CDLA 5IERA 5IEPA 2P09A 3LT9A 4EXRA 2BMQB 3JUQA 3VSYA 2XRXB 3BNBA 3LH4A 3X40A 4XB5A 4IPBA 1GYBA 5AYRB 1AR0A 2KRTA 1AQTA 3OWYA 3SEDA 3JUOA 2F98A 4L7KA 1W2B2 2GU1A 1JB5A 4HM0B 4WWUC 2CFGA 1N9JA 5IG5A 1O7MB 3PGBA 3LTDA 1VZZA 3CD63 3LTBA 3EQQB 1J2BA 3CME3 3X3ZA 5AEUB 3NQYA 3V98A 3I0YA 4K90B 3L0RA 4BTWA 5LC6A 3BNCA 2PNCA 3V92A 1JN5A 3B7CA 1VQO3 4R80A 4TLFA 3EHCA 3MHEA 1IV7A 1ROAA 3EF8A 2CFWA 5STDA 3OXAA 1AVKA 2WGOA 2XR8B 2XF3A 4XBXA 3JUNA 4IIAA 1Q40B 4J8TA 2Z77A 3ECFA 3CCU3 1SQWA 3KE7A 2QEX3 3FLJA 4R9KA 4LGQA 1RRHA 1JKGB 2YFLB 4HVNA 2JQ5A 2CFKA 4RNZA 3G6E3 3MSOA 1UW1A 2C10A 1WMOA 4XBYA 1YIJ3 3LZAA 2BO9B 2CW9A 4AEQA 5CLKA 1AVLA 1N5PA 3HK4A 3PCRA 1QALA 3K7CA 6STDA 1OHPA 2YFJB 5LC7A 3S29A 5EEOA 1YHQ3 3DGMA 2IMJA 3CU3A 1OCVA 2P05A 2GEXA 2OCTA 3EBYA 2BMRB 2Q07A 1FUWA 3NBJA 1W02A 4MEIA 3FCSB 1UI7A 4FMDA 4NHFA 2QGUA 1CYUA 3NQZA 1ULJB 3DXOA 3F8HA 4FMAA 2IA7A 1EA2A 1FS0E 4HM8B 1JEKA 1Q40A 1T5YA 1Q814 4MMZB 1JNQA 1IFPA 1TP6A 3FZWA 1IT8A 3IJEB 1JKGA 2CG1A 3EFFK 4HJLB 2BNGA 1TIJA 3EC9A 1LNHA 3PYJA 3CCJ3 1JJ22 3PXMA 3EN8A 1DVDA 4QMAA 5D83A 3F7SA 4HM4B 1RN7A 4XBTA 4ZM8A 3DM8A 2ML5A 5BXQA 1O7HB 1NDOB 2B24B 3EE1A 2OTL3 2OOVC 1E79H 1K28A 4JRFA 4OVMA 2CWVA 4MMYB 1E97A 1Y4KA 3HZPA 1YJ93 1GY5A 3KFQC 3NBBA 1ASKA 2OQEC 1A2KA 1OHSA 4HM2B 4ORLA 4HZ9B 3CC43 4LMIA 1YI23 3ALAA 3UJMA 5I97A 1A67A 3N54B 1LOXA 1FGMA 3OWUA 4WYKB 3MPHA 3PZWA 2I9WA 4CCVA 1D6UA 3EB8A 4STDA 2MC8A 2Z76A 4K1UA 3SX1A 1VQ73 1O7NB 3SLUA 3USSA 1SIHA 3DY5A 4FCZA 4XM4A 3K0ZA 1RJOA 3AMOB 3QK9A 3HIIA 4K1VA 4X2HA 5JPUA 3UL5A 4RBNA 1VQM3 3D3LA 1VQ63 1IV9A 1HKXA 2ZDJA 3FH1A 4PEJA 1Q864 2B1XB 3HI7A 3MG3A 4O3VA 1A90A 5DRVA 1DMMA 1UI8A 3PCSA 1N9EA 3O8YA 3CC73 1NU3A 2P0MA 1M9GA 4H3UA 3STDA 3B4PA 3MYTA 5CXOA 1JRQA 5KP3A 2KCDA 1FA3A 3ER7A 4FMBA 1LVNA 1W01A 1ULIB 2C11A 2STDA 3T8NA 1YJW3 2HMJB 3RGAA 2GEYA 4BTYA 1YVBI 4O02B 1IVWA 1N8QA 1IVXA 5IG0A 3S28A 3FF0A 1VQL3 1E3RA 1TUHA 1TU5A 2XEPA 3IMAB 2QE7H 2W56B 2BMOB 5KP4A 3J7Yd 2OTJ3 1IK3A 3I563 3JVCA 4DJGA 4MJDA 1ISKA 1VQN3 3KN4A 5JPPA 2W9PA 4XDWA 5G2GA 1JB4A 2W0QA 3LTAA 3BLZA 4HM3B 4HM6B 1L5GB 2HMNB 3Q90A 3K5TA 3KZTA 3PS8A 5KP1A 3PJSK 1YIT3 3EN1B 5AIIA 4N6UA 4N6V0 3I553 1KSIA 4LZIA 3LOYA 1IQYA 1GD3A 3JUMA 2CH9A 3B8LA 4R9LA 2YFIB 2KXGA 4WP5A 3WMDA 1KQS2 1N8R4 1W6GA 3EJVA 4KFDA 1VQ83 3CPOA 4HZBB 4L8PA 4J9AA 1RKYA 3F8XA 4N6NB 2CFDA 3LTCA 1MOLA 1WTHA 2D42A 2K0MA 3NBRA 1OUNA 1WMNA 2UX0A 1CQSA 3BB9A 1O7WB 4LEHA 3T8UA 3CCS3 2Z6BA 3WA3A 1F8NA 2F86B 1NB5I 3IPTA 5AIHA 4H61A 2WOFA 3OWSA 4KFEA 5IG3A 2YX9A 3NUVA 3WODG 4HYZA 2PZVA 3X3XA 3X41A 2HMKB 2XGLA 2XFSA 2ZL8A 3Q1CA 4U13A 5CF2A 1HU9A 1M1XB 2D1WA 1G96A 1U5OA 2IUJA 1Q824 3NX0A 1GS3A 3FKAA 1V74A 2E5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFF K;  1BSH A;  4WVZ A;  2XND H;  2W6J H;  4QMA A;  2WSS H;  3USS A;  2V7Q H;  2E5Y A;  3PJS K;  1E79 H;  2CK3 H;  1BSN A;  1FS0 E;  1JEK A;  4YXW H;  4DJG A;  1AQT A;  2JDI H;  2QE7 H;  1IFP A;  4TLF A;  2E5T A; 
#chains in the Genus database with same CATH topology
 3H1J G;  2RNT A;  3B5N B;  4GB5 A;  3EFG A;  1J2J B;  1JMM A;  1BE3 E;  2J58 A;  2O01 J;  2PFX A;  4W7Y A;  2E2V A;  1XTG B;  3L75 D;  2E75 B;  1P84 D;  4H13 B;  2JEE A;  1PP9 G;  1CW5 A;  4I5Q A;  1T8Z A;  2HOH A;  2AEF A;  2SPZ A;  1HWT C;  1I3F A;  3FSD A;  1IC2 A;  1W7C A;  1ZP0 C;  1USD A;  3GRD A;  2KP8 A;  4EDF A;  3L70 D;  1X1W A;  1WQL B;  1JMB A;  1YGE A;  1J1D B;  2O9U X;  2VRS A;  1N7S D;  3SOA A;  1GDT A;  1JCD A;  3LXU X;  1NO4 A;  5AW9 B;  3WMM 0;  1K73 4;  1FZE A;  4U3F D;  3JC2 2;  5AIF A;  3HUS C;  2WOH A;  2WPS A;  2IZ1 A;  1Z1S A;  1M56 D;  1QLE D;  1RE3 C;  1QJG A;  4K61 A;  1L0N E;  1NU1 D;  5AVZ B;  4N6O B;  2WPV B;  4D6T G;  2E74 B;  5M19 A;  2IYP A;  2ZA4 A;  1O7P B;  3RL0 D;  1T3B A;  3RBX A;  3M0A A;  3TDK A;  4WYK A;  1URQ B;  4TX4 A;  1LWU C;  1BUJ A;  1SQX E;  3LYG A;  4AKY A;  1GMP A;  2GU3 A;  3MWZ A;  5M18 A;  1SJW A;  2AXT E;  5AIG A;  5KJ7 D;  2OQQ A;  5AVW B;  3P7K A;  1R4C A;  1NB3 I;  3G71 3;  1LNI A;  1BRK A;  1KIL C;  2PP6 A;  4HKZ H;  3V2Q A;  1BGS A;  2ZVO B;  4KFF A;  4EIJ A;  2ZYG A;  4AKZ A;  1N2D C;  4EV2 A;  3S1K A;  4H0L B;  1G1I A;  1IVV A;  2FXO A;  3WUU A;  1B2S A;  4BRY A;  2A06 D;  1FAV A;  1OHO A;  2Q9I A;  1RTU A;  1OZH A;  2KF6 A;  3QWO C;  1N73 B;  4XDV A;  2OOV A;  1K04 A;  2HOD B;  1FC2 C;  2OYH A;  2FXT A;  1Y9B A;  1AV4 A;  2BCC D;  1XTC C;  3GW6 A;  3L71 J;  3FG4 A;  3NM7 A;  1SFC B;  2HMM B;  2H0G A;  3EBT A;  1BIR A;  3N9H A;  3CC2 3;  2LXC B;  2N1T B;  1GTW A;  2XKM A;  2POH A;  3AE1 C;  3WOE B;  3CMA 3;  5CJ0 A;  3HE4 A;  2W9Q A;  1I0V A;  3AE9 C;  1N7L A;  4H44 B;  3BCC D;  3T0U A;  3CCQ 3;  1PU4 A;  1B3S A;  3A5T A;  3VP8 A;  1X8Y A;  1RGG A;  1QL2 A;  2I1J A;  2A15 A;  1BNG A;  2OGU A;  2XSO B;  3CCM 3;  1GD4 A;  5TGN A;  3N7N A;  3TSI A;  2XNX A;  3CCV 3;  3VMZ A;  3WUV A;  1Q7Y Q;  1L4A B;  5KAI H;  1KIL D;  3WOF B;  1NTK D;  2XSH B;  3H1J E;  2OYI C;  2FYZ A;  3R4Y A;  2CWT A;  2P2U A;  5APT A;  2QG4 A;  3S5C A;  1BSB A;  1YGW A;  1A2V A;  1JTH B;  2V7Q H;  4OGQ B;  1YIJ P;  3L73 D;  1MFZ A;  5FW5 A;  3AE7 C;  1FGQ A;  1C54 A;  3CMA P;  1PP9 E;  1PZQ A;  1NWQ A;  3IN6 A;  2INX A;  5APV A;  1ZGX A;  2JKV A;  2YKP A;  1U7M A;  2AXC A;  3G16 A;  1H0T A;  4L74 A;  3CCQ P;  4FMC A;  4MMX B;  3B4S A;  2K9J B;  1GW3 A;  3Q3F A;  1M1K Q;  2XND H;  4EC6 A;  3CCE 3;  1W4N A;  4EV5 A;  3MGN A;  1PGP A;  1FZF A;  2SBL A;  3JUP A;  3FXD A;  5ELJ A;  1KD1 Q;  1OH0 A;  1AQ5 A;  3CCV P;  1VQ9 3;  4I6M C;  3MG1 A;  5DRE A;  1N7S A;  3HX8 A;  2N9Y B;  4JYC A;  4Y99 B;  2V7Q J;  3LT9 A;  3VSY A;  4GOE A;  2YIU C;  3OWY A;  3U1C A;  2F4Y A;  2SAR A;  4L7K A;  4BL3 A;  2ZAE B;  1W2B 2;  2R41 A;  4WWU C;  5IG5 A;  1FZU A;  1IFM A;  4HB1 A;  3UIA A;  4D6T E;  1FOS E;  3LTD A;  1VZZ A;  1Z56 A;  1EQ7 A;  5AW8 B;  1RQU A;  1NAY A;  3X3Z A;  3CME 3;  2PAJ A;  5AEU B;  1LTJ C;  4K90 B;  2Q3I A;  3BNC A;  3CCE P;  2PNC A;  1QX8 A;  1PV3 A;  2HYN A;  1VQO 3;  3B8E B;  2ITA A;  1VQ9 P;  2WGO A;  2XR8 B;  2KNC B;  1GZL A;  1HZ1 A;  3JUN A;  1B2X A;  5KJ7 A;  3FLJ A;  2W6A A;  3M0D C;  2Q3E A;  1VF5 B;  4GSP A;  3CC7 P;  1SQV E;  1WMO A;  1YNV X;  5GTI E;  1GU4 A;  2BO9 B;  4AEQ A;  2FFD C;  1AVL A;  1N5P A;  4ZMD A;  3K7C A;  1SQX J;  2YFJ B;  1YHQ 3;  1KC8 Q;  3G3Z A;  2P05 A;  2GEX A;  3EBY A;  2BMR B;  1DD3 A;  1VQL P;  3CME P;  1I2F A;  1KYO D;  1FDO A;  4NHF A;  1CYU A;  2ZVN B;  2OTJ P;  3F8H A;  4FMA A;  3CI9 A;  2BCC E;  3HUS A;  1EA2 A;  3AEF C;  1AVO A;  1RF0 C;  3FWL A;  3H1I D;  1NOH A;  3H1L D;  1FS0 E;  4HM8 B;  1DEE G;  1VQN P;  3TGU D;  1RE3 A;  5APX A;  3WHO A;  1IFP A;  1TP6 A;  3IJE B;  4YXD C;  4I1L A;  2KIK A;  1FZG A;  3MD0 A;  1TIJ A;  2I8D A;  2BEZ F;  1NTM D;  3EN8 A;  5D83 A;  1IK7 A;  4XBT A;  1CI6 B;  1O7H B;  2B24 B;  2ZT9 C;  1LWU A;  1HVV A;  1LTS C;  4JRF A;  3A3Y B;  4OVM A;  1UDI I;  4EOT A;  1A2K A;  4HM2 B;  1BGY J;  5I97 A;  1S5L E;  3AE3 C;  1FGM A;  3OWU A;  2KI7 B;  4WYK B;  3MUD C;  3CCS P;  3MPH A;  4IL6 E;  1NTK E;  1KZU B;  4STD A;  1UGH I;  1KIL A;  4K1U A;  3SX1 A;  2OYO A;  3L71 G;  3K0Z A;  3CWB D;  5BU5 A;  2Y9Z A;  2KSE A;  1T2K C;  1UCJ A;  4K1V A;  4X2H A;  5JPU A;  3VMX A;  1VQ6 3;  1W2E A;  3L73 E;  3KPE A;  1Q86 4;  3AEG C;  2B1X B;  1NU1 K;  1DE3 A;  1PPJ D;  1EUI C;  4I7Z C;  1N9E A;  3O8Y A;  2P0M A;  1GL2 C;  2XDJ A;  3MYT A;  1LP1 A;  1SQQ E;  4K3A A;  2CPB A;  3H1J J;  2P7J A;  3T8N A;  2QJK C;  2QJY C;  1MWS A;  3QH9 A;  1JOC A;  1IVX A;  3EQ2 A;  2OYH B;  5IG0 A;  3RL0 g;  3FF0 A;  5GSP A;  7GSP A;  3RK3 E;  1RMS A;  1PP9 J;  1TUH A;  1BRI A;  1TU5 A;  2ZT9 D;  3IAO A;  1UCK A;  1EZV G;  3Q5R A;  1SAR A;  5M1B A;  4MJD A;  5APS A;  3KN4 A;  2W9P A;  1VQ6 P;  3LTA A;  3BLZ A;  2RN0 A;  1X1X A;  5KP1 A;  3L70 J;  3EN1 B;  5RNT A;  3H32 A;  2MJZ A;  1KTM A;  4LZI A;  1EDI A;  1BDC A;  1BVI A;  1IQY A;  1BSD A;  2CH9 A;  3VMY A;  2YFI B;  1KQS 2;  1YBK A;  1N8R 4;  4DOJ A;  5CBO A;  2OYI A;  1S4X A;  1H8A A;  1RN1 A;  4PJ0 H;  1T2K D;  1RDS A;  3EJV A;  1LT9 C;  4U3F J;  1SQP D;  4NPD A;  1RKY A;  4DT0 A;  1GK4 A;  1MWT A;  4DZO A;  2NPS B;  2K0M A;  3NBR A;  2UX0 A;  1O7W B;  2R3C A;  3T8U A;  2K9Y A;  3WA3 A;  1F8N A;  1NB5 I;  1NU1 J;  3OWS A;  3NUV A;  5GTI H;  3L74 D;  5KAF E;  5AW5 B;  2CX1 A;  3X41 A;  1NKZ B;  2HMK B;  2ZL8 A;  5JBS A;  1G96 A;  3O6Q A;  1W2B O;  3A5E A;  4HJG H;  1BRG A;  3SXX A;  4IFD K;  1CSB A;  3X42 A;  2WMM A;  1X9V A;  1H0T B;  2M3E A;  3VF1 A;  1BRN L;  1DMQ A;  2YO2 A;  3C8V A;  1HH0 A;  1D6Z A;  2W27 A;  1KYO E;  4N3V A;  3HOH A;  2C4B A;  3SVA A;  5EVH A;  1UCI A;  3S67 A;  3WU2 E;  2H0I A;  3H1L E;  3NM2 A;  3WR2 A;  2P0X A;  2RMZ A;  1SQV J;  3KSP A;  1S5A A;  3AE4 C;  2WO0 A;  1QAK A;  1OX3 A;  3HD7 C;  3CXH D;  4GHO A;  2JJL A;  2FY8 A;  2YXQ B;  1U8C B;  4WBA A;  4HBR A;  2WZ7 A;  1RGA A;  1S3J A;  1JY3 O;  3FF2 A;  1NJI 4;  1LJ2 A;  2KOG A;  3KII A;  4HAA A;  1LTJ A;  2XZR A;  3BND A;  1NTZ D;  2YKO A;  1SQX G;  2MF7 A;  4JYB A;  4I4K A;  1BCC D;  1S5L H;  2BCC J;  2MKV A;  2CFL A;  4N6M A;  1C7H A;  3H3H A;  1RE4 A;  4IL6 H;  3HE5 B;  3MG2 A;  3DUK A;  1BSH A;  3W68 A;  1RGF A;  1T3U A;  3M0D A;  1IVU A;  2RFR A;  3L71 E;  3B4O A;  2K37 A;  5EQL A;  1NO3 A;  3WA2 X;  3BCC J;  1FGO A;  4IL6 X;  1L0L D;  3GHG A;  1VQ4 3;  3KXD A;  2ZYD A;  2G3A A;  1LTB C;  1FU1 A;  3O8Z A;  2C0W A;  2F99 A;  2KYV A;  4WVZ A;  1FJK A;  4OK0 A;  2ML6 A;  1IFI A;  3S27 A;  4XA4 A;  1NTK J;  1QVG O;  1JUN A;  3NHX A;  4RNY A;  1RF0 A;  4JF8 A;  2P38 A;  4IT7 A;  2D2C C;  2WSC H;  3HD7 D;  1BGY G;  1I8V A;  2E2T A;  3CXC 2;  4GOF A;  2H8P D;  3L73 J;  4KZ1 A;  2KLV A;  3OW2 2;  1LTI C;  1EDK A;  1EZV E;  1I2G A;  2YXR B;  3FX0 A;  3BVH A;  4B86 A;  1GK6 A;  1V58 A;  2J5U A;  3NV0 A;  1JNM A;  1A2P A;  3MKI A;  2LR2 A;  1VQ4 P;  2A45 G;  3A76 A;  2H7H A;  1SQQ J;  5BVZ A;  3F7X A;  3N8B A;  1KFM A;  1VL2 A;  3LW5 H;  4WY4 D;  4A7P A;  1OVU A;  3GZY B;  3MUD A;  3TDG A;  4BTX A;  2DW3 A;  3PH0 A;  4FCJ A;  2LYX A;  1FZA A;  1LXE A;  1BNF A;  2WSE H;  3CCL 3;  2FYN B;  3E1I A;  3CX5 E;  4NRE A;  3CCR 3;  3P8M C;  5BVB A;  3Q1M A;  4GT1 A;  3BNE A;  3GMA A;  3UL6 A;  3P8C D;  4IFF A;  4NPF X;  1IT7 A;  2GBW B;  5KAF H;  4G1M B;  1JZO A;  1S72 3;  1TFK A;  1PL5 A;  3DGO A;  1RH5 B;  3RDE A;  1USE A;  1NTM K;  4OWF A;  3CCU P;  1NVO A;  1Q90 D;  3V99 A;  3KSE D;  2C9L Y;  3AEB C;  1S9K E;  1NYH A;  2D2C D;  3LW5 J;  5IF6 A;  1LTG C;  3L72 D;  1K9M 4;  1KB9 E;  1RQV A;  4YPC A;  3L70 G;  4R4K A;  5CHX A;  1HTL C;  5APW A;  3L4F A;  1QAF A;  3NXS A;  4KVH A;  1GD2 E;  1KYO H;  3DMC A;  3AGO A;  5D81 A;  2WSE J;  2B87 A;  1GOY A;  3A0B E;  1KQS O;  1X22 A;  4U3F G;  3WU2 H;  2WIT A;  4HM5 B;  4KT3 B;  3CCL P;  5AVV B;  3CCR P;  3RK2 D;  3FG3 A;  4DCK A;  1FBM A;  3M9B A;  5AVY B;  1OF5 A;  2Z7A A;  2RKL A;  1DEB A;  1ZRT D;  2B89 A;  5APU A;  2L4V A;  1NU1 G;  4N6T A;  2BEQ D;  2AAE A;  3RK3 B;  1S72 P;  1R8E A;  4N3Y B;  1NHL A;  4CDL A;  5IER A;  1MWR A;  2XRX B;  1BSC A;  3JSV C;  3LH4 A;  1AR0 A;  2KRT A;  3H32 B;  5M1A A;  4C7N A;  1G1J A;  2GU1 A;  1JB5 A;  3Q5P A;  3H1I J;  1SVF A;  3H1L J;  3D5G A;  1EXI A;  1OXZ A;  1SQB K;  3TGU J;  1ZOY C;  4WB4 A;  1AV1 A;  1LOV A;  1YI2 P;  1RGC A;  1GSP A;  1LQM B;  3CD6 3;  3GG2 A;  3LTB A;  2GUV A;  4I2L C;  1NTM J;  5AVS B;  1SQV G;  4BTW A;  2W83 C;  1DET A;  2JWD A;  3B5N C;  3V92 A;  1JN5 A;  1YQ4 C;  3EHC A;  1IV7 A;  1M57 D;  1VQM P;  4K35 A;  1AVK A;  1M8O B;  3K5B A;  4H13 C;  3O6Q B;  1OW6 A;  4J8T A;  4XBX A;  1SQW A;  2WT7 A;  1IZN B;  5AVU B;  1JKG B;  3ZG5 A;  4HVN A;  2JQ5 A;  2BCC G;  3MSO A;  1BGY E;  4UB6 H;  3E1R A;  1YIJ 3;  1SQP K;  2Y0E A;  3CWB J;  1YTZ T;  3HD7 A;  1J1D C;  3PCR A;  5KLI B;  6STD A;  2YIU B;  3ZDM A;  3CD6 P;  3DGM A;  3AGN A;  1EZV I;  2IMJ A;  3BCC G;  2KK7 A;  1V57 A;  3KQG A;  1W02 A;  2L5G B;  3FCS B;  1H88 A;  3M9Q A;  2E43 A;  1ZR4 A;  2O3J A;  2GUS A;  3W67 A;  2HPC A;  1J1E B;  3H1K D;  1LRA A;  3RNT A;  1JEK A;  3H6P A;  1Q40 A;  1T5Y A;  4CJN A;  1PY3 A;  1QGK B;  1IT8 A;  1HGV A;  2CG1 A;  4C7R A;  4WY4 A;  4HJL B;  2E74 C;  1NTK G;  3EC9 A;  3I55 P;  4QMA A;  3CX5 H;  5BXQ A;  1URQ C;  1NDO B;  5EFW B;  1PFI A;  3CX5 I;  1E79 H;  2FYU D;  2KZI A;  1K28 A;  3FGA D;  2CWV A;  1YJ9 3;  3L73 G;  5AVT B;  1VQ8 P;  1RGE A;  2P58 A;  4NPE A;  3L75 E;  3NBB A;  1P84 E;  3BAT A;  1ASK A;  4H13 D;  3CC4 3;  5APQ A;  1DX7 A;  3OW2 O;  4LC1 A;  4CCV A;  3EB8 A;  1RLS A;  3GHG B;  1KB9 H;  1ZS7 A;  2MC8 A;  2Z76 A;  1KB9 I;  2AAD A;  3L70 E;  1SQQ G;  1LGH B;  4FCZ A;  1NTZ K;  1RJO A;  4H0L C;  2GSP A;  3N4X A;  2I1K A;  1KV4 A;  4RBN A;  3D3L A;  1IV9 A;  3A0B H;  4GKG A;  1A90 A;  4O3V A;  1WRG A;  4U3F E;  4PV1 B;  1N73 C;  3CC7 3;  4H3U A;  3L74 J;  1YJ9 P;  3L37 A;  5B5E E;  1NU1 E;  1L0L K;  1ZRT E;  1GU5 A;  3CC4 P;  1W01 A;  3H1H D;  1SFC C;  1IK9 A;  1YJW 3;  2GEY A;  6GSP A;  2N1T C;  1FZC B;  1VQL 3;  2RH0 A;  4H44 C;  3IMA B;  5KP4 A;  2OTJ 3;  2BMO B;  3JVC A;  4DJG A;  2M8R A;  4PJ0 E;  1N86 A;  5E79 H;  1VQN 3;  2J8X B;  5JPP A;  4XDW A;  5G2G A;  2Y0D A;  3T97 A;  1JB4 A;  2KXP B;  1L5G B;  2HMN B;  3Q90 A;  3PS8 A;  1FYS A;  4N6U A;  2QRX A;  4PD4 D;  2KF4 A;  2IBZ D;  1L4A C;  2E76 B;  3LOY A;  1RHZ B;  3JUM A;  1R5L A;  4R9L A;  4N6J A;  3WMD A;  1FOS F;  4H0L D;  1G0T A;  1RN4 A;  4ZNC A;  2A06 E;  4L8P A;  4OGQ C;  1NTZ J;  1YJW P;  1Q81 Q;  3M06 A;  1MOL A;  4RJT A;  1BCC J;  2D42 A;  5CJ4 A;  1CQS A;  4JQ0 D;  1I70 A;  3BB9 A;  4LEH A;  2F5M A;  3KCH A;  3CCS 3;  3IPT A;  1GMQ A;  5AIH A;  4H61 A;  3CLQ A;  2WOF A;  1Q7H A;  4HYZ A;  2JR8 A;  2HLO A;  3Q1C A;  2XGL A;  4U13 A;  2OTK E;  3H1I G;  3H1L G;  1HU9 A;  3NX0 A;  1HGZ A;  1SFC D;  3EWK A;  3OA7 A;  3TGU G;  1V74 A;  2E5T A;  1K41 A;  3F9S A;  2RCD A;  2N1T D;  4GL6 A;  1L0L J;  1OGZ A;  2W2C A;  2UUG C;  3M9H A;  3BCC E;  1NTM G;  3FG1 A;  4Y99 C;  3OX9 A;  2G8Y A;  3V4W A;  2A45 H;  1FDI A;  1OF5 B;  1BSN A;  2A45 I;  1QVG 2;  2KS1 A;  4ZKU A;  1X79 B;  3GAX A;  2QJP B;  2IDB A;  4FCM A;  1TRQ A;  3VYI A;  3DGN A;  1VPC A;  2CHC A;  3BU4 A;  1W00 A;  1E5W A;  3RBZ A;  3F14 A;  1KIL E;  1L4A D;  1DVC A;  5TIS E;  3LIE A;  2XH9 A;  1NKN A;  4C7N B;  2M5A A;  2K1A A;  3MZW B;  1FE6 A;  5D82 A;  4BU4 A;  2QA4 P;  1TFO A;  1KWI A;  3CWB G;  1Q7Y 4;  4OGQ D;  1BRS A;  1P84 H;  5KLV D;  1EQK A;  1N5H A;  1Y47 A;  1P84 I;  1CYV A;  5AW7 B;  1G02 A;  2Z5I A;  1U7J A;  1PPJ G;  3V4Q A;  5G1K A;  2HG5 D;  3ROB A;  4EW5 A;  4AYC A;  2Q6Q A;  3CPW 2;  5AI1 A;  4BRY B;  1NWW A;  3SOY A;  1SII A;  4C46 A;  3KKG A;  3SWY A;  3DGL A;  1GY6 A;  3V5B A;  1VQQ A;  3G4S 3;  1Y8A A;  1PIX A;  4O2H A;  1KQF B;  1SQB D;  3GZR A;  4L8O A;  3AHW A;  2CG0 A;  1US1 A;  2K88 A;  1OWA A;  2WT7 B;  4U7J A;  2ZHX B;  1M1K 4;  3L75 J;  3C9I A;  1IFN A;  1IU7 A;  1I3I A;  1KD1 4;  1FUS A;  1OVV A;  2GBX B;  5B5E H;  3G8Z A;  2R5D A;  2GXF A;  2WVR A;  1ZXG A;  3HE4 B;  3E99 A;  1JY2 O;  3L72 J;  5DJU B;  3AE6 C;  3H1H E;  5CCH C;  3HRN A;  5AW2 B;  2R32 A;  1X1U A;  4EYC A;  2R4I A;  2ZFC A;  1A02 J;  2WGQ A;  3QRD A;  1X0T A;  4YXW H;  3M91 A;  1IQX A;  2JDI H;  1ZX2 A;  2CIU A;  5AYS C;  2E2U A;  9RNT A;  2HPC B;  2Q7C A;  1QVF O;  1SS1 A;  3OJA B;  3G4S P;  1URQ A;  3D4A A;  1OW7 A;  1SQP G;  1CEW I;  1YQ3 C;  1JM0 A;  3Q3D A;  1RNB A;  4WY4 B;  3A7O A;  4XFJ A;  2O01 N;  5KKZ B;  1BSE A;  1ZME C;  2QIW A;  1BUQ A;  1GL2 D;  2ZJS E;  2W8Z A;  1NAF A;  4Q53 A;  2ZYA A;  5DJT B;  2CPS A;  4HM1 B;  3L74 G;  1PGQ A;  3AE5 C;  1JB2 A;  1ROV A;  1BE3 D;  3SYU A;  1TTO A;  1VDF A;  1T2H A;  1UUW B;  1BNS A;  3SFD C;  3Q2Y A;  3LT8 A;  3IF4 A;  1HYF A;  2C0X A;  2V4H A;  5AVR B;  5AEW B;  1W6Y A;  3UNL A;  2OWP A;  3BIR A;  2E5Y A;  3GLM A;  3JCU H;  5GTH E;  2HMO B;  3G9R A;  1YYC A;  3NTN A;  1O7G B;  1FGR A;  1K73 Q;  1N73 A;  1MWU A;  1KC8 4;  1OGX A;  3WDG B;  3H1I E;  4HKV B;  2QEX P;  1N7S B;  3A0H E;  2PRR A;  3TGU E;  1RHL A;  1DYU A;  1BDD A;  5CCH D;  2CKF B;  1U57 A;  2FYU K;  1OW8 A;  3G6E P;  5K5G B;  1W2Z A;  3D6Y A;  1SFC A;  1IQ8 A;  2WSS H;  1OPY A;  1EC5 A;  1EKM A;  1UCL A;  1NTM E;  2N1T A;  1T3J A;  1HJB A;  3VN0 A;  3UB1 A;  4JBZ A;  1HJ0 A;  2CX0 A;  5IEN A;  5CK6 A;  3RK2 B;  4RZM A;  3F89 A;  1NTZ G;  1L0N D;  5H2F E;  1RRL A;  1D7M A;  2FNQ A;  1BCC G;  1JO5 A;  1TJD A;  3OV4 A;  5TIS H;  3GSP A;  3RL0 B;  1QMA A;  8CHO A;  3KHU A;  2KF3 A;  1L4A A;  2KZJ A;  2YO3 A;  1SQX D;  2W04 A;  1D6Y A;  3D6Z A;  1UGI A;  3CWB E;  5IEP A;  1I0X A;  1S5L X;  4Y28 J;  3JUQ A;  2FFD A;  3VTP C;  3X40 A;  4XB5 A;  1GYB A;  5AYR B;  1B20 A;  1JTH A;  1T2I A;  1L0L G;  3BRT B;  1LQG C;  3SED A;  1AQZ A;  1MZ9 A;  2IY2 A;  4EI2 A;  3GF7 A;  2OTL P;  2NPS C;  3DH2 A;  1PPJ E;  3H1K J;  5CCG C;  2XU6 A;  3V2R A;  3PGB A;  3WUT A;  2W6B A;  4CPG A;  3V6I A;  1KN7 A;  1GOV A;  3EQQ B;  3ZG0 A;  1J2B A;  2K9J A;  1AJY A;  1KQG B;  3SFE C;  2H43 A;  1EXJ A;  3V98 A;  1SQB E;  4UB6 E;  5LC6 A;  5KTB A;  4N78 D;  3PRJ A;  1BNJ A;  4KJM A;  2KAA A;  4R80 A;  2AEM A;  4TLF A;  3HUS B;  1FZB A;  2P67 A;  3MHE A;  1ROA A;  3EF8 A;  2CFW A;  1QL1 A;  1GMR A;  5BIR A;  2XF3 A;  1Q82 Q;  2HFE D;  3CCU 3;  3KE7 A;  4HYT B;  4HH2 A;  4HOH A;  4R9K A;  4LGQ A;  2YFL B;  2J59 M;  5B66 E;  4RNZ A;  1ZR2 A;  1UW1 A;  3D5I A;  5AW6 B;  1I2E A;  3LZA A;  2CW9 A;  1LWU B;  3HK4 A;  1QAL A;  1IFD A;  1GOU A;  5AW1 B;  1MKM A;  5LC7 A;  3CPW O;  1KOR A;  3U59 A;  3CU3 A;  1DH3 A;  1FUW A;  2Q07 A;  1SQP E;  3NBJ A;  5BU8 B;  4MEI A;  2IYO A;  1JBR A;  2QGU A;  1B2U A;  4R4L A;  5CBN A;  3DXO A;  4J5K A;  2OAR A;  1KIL B;  5CCG D;  3L75 G;  2M5A B;  3P32 A;  2KNC A;  2JWA A;  4AUW A;  3H1J D;  3H1H J;  1R5S A;  3L74 E;  4MMZ B;  2NZ2 A;  3FZW A;  1GL2 A;  1YIT P;  2BNG A;  2BIR A;  1LNH A;  3GF3 A;  3PYJ A;  3PXM A;  4RNT A;  2GM4 A;  2UWJ E;  3F7S A;  4HM4 B;  3L72 G;  2NRG A;  1PP9 D;  1RGK A;  5KJ7 C;  2QM8 A;  1E97 A;  1UUG B;  1Y4K A;  5GTH H;  3HZP A;  1KYO I;  1GY5 A;  1LP1 B;  1BAN A;  3KFQ C;  2OQE C;  1OHS A;  4HZ9 B;  4LMI A;  1YI2 3;  2R3S A;  1BRH A;  1K05 A;  3N54 B;  3A0H H;  1G2C A;  3U1A A;  3PZW A;  1D6U A;  2KB7 P;  2WSF H;  1O7N B;  3SLU A;  4NPB A;  3CXH E;  3DGY A;  2ZXX A;  5KLV K;  1HF9 A;  5HOH A;  1BSA A;  3QK9 A;  2IX7 C;  5CCH A;  1RF1 C;  1MV8 A;  1HBW A;  1VQM 3;  2ZDJ A;  3FH1 A;  2Z5H A;  1CZQ A;  3HI7 A;  1ZW0 A;  3MG3 A;  5H2F H;  5DRV A;  1LT9 A;  1NTZ E;  3PCS A;  1CI6 A;  3HTK A;  1NH4 A;  1BCC E;  3AHS A;  4D6T D;  5CXO A;  1LT1 A;  5E79 E;  5KP3 A;  2KCD A;  1M1J C;  1FW7 A;  2OYI B;  1LVN A;  1ULI B;  2WSF J;  3D70 A;  3RGA A;  4BTY A;  3D71 A;  4L76 A;  1IVW A;  3L35 A;  2HR3 A;  1BOX A;  1OFC X;  5AW4 B;  1OIP A;  2XEP A;  2FXM A;  2QE7 H;  2PGD A;  3J7Y d;  1L0L E;  1IK3 A;  2K3D A;  3AE2 C;  2A06 G;  2FYN C;  3BAS A;  1ISK A;  1WMK A;  1QEX A;  2E75 C;  1ZLL A;  2B88 A;  3K5T A;  3KZT A;  2ZXE B;  2WTY A;  1SQV D;  1GW4 A;  4N6V 0;  3I55 3;  1UII A;  1KSI A;  1YVS A;  2FKW B;  1GD3 A;  1FJP A;  4JF7 A;  2KXG A;  4WP5 A;  1RCL A;  4KFD A;  1K8A Q;  1VQ8 3;  3CPO A;  4N78 E;  1RCK A;  5KLV J;  1PYL A;  3F8X A;  1YTZ I;  8RNT A;  1OUN A;  1WMN A;  3V2P A;  2YNY A;  3NMD A;  2F86 B;  2WQY C;  5B66 H;  1AFO A;  4KFE A;  4CPK A;  2YX9 A;  4DKI A;  1RSN A;  2PZV A;  3X3X A;  1R4Y A;  3TNU A;  3H1K G;  1U5O A;  1Q82 4;  1GS3 A;  3G71 P;  3FKA A;  1LTJ B;  1SQB J;  4LSO A;  3RK3 C;  4IFM A;  3CNX A;  3U97 A;  1MFT A;  1H89 A;  2GA1 A;  4TT3 H;  4UB8 E;  3NXJ A;  2WPR A;  3B5N D;  3TK1 A;  1Q42 A;  2CK3 H;  4ZKP A;  1W6C A;  1EG9 B;  1M90 Q;  2IZ0 A;  2FYU G;  3IFM A;  3I5C A;  3PLN A;  1RGL A;  3P8C E;  2E75 D;  2BAS A;  2QVA A;  3RGR A;  4O8S A;  2NPS A;  1OAC A;  5CCG A;  3F40 A;  1Q86 Q;  4WHA A;  1LOW A;  2FFD B;  3ZFZ A;  3GWR A;  2LQV A;  1BU4 A;  1QVF 2;  2FBW C;  3PTZ A;  1ZV8 A;  3L72 E;  3CC2 P;  3VGN A;  4J5G A;  1IJD B;  4GOD A;  1UIX A;  1L0N K;  4BXL A;  1SQP J;  2E42 A;  1YJN 3;  4KT0 J;  2L1S A;  2O3O A;  4QWT A;  4OUQ A;  4O9B A;  7STD A;  1ZO2 A;  2M7O A;  4OVN F;  3SSU A;  2KLU A;  5A0O B;  3MTU E;  4X2O A;  1SQQ D;  3LML A;  1SQX K;  3CCM P;  1MNL A;  3CXH H;  2V1L A;  4ILF A;  4N6L A;  3CXH I;  2JO1 A;  1BE3 J;  2W03 A;  1MGR A;  3GZB A;  4KHX A;  2BU4 A;  3KDP B;  3RK3 D;  3M8C A;  3H1H G;  2KUB A;  2E74 D;  2ZT9 B;  1MUU A;  3PP5 A;  3NV0 B;  1IFJ A;  5KLI C;  2Y9Y A;  1AY7 A;  2KSJ A;  3X3Y A;  3TYY A;  1URQ D;  2KF5 A;  5CMZ A;  1A02 F;  2P1J A;  3AMO A;  4WFO A;  1EDL A;  3CNM A;  4BL2 A;  1SP4 A;  2RBI A;  3VP9 A;  1JV2 B;  1N8R Q;  1EDJ A;  1YJN P;  1JB0 J;  2Y73 A;  1AVY A;  3S4R A;  1VQK 3;  1J1E C;  2O1K A;  2Q1K A;  1LTT C;  2N9B A;  3F5H A;  3V2N A;  1B27 A;  1KMI Z;  2CC3 A;  5IG4 A;  5ELU A;  3HE5 A;  5BU4 A;  3D9R A;  3FWN A;  3K9M C;  2IBZ G;  2AXT H;  4ASV A;  1IDP A;  1KFN A;  2O1J A;  2RGQ A;  4FR9 A;  2CWU A;  3HIG A;  4HM7 B;  3ITK A;  2H0H A;  3DZL A;  5IEO A;  1LTA C;  2R5B A;  1RE4 C;  2IUK A;  4I7Z B;  3EX9 A;  1STF I;  2W6J H;  1L0N J;  1GL2 B;  3AEA C;  4RO0 A;  1JZD A;  2OQE A;  2W56 A;  3KYQ A;  3JCU E;  1KQL A;  2QJK B;  4L75 A;  2QJY B;  1GY7 A;  1B2Z A;  2QA4 3;  3GHG C;  1TRP A;  4M3L A;  1VQP 3;  2K54 A;  1PFP A;  2B87 B;  3URP A;  3D79 A;  1VQK P;  2XFT A;  2L91 A;  1DD4 A;  4OH8 B;  1RF1 A;  3FGY A;  5L8R J;  1G2C B;  4H44 D;  4W80 A;  4Z1M H;  1WMP A;  5C39 A;  2BT3 A;  1B21 A;  1VQO P;  1K8A 4;  2YMK A;  2FGT A;  4XE5 B;  4EYY Q;  4PV1 C;  2Y74 A;  5CF1 A;  1NJI Q;  1FUT A;  1E3V A;  1TU3 F;  2RSX A;  5FGO A;  3H1K E;  5HGR A;  4EBG A;  2QSI A;  1M1J A;  1BNI A;  1STD A;  3H51 A;  3KZI E;  2HML B;  1OVR A;  1B2M A;  2Z4E A;  3H25 A;  2QIY A;  4UB8 H;  1LT9 B;  2WWW A;  3HTK B;  4BIR A;  1FZC C;  1VQP P;  3G0K A;  1SPU A;  2BHM A;  3K63 A;  3IR9 A;  4AQR D;  2FYU E;  1YHQ P;  1FGT A;  3B5N A;  3L36 A;  2M3B A;  2K3R A;  1WNH A;  3AED C;  2B9B A;  5KLV G;  5AW0 B;  2P10 A;  1L2P A;  5AVQ B;  1GMJ A;  2XGN A;  1BAO A;  3GZX B;  3Q2P A;  1JBT A;  1W5C E;  3U1W A;  3AE8 C;  1BNR A;  2R44 A;  4LYL B;  3L71 D;  1LNQ A;  1W5Z A;  1M90 4;  2LXB A;  4RKU J;  1DMN A;  2Y0C A;  1UUV B;  1VQ5 3;  1VF5 C;  4R1K A;  2E76 C;  1JN5 B;  2H88 C;  5IW9 A;  1CH0 A;  2P09 A;  4EXR A;  2BMQ B;  3BNB A;  1SQB G;  2QM7 A;  4IPB A;  1AQT A;  3JUO A;  2F98 A;  1MGW A;  4WWI A;  3R2P A;  4HM0 B;  3TF5 A;  1JY2 P;  1LOY A;  1IYY A;  4PV1 D;  2CFG A;  1N9J A;  3HD7 B;  1O7M B;  3VOP A;  2IFM A;  1Q2N A;  4BWN A;  1DIP A;  1HUC A;  4W7Z A;  1EEJ A;  5APY A;  1X1Y A;  3NQY A;  3I0Y A;  3L0R A;  1S2E A;  1EZV D;  1VQ5 P;  3B7C A;  5STD A;  3OXA A;  1SQV K;  4ASW A;  3TNU B;  4IIA A;  1Q40 B;  2Z77 A;  3ECF A;  1T6A A;  2QEX 3;  2YMY A;  2IYJ A;  1RRH A;  2QJP C;  2CFK A;  3ABV C;  3G6E 3;  2C10 A;  4XBY A;  5TJH A;  1ZN5 A;  4PD4 E;  2Q5U A;  2C9N Y;  1VF5 D;  2IBZ E;  2E76 D;  5CLK A;  4MN4 C;  4RES B;  1RGH A;  1OHP A;  3VMA A;  3S29 A;  5EEO A;  1BE3 G;  3CX5 D;  5AVX B;  3A2A A;  1OCV A;  3RGU A;  2OCT A;  2IFN A;  5G1L A;  1UI7 A;  4FMD A;  1PGJ A;  1K9M Q;  2F5W A;  3NQZ A;  1ULJ B;  2IA7 A;  4D6T J;  1WT6 A;  2JP3 A;  2D2C B;  1S9K D;  3B71 A;  3FXE A;  2HOD A;  1Q81 4;  1RY3 A;  1KB9 D;  1JNQ A;  1PGO A;  1JKG A;  3EFF K;  1Q9E A;  3CCJ 3;  1JJ2 2;  1JY3 P;  1OMI A;  3PHL A;  1DVD A;  3OAK A;  1RN7 A;  4ZM8 A;  3DM8 A;  2ML5 A;  3EE1 A;  2OTL 3;  2OOV C;  2OYH C;  2M0B A;  4MMY B;  3SWK A;  3MHV A;  1NTK K;  6RNT A;  3AEC C;  4ORL A;  3ALA A;  3UJM A;  1NGM B;  2AEJ A;  1A67 A;  1LOX A;  1L0N G;  3Q5S A;  2I9W A;  1JCC A;  3KZI H;  2YKQ A;  4LGD E;  1VQ7 3;  5AW3 B;  3USS A;  4JPZ B;  1SIH A;  3DY5 A;  4XM4 A;  1FDM A;  3AMO B;  3HII A;  3S9O A;  3UL5 A;  1HKX A;  1JBS A;  4PEJ A;  1SQQ K;  3T97 B;  2WPQ A;  3CCJ P;  2F56 A;  1JY2 N;  5KLV E;  1DMM A;  1UI8 A;  1NU3 A;  1M9G A;  3STD A;  3B4P A;  4WY4 C;  1JRQ A;  1SLQ A;  7RNT A;  5KKZ C;  1FA3 A;  3ER7 A;  4FMB A;  2C11 A;  2STD A;  2HMJ B;  4R4M A;  1YVB I;  4O02 B;  2IPP A;  1N8Q A;  3S28 A;  1NNV A;  1E3R A;  1S1C X;  1VQ7 P;  2FXP A;  2UGI A;  2W56 B;  2FYU J;  4LLH A;  3I56 3;  4L73 A;  2LKM A;  4GIF A;  4IOI H;  2W0Q A;  4HM3 B;  4HM6 B;  2H89 C;  1BGY D;  3PJS K;  1YIT 3;  5AII A;  1RF1 B;  1M7L A;  1N7S C;  3B8L A;  3AEE C;  2XV5 A;  4YTP C;  1W6G A;  3SWF A;  2O01 H;  4HZB B;  2KS1 B;  4J9A A;  3BRV B;  3E7K A;  4N6N B;  2CFD A;  3LTC A;  1FZC A;  3CL3 D;  1WTH A;  3MP7 B;  1IO4 A;  2Z6B A;  1AA0 A;  1M1J B;  1BRJ A;  3RK2 C;  5IG3 A;  3MIW A;  2NPS D;  3C1L A;  3I56 P;  1RNT A;  3WOD G;  4PD4 H;  4GDO A;  5CF2 A;  2XFS A;  4PD4 I;  2WSC J;  3NFQ A;  1M1X B;  2D1W A;  1BNE A;  1JY3 N;  2IBZ I;  2W90 A;  5KAI E;  2IUJ A;  3LID A;  3RL0 C;  3II6 A; 
#chains in the Genus database with same CATH homology
 1K41 A;  3F9S A;  4LSO A;  2RCD A;  3CNX A;  4GL6 A;  4GB5 A;  3SXX A;  3U97 A;  1OGZ A;  2W2C A;  3X42 A;  3VF1 A;  1DMQ A;  2E2V A;  3FG1 A;  3NXJ A;  3OX9 A;  1Q42 A;  1OF5 B;  2CK3 H;  1D6Z A;  1BSN A;  1W6C A;  1EG9 B;  4N3V A;  1QVG 2;  3SVA A;  3GAX A;  5EVH A;  4FCM A;  3S67 A;  3FSD A;  3RGR A;  4O8S A;  1W7C A;  3NM2 A;  1OAC A;  3DGN A;  2P0X A;  3GRD A;  2CHC A;  3F40 A;  3KSP A;  1W00 A;  1S5A A;  4WHA A;  2WO0 A;  1QAK A;  1WQL B;  3F14 A;  1DVC A;  1YGE A;  2O9U X;  3GWR A;  2XH9 A;  3SOA A;  2LQV A;  1QVF 2;  1U8C B;  4HBR A;  5D82 A;  3VGN A;  3LXU X;  3FF2 A;  1TFO A;  1KWI A;  1K73 4;  1NJI 4;  3KII A;  1Q7Y 4;  3BND A;  1YJN 3;  2MF7 A;  1EQK A;  1N5H A;  5AIF A;  4I4K A;  2O3O A;  4QWT A;  1CYV A;  4OUQ A;  2WOH A;  1ZO2 A;  7STD A;  2CFL A;  2M7O A;  4N6M A;  1C7H A;  3H3H A;  1Z1S A;  5A0O B;  3MG2 A;  3DUK A;  1QJG A;  4K61 A;  4X2O A;  1BSH A;  3LML A;  3ROB A;  4N6O B;  3CPW 2;  5AI1 A;  1MNL A;  2V1L A;  1NWW A;  4N6L A;  1IVU A;  1SII A;  3SOY A;  2RFR A;  1O7P B;  2W03 A;  3B4O A;  3KKG A;  3DGL A;  1GY6 A;  5EQL A;  1NO3 A;  3G4S 3;  3GZB A;  4O2H A;  3WA2 X;  3M8C A;  4WYK A;  3GZR A;  4TX4 A;  4L8O A;  1FGO A;  2CG0 A;  3LYG A;  4AKY A;  3NV0 B;  1US1 A;  1VQ4 3;  2GU3 A;  1M1K 4;  3MWZ A;  3X3Y A;  1SJW A;  5AIG A;  1IU7 A;  3AMO A;  4WFO A;  1KD1 4;  3CNM A;  2F99 A;  4WVZ A;  1JV2 B;  2GBX B;  2ML6 A;  4OK0 A;  3G8Z A;  2GXF A;  3S27 A;  1R4C A;  1NB3 I;  2Y73 A;  3G71 3;  3E99 A;  1VQK 3;  3NHX A;  4RNY A;  4JF8 A;  5IG4 A;  2CC3 A;  4KFF A;  2P38 A;  4IT7 A;  5ELU A;  4AKZ A;  4EV2 A;  3D9R A;  1IVV A;  2E2T A;  4EYC A;  2R4I A;  3CXC 2;  3K9M C;  2WGQ A;  1IDP A;  2RGQ A;  3QRD A;  4FR9 A;  4YXW H;  4KZ1 A;  2CIU A;  1IQX A;  2JDI H;  1ZX2 A;  2CWU A;  3HIG A;  5AYS C;  2E2U A;  4HM7 B;  3OW2 2;  1OHO A;  3DZL A;  5IEO A;  2IUK A;  4XDV A;  3EX9 A;  1STF I;  1CEW I;  2W6J H;  2OOV A;  2FXT A;  3NV0 A;  1AV4 A;  3MKI A;  3A76 A;  2OQE A;  2W56 A;  3F7X A;  3N8B A;  3FG4 A;  3NM7 A;  1BUQ A;  2HMM B;  3EBT A;  1GY7 A;  3GZY B;  3N9H A;  3TDG A;  4Q53 A;  4BTX A;  3CC2 3;  2QA4 3;  4HM1 B;  1VQP 3;  2K54 A;  3WOE B;  1PFP A;  1JB2 A;  3CMA 3;  1ROV A;  2W9Q A;  4FCJ A;  2LYX A;  1UUW B;  3T0U A;  2XFT A;  1LXE A;  3LT8 A;  3FGY A;  3CCQ 3;  1PU4 A;  5AEW B;  1W6Y A;  3CCL 3;  3UNL A;  2OWP A;  5JBS A;  4NRE A;  3CCR 3;  2E5Y A;  5BVB A;  3BNE A;  1WMP A;  2A15 A;  3UL6 A;  2BT3 A;  2XSO B;  1IT7 A;  3CCM 3;  2HMO B;  2FGT A;  1K8A 4;  2GBW B;  4G1M B;  1S72 3;  1TFK A;  2Y74 A;  1GD4 A;  5TGN A;  1O7G B;  1FGR A;  5CF1 A;  3CCV 3;  3DGO A;  3RDE A;  1KC8 4;  1E3V A;  1OGX A;  3WOF B;  2RSX A;  5FGO A;  3WDG B;  4HKV B;  3V99 A;  3KSE D;  5HGR A;  1DYU A;  4EBG A;  2XSH B;  1STD A;  5IF6 A;  2CKF B;  3H51 A;  1K9M 4;  2CWT A;  2HML B;  1W2Z A;  4R4K A;  2QIY A;  3S5C A;  1A2V A;  2WSS H;  1IQ8 A;  2V7Q H;  1OPY A;  1QAF A;  1EKM A;  4KVH A;  5FW5 A;  3DMC A;  1FGQ A;  5D81 A;  3G0K A;  3UB1 A;  1SPU A;  2BHM A;  3K63 A;  5IEN A;  2INX A;  5CK6 A;  1FGT A;  1WNH A;  4RZM A;  4HM5 B;  3G16 A;  1RRL A;  2XGN A;  4FMC A;  3GZX B;  3Q2P A;  2FNQ A;  4MMX B;  3U1W A;  3FG3 A;  3OV4 A;  1OF5 A;  2XND H;  2Z7A A;  4EC6 A;  1W4N A;  1W5Z A;  3CCE 3;  4EV5 A;  1DMN A;  1M90 4;  2L4V A;  4N6T A;  1QMA A;  1UUV B;  2SBL A;  1VQ5 3;  3JUP A;  5ELJ A;  8CHO A;  4R1K A;  1JN5 B;  1OH0 A;  1VQ9 3;  2W04 A;  1D6Y A;  3MG1 A;  5IW9 A;  5DRE A;  3HX8 A;  4CDL A;  5IER A;  5IEP A;  2P09 A;  3LT9 A;  4EXR A;  2BMQ B;  3JUQ A;  3VSY A;  2XRX B;  3BNB A;  3LH4 A;  3X40 A;  4XB5 A;  4IPB A;  1GYB A;  5AYR B;  1AR0 A;  2KRT A;  1AQT A;  3OWY A;  3SED A;  3JUO A;  2F98 A;  4L7K A;  1W2B 2;  2GU1 A;  1JB5 A;  4HM0 B;  4WWU C;  2CFG A;  1N9J A;  5IG5 A;  1O7M B;  3PGB A;  3LTD A;  1VZZ A;  3CD6 3;  3LTB A;  3EQQ B;  1J2B A;  3CME 3;  3X3Z A;  5AEU B;  3NQY A;  3V98 A;  3I0Y A;  4K90 B;  3L0R A;  4BTW A;  5LC6 A;  3BNC A;  2PNC A;  3V92 A;  1JN5 A;  3B7C A;  1VQO 3;  4R80 A;  4TLF A;  3EHC A;  3MHE A;  1IV7 A;  1ROA A;  3EF8 A;  2CFW A;  5STD A;  3OXA A;  1AVK A;  2WGO A;  2XR8 B;  2XF3 A;  4XBX A;  3JUN A;  4IIA A;  1Q40 B;  4J8T A;  2Z77 A;  3ECF A;  3CCU 3;  1SQW A;  3KE7 A;  2QEX 3;  3FLJ A;  4R9K A;  4LGQ A;  1RRH A;  1JKG B;  2YFL B;  4HVN A;  2JQ5 A;  2CFK A;  4RNZ A;  3G6E 3;  3MSO A;  1UW1 A;  2C10 A;  1WMO A;  4XBY A;  1YIJ 3;  3LZA A;  2BO9 B;  2CW9 A;  4AEQ A;  5CLK A;  1AVL A;  1N5P A;  3HK4 A;  3PCR A;  1QAL A;  3K7C A;  6STD A;  1OHP A;  2YFJ B;  5LC7 A;  3S29 A;  5EEO A;  1YHQ 3;  3DGM A;  2IMJ A;  3CU3 A;  1OCV A;  2P05 A;  2GEX A;  2OCT A;  3EBY A;  2BMR B;  2Q07 A;  1FUW A;  3NBJ A;  1W02 A;  4MEI A;  3FCS B;  1UI7 A;  4FMD A;  4NHF A;  2QGU A;  1CYU A;  3NQZ A;  1ULJ B;  3DXO A;  3F8H A;  4FMA A;  2IA7 A;  1EA2 A;  1FS0 E;  4HM8 B;  1JEK A;  1Q40 A;  1T5Y A;  1Q81 4;  4MMZ B;  1JNQ A;  1IFP A;  1TP6 A;  3FZW A;  1IT8 A;  3IJE B;  1JKG A;  2CG1 A;  3EFF K;  4HJL B;  2BNG A;  1TIJ A;  3EC9 A;  1LNH A;  3PYJ A;  3CCJ 3;  1JJ2 2;  3PXM A;  3EN8 A;  1DVD A;  4QMA A;  5D83 A;  3F7S A;  4HM4 B;  1RN7 A;  4XBT A;  4ZM8 A;  3DM8 A;  2ML5 A;  5BXQ A;  1O7H B;  1NDO B;  2B24 B;  3EE1 A;  2OTL 3;  2OOV C;  1E79 H;  1K28 A;  4JRF A;  4OVM A;  2CWV A;  4MMY B;  1E97 A;  1Y4K A;  3HZP A;  1YJ9 3;  1GY5 A;  3KFQ C;  3NBB A;  1ASK A;  2OQE C;  1A2K A;  1OHS A;  4HM2 B;  4ORL A;  4HZ9 B;  3CC4 3;  4LMI A;  1YI2 3;  3ALA A;  3UJM A;  5I97 A;  1A67 A;  3N54 B;  1LOX A;  1FGM A;  3OWU A;  4WYK B;  3MPH A;  3PZW A;  2I9W A;  4CCV A;  1D6U A;  3EB8 A;  4STD A;  2MC8 A;  2Z76 A;  4K1U A;  3SX1 A;  1VQ7 3;  1O7N B;  3SLU A;  3USS A;  1SIH A;  3DY5 A;  4FCZ A;  4XM4 A;  3K0Z A;  1RJO A;  3AMO B;  3QK9 A;  3HII A;  4K1V A;  4X2H A;  5JPU A;  3UL5 A;  4RBN A;  1VQM 3;  3D3L A;  1VQ6 3;  1IV9 A;  1HKX A;  2ZDJ A;  3FH1 A;  4PEJ A;  1Q86 4;  2B1X B;  3HI7 A;  3MG3 A;  4O3V A;  1A90 A;  5DRV A;  1DMM A;  1UI8 A;  3PCS A;  1N9E A;  3O8Y A;  3CC7 3;  1NU3 A;  2P0M A;  1M9G A;  4H3U A;  3STD A;  3B4P A;  3MYT A;  5CXO A;  1JRQ A;  5KP3 A;  2KCD A;  1FA3 A;  3ER7 A;  4FMB A;  1LVN A;  1W01 A;  1ULI B;  2C11 A;  2STD A;  3T8N A;  1YJW 3;  2HMJ B;  3RGA A;  2GEY A;  4BTY A;  1YVB I;  4O02 B;  1IVW A;  1N8Q A;  1IVX A;  5IG0 A;  3S28 A;  3FF0 A;  1VQL 3;  1E3R A;  1TUH A;  1TU5 A;  2XEP A;  3IMA B;  2QE7 H;  2W56 B;  2BMO B;  5KP4 A;  3J7Y d;  2OTJ 3;  1IK3 A;  3I56 3;  3JVC A;  4DJG A;  4MJD A;  1ISK A;  1VQN 3;  3KN4 A;  5JPP A;  2W9P A;  4XDW A;  5G2G A;  1JB4 A;  2W0Q A;  3LTA A;  3BLZ A;  4HM3 B;  4HM6 B;  1L5G B;  2HMN B;  3Q90 A;  3K5T A;  3KZT A;  3PS8 A;  5KP1 A;  3PJS K;  1YIT 3;  3EN1 B;  5AII A;  4N6U A;  4N6V 0;  3I55 3;  1KSI A;  4LZI A;  3LOY A;  1IQY A;  1GD3 A;  3JUM A;  2CH9 A;  3B8L A;  4R9L A;  2YFI B;  2KXG A;  4WP5 A;  3WMD A;  1KQS 2;  1N8R 4;  1W6G A;  3EJV A;  4KFD A;  1VQ8 3;  3CPO A;  4HZB B;  4L8P A;  4J9A A;  1RKY A;  3F8X A;  4N6N B;  2CFD A;  3LTC A;  1MOL A;  1WTH A;  2D42 A;  2K0M A;  3NBR A;  1OUN A;  1WMN A;  2UX0 A;  1CQS A;  3BB9 A;  1O7W B;  4LEH A;  3T8U A;  3CCS 3;  2Z6B A;  3WA3 A;  1F8N A;  2F86 B;  1NB5 I;  3IPT A;  5AIH A;  4H61 A;  2WOF A;  3OWS A;  4KFE A;  5IG3 A;  2YX9 A;  3NUV A;  3WOD G;  4HYZ A;  2PZV A;  3X3X A;  3X41 A;  2HMK B;  2XGL A;  2XFS A;  2ZL8 A;  3Q1C A;  4U13 A;  5CF2 A;  1HU9 A;  1M1X B;  2D1W A;  1G96 A;  1U5O A;  2IUJ A;  1Q82 4;  3NX0 A;  1GS3 A;  3FKA A;  1V74 A;  2E5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...