2W6JH

Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 5.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL
publication title Improving diffraction by humidity control: a novel device compatible with X-ray beamlines.
pubmed doi rcsb
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2w6jH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w6jH01
4DJGA 4WVZA 3USSA 1IFPA 2JDIH 1JEKA 1E79H 2W6JH 1BSHA 2CK3H 2QE7H 1BSNA 2XNDH 1FS0E 2WSSH 2E5TA 3EFFK 1AQTA 3PJSK 4YXWH 4QMAA 2V7QH 4TLFA 2E5YA
chains in the Genus database with same CATH superfamily
1VZZA 1P84E 3RK2B 3F7SA 1FGQA 1LT9C 1BRNL 1BGYD 1AV1A 2WGOA 3STDA 3VGNA 2ML5A 5TGNA 4I5QA 2BMOB 1RF0C 2MKVA 1RTUA 3P8MC 2RH0A 2CG0A 2QJPC 5AVSB 3PGBA 1CYUA 1BNSA 3SLUA 5KP4A 3J7Yd 3SWFA 2E75D 3CCQ3 1FZEA 2YFJB 2Q1KA 2XSHB 2BCCJ 4PD4H 3VTPC 1Q864 3G9RA 3FGYA 1BNEA 3A0BE 2BNGA 2H8PD 1URQA 3LYGA 2Z5IA 4YTPC 2OQQA 2K9JA 1N2DC 1FUSA 1VQ63 2H43A 3L71J 3KPEA 5APYA 2OOVA 3FZWA 4BTYA 3CMA3 1YQ3C 5KLIB 1EDIA 1KORA 3SSUA 3D6ZA 3U1CA 5KAIH 3QH9A 3CPWO 2KF4A 4X2HA 4K35A 4KVHA 3MG3A 1B2ZA 1ZRTD 1NU1D 2KI7B 1SPUA 3T0UA 1EXIA 2BMQB 1AVYA 2IBZI 4WFOA 4NPBA 3IFMA 5AW0B 1CZQA 1GZLA 4HJGH 2QJKC 5K5GB 1MV8A 1SQVK 3HD7C 4C46A 3KZIE 1VQ43 1SQXJ 3VF1A 3Q3DA 1V58A 2C11A 3GZXB 3BNEA 1NTZE 3GHGA 1PGQA 3OAKA 2BEQD 1TFKA 1OHPA 4N3VA 3CCL3 1DMNA 1M8OB 3S4RA 2KP8A 3OWYA 1RY3A 2FFDB 2R5BA 1RGLA 1SQQK 2W0QA 2R3SA 1B2SA 1TRPA 1KV4A 2O01J 1P84H 1Q814 2IMJA 3NBRA 4GDOA 4NPEA 5M1BA 1G0TA 2H0IA 2O3JA 1U57A 2HG5D 5CCGC 4HM0B 1KB9I 4R9LA 4K90B 1U8CB 1EDJA 4KZ1A 4HYTB 1NNVA 1QMAA 1Q2NA 2Y0EA 2BIRA 3NXSA 3P32A 1VQMP 3MUDC 4H0LB 4JF8A 3EC9A 1GD2E 2YFIB 1E97A 5AIIA 2RSXA 3PHLA 1W6CA 1W7CA 5HOHA 3CMEP 1LT9B 1AV4A 2CFGA 1HH0A 2OTJP 1PFPA 3X40A 1SQPJ 3AHWA 2ZYDA 2OCTA 4MMZB 2OQEA 1DMQA 2CW9A 3A0BH 2QJPB 1US1A 3PCRA 2NRGA 2D42A 4XBTA 1UCLA 3L35A 3TNUA 1HWTC 1D6UA 1H0TB 3X3YA 1R5LA 3D9RA 1OFCX 2GM4A 5KLVK 4CPKA 3X3ZA 1XTGB 1BU4A 1NKNA 2NZ2A 1NTZD 3L73G 2CPSA 2PGDA 1KYOI 3NXJA 1JEKA 2OGUA 3G4S3 1K9MQ 3M91A 3G6EP 3H1JD 2PP6A 4HH2A 1OGXA 2BT3A 5RNTA 1Y4KA 3P8CE 3GRDA 1JZDA 4FR9A 1IFDA 1X22A 1IQ8A 4RNZA 2Q6QA 1M90Q 2Q5UA 3MHVA 1CI6B 4ASVA 2WSFJ 4RNYA 3K63A 2XR8B 3KZIH 1BRGA 3CC43 4IPBA 3DXOA 1AQZA 4O02B 2WSCH 2JQ5A 1GK4A 2QJKB 3MPHA 3N54B 3I55P 2Q07A 1L4AA 1HF9A 4RNTA 1AQTA 2M0BA 2QJYC 3PTZA 3KSED 3V92A 1GK6A 5KKZC 1KILC 3HD7B 3BLZA 3HIGA 1FE6A 4FMAA 3CL3D 2WOHA 2IA7A 1BUJA 1NTMG 2E42A 1LP1B 4N6V0 2GUVA 3O6QB 4R4MA 2HODA 1DEBA 3TGUJ 2WTYA 3C9IA 3G16A 2GXFA 5AIHA 4PD4I 2QA4P 1FBMA 2A45G 1FZCA 2W56A 5AW8B 1KD1Q 1S723 3EWKA 3EE1A 2QSIA 3MG2A 1M57D 1M1JA 3Q2YA 1N73A 2Z76A 1JY2N 1JUNA 3GZYB 4ZMDA 1RE4C 4PV1C 3MD0A 3L71G 3QK9A 4KFFA 3L70J 3RK2D 3VMYA 4AQRD 2ZT9C 3WODG 1STFI 2H7HA 1FOSE 5EEOA 2KNCB 3NMDA 3HI7A 4J5KA 1N8RQ 1M9GA 1WRGA 2B1XB 1Q7YQ 3EQQB 3K5TA 2KF3A 5IG0A 1MZ9A 3P8CD 2GU1A 3TSIA 3OJAB 3AMOB 1DETA 1ASKA 1JNQA 2V7QH 3WOFB 1OVRA 4O3VA 5AW6B 2WPSA 1N7SB 2H88C 2K37A 3B71A 3CLQA 3L73E 2P38A 1L0NJ 2KOGA 3G71P 3EX9A 1SQXG 3CPOA 1J1DC 3SVAA 5E79E 4HKZH 3OW22 3U59A 1KFNA 1W6GA 8RNTA 3LH4A 3PCSA 3L75J 1WMPA 2ZXEB 3VP8A 1D7MA 2K3DA 2W6JH 1RE3A 4CPGA 1RGFA 3CCJP 1BNIA 3FH1A 2FYZA 2IX7C 3NQYA 1IT8A 1LOWA 3CME3 4XDVA 3PJSK 3CCUP 3HX8A 1P84I 1SIHA 3HOHA 4WHAA 1WT6A 4J8TA 4TT3H 1LTTC 2ZYGA 2YXRB 1RN1A 2UGIA 2K9YA 5TISE 3S28A 3ZDMA 2BHMA 4EV2A 2P09A 1GOVA 5AVZB 1DVCA 1Z1SA 1L5GB 4HZ9B 1C7HA 1GOYA 3AE4C 5KJ7C 1NTME 4D6TJ 2IFNA 2OYIC 1SQPG 2AEMA 1FDMA 3CCS3 1JY3P 1M904 1EDKA 1LQMB 2QJYB 3JC22 3F8XA 4I2LC 3VYIA 3B4SA 4WBAA 1KILB 1JNMA 1BSEA 1UI8A 1Y47A 1UIIA 2K54A 2IZ0A 1T8ZA 2HMLB 3L71E 2Y73A 3L73D 2B89A 6STDA 1NO4A 3RL0D 3KE7A 1IK3A 3G6E3 5AVVB 1QALA 5CHXA 1JY3O 3M0AA 2Q3EA 1SFCA 3CCQP 1IVXA 3GF3A 1JN5A 1I70A 1SQVJ 4H44C 2W27A 1UDII 3WUUA 4L7KA 4PV1B 1W4NA 4H0LD 2WT7B 3JUPA 1EZVG 1O7HB 2OTL3 3DM8A 5CJ4A 2ZT9B 3C8VA 2Z77A 2KCDA 4BIRA 4BL2A 3I553 3HUSA 1BSCA 1VQ6P 2K3RA 2WOFA 3F14A 4BRYB 5STDA 1T5YA 1SQBK 1N9EA 1H8AA 1NU1G 3H32A 1EXJA 4HAAA 5IEOA 1SQQJ 3EBYA 4OVMA 3F40A 1NHLA 1SQXE 1JMBA 2B24B 1VQ5P 3EB8A 3K7CA 2L5GB 5E79H 1BSHA 3CWBJ 2XFTA 1W2EA 1Q42A 1QVGO 3PZWA 2WPQA 1X9VA 1N8R4 1BSAA 1NKZB 1EDLA 1FZAA 1OZHA 3H25A 3R2PA 3EF8A 2BCCD 3FXEA 1B2MA 1O7GB 3L72J 1J1DB 4HZBB 1FC2C 1MNLA 2J5UA 2BU4A 1OW8A 1FZGA 1VQ4P 3TGUG 3FWNA 2WWWA 5G1KA 1DEEG 3VSYA 3HTKA 3L71D 5TISH 2KXPB 2WITA 1B2XA 1EA2A 3H1IJ 5APTA 1IFJA 2L91A 1KQS2 3VMZA 4RKUJ 3CCLP 5IW9A 2LYXA 1YIJ3 3CXHE 3M0DA 3F5HA 2PFXA 4HB1A 2J8XB 2CFKA 5KLVJ 4AEQA 1SQPE 1T3BA 2AAEA 4BTWA 2KS1B 1I2GA 3PS8A 1YJN3 2A45H 3AEBC 5AW2B 2Z4EA 3LXUX 2P05A 3HE5A 1D6ZA 1Q9EA 4I1LA 1G2CB 4H13B 5KAIE 2YX9A 5AVUB 1BDCA 3HD7D 2YIUC 3HE4B 1T3JA 2QM8A 1RGHA 5L8RJ 2OYIB 4LC1A 3ABVC 1G1IA 1LWUC 1SQXD 4XM4A 1J2BA 1SP4A 2C0WA 1UW1A 1FA3A 1X1UA 1FUTA 2WSEJ 1T2KC 3V99A 1Y9BA 1L0NG 3UJMA 5DJUB 5B66E 4AUWA 1BRKA 1JV2B 1VQL3 5BVZA 1JKGB 4EBGA 3H51A 1EZVE 1R5SA 3WA3A 1J1EC 1G02A 1LNIA 3L75G 4HM4B 1G1JA 1NVOA 1OACA 1JB4A 1NGMB 1JB2A 3BATA 5AW5B 4H44B 1W2BO 1NU1E 5JPPA 4JPZB 1BCCJ 3VOPA 5AEUB 2XF3A 4FCZA 1IK9A 3NQZA 1TTOA 1MWSA 1GY5A 1E3RA 5CF1A 2K88A 3H1JG 3NV0B 3VMXA 1BNGA 1LTGC 2Z5HA 1LGHB 3HK4A 3G4SP 1N7SD 1GD3A 3GWRA 1A67A 3CXHD 1JTHA 1RQVA 2CG1A 1CEWI 1YI2P 1SQPD 2R5DA 5D81A 2WMMA 2O01H 3H3HA 1N73C 3LW5J 1L2PA 1LTJC 4D6TG 3KYQA 2KRTA 3CCM3 3WU2E 2IPPA 7RNTA 3E7KA 2HR3A 3TGUE 3L0RA 3CC4P 3AEDC 2OYHA 1CQSA 1TIJA 4OH8B 3DMCA 1FZFA 2KUBA 3MG1A 4WYKB 2R41A 4JQ0D 4JYBA 3WR2A 5CF2A 3F89A 3VMAA 3CXHH 2YKPA 4LSOA 1RF1A 1RDSA 2KB7P 1GU4A 2POHA 5CCHC 2ZFCA 2OYOA 4O9BA 4CDLA 1W02A 1JBSA 2HYNA 5GTHE 1QAFA 4OWFA 1SQVG 1FU1A 2J58A 1EZVD 2INXA 3F8HA 4RESB 4IFMA 1YTZI 2C4BA 3UL6A 3B5NB 1T2HA 1VQ53 5ELUA 3A0HE 1S72P 1JB0J 1GW3A 1JJ22 4RJTA 1TRQA 2YNYA 4Q53A 1SIIA 1I3FA 4NHFA 1ISKA 3CX5I 2WO0A 4KFEA 1B27A 2N1TC 4NREA 3ECFA 1LTSC 1RGGA 1JCDA 3FWLA 1NWWA 1OCVA 4WVZA 1LQGC 1L0NE 1SQQG 2XZRA 3FKAA 3WMDA 2CWUA 1KILD 1RE3C 5B66H 1NWQA 1BRJA 5AW7B 3RBZA 5LC6A 1VQQA 3AECC 3FF0A 1GL2C 3CWBG 4OUQA 1LXEA 3K5BA 2R4IA 4U3FG 3L75E 1ROAA 4HM7B 5LC7A 3ZG5A 1LWUB 2FXOA 3PH0A 4AKZA 4H3UA 2K1AA 1OXZA 4GOEA 1BSDA 3T8UA 1ZW0A 4ZKPA 1AFOA 4TLFA 4JRFA 1GMQA 3QWOC 3OWUA 1ULIB 2B87B 5DJTB 4N3YB 1YQ4C 3TGUD 3L72G 1UI7A 3D71A 5FW5A 1JO5A 1PY3A 4R1KA 4PV1D 4FMDA 1J1EB 3CC2P 3H1JE 3AEEC 4LYLB 4HM3B 2GEYA 3M8CA 4HBRA 2CFLA 2ZT9D 2JWDA 4G1MB 4R9KA 4IL6E 2JO1A 3H1IG 3AGNA 2FYNC 4UB6E 1TU5A 4BU4A 2LXBA 1X1XA 3G0KA 1QJGA 3WOEB 4L8OA 3AGOA 1BNFA 4D6TE 4BXLA 1M7LA 1DH3A 3WU2H 4GL6A 2BEZF 1BNJA 2E74C 1BGSA 5M19A 2RFRA 1EQKA 2HLOA 2KZJA 1S5LX 2V1LA 1FGRA 2O01N 4WY4C 1WTHA 4I4KA 2IYPA 2KLUA 4EXRA 2PZVA 1LTJB 1W5CE 2OWPA 1LOYA 4HJLB 2W2CA 1U7MA 4O2HA 1HGZA 4XDWA 1L0ND 2YMYA 1K8AQ 3B7CA 3FSDA 1SQBJ 5GTHH 1IYYA 3SWYA 3TK1A 1SQVE 2F5MA 1ZP0C 3WHOA 2Z6BA 4C7RA 4LMIA 5AW1B 3L75D 3CCSP 1RN7A 1ZXGA 3WDGB 1YGEA 1AVKA 4GSPA 1Q40B 5BU5A 3A0HH 3B8LA 2I1JA 5AIFA 3BCCJ 1MWUA 1ZGXA 1S5AA 1IFMA 1TP6A 1T6AA 1IU7A 3ITKA 3SEDA 3BVHA 3U1AA 2QIWA 2XSOB 3II6A 2CC3A 1SQQE 1RH5B 1K28A 1YI23 1UIXA 3KQGA 2E76C 1EKMA 1RNTA 1OVVA 4H13D 2NPSC 2KYVA 3CWBE 1X79B 5KJ7D 1LVNA 3B4OA 3JUMA 1QVFO 4U3FE 3BRTB 2RKLA 1HU9A 1IFPA 3MYTA 5CXOA 2XDJA 1G96A 1FZUA 2RCDA 5APWA 3LIEA 4U7JA 2OTLP 1WNHA 1B21A 1YTZT 2RGQA 4D6TD 3FCSB 1LJ2A 3EN8A 1NTKK 3L72E 1GMPA 1ZOYC 2C9NY 1GL2B 3G3ZA 2JWAA 1BRIA 2R3CA 3NUVA 2F99A 4YPCA 1N7LA 2FFDA 3QRDA 1UCKA 4A7PA 4CCVA 2WGQA 3V4QA 4R4KA 1HTLC 2PRRA 3N4XA 4PJ0E 2BCCG 1M1XB 3UNLA 2XRXB 4IL6H 3H1IE 2ZL8A 4H44D 2W90A 4IOIH 3D4AA 5JPUA 8CHOA 4UB6H 2UX0A 3O8ZA 3GAXA 1JRQA 4HYZA 1SQVD 3P7KA 5AVWB 3WUVA 5M18A 4QMAA 3WUTA 3T97B 5EVHA 1PYLA 3CXHI 3BRVB 1T2IA 5AVYB 1KC8Q 3A5EA 3IR9A 2XGLA 3BNDA 1OGZA 4WB4A 4BWNA 2CFWA 3M06A 2XFSA 1LT9A 4K1VA 3OX9A 1IJDB 1BE3J 2FYNB 2GA1A 4EYYQ 1RF0A 4U13A 1HBWA 3Q3FA 5APQA 5I97A 1AQ5A 2W6AA 1YVSA 1N9JA 1O7PB 2F56A 3SYUA 4O8SA 2ZJSE 1MUUA 1SQQD 1IQYA 1K41A 5AVRB 1FDOA 1YIJP 2E74B 5APXA 1OW7A 3CWBD 1H0TA 3M9BA 1V57A 3ER7A 4WY4B 3HRNA 4U3FD 1TFOA 4FCMA 1KZUB 4N78E 1YJNP 1NTMK 3LZAA 1R4CA 2O1JA 3JUQA 1OHOA 2M5AB 4L75A 3CC23 2LXCB 1RRLA 1S4XA 4XBYA 3L72D 2E43A 1BUQA 4RO0A 3AE8C 3CC7P 4C7NB 2HOHA 4KFDA 1VQ93 2BO9B 3CCR3 3USSA 1JY3N 3Q2PA 3S5CA 3U1WA 1BSNA 2CWVA 3MHEA 3HIIA 4OGQC 3W67A 1K8A4 3B5ND 4STDA 4XFJA 2JR8A 3H1ID 1BVIA 1YGWA 1PGJA 1I0XA 1CI6A 1H88A 2CWTA 1VQLP 2D1WA 2YXQB 2C10A 2M3BA 5G2GA 2OARA 5AEWB 5C39A 4BTXA 1VQP3 5KLVD 1JOCA 3AE9C 2E76B 3H1HJ 2Y0DA 1ZMEC 2BMRB 2Q3IA 2V4HA 3Q5RA 5BVBA 3AEFC 2KXGA 2NPSB 5B5EE 5A0OB 2QE7H 4GOFA 1K9M4 3EHCA 1IK7A 3HD7A 2GBXB 1URQC 1ZN5A 2AEJA 4GHOA 1OIPA 2HPCB 5IF6A 5H2FE 1RF1C 3L74J 5BIRA 4DKIA 4MMYB 2BCCE 4PJ0H 2OOVC 4JF7A 1T2KD 5AVQB 1LP1A 3O6QA 1JMMA 1B20A 1MGRA 5KKZB 2IY2A 2FYUK 1R4YA 3URPA 4XB5A 3V2PA 4N78D 3KCHA 1SQBG 2P2UA 3KHUA 1RSNA 1Q82Q 1L0LK 3CPW2 3CCMP 3N7NA 2C0XA 3TF5A 1HUCA 3AE7C 1EQ7A 1OF5B 2IBZD 1EC5A 1Q7HA 2KNCA 3RDEA 1GTWA 3K0ZA 3MUDA 3BCCG 1O7NB 1BCCD 1E3VA 3N9HA 1W01A 1JM0A 2PAJA 4N6LA 3A7OA 5D83A 3AMOA 3GSPA 3GG2A 3EN1B 6RNTA 1BOXA 2QM7A 1KD14 3GHGC 3FG3A 1N7SA 5IG3A 3CU3A 1D6YA 3WMM0 1YVBI 1FZBA 4X2OA 1KC84 4NPDA 2JP3A 2MC8A 4UB8E 3RL0g 3L37A 1JZOA 2Y9YA 1DIPA 2UWJE 1EUIC 2ZVOB 1YYCA 1W6YA 4FMCA 1USEA 4R80A 1XTCC 1FDIA 1RHLA 3A2AA 1GYBA 5IG4A 1KQGB 1Q7Y4 1RGAA 1HGVA 1IQXA 2L4VA 2K0MA 2ML6A 3KSPA 4DJGA 4ZM8A 4PEJA 2WVRA 3KFQC 2GU3A 2R32A 5KAFE 5TJHA 1E5WA 1OW6A 1SS1A 5CCHD 2ZYAA 1MOLA 4WWIA 4W7ZA 3CXC2 1YHQ3 2IDBA 1VPCA 1LTAC 4OGQB 3E1RA 2OQEC 5B5EH 4K1UA 3NM7A 1UCJA 7STDA 4WWUC 1NB3I 3C1LA 1NU1K 3GW6A 5H2FH 2H0GA 1I2EA 2ZVNB 1ZLLA 3NBJA 3L70G 2CK3H 2SPZA 1BE3G 2HMKB 1IVUA 3B4PA 4JYCA 4BL3A 1KILA 1GL2D 1URQB 2D2CC 2JKVA 5KP1A 2FY8A 2K9JB 1SQBE 4GB5A 2KF6A 3CC73 1VQ7P 1OPYA 1W5ZA 3FGAD 3DZLA 3U97A 2P0XA 1BIRA 3FF2A 1PGPA 3OWSA 1GMRA 1S3JA 2WPVB 3BCCE 3GMAA 4GKGA 4MEIA 1QL2A 1STDA 3M9QA 1H89A 2GBWB 1RE4A 3ROBA 1RGEA 1S1CX 2QEX3 2WT7A 2AXTE 4RZMA 3FG4A 1RNBA 1ZR2A 2P1JA 4HKVB 2JDIH 1OMIA 1NTKJ 2A15A 2QG4A 3V2NA 5CCGD 2IYJA 3EBTA 4BRYA 1L4AC 1N86A 2HMMB 4UB8H 3L73J 3LTDA 1J2JB 1Q824 1CYVA 1DD4A 1LT1A 1OX3A 3Q1MA 1K73Q 2E74D 2GUSA 3GHGB 1KILE 3I5CA 3RL0C 3MKIA 1O7MB 3BU4A 3H1HG 1FGOA 1SQWA 4WY4D 3OW2O 2XNXA 1FZCC 1QEXA 1U7JA 9RNTA 3TYYA 1UCIA 2IFMA 4N6JA 1DX7A 2FNQA 1OVUA 5KAFH 1AVLA 1U5OA 1M1JC 3KKGA 3ZFZA 2YKQA 3L74G 3IF4A 2KSEA 3MIWA 1GOUA 3KIIA 5AI1A 2PNCA 3LTCA 1PP9J 5FGOA 1Y8AA 1A90A 3MSOA 3RNTA 1SQBD 2FXMA 2KIKA 5CJ0A 1CW5A 3AE3C 4HM1B 3EFGA 3X41A 4Y28J 1NTZK 2CFDA 3EFFK 3FXDA 2JJLA 1LNQA 3H1LJ 3GLMA 3SWKA 3CCEP 2AADA 1VF5C 3G8ZA 3L70E 4EV5A 3BCCD 1BE3E 5HGRA 1X8YA 3M9HA 3FG1A 1NTMJ 1PZQA 1RMSA 2KS1A 1JBRA 1VQ8P 3D3LA 4HVNA 3AE2C 1FUWA 3T8NA 2E76D 4JBZA 2AXCA 1AA0A 2NPSD 1RKYA 1G2CA 5AVTB 2FXTA 3PXMA 1O7WB 2IYOA 3TNUB 5KJ7A 3DUKA 4EDFA 3AEAC 3HE4A 1LOVA 1A2VA 3V6IA 3H1KJ 1RN4A 2KZIA 2OYIA 2Q7CA 2F5WA 4AKYA 1UUWB 3V98A 2D2CB 1F8NA 2H89C 1IFIA 3CNMA 2YIUB 1GS3A 1S5LE 4DZOA 3Q90A 2AXTH 1JKGA 2YO3A 3AEGC 2N9BA 1JBTA 2OTKE 2ITAA 3RK3C 3BNBA 2CPBA 5CBNA 1ZR4A 1VQK3 3UL5A 3IN6A 1YIT3 4W7YA 1KQLA 1P84D 2WSFH 1LOXA 2I8DA 4XA4A 2YKOA 3A76A 4LLHA 3L36A 1X1WA 1N5HA 4DOJA 2F4YA 3PLNA 3V2RA 1EG9B 1M1KQ 1WMOA 2BASA 4ZKUA 1FJKA 1QLED 2W9QA 3H1HE 5CLKA 2G8YA 1VL2A 3NV0A 1WQLB 1L4AB 1VQO3 1GU5A 1VQ9P 2E5YA 2FYUJ 3L70D 3CCRP 1HYFA 2B9BA 1DMMA 3UB1A 1BE3D 1IFNA 1UUGB 3CD63 2KK7A 3L74E 1L0LJ 1ROVA 3E1IA 1VQ73 5KLVG 1BRSA 2Y0CA 4LGQA 3RL0B 4RBNA 4DT0A 2MJZA 3DGMA 2HODB 4YXWH 3KZTA 3TDGA 1SFCC 1FZCB 2W56B 2QVAA 1VQPP 2A45I 1YBKA 3NM2A 1K734 5KP3A 1M1JB 1N73B 4WYKA 4EOTA 4ILFA 2YO2A 4Y99C 1QGKB 3NTNA 4OK0A 3MTUE 1IVWA 1A2KA 3SXXA 3JUNA 1W2ZA 3A5TA 5DRVA 1BSBA 4L73A 1YJ93 1FGMA 1BGYJ 1KQSO 3VN0A 3H6PA 3HUSC 1PPJG 1N7SC 1KQFB 3CNXA 1RGCA 4OGQD 1RCKA 1NJIQ 2WPRA 3I563 3VP9A 4WP5A 3B5NA 4W80A 4KT3B 3AE6C 1VF5B 3SOAA 5JBSA 4M3LA 1BANA 1RQUA 2XKMA 4N6MA 2P67A 1NTKG 2IBZG 4L8PA 1IVVA 1MWRA 2E2TA 1UUVB 3V4WA 2QIYA 2E75C 1T3UA 1BCCG 1VQN3 1RGKA 1MFZA 4B86A 1QVG2 3H1HD 1R8EA 1S5LH 1URQD 3A3YB 3B8EB 3V5BA 1NAFA 4IL6X 4QWTA 4CJNA 2N1TB 3F7XA 1MKMA 1LWUA 5IERA 4GIFA 3L74D 2XNDH 3GF7A 1QAKA 3OV4A 1NO3A 1IDPA 1X0TA 1NU1J 4EIJA 4KJMA 4LGDE 2B87A 4I6MC 3DGYA 2FXPA 3CCE3 1FGTA 1I0VA 2W8ZA 3Q5SA 5CMZA 3M0DC 1PP9G 3MZWB 3RK3B 1VQ83 2M8RA 1M56D 1BNRA 1YJWP 1RRHA 3ALAA 5APSA 2QGUA 1NB5I 1HJBA 2W6BA 1I8VA 3H1LG 5APUA 1HKXA 2FKWB 1IZNB 5KLVE 2IZ1A 4FMBA 3FX0A 1LTIC 1DE3A 1LNHA 1B2UA 3LTBA 5G1LA 1YHQP 5BU4A 4GT1A 4K3AA 1DYUA 3O8YA 4N6NB 1AJYA 1FW7A 3SFDC 4HM8B 1M1K4 1SARA 4N6OB 1KN7A 3LT9A 2I1KA 1I3IA 1LTJA 1BAOA 4EYCA 3H1KG 5IG5A 1RCLA 3BIRA 1ULJB 6GSPA 1SFCB 2C9LY 1JN5B 1PPJE 4I7ZC 2QRXA 2Z7AA 3IPTA 2Y9ZA 2JEEA 3D6YA 2LQVA 3LIDA 1B3SA 2SARA 5APVA 4Y99B 3BB9A 2M7OA 1W00A 2LR2A 3JCUE 3FLJA 3RGAA 1Q40A 2P10A 4HM6B 3BNCA 1AY7A 1W2B2 1EZVI 1NTKE 2IBZE 5CCHA 4FCJA 3CX5E 1A02F 3HUSB 1ZO2A 1GDTA 4MN4C 3LMLA 1BCCE 4AYCA 2CHCA 3H32B 1HJ0A 1V74A 1ZS7A 5AYRB 3DY5A 3RGRA 2A06G 1IT7A 1JCCA 2J59M 1JY2P 1TU3F 3KDPB 1NH4A 4R4LA 1RHZB 1MWTA 3LT8A 1FYSA 1YNVX 2SBLA 3NHXA 2E75B 3JSVC 2HMOB 2QEXP 1CH0A 2N1TA 2G3AA 1OUNA 1NJI4 1PU4A 3X42A 2OYHC 2FYUG 1NTZJ 3BASA 2DW3A 4IIAA 1NDOB 4K61A 2WSCJ 1VQM3 2D2CD 5EFWB 3N8BA 3F9SA 1GL2A 1L0LG 1JY2O 1TUHA 2VRSA 3CCVP 1PFIA 3S67A 3Q5PA 1NAYA 5GSPA 2W9PA 1PP9E 3D5GA 2OTJ3 3TDKA 3H1JJ 2CH9A 3Q1CA 1SQXK 3HTKB 2KF5A 3I0YA 4J5GA 3JUOA 1KFMA 5IEPA 1Q90D 5AW3B 1KB9E 1IV7A 5D82A 4TX4A 3H1LE 2P58A 3S27A 1PPJD 2GSPA 1PGOA 4H13C 4KHXA 4XE5B 1FS0E 2W03A 5CBOA 1BGYG 3T97A 1OHSA 3GZBA 3AE1C 1GMJA 1X1YA 2O3OA 1DVDA 3LTAA 1GW4A 1Z56A 1LRAA 1TJDA 3HZPA 4XBXA 5AYSC 2N9YB 2P0MA 1WMNA 1AVOA 3X3XA 3OA7A 3HE5B 2KLVA 1L4AD 3V2QA 4GODA 5CCGA 1C54A 3PRJA 2FGTA 1NTKD 3CX5D 3DGOA 3D5IA 4IFFA 3EQ2A 3ZG0A 2P7JA 5ELJA 1HZ1A 4YXDC 3H1KE 2F98A 1USDA 3DH2A 1SJWA 4LEHA 1PL5A 3R4YA 1PV3A 1A02J 1KSIA 4MJDA 3W68A 1QL1A 2WSEH 2XH9A 5CK6A 2V7QJ 1OH0A 2W83C 2O1KA 1UGIA 2XEPA 4WY4A 4N6UA 5KTBA 1SQPK 2RMZA 2WZ7A 5AVXB 3JCUH 2CKFB 3SOYA 1E79H 3RK3E 1GSPA 2M5AA 1KYOE 1FOSF 3AE5C 3DGLA 3KN4A 1KMIZ 1IC2A 3CX5H 2I9WA 2RN0A 4I7ZB 2H0HA 1OWAA 1S9KE 2XU6A 4C7NA 1AR0A 1YJW3 3RK2C 3KXDA 1IV9A 4EI2A 1I2FA 3EJVA 3CMAP 1PP9D 3PP5A 3S29A 1FJPA 2A06E 3CI9A 1GD4A 1Q86Q 5EQLA 1VF5D 1KB9D 1QX8A 2L1SA 5GTIE 3NBBA 2HMJB 1JB5A 3WA2X 4U3FJ 1NYHA 2R44A 2RBIA 3H1LD 1BRHA 2ZA4A 1JTHB 2FYUE 2QA43 4HOHA 4IFDK 1MFTA 3DGNA 2KSJA 1NTMD 4ZNCA 1VQKP 2GEXA 3LW5H 1YITP 1GY7A 1L0LE 2NPSA 4LZIA 5DREA 1KTMA 3S9OA 2HFED 3E99A 2W04A 2E2UA 2E2VA 3IAOA 4J9AA 2IUJA 2HPCA 1KWIA 1CSBA 1RJOA 1K04A 2N1TD 5IENA 1A2PA 2ZAEB 5AIGA 2OYHB 4DCKA 1IO4A 3H1KD 3MP7B 2B88A 1KB9H 2CX1A 4PD4E 3RGUA 1S2EA 2WQYC 1VQOP 5KLIC 1BDDA 1GY6A 3B5NC 4EC6A 3UIAA 1VDFA 1BGYE 1RF1B 3CD6P 3LOYA 3RBXA 2UUGC 5M1AA 2XGNA 3IMAB 1DD3A 2YMKA 2Y74A 2ZDJA 3RK3D 1NU3A 2Q9IA 4NPFX 1KYOD 3SX1A 1ZX2A 3OXAA 5BXQA 2E5TA 1N5PA 1OF5A 4HM2B 3G713 1HVVA 4Z1MH 1EEJA 1S9KD 5AW9B 1N8QA 3MWZA 3L4FA 4IT7A 2ZXXA 1SVFA 2STDA 4MMXB 4N6TA 1WMKA 3NX0A 1SLQA 4ASWA 5BU8B 3GZRA 4L76A 2YFLB 4ORLA 4L74A 2A06D 1ZV8A 3IJEB 4HM5B 1YJ9P 3MGNA 2F86B 2O9UX 2KAAA 4OVNF 1RLSA 1QVF2 1UGHI 2M3EA 2WSSH 2FBWC 3CCJ3 1Q81Q 1MGWA 1K05A 4EW5A 2ZHXB 2FYUD 3CCV3 3I56P 1KYOH 2CX0A 3NFQA 3K9MC 3PYJA 2CIUA 2FFDC 5AW4B 3CCU3 1LTBC 1NOHA 1L0LD 1NTZG 1SFCD 2LKMA 3D70A 1ZRTE 2RNTA 2IUKA 3AHSA 4H61A 2HMNB 1PIXA 3SFEC 2XV5A 1VQNP 4KT0J 1FAVA 3D79A 3S1KA 7GSPA 3JVCA 4PD4D 5GTIH 2MF7A 1L0NK 4H0LC 2AEFA
chains in the Genus database with same CATH topology
5IEOA 1VZZA 1K734 3EBYA 5KP3A 4OVMA 4WYKA 3F40A 3F7SA 1FGQA 3ER7A 2B24B 4OK0A 1IVWA 1A2KA 3SXXA 1TFOA 2WGOA 3EB8A 3JUNA 2ML5A 1W2ZA 3K7CA 1BSHA 4FCMA 5TGNA 3VGNA 2BMOB 2XFTA 5DRVA 1Q42A 3LZAA 3PZWA 1FGMA 1YJ93 1R4CA 3JUQA 1OHOA 2CG0A 3CC23 1N8R4 3PGBA 1RRLA 3CNXA 1CYUA 4XBYA 3SLUA 5KP4A 1BUQA 3I563 3EF8A 3J7Yd 3CCQ3 4KFDA 1O7GB 1VQ93 4HZBB 4WP5A 2BO9B 3SOAA 3CCR3 3USSA 2XSHB 2YFJB 3Q2PA 1MNLA 5JBSA 1Q864 3FGYA 3S5CA 3U1WA 4N6MA 1BSNA 2CWVA 3MHEA 3HIIA 4L8PA 1IVVA 1K8A4 2E2TA 1UUVB 2BNGA 2QIYA 4STDA 3VSYA 3LYGA 1VQN3 2CWTA 2D1WA 1EA2A 1QVG2 2C10A 1VQ63 5G2GA 2OOVA 5AEWB 1KQS2 4BTXA 5IW9A 3FZWA 1VQP3 4BTYA 3CMA3 2LYXA 1YIJ3 2BMRB 4QWTA 5BVBA 2CFKA 4AEQA 2KXGA 3F7XA 4X2HA 4BTWA 4KVHA 5A0OB 2QE7H 5IERA 3MG3A 2XNDH 3PS8A 1K9M4 1YJN3 3EHCA 2GBXB 3T0UA 1SPUA 1QAKA 3LXUX 5IF6A 2P05A 1D6ZA 2BMQB 3OV4A 1NO3A 1IDPA 4WFOA 4MMYB 2YX9A 2OOVC 3CCE3 1FGTA 1VQ83 4XM4A 1J2BA 1UW1A 1FA3A 4XB5A 1RRHA 1VQ43 3ALAA 3VF1A 2C11A 3GZXB 3V99A 3UJMA 3BNEA 2QGUA 3CPW2 1NB5I 1JV2B 1VQL3 1HKXA 1JKGB 4EBGA 1TFKA 3H51A 1OF5B 1OHPA 4FMBA 4N3VA 3WA3A 3CCL3 4HM4B 3RDEA 3K0ZA 1DMNA 1LNHA 3OWYA 1OACA 1O7NB 1JB4A 1E3VA 3N9HA 1W01A 1JB2A 3LTBA 2W0QA 4N6LA 1DYUA 5JPPA 3O8YA 4N6NB 5D83A 5AEUB 4HM8B 3AMOA 2XF3A 1Q814 1M1K4 4FCZA 2IMJA 3NBRA 4N6OB 3LT9A 3EN1B 3NQZA 1KD14 3FG3A 5IG3A 1GY5A 4EYCA 4HM0B 3CU3A 1E3RA 1D6YA 4R9LA 5CF1A 4K90B 5IG5A 1U8CB 1YVBI 4KZ1A 1QMAA 1ULJB 3NV0B 4X2OA 1KC84 2MC8A 3HK4A 1JN5B 1GD3A 4JF8A 3EC9A 3GWRA 2YFIB 1E97A 1A67A 5AIIA 2Z7AA 2RSXA 2CG1A 3IPTA 2LQVA 1W6YA 1CEWI 1W6CA 1W7CA 4FMCA 4R80A 3STDA 3BB9A 2M7OA 1AV4A 1W00A 5D81A 2CFGA 3FLJA 3RGAA 1PFPA 1Q40A 3X40A 3H3HA 4HM6B 1GYBA 3BNCA 5IG4A 1W2B2 1Q7Y4 2OCTA 4MMZB 2OQEA 2KRTA 1IQXA 1DMQA 2CW9A 2L4VA 3CCM3 1US1A 3PCRA 4FCJA 2K0MA 3L0RA 2ML6A 2D42A 3KSPA 4DJGA 4ZM8A 1ZO2A 4PEJA 4XBTA 3KFQC 3LMLA 2GU3A 1TIJA 1CQSA 2CHCA 3DMCA 3MG1A 1V74A 1D6UA 1MOLA 4WYKB 5AYRB 3DY5A 3CXC2 5CF2A 3RGRA 1IT7A 3X3YA 3D9RA 1YHQ3 3X3ZA 3LT8A 4LSOA 2SBLA 2OQEC 4K1UA 3NHXA 3NM7A 2HMOB 4CDLA 1W02A 7STDA 4WWUC 1NB3I 1OUNA 1QAFA 1NJI4 1PU4A 3X42A 3NXJA 1JEKA 2INXA 3F8HA 4IIAA 1NDOB 4K61A 1VQM3 3UL6A 3NBJA 2CK3H 3G4S3 3N8BA 3F9SA 1VQ53 5ELUA 1TUHA 1OGXA 1JJ22 2HMKB 2BT3A 1Y4KA 3S67A 3GRDA 2W9PA 1IVUA 4FR9A 4Q53A 1SIIA 3B4PA 4NHFA 2OTJ3 2CH9A 1IQ8A 4RNZA 3Q1CA 1ISKA 2WO0A 4KFEA 4NREA 3ECFA 3I0YA 3JUOA 4RNYA 3K63A 1NWWA 2XR8B 5IEPA 5KP1A 1OCVA 4WVZA 1IV7A 4GB5A 3FKAA 3CC43 3CC73 4IPBA 3DXOA 5D82A 3WMDA 2CWUA 1OPYA 1W5ZA 4TX4A 3DZLA 5LC6A 3S27A 4O02B 3FF0A 3U97A 2JQ5A 2P0XA 4OUQA 1LXEA 3MPHA 3N54B 1FS0E 2Q07A 2W03A 2R4IA 3FF2A 1ROAA 4HM7B 5LC7A 1OHSA 1AQTA 3GZBA 3OWSA 2O3OA 1DVDA 3V92A 3LTAA 3KSED 4AKZA 3HZPA 4H3UA 4XBXA 5AYSC 3BLZA 2P0MA 3T8UA 1WMNA 3HIGA 4MEIA 1STDA 2GBWB 3X3XA 4TLFA 4JRFA 3ROBA 4FMAA 2QEX3 2FGTA 2WOHA 2IA7A 1ULIB 3OWUA 3FG4A 4RZMA 4HKVB 2JDIH 1UI7A 5FW5A 3DGOA 4N6V0 2A15A 4R1KA 5ELJA 4FMDA 2F98A 3G16A 2GXFA 1SJWA 4LEHA 4MJDA 5AIHA 1KSIA 3EBTA 2W56A 4HM3B 2GEYA 2HMMB 3M8CA 4HBRA 1S723 2CFLA 3EE1A 2XH9A 3LTDA 3MG2A 5CK6A 1Q824 1CYVA 4G1MB 2Z76A 1OH0A 3GZYB 2XEPA 4R9KA 4N6UA 3QK9A 1TU5A 4KFFA 2CKFB 3G0KA 3MKIA 1E79H 1O7MB 1QJGA 3SOYA 3WOEB 1FGOA 1SQWA 4L8OA 3WODG 1STFI 5EEOA 3DGLA 3KN4A 4GL6A 3HI7A 2I9WA 1M9GA 2FNQA 2B1XB 3EQQB 1AR0A 1AVLA 1U5OA 2RFRA 3K5TA 5IG0A 1IV9A 3KKGA 1YJW3 1EQKA 2V1LA 2GU1A 3EJVA 1FGRA 3KIIA 3AMOB 5AI1A 1ASKA 1JNQA 2V7QH 1WTHA 2PNCA 3WOFB 4I4KA 3S29A 4O3VA 4EXRA 3LTCA 2PZVA 1GD4A 2OWPA 5FGOA 5EQLA 1A90A 4HJLB 3MSOA 2W2CA 4O2HA 4XDWA 3NBBA 2HMJB 3B7CA 4HM1B 1JB5A 3WA2X 3X41A 2P38A 3FSDA 2QA43 2CFDA 3EFFK 3EX9A 3CPOA 2Z6BA 4LMIA 3SVAA 3DGNA 3G8ZA 1RN7A 3WDGB 3OW22 1YGEA 1AVKA 4EV5A 2GEXA 1W6GA 1Q40B 1GY7A 3LH4A 3PCSA 5HGRA 4LZIA 1WMPA 5DREA 3FG1A 3B8LA 5AIFA 3E99A 3D3LA 1S5AA 4HVNA 1FUWA 3T8NA 1TP6A 2W6JH 2E2UA 2W04A 2E2VA 2IUJA 1IU7A 4J9AA 3SEDA 1KWIA 1RJOA 5IENA 5AIGA 1RKYA 2FXTA 3PXMA 3FH1A 1O7WB 2XSOB 2CC3A 3NQYA 1YI23 1K28A 3DUKA 1IT8A 3CME3 4XDVA 3PJSK 1A2VA 1EKMA 3HX8A 1SIHA 4WHAA 4J8TA 1GY6A 1LVNA 4EC6A 3B4OA 3JUMA 1HU9A 1IFPA 4AKYA 1UUWB 3LOYA 3MYTA 2BHMA 3S28A 3V98A 4EV2A 2XGNA 1G96A 2P09A 5CXOA 1F8NA 1DVCA 2RCDA 3IMAB 1Z1SA 3CNMA 2Y74A 2ZDJA 1L5GB 1NU3A 4HZ9B 1WNHA 1GS3A 1C7HA 2RGQA 3SX1A 1ZX2A 3OXAA 5BXQA 3Q90A 3FCSB 2E5TA 1JKGA 1N5PA 3EN8A 1OF5A 4HM2B 3G713 3NUVA 1N8QA 2F99A 3MWZA 4IT7A 4MMXB 3CCS3 2STDA 1M904 4N6TA 3BNBA 3NX0A 3QRDA 3GZRA 1VQK3 4CCVA 2YFLB 3UL5A 3F8XA 1YIT3 2WGQA 4ORLA 1LOXA 3IJEB 1UI8A 4R4KA 3A76A 4HM5B 2K54A 2F86B 2O9UX 1M1XB 3UNLA 2XRXB 2ZL8A 5JPUA 1N5HA 2HMLB 2Y73A 1QVF2 8CHOA 2WSSH 1EG9B 6STDA 3CCJ3 1WMOA 2UX0A 3KE7A 3GAXA 1JRQA 4HYZA 1IK3A 2W9QA 1QALA 5CLKA 3NV0A 3G6E3 1WQLB 3CCV3 3K9MC 1IVXA 3PYJA 1VQO3 1JN5A 4QMAA 2CIUA 5EVHA 3CCU3 2E5YA 2XGLA 1DMMA 3BNDA 1OGZA 3UB1A 2CFWA 4L7KA 2XFSA 4K1VA 3CD63 3OX9A 1W4NA 1ROVA 3JUPA 1VQ73 2IUKA 4U13A 4LGQA 4H61A 2HMNB 1O7HB 2OTL3 5I97A 4RBNA 3DM8A 1N9JA 2Z77A 1O7PB 2KCDA 3DGMA 3I553 4O8SA 4YXWH 3KZTA 2WOFA 3TDGA 3F14A 3JVCA 5STDA 1T5YA 1IQYA 1K41A 1N9EA 2MF7A 2W56B 3NM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DJG A;  4WVZ A;  3USS A;  1IFP A;  2JDI H;  1JEK A;  1E79 H;  2W6J H;  1BSH A;  2CK3 H;  2QE7 H;  1BSN A;  2XND H;  1FS0 E;  2WSS H;  2E5T A;  3EFF K;  1AQT A;  3PJS K;  4YXW H;  4QMA A;  2V7Q H;  4TLF A;  2E5Y A; 
#chains in the Genus database with same CATH topology
 1VZZ A;  1P84 E;  3RK2 B;  3F7S A;  1FGQ A;  1LT9 C;  1BRN L;  1BGY D;  1AV1 A;  2WGO A;  3STD A;  3VGN A;  2ML5 A;  5TGN A;  4I5Q A;  2BMO B;  1RF0 C;  2MKV A;  1RTU A;  3P8M C;  2RH0 A;  2CG0 A;  2QJP C;  5AVS B;  3PGB A;  1CYU A;  1BNS A;  3SLU A;  5KP4 A;  3J7Y d;  3SWF A;  2E75 D;  3CCQ 3;  1FZE A;  2YFJ B;  2Q1K A;  2XSH B;  2BCC J;  4PD4 H;  3VTP C;  1Q86 4;  3G9R A;  3FGY A;  1BNE A;  3A0B E;  2BNG A;  2H8P D;  1URQ A;  3LYG A;  2Z5I A;  4YTP C;  2OQQ A;  2K9J A;  1N2D C;  1FUS A;  1VQ6 3;  2H43 A;  3L71 J;  3KPE A;  5APY A;  2OOV A;  3FZW A;  4BTY A;  3CMA 3;  1YQ3 C;  5KLI B;  1EDI A;  1KOR A;  3SSU A;  3D6Z A;  3U1C A;  5KAI H;  3QH9 A;  3CPW O;  2KF4 A;  4X2H A;  4K35 A;  4KVH A;  3MG3 A;  1B2Z A;  1ZRT D;  1NU1 D;  2KI7 B;  1SPU A;  3T0U A;  1EXI A;  2BMQ B;  1AVY A;  2IBZ I;  4WFO A;  4NPB A;  3IFM A;  5AW0 B;  1CZQ A;  1GZL A;  4HJG H;  2QJK C;  5K5G B;  1MV8 A;  1SQV K;  3HD7 C;  4C46 A;  3KZI E;  1VQ4 3;  1SQX J;  3VF1 A;  3Q3D A;  1V58 A;  2C11 A;  3GZX B;  3BNE A;  1NTZ E;  3GHG A;  1PGQ A;  3OAK A;  2BEQ D;  1TFK A;  1OHP A;  4N3V A;  3CCL 3;  1DMN A;  1M8O B;  3S4R A;  2KP8 A;  3OWY A;  1RY3 A;  2FFD B;  2R5B A;  1RGL A;  1SQQ K;  2W0Q A;  2R3S A;  1B2S A;  1TRP A;  1KV4 A;  2O01 J;  1P84 H;  1Q81 4;  2IMJ A;  3NBR A;  4GDO A;  4NPE A;  5M1B A;  1G0T A;  2H0I A;  2O3J A;  1U57 A;  2HG5 D;  5CCG C;  4HM0 B;  1KB9 I;  4R9L A;  4K90 B;  1U8C B;  1EDJ A;  4KZ1 A;  4HYT B;  1NNV A;  1QMA A;  1Q2N A;  2Y0E A;  2BIR A;  3NXS A;  3P32 A;  1VQM P;  3MUD C;  4H0L B;  4JF8 A;  3EC9 A;  1GD2 E;  2YFI B;  1E97 A;  5AII A;  2RSX A;  3PHL A;  1W6C A;  1W7C A;  5HOH A;  3CME P;  1LT9 B;  1AV4 A;  2CFG A;  1HH0 A;  2OTJ P;  1PFP A;  3X40 A;  1SQP J;  3AHW A;  2ZYD A;  2OCT A;  4MMZ B;  2OQE A;  1DMQ A;  2CW9 A;  3A0B H;  2QJP B;  1US1 A;  3PCR A;  2NRG A;  2D42 A;  4XBT A;  1UCL A;  3L35 A;  3TNU A;  1HWT C;  1D6U A;  1H0T B;  3X3Y A;  1R5L A;  3D9R A;  1OFC X;  2GM4 A;  5KLV K;  4CPK A;  3X3Z A;  1XTG B;  1BU4 A;  1NKN A;  2NZ2 A;  1NTZ D;  3L73 G;  2CPS A;  2PGD A;  1KYO I;  3NXJ A;  1JEK A;  2OGU A;  3G4S 3;  1K9M Q;  3M91 A;  3G6E P;  3H1J D;  2PP6 A;  4HH2 A;  1OGX A;  2BT3 A;  5RNT A;  1Y4K A;  3P8C E;  3GRD A;  1JZD A;  4FR9 A;  1IFD A;  1X22 A;  1IQ8 A;  4RNZ A;  2Q6Q A;  1M90 Q;  2Q5U A;  3MHV A;  1CI6 B;  4ASV A;  2WSF J;  4RNY A;  3K63 A;  2XR8 B;  3KZI H;  1BRG A;  3CC4 3;  4IPB A;  3DXO A;  1AQZ A;  4O02 B;  2WSC H;  2JQ5 A;  1GK4 A;  2QJK B;  3MPH A;  3N54 B;  3I55 P;  2Q07 A;  1L4A A;  1HF9 A;  4RNT A;  1AQT A;  2M0B A;  2QJY C;  3PTZ A;  3KSE D;  3V92 A;  1GK6 A;  5KKZ C;  1KIL C;  3HD7 B;  3BLZ A;  3HIG A;  1FE6 A;  4FMA A;  3CL3 D;  2WOH A;  2IA7 A;  1BUJ A;  1NTM G;  2E42 A;  1LP1 B;  4N6V 0;  2GUV A;  3O6Q B;  4R4M A;  2HOD A;  1DEB A;  3TGU J;  2WTY A;  3C9I A;  3G16 A;  2GXF A;  5AIH A;  4PD4 I;  2QA4 P;  1FBM A;  2A45 G;  1FZC A;  2W56 A;  5AW8 B;  1KD1 Q;  1S72 3;  3EWK A;  3EE1 A;  2QSI A;  3MG2 A;  1M57 D;  1M1J A;  3Q2Y A;  1N73 A;  2Z76 A;  1JY2 N;  1JUN A;  3GZY B;  4ZMD A;  1RE4 C;  4PV1 C;  3MD0 A;  3L71 G;  3QK9 A;  4KFF A;  3L70 J;  3RK2 D;  3VMY A;  4AQR D;  2ZT9 C;  3WOD G;  1STF I;  2H7H A;  1FOS E;  5EEO A;  2KNC B;  3NMD A;  3HI7 A;  4J5K A;  1N8R Q;  1M9G A;  1WRG A;  2B1X B;  1Q7Y Q;  3EQQ B;  3K5T A;  2KF3 A;  5IG0 A;  1MZ9 A;  3P8C D;  2GU1 A;  3TSI A;  3OJA B;  3AMO B;  1DET A;  1ASK A;  1JNQ A;  2V7Q H;  3WOF B;  1OVR A;  4O3V A;  5AW6 B;  2WPS A;  1N7S B;  2H88 C;  2K37 A;  3B71 A;  3CLQ A;  3L73 E;  2P38 A;  1L0N J;  2KOG A;  3G71 P;  3EX9 A;  1SQX G;  3CPO A;  1J1D C;  3SVA A;  5E79 E;  4HKZ H;  3OW2 2;  3U59 A;  1KFN A;  1W6G A;  8RNT A;  3LH4 A;  3PCS A;  3L75 J;  1WMP A;  2ZXE B;  3VP8 A;  1D7M A;  2K3D A;  2W6J H;  1RE3 A;  4CPG A;  1RGF A;  3CCJ P;  1BNI A;  3FH1 A;  2FYZ A;  2IX7 C;  3NQY A;  1IT8 A;  1LOW A;  3CME 3;  4XDV A;  3PJS K;  3CCU P;  3HX8 A;  1P84 I;  1SIH A;  3HOH A;  4WHA A;  1WT6 A;  4J8T A;  4TT3 H;  1LTT C;  2ZYG A;  2YXR B;  1RN1 A;  2UGI A;  2K9Y A;  5TIS E;  3S28 A;  3ZDM A;  2BHM A;  4EV2 A;  2P09 A;  1GOV A;  5AVZ B;  1DVC A;  1Z1S A;  1L5G B;  4HZ9 B;  1C7H A;  1GOY A;  3AE4 C;  5KJ7 C;  1NTM E;  4D6T J;  2IFN A;  2OYI C;  1SQP G;  2AEM A;  1FDM A;  3CCS 3;  1JY3 P;  1M90 4;  1EDK A;  1LQM B;  2QJY B;  3JC2 2;  3F8X A;  4I2L C;  3VYI A;  3B4S A;  4WBA A;  1KIL B;  1JNM A;  1BSE A;  1UI8 A;  1Y47 A;  1UII A;  2K54 A;  2IZ0 A;  1T8Z A;  2HML B;  3L71 E;  2Y73 A;  3L73 D;  2B89 A;  6STD A;  1NO4 A;  3RL0 D;  3KE7 A;  1IK3 A;  3G6E 3;  5AVV B;  1QAL A;  5CHX A;  1JY3 O;  3M0A A;  2Q3E A;  1SFC A;  3CCQ P;  1IVX A;  3GF3 A;  1JN5 A;  1I70 A;  1SQV J;  4H44 C;  2W27 A;  1UDI I;  3WUU A;  4L7K A;  4PV1 B;  1W4N A;  4H0L D;  2WT7 B;  3JUP A;  1EZV G;  1O7H B;  2OTL 3;  3DM8 A;  5CJ4 A;  2ZT9 B;  3C8V A;  2Z77 A;  2KCD A;  4BIR A;  4BL2 A;  3I55 3;  3HUS A;  1BSC A;  1VQ6 P;  2K3R A;  2WOF A;  3F14 A;  4BRY B;  5STD A;  1T5Y A;  1SQB K;  1N9E A;  1H8A A;  1NU1 G;  3H32 A;  1EXJ A;  4HAA A;  5IEO A;  1SQQ J;  3EBY A;  4OVM A;  3F40 A;  1NHL A;  1SQX E;  1JMB A;  2B24 B;  1VQ5 P;  3EB8 A;  3K7C A;  2L5G B;  5E79 H;  1BSH A;  3CWB J;  2XFT A;  1W2E A;  1Q42 A;  1QVG O;  3PZW A;  2WPQ A;  1X9V A;  1N8R 4;  1BSA A;  1NKZ B;  1EDL A;  1FZA A;  1OZH A;  3H25 A;  3R2P A;  3EF8 A;  2BCC D;  3FXE A;  1B2M A;  1O7G B;  3L72 J;  1J1D B;  4HZB B;  1FC2 C;  1MNL A;  2J5U A;  2BU4 A;  1OW8 A;  1FZG A;  1VQ4 P;  3TGU G;  3FWN A;  2WWW A;  5G1K A;  1DEE G;  3VSY A;  3HTK A;  3L71 D;  5TIS H;  2KXP B;  2WIT A;  1B2X A;  1EA2 A;  3H1I J;  5APT A;  1IFJ A;  2L91 A;  1KQS 2;  3VMZ A;  4RKU J;  3CCL P;  5IW9 A;  2LYX A;  1YIJ 3;  3CXH E;  3M0D A;  3F5H A;  2PFX A;  4HB1 A;  2J8X B;  2CFK A;  5KLV J;  4AEQ A;  1SQP E;  1T3B A;  2AAE A;  4BTW A;  2KS1 B;  1I2G A;  3PS8 A;  1YJN 3;  2A45 H;  3AEB C;  5AW2 B;  2Z4E A;  3LXU X;  2P05 A;  3HE5 A;  1D6Z A;  1Q9E A;  4I1L A;  1G2C B;  4H13 B;  5KAI E;  2YX9 A;  5AVU B;  1BDC A;  3HD7 D;  2YIU C;  3HE4 B;  1T3J A;  2QM8 A;  1RGH A;  5L8R J;  2OYI B;  4LC1 A;  3ABV C;  1G1I A;  1LWU C;  1SQX D;  4XM4 A;  1J2B A;  1SP4 A;  2C0W A;  1UW1 A;  1FA3 A;  1X1U A;  1FUT A;  2WSE J;  1T2K C;  3V99 A;  1Y9B A;  1L0N G;  3UJM A;  5DJU B;  5B66 E;  4AUW A;  1BRK A;  1JV2 B;  1VQL 3;  5BVZ A;  1JKG B;  4EBG A;  3H51 A;  1EZV E;  1R5S A;  3WA3 A;  1J1E C;  1G02 A;  1LNI A;  3L75 G;  4HM4 B;  1G1J A;  1NVO A;  1OAC A;  1JB4 A;  1NGM B;  1JB2 A;  3BAT A;  5AW5 B;  4H44 B;  1W2B O;  1NU1 E;  5JPP A;  4JPZ B;  1BCC J;  3VOP A;  5AEU B;  2XF3 A;  4FCZ A;  1IK9 A;  3NQZ A;  1TTO A;  1MWS A;  1GY5 A;  1E3R A;  5CF1 A;  2K88 A;  3H1J G;  3NV0 B;  3VMX A;  1BNG A;  1LTG C;  2Z5H A;  1LGH B;  3HK4 A;  3G4S P;  1N7S D;  1GD3 A;  3GWR A;  1A67 A;  3CXH D;  1JTH A;  1RQV A;  2CG1 A;  1CEW I;  1YI2 P;  1SQP D;  2R5D A;  5D81 A;  2WMM A;  2O01 H;  3H3H A;  1N73 C;  3LW5 J;  1L2P A;  1LTJ C;  4D6T G;  3KYQ A;  2KRT A;  3CCM 3;  3WU2 E;  2IPP A;  7RNT A;  3E7K A;  2HR3 A;  3TGU E;  3L0R A;  3CC4 P;  3AED C;  2OYH A;  1CQS A;  1TIJ A;  4OH8 B;  3DMC A;  1FZF A;  2KUB A;  3MG1 A;  4WYK B;  2R41 A;  4JQ0 D;  4JYB A;  3WR2 A;  5CF2 A;  3F89 A;  3VMA A;  3CXH H;  2YKP A;  4LSO A;  1RF1 A;  1RDS A;  2KB7 P;  1GU4 A;  2POH A;  5CCH C;  2ZFC A;  2OYO A;  4O9B A;  4CDL A;  1W02 A;  1JBS A;  2HYN A;  5GTH E;  1QAF A;  4OWF A;  1SQV G;  1FU1 A;  2J58 A;  1EZV D;  2INX A;  3F8H A;  4RES B;  4IFM A;  1YTZ I;  2C4B A;  3UL6 A;  3B5N B;  1T2H A;  1VQ5 3;  5ELU A;  3A0H E;  1S72 P;  1JB0 J;  1GW3 A;  1JJ2 2;  4RJT A;  1TRQ A;  2YNY A;  4Q53 A;  1SII A;  1I3F A;  4NHF A;  1ISK A;  3CX5 I;  2WO0 A;  4KFE A;  1B27 A;  2N1T C;  4NRE A;  3ECF A;  1LTS C;  1RGG A;  1JCD A;  3FWL A;  1NWW A;  1OCV A;  4WVZ A;  1LQG C;  1L0N E;  1SQQ G;  2XZR A;  3FKA A;  3WMD A;  2CWU A;  1KIL D;  1RE3 C;  5B66 H;  1NWQ A;  1BRJ A;  5AW7 B;  3RBZ A;  5LC6 A;  1VQQ A;  3AEC C;  3FF0 A;  1GL2 C;  3CWB G;  4OUQ A;  1LXE A;  3K5B A;  2R4I A;  4U3F G;  3L75 E;  1ROA A;  4HM7 B;  5LC7 A;  3ZG5 A;  1LWU B;  2FXO A;  3PH0 A;  4AKZ A;  4H3U A;  2K1A A;  1OXZ A;  4GOE A;  1BSD A;  3T8U A;  1ZW0 A;  4ZKP A;  1AFO A;  4TLF A;  4JRF A;  1GMQ A;  3QWO C;  3OWU A;  1ULI B;  2B87 B;  5DJT B;  4N3Y B;  1YQ4 C;  3TGU D;  3L72 G;  1UI7 A;  3D71 A;  5FW5 A;  1JO5 A;  1PY3 A;  4R1K A;  4PV1 D;  4FMD A;  1J1E B;  3CC2 P;  3H1J E;  3AEE C;  4LYL B;  4HM3 B;  2GEY A;  3M8C A;  4HBR A;  2CFL A;  2ZT9 D;  2JWD A;  4G1M B;  4R9K A;  4IL6 E;  2JO1 A;  3H1I G;  3AGN A;  2FYN C;  4UB6 E;  1TU5 A;  4BU4 A;  2LXB A;  1X1X A;  3G0K A;  1QJG A;  3WOE B;  4L8O A;  3AGO A;  1BNF A;  4D6T E;  4BXL A;  1M7L A;  1DH3 A;  3WU2 H;  4GL6 A;  2BEZ F;  1BNJ A;  2E74 C;  1BGS A;  5M19 A;  2RFR A;  1EQK A;  2HLO A;  2KZJ A;  1S5L X;  2V1L A;  1FGR A;  2O01 N;  4WY4 C;  1WTH A;  4I4K A;  2IYP A;  2KLU A;  4EXR A;  2PZV A;  1LTJ B;  1W5C E;  2OWP A;  1LOY A;  4HJL B;  2W2C A;  1U7M A;  4O2H A;  1HGZ A;  4XDW A;  1L0N D;  2YMY A;  1K8A Q;  3B7C A;  3FSD A;  1SQB J;  5GTH H;  1IYY A;  3SWY A;  3TK1 A;  1SQV E;  2F5M A;  1ZP0 C;  3WHO A;  2Z6B A;  4C7R A;  4LMI A;  5AW1 B;  3L75 D;  3CCS P;  1RN7 A;  1ZXG A;  3WDG B;  1YGE A;  1AVK A;  4GSP A;  1Q40 B;  5BU5 A;  3A0H H;  3B8L A;  2I1J A;  5AIF A;  3BCC J;  1MWU A;  1ZGX A;  1S5A A;  1IFM A;  1TP6 A;  1T6A A;  1IU7 A;  3ITK A;  3SED A;  3BVH A;  3U1A A;  2QIW A;  2XSO B;  3II6 A;  2CC3 A;  1SQQ E;  1RH5 B;  1K28 A;  1YI2 3;  1UIX A;  3KQG A;  2E76 C;  1EKM A;  1RNT A;  1OVV A;  4H13 D;  2NPS C;  2KYV A;  3CWB E;  1X79 B;  5KJ7 D;  1LVN A;  3B4O A;  3JUM A;  1QVF O;  4U3F E;  3BRT B;  2RKL A;  1HU9 A;  1IFP A;  3MYT A;  5CXO A;  2XDJ A;  1G96 A;  1FZU A;  2RCD A;  5APW A;  3LIE A;  4U7J A;  2OTL P;  1WNH A;  1B21 A;  1YTZ T;  2RGQ A;  4D6T D;  3FCS B;  1LJ2 A;  3EN8 A;  1NTK K;  3L72 E;  1GMP A;  1ZOY C;  2C9N Y;  1GL2 B;  3G3Z A;  2JWA A;  1BRI A;  2R3C A;  3NUV A;  2F99 A;  4YPC A;  1N7L A;  2FFD A;  3QRD A;  1UCK A;  4A7P A;  4CCV A;  2WGQ A;  3V4Q A;  4R4K A;  1HTL C;  2PRR A;  3N4X A;  4PJ0 E;  2BCC G;  1M1X B;  3UNL A;  2XRX B;  4IL6 H;  3H1I E;  2ZL8 A;  4H44 D;  2W90 A;  4IOI H;  3D4A A;  5JPU A;  8CHO A;  4UB6 H;  2UX0 A;  3O8Z A;  3GAX A;  1JRQ A;  4HYZ A;  1SQV D;  3P7K A;  5AVW B;  3WUV A;  5M18 A;  4QMA A;  3WUT A;  3T97 B;  5EVH A;  1PYL A;  3CXH I;  3BRV B;  1T2I A;  5AVY B;  1KC8 Q;  3A5E A;  3IR9 A;  2XGL A;  3BND A;  1OGZ A;  4WB4 A;  4BWN A;  2CFW A;  3M06 A;  2XFS A;  1LT9 A;  4K1V A;  3OX9 A;  1IJD B;  1BE3 J;  2FYN B;  2GA1 A;  4EYY Q;  1RF0 A;  4U13 A;  1HBW A;  3Q3F A;  5APQ A;  5I97 A;  1AQ5 A;  2W6A A;  1YVS A;  1N9J A;  1O7P B;  2F56 A;  3SYU A;  4O8S A;  2ZJS E;  1MUU A;  1SQQ D;  1IQY A;  1K41 A;  5AVR B;  1FDO A;  1YIJ P;  2E74 B;  5APX A;  1OW7 A;  3CWB D;  1H0T A;  3M9B A;  1V57 A;  3ER7 A;  4WY4 B;  3HRN A;  4U3F D;  1TFO A;  4FCM A;  1KZU B;  4N78 E;  1YJN P;  1NTM K;  3LZA A;  1R4C A;  2O1J A;  3JUQ A;  1OHO A;  2M5A B;  4L75 A;  3CC2 3;  2LXC B;  1RRL A;  1S4X A;  4XBY A;  3L72 D;  2E43 A;  1BUQ A;  4RO0 A;  3AE8 C;  3CC7 P;  4C7N B;  2HOH A;  4KFD A;  1VQ9 3;  2BO9 B;  3CCR 3;  3USS A;  1JY3 N;  3Q2P A;  3S5C A;  3U1W A;  1BSN A;  2CWV A;  3MHE A;  3HII A;  4OGQ C;  3W67 A;  1K8A 4;  3B5N D;  4STD A;  4XFJ A;  2JR8 A;  3H1I D;  1BVI A;  1YGW A;  1PGJ A;  1I0X A;  1CI6 A;  1H88 A;  2CWT A;  1VQL P;  2D1W A;  2YXQ B;  2C10 A;  2M3B A;  5G2G A;  2OAR A;  5AEW B;  5C39 A;  4BTX A;  1VQP 3;  5KLV D;  1JOC A;  3AE9 C;  2E76 B;  3H1H J;  2Y0D A;  1ZME C;  2BMR B;  2Q3I A;  2V4H A;  3Q5R A;  5BVB A;  3AEF C;  2KXG A;  2NPS B;  5B5E E;  5A0O B;  2QE7 H;  4GOF A;  1K9M 4;  3EHC A;  1IK7 A;  3HD7 A;  2GBX B;  1URQ C;  1ZN5 A;  2AEJ A;  4GHO A;  1OIP A;  2HPC B;  5IF6 A;  5H2F E;  1RF1 C;  3L74 J;  5BIR A;  4DKI A;  4MMY B;  2BCC E;  4PJ0 H;  2OOV C;  4JF7 A;  1T2K D;  5AVQ B;  1LP1 A;  3O6Q A;  1JMM A;  1B20 A;  1MGR A;  5KKZ B;  2IY2 A;  2FYU K;  1R4Y A;  3URP A;  4XB5 A;  3V2P A;  4N78 D;  3KCH A;  1SQB G;  2P2U A;  3KHU A;  1RSN A;  1Q82 Q;  1L0L K;  3CPW 2;  3CCM P;  3N7N A;  2C0X A;  3TF5 A;  1HUC A;  3AE7 C;  1EQ7 A;  1OF5 B;  2IBZ D;  1EC5 A;  1Q7H A;  2KNC A;  3RDE A;  1GTW A;  3K0Z A;  3MUD A;  3BCC G;  1O7N B;  1BCC D;  1E3V A;  3N9H A;  1W01 A;  1JM0 A;  2PAJ A;  4N6L A;  3A7O A;  5D83 A;  3AMO A;  3GSP A;  3GG2 A;  3EN1 B;  6RNT A;  1BOX A;  2QM7 A;  1KD1 4;  3GHG C;  3FG3 A;  1N7S A;  5IG3 A;  3CU3 A;  1D6Y A;  3WMM 0;  1YVB I;  1FZB A;  4X2O A;  1KC8 4;  4NPD A;  2JP3 A;  2MC8 A;  4UB8 E;  3RL0 g;  3L37 A;  1JZO A;  2Y9Y A;  1DIP A;  2UWJ E;  1EUI C;  2ZVO B;  1YYC A;  1W6Y A;  4FMC A;  1USE A;  4R80 A;  1XTC C;  1FDI A;  1RHL A;  3A2A A;  1GYB A;  5IG4 A;  1KQG B;  1Q7Y 4;  1RGA A;  1HGV A;  1IQX A;  2L4V A;  2K0M A;  2ML6 A;  3KSP A;  4DJG A;  4ZM8 A;  4PEJ A;  2WVR A;  3KFQ C;  2GU3 A;  2R32 A;  5KAF E;  5TJH A;  1E5W A;  1OW6 A;  1SS1 A;  5CCH D;  2ZYA A;  1MOL A;  4WWI A;  4W7Z A;  3CXC 2;  1YHQ 3;  2IDB A;  1VPC A;  1LTA C;  4OGQ B;  3E1R A;  2OQE C;  5B5E H;  4K1U A;  3NM7 A;  1UCJ A;  7STD A;  4WWU C;  1NB3 I;  3C1L A;  1NU1 K;  3GW6 A;  5H2F H;  2H0G A;  1I2E A;  2ZVN B;  1ZLL A;  3NBJ A;  3L70 G;  2CK3 H;  2SPZ A;  1BE3 G;  2HMK B;  1IVU A;  3B4P A;  4JYC A;  4BL3 A;  1KIL A;  1GL2 D;  1URQ B;  2D2C C;  2JKV A;  5KP1 A;  2FY8 A;  2K9J B;  1SQB E;  4GB5 A;  2KF6 A;  3CC7 3;  1VQ7 P;  1OPY A;  1W5Z A;  3FGA D;  3DZL A;  3U97 A;  2P0X A;  1BIR A;  3FF2 A;  1PGP A;  3OWS A;  1GMR A;  1S3J A;  2WPV B;  3BCC E;  3GMA A;  4GKG A;  4MEI A;  1QL2 A;  1STD A;  3M9Q A;  1H89 A;  2GBW B;  1RE4 A;  3ROB A;  1RGE A;  1S1C X;  2QEX 3;  2WT7 A;  2AXT E;  4RZM A;  3FG4 A;  1RNB A;  1ZR2 A;  2P1J A;  4HKV B;  2JDI H;  1OMI A;  1NTK J;  2A15 A;  2QG4 A;  3V2N A;  5CCG D;  2IYJ A;  3EBT A;  4BRY A;  1L4A C;  1N86 A;  2HMM B;  4UB8 H;  3L73 J;  3LTD A;  1J2J B;  1Q82 4;  1CYV A;  1DD4 A;  1LT1 A;  1OX3 A;  3Q1M A;  1K73 Q;  2E74 D;  2GUS A;  3GHG B;  1KIL E;  3I5C A;  3RL0 C;  3MKI A;  1O7M B;  3BU4 A;  3H1H G;  1FGO A;  1SQW A;  4WY4 D;  3OW2 O;  2XNX A;  1FZC C;  1QEX A;  1U7J A;  9RNT A;  3TYY A;  1UCI A;  2IFM A;  4N6J A;  1DX7 A;  2FNQ A;  1OVU A;  5KAF H;  1AVL A;  1U5O A;  1M1J C;  3KKG A;  3ZFZ A;  2YKQ A;  3L74 G;  3IF4 A;  2KSE A;  3MIW A;  1GOU A;  3KII A;  5AI1 A;  2PNC A;  3LTC A;  1PP9 J;  5FGO A;  1Y8A A;  1A90 A;  3MSO A;  3RNT A;  1SQB D;  2FXM A;  2KIK A;  5CJ0 A;  1CW5 A;  3AE3 C;  4HM1 B;  3EFG A;  3X41 A;  4Y28 J;  1NTZ K;  2CFD A;  3EFF K;  3FXD A;  2JJL A;  1LNQ A;  3H1L J;  3GLM A;  3SWK A;  3CCE P;  2AAD A;  1VF5 C;  3G8Z A;  3L70 E;  4EV5 A;  3BCC D;  1BE3 E;  5HGR A;  1X8Y A;  3M9H A;  3FG1 A;  1NTM J;  1PZQ A;  1RMS A;  2KS1 A;  1JBR A;  1VQ8 P;  3D3L A;  4HVN A;  3AE2 C;  1FUW A;  3T8N A;  2E76 D;  4JBZ A;  2AXC A;  1AA0 A;  2NPS D;  1RKY A;  1G2C A;  5AVT B;  2FXT A;  3PXM A;  1O7W B;  2IYO A;  3TNU B;  5KJ7 A;  3DUK A;  4EDF A;  3AEA C;  3HE4 A;  1LOV A;  1A2V A;  3V6I A;  3H1K J;  1RN4 A;  2KZI A;  2OYI A;  2Q7C A;  2F5W A;  4AKY A;  1UUW B;  3V98 A;  2D2C B;  1F8N A;  2H89 C;  1IFI A;  3CNM A;  2YIU B;  1GS3 A;  1S5L E;  4DZO A;  3Q90 A;  2AXT H;  1JKG A;  2YO3 A;  3AEG C;  2N9B A;  1JBT A;  2OTK E;  2ITA A;  3RK3 C;  3BNB A;  2CPB A;  5CBN A;  1ZR4 A;  1VQK 3;  3UL5 A;  3IN6 A;  1YIT 3;  4W7Y A;  1KQL A;  1P84 D;  2WSF H;  1LOX A;  2I8D A;  4XA4 A;  2YKO A;  3A76 A;  4LLH A;  3L36 A;  1X1W A;  1N5H A;  4DOJ A;  2F4Y A;  3PLN A;  3V2R A;  1EG9 B;  1M1K Q;  1WMO A;  2BAS A;  4ZKU A;  1FJK A;  1QLE D;  2W9Q A;  3H1H E;  5CLK A;  2G8Y A;  1VL2 A;  3NV0 A;  1WQL B;  1L4A B;  1VQO 3;  1GU5 A;  1VQ9 P;  2E5Y A;  2FYU J;  3L70 D;  3CCR P;  1HYF A;  2B9B A;  1DMM A;  3UB1 A;  1BE3 D;  1IFN A;  1UUG B;  3CD6 3;  2KK7 A;  3L74 E;  1L0L J;  1ROV A;  3E1I A;  1VQ7 3;  5KLV G;  1BRS A;  2Y0C A;  4LGQ A;  3RL0 B;  4RBN A;  4DT0 A;  2MJZ A;  3DGM A;  2HOD B;  4YXW H;  3KZT A;  3TDG A;  1SFC C;  1FZC B;  2W56 B;  2QVA A;  1VQP P;  2A45 I;  1YBK A;  3NM2 A;  1K73 4;  5KP3 A;  1M1J B;  1N73 B;  4WYK A;  4EOT A;  4ILF A;  2YO2 A;  4Y99 C;  1QGK B;  3NTN A;  4OK0 A;  3MTU E;  1IVW A;  1A2K A;  3SXX A;  3JUN A;  1W2Z A;  3A5T A;  5DRV A;  1BSB A;  4L73 A;  1YJ9 3;  1FGM A;  1BGY J;  1KQS O;  3VN0 A;  3H6P A;  3HUS C;  1PPJ G;  1N7S C;  1KQF B;  3CNX A;  1RGC A;  4OGQ D;  1RCK A;  1NJI Q;  2WPR A;  3I56 3;  3VP9 A;  4WP5 A;  3B5N A;  4W80 A;  4KT3 B;  3AE6 C;  1VF5 B;  3SOA A;  5JBS A;  4M3L A;  1BAN A;  1RQU A;  2XKM A;  4N6M A;  2P67 A;  1NTK G;  2IBZ G;  4L8P A;  1IVV A;  1MWR A;  2E2T A;  1UUV B;  3V4W A;  2QIY A;  2E75 C;  1T3U A;  1BCC G;  1VQN 3;  1RGK A;  1MFZ A;  4B86 A;  1QVG 2;  3H1H D;  1R8E A;  1S5L H;  1URQ D;  3A3Y B;  3B8E B;  3V5B A;  1NAF A;  4IL6 X;  4QWT A;  4CJN A;  2N1T B;  3F7X A;  1MKM A;  1LWU A;  5IER A;  4GIF A;  3L74 D;  2XND H;  3GF7 A;  1QAK A;  3OV4 A;  1NO3 A;  1IDP A;  1X0T A;  1NU1 J;  4EIJ A;  4KJM A;  4LGD E;  2B87 A;  4I6M C;  3DGY A;  2FXP A;  3CCE 3;  1FGT A;  1I0V A;  2W8Z A;  3Q5S A;  5CMZ A;  3M0D C;  1PP9 G;  3MZW B;  3RK3 B;  1VQ8 3;  2M8R A;  1M56 D;  1BNR A;  1YJW P;  1RRH A;  3ALA A;  5APS A;  2QGU A;  1NB5 I;  1HJB A;  2W6B A;  1I8V A;  3H1L G;  5APU A;  1HKX A;  2FKW B;  1IZN B;  5KLV E;  2IZ1 A;  4FMB A;  3FX0 A;  1LTI C;  1DE3 A;  1LNH A;  1B2U A;  3LTB A;  5G1L A;  1YHQ P;  5BU4 A;  4GT1 A;  4K3A A;  1DYU A;  3O8Y A;  4N6N B;  1AJY A;  1FW7 A;  3SFD C;  4HM8 B;  1M1K 4;  1SAR A;  4N6O B;  1KN7 A;  3LT9 A;  2I1K A;  1I3I A;  1LTJ A;  1BAO A;  4EYC A;  3H1K G;  5IG5 A;  1RCL A;  3BIR A;  1ULJ B;  6GSP A;  1SFC B;  2C9L Y;  1JN5 B;  1PPJ E;  4I7Z C;  2QRX A;  2Z7A A;  3IPT A;  2Y9Z A;  2JEE A;  3D6Y A;  2LQV A;  3LID A;  1B3S A;  2SAR A;  5APV A;  4Y99 B;  3BB9 A;  2M7O A;  1W00 A;  2LR2 A;  3JCU E;  3FLJ A;  3RGA A;  1Q40 A;  2P10 A;  4HM6 B;  3BNC A;  1AY7 A;  1W2B 2;  1EZV I;  1NTK E;  2IBZ E;  5CCH A;  4FCJ A;  3CX5 E;  1A02 F;  3HUS B;  1ZO2 A;  1GDT A;  4MN4 C;  3LML A;  1BCC E;  4AYC A;  2CHC A;  3H32 B;  1HJ0 A;  1V74 A;  1ZS7 A;  5AYR B;  3DY5 A;  3RGR A;  2A06 G;  1IT7 A;  1JCC A;  2J59 M;  1JY2 P;  1TU3 F;  3KDP B;  1NH4 A;  4R4L A;  1RHZ B;  1MWT A;  3LT8 A;  1FYS A;  1YNV X;  2SBL A;  3NHX A;  2E75 B;  3JSV C;  2HMO B;  2QEX P;  1CH0 A;  2N1T A;  2G3A A;  1OUN A;  1NJI 4;  1PU4 A;  3X42 A;  2OYH C;  2FYU G;  1NTZ J;  3BAS A;  2DW3 A;  4IIA A;  1NDO B;  4K61 A;  2WSC J;  1VQM 3;  2D2C D;  5EFW B;  3N8B A;  3F9S A;  1GL2 A;  1L0L G;  1JY2 O;  1TUH A;  2VRS A;  3CCV P;  1PFI A;  3S67 A;  3Q5P A;  1NAY A;  5GSP A;  2W9P A;  1PP9 E;  3D5G A;  2OTJ 3;  3TDK A;  3H1J J;  2CH9 A;  3Q1C A;  1SQX K;  3HTK B;  2KF5 A;  3I0Y A;  4J5G A;  3JUO A;  1KFM A;  5IEP A;  1Q90 D;  5AW3 B;  1KB9 E;  1IV7 A;  5D82 A;  4TX4 A;  3H1L E;  2P58 A;  3S27 A;  1PPJ D;  2GSP A;  1PGO A;  4H13 C;  4KHX A;  4XE5 B;  1FS0 E;  2W03 A;  5CBO A;  1BGY G;  3T97 A;  1OHS A;  3GZB A;  3AE1 C;  1GMJ A;  1X1Y A;  2O3O A;  1DVD A;  3LTA A;  1GW4 A;  1Z56 A;  1LRA A;  1TJD A;  3HZP A;  4XBX A;  5AYS C;  2N9Y B;  2P0M A;  1WMN A;  1AVO A;  3X3X A;  3OA7 A;  3HE5 B;  2KLV A;  1L4A D;  3V2Q A;  4GOD A;  5CCG A;  1C54 A;  3PRJ A;  2FGT A;  1NTK D;  3CX5 D;  3DGO A;  3D5I A;  4IFF A;  3EQ2 A;  3ZG0 A;  2P7J A;  5ELJ A;  1HZ1 A;  4YXD C;  3H1K E;  2F98 A;  1USD A;  3DH2 A;  1SJW A;  4LEH A;  1PL5 A;  3R4Y A;  1PV3 A;  1A02 J;  1KSI A;  4MJD A;  3W68 A;  1QL1 A;  2WSE H;  2XH9 A;  5CK6 A;  2V7Q J;  1OH0 A;  2W83 C;  2O1K A;  1UGI A;  2XEP A;  4WY4 A;  4N6U A;  5KTB A;  1SQP K;  2RMZ A;  2WZ7 A;  5AVX B;  3JCU H;  2CKF B;  3SOY A;  1E79 H;  3RK3 E;  1GSP A;  2M5A A;  1KYO E;  1FOS F;  3AE5 C;  3DGL A;  3KN4 A;  1KMI Z;  1IC2 A;  3CX5 H;  2I9W A;  2RN0 A;  4I7Z B;  2H0H A;  1OWA A;  1S9K E;  2XU6 A;  4C7N A;  1AR0 A;  1YJW 3;  3RK2 C;  3KXD A;  1IV9 A;  4EI2 A;  1I2F A;  3EJV A;  3CMA P;  1PP9 D;  3PP5 A;  3S29 A;  1FJP A;  2A06 E;  3CI9 A;  1GD4 A;  1Q86 Q;  5EQL A;  1VF5 D;  1KB9 D;  1QX8 A;  2L1S A;  5GTI E;  3NBB A;  2HMJ B;  1JB5 A;  3WA2 X;  4U3F J;  1NYH A;  2R44 A;  2RBI A;  3H1L D;  1BRH A;  2ZA4 A;  1JTH B;  2FYU E;  2QA4 3;  4HOH A;  4IFD K;  1MFT A;  3DGN A;  2KSJ A;  1NTM D;  4ZNC A;  1VQK P;  2GEX A;  3LW5 H;  1YIT P;  1GY7 A;  1L0L E;  2NPS A;  4LZI A;  5DRE A;  1KTM A;  3S9O A;  2HFE D;  3E99 A;  2W04 A;  2E2U A;  2E2V A;  3IAO A;  4J9A A;  2IUJ A;  2HPC A;  1KWI A;  1CSB A;  1RJO A;  1K04 A;  2N1T D;  5IEN A;  1A2P A;  2ZAE B;  5AIG A;  2OYH B;  4DCK A;  1IO4 A;  3H1K D;  3MP7 B;  2B88 A;  1KB9 H;  2CX1 A;  4PD4 E;  3RGU A;  1S2E A;  2WQY C;  1VQO P;  5KLI C;  1BDD A;  1GY6 A;  3B5N C;  4EC6 A;  3UIA A;  1VDF A;  1BGY E;  1RF1 B;  3CD6 P;  3LOY A;  3RBX A;  2UUG C;  5M1A A;  2XGN A;  3IMA B;  1DD3 A;  2YMK A;  2Y74 A;  2ZDJ A;  3RK3 D;  1NU3 A;  2Q9I A;  4NPF X;  1KYO D;  3SX1 A;  1ZX2 A;  3OXA A;  5BXQ A;  2E5T A;  1N5P A;  1OF5 A;  4HM2 B;  3G71 3;  1HVV A;  4Z1M H;  1EEJ A;  1S9K D;  5AW9 B;  1N8Q A;  3MWZ A;  3L4F A;  4IT7 A;  2ZXX A;  1SVF A;  2STD A;  4MMX B;  4N6T A;  1WMK A;  3NX0 A;  1SLQ A;  4ASW A;  5BU8 B;  3GZR A;  4L76 A;  2YFL B;  4ORL A;  4L74 A;  2A06 D;  1ZV8 A;  3IJE B;  4HM5 B;  1YJ9 P;  3MGN A;  2F86 B;  2O9U X;  2KAA A;  4OVN F;  1RLS A;  1QVF 2;  1UGH I;  2M3E A;  2WSS H;  2FBW C;  3CCJ 3;  1Q81 Q;  1MGW A;  1K05 A;  4EW5 A;  2ZHX B;  2FYU D;  3CCV 3;  3I56 P;  1KYO H;  2CX0 A;  3NFQ A;  3K9M C;  3PYJ A;  2CIU A;  2FFD C;  5AW4 B;  3CCU 3;  1LTB C;  1NOH A;  1L0L D;  1NTZ G;  1SFC D;  2LKM A;  3D70 A;  1ZRT E;  2RNT A;  2IUK A;  3AHS A;  4H61 A;  2HMN B;  1PIX A;  3SFE C;  2XV5 A;  1VQN P;  4KT0 J;  1FAV A;  3D79 A;  3S1K A;  7GSP A;  3JVC A;  4PD4 D;  5GTI H;  2MF7 A;  1L0N K;  4H0L C;  2AEF A; 
#chains in the Genus database with same CATH homology
 5IEO A;  1VZZ A;  1K73 4;  3EBY A;  5KP3 A;  4OVM A;  4WYK A;  3F40 A;  3F7S A;  1FGQ A;  3ER7 A;  2B24 B;  4OK0 A;  1IVW A;  1A2K A;  3SXX A;  1TFO A;  2WGO A;  3EB8 A;  3JUN A;  2ML5 A;  1W2Z A;  3K7C A;  1BSH A;  4FCM A;  5TGN A;  3VGN A;  2BMO B;  2XFT A;  5DRV A;  1Q42 A;  3LZA A;  3PZW A;  1FGM A;  1YJ9 3;  1R4C A;  3JUQ A;  1OHO A;  2CG0 A;  3CC2 3;  1N8R 4;  3PGB A;  1RRL A;  3CNX A;  1CYU A;  4XBY A;  3SLU A;  5KP4 A;  1BUQ A;  3I56 3;  3EF8 A;  3J7Y d;  3CCQ 3;  4KFD A;  1O7G B;  1VQ9 3;  4HZB B;  4WP5 A;  2BO9 B;  3SOA A;  3CCR 3;  3USS A;  2XSH B;  2YFJ B;  3Q2P A;  1MNL A;  5JBS A;  1Q86 4;  3FGY A;  3S5C A;  3U1W A;  4N6M A;  1BSN A;  2CWV A;  3MHE A;  3HII A;  4L8P A;  1IVV A;  1K8A 4;  2E2T A;  1UUV B;  2BNG A;  2QIY A;  4STD A;  3VSY A;  3LYG A;  1VQN 3;  2CWT A;  2D1W A;  1EA2 A;  1QVG 2;  2C10 A;  1VQ6 3;  5G2G A;  2OOV A;  5AEW B;  1KQS 2;  4BTX A;  5IW9 A;  3FZW A;  1VQP 3;  4BTY A;  3CMA 3;  2LYX A;  1YIJ 3;  2BMR B;  4QWT A;  5BVB A;  2CFK A;  4AEQ A;  2KXG A;  3F7X A;  4X2H A;  4BTW A;  4KVH A;  5A0O B;  2QE7 H;  5IER A;  3MG3 A;  2XND H;  3PS8 A;  1K9M 4;  1YJN 3;  3EHC A;  2GBX B;  3T0U A;  1SPU A;  1QAK A;  3LXU X;  5IF6 A;  2P05 A;  1D6Z A;  2BMQ B;  3OV4 A;  1NO3 A;  1IDP A;  4WFO A;  4MMY B;  2YX9 A;  2OOV C;  3CCE 3;  1FGT A;  1VQ8 3;  4XM4 A;  1J2B A;  1UW1 A;  1FA3 A;  4XB5 A;  1RRH A;  1VQ4 3;  3ALA A;  3VF1 A;  2C11 A;  3GZX B;  3V99 A;  3UJM A;  3BNE A;  2QGU A;  3CPW 2;  1NB5 I;  1JV2 B;  1VQL 3;  1HKX A;  1JKG B;  4EBG A;  1TFK A;  3H51 A;  1OF5 B;  1OHP A;  4FMB A;  4N3V A;  3WA3 A;  3CCL 3;  4HM4 B;  3RDE A;  3K0Z A;  1DMN A;  1LNH A;  3OWY A;  1OAC A;  1O7N B;  1JB4 A;  1E3V A;  3N9H A;  1W01 A;  1JB2 A;  3LTB A;  2W0Q A;  4N6L A;  1DYU A;  5JPP A;  3O8Y A;  4N6N B;  5D83 A;  5AEU B;  4HM8 B;  3AMO A;  2XF3 A;  1Q81 4;  1M1K 4;  4FCZ A;  2IMJ A;  3NBR A;  4N6O B;  3LT9 A;  3EN1 B;  3NQZ A;  1KD1 4;  3FG3 A;  5IG3 A;  1GY5 A;  4EYC A;  4HM0 B;  3CU3 A;  1E3R A;  1D6Y A;  4R9L A;  5CF1 A;  4K90 B;  5IG5 A;  1U8C B;  1YVB I;  4KZ1 A;  1QMA A;  1ULJ B;  3NV0 B;  4X2O A;  1KC8 4;  2MC8 A;  3HK4 A;  1JN5 B;  1GD3 A;  4JF8 A;  3EC9 A;  3GWR A;  2YFI B;  1E97 A;  1A67 A;  5AII A;  2Z7A A;  2RSX A;  2CG1 A;  3IPT A;  2LQV A;  1W6Y A;  1CEW I;  1W6C A;  1W7C A;  4FMC A;  4R80 A;  3STD A;  3BB9 A;  2M7O A;  1AV4 A;  1W00 A;  5D81 A;  2CFG A;  3FLJ A;  3RGA A;  1PFP A;  1Q40 A;  3X40 A;  3H3H A;  4HM6 B;  1GYB A;  3BNC A;  5IG4 A;  1W2B 2;  1Q7Y 4;  2OCT A;  4MMZ B;  2OQE A;  2KRT A;  1IQX A;  1DMQ A;  2CW9 A;  2L4V A;  3CCM 3;  1US1 A;  3PCR A;  4FCJ A;  2K0M A;  3L0R A;  2ML6 A;  2D42 A;  3KSP A;  4DJG A;  4ZM8 A;  1ZO2 A;  4PEJ A;  4XBT A;  3KFQ C;  3LML A;  2GU3 A;  1TIJ A;  1CQS A;  2CHC A;  3DMC A;  3MG1 A;  1V74 A;  1D6U A;  1MOL A;  4WYK B;  5AYR B;  3DY5 A;  3CXC 2;  5CF2 A;  3RGR A;  1IT7 A;  3X3Y A;  3D9R A;  1YHQ 3;  3X3Z A;  3LT8 A;  4LSO A;  2SBL A;  2OQE C;  4K1U A;  3NHX A;  3NM7 A;  2HMO B;  4CDL A;  1W02 A;  7STD A;  4WWU C;  1NB3 I;  1OUN A;  1QAF A;  1NJI 4;  1PU4 A;  3X42 A;  3NXJ A;  1JEK A;  2INX A;  3F8H A;  4IIA A;  1NDO B;  4K61 A;  1VQM 3;  3UL6 A;  3NBJ A;  2CK3 H;  3G4S 3;  3N8B A;  3F9S A;  1VQ5 3;  5ELU A;  1TUH A;  1OGX A;  1JJ2 2;  2HMK B;  2BT3 A;  1Y4K A;  3S67 A;  3GRD A;  2W9P A;  1IVU A;  4FR9 A;  4Q53 A;  1SII A;  3B4P A;  4NHF A;  2OTJ 3;  2CH9 A;  1IQ8 A;  4RNZ A;  3Q1C A;  1ISK A;  2WO0 A;  4KFE A;  4NRE A;  3ECF A;  3I0Y A;  3JUO A;  4RNY A;  3K63 A;  1NWW A;  2XR8 B;  5IEP A;  5KP1 A;  1OCV A;  4WVZ A;  1IV7 A;  4GB5 A;  3FKA A;  3CC4 3;  3CC7 3;  4IPB A;  3DXO A;  5D82 A;  3WMD A;  2CWU A;  1OPY A;  1W5Z A;  4TX4 A;  3DZL A;  5LC6 A;  3S27 A;  4O02 B;  3FF0 A;  3U97 A;  2JQ5 A;  2P0X A;  4OUQ A;  1LXE A;  3MPH A;  3N54 B;  1FS0 E;  2Q07 A;  2W03 A;  2R4I A;  3FF2 A;  1ROA A;  4HM7 B;  5LC7 A;  1OHS A;  1AQT A;  3GZB A;  3OWS A;  2O3O A;  1DVD A;  3V92 A;  3LTA A;  3KSE D;  4AKZ A;  3HZP A;  4H3U A;  4XBX A;  5AYS C;  3BLZ A;  2P0M A;  3T8U A;  1WMN A;  3HIG A;  4MEI A;  1STD A;  2GBW B;  3X3X A;  4TLF A;  4JRF A;  3ROB A;  4FMA A;  2QEX 3;  2FGT A;  2WOH A;  2IA7 A;  1ULI B;  3OWU A;  3FG4 A;  4RZM A;  4HKV B;  2JDI H;  1UI7 A;  5FW5 A;  3DGO A;  4N6V 0;  2A15 A;  4R1K A;  5ELJ A;  4FMD A;  2F98 A;  3G16 A;  2GXF A;  1SJW A;  4LEH A;  4MJD A;  5AIH A;  1KSI A;  3EBT A;  2W56 A;  4HM3 B;  2GEY A;  2HMM B;  3M8C A;  4HBR A;  1S72 3;  2CFL A;  3EE1 A;  2XH9 A;  3LTD A;  3MG2 A;  5CK6 A;  1Q82 4;  1CYV A;  4G1M B;  2Z76 A;  1OH0 A;  3GZY B;  2XEP A;  4R9K A;  4N6U A;  3QK9 A;  1TU5 A;  4KFF A;  2CKF B;  3G0K A;  3MKI A;  1E79 H;  1O7M B;  1QJG A;  3SOY A;  3WOE B;  1FGO A;  1SQW A;  4L8O A;  3WOD G;  1STF I;  5EEO A;  3DGL A;  3KN4 A;  4GL6 A;  3HI7 A;  2I9W A;  1M9G A;  2FNQ A;  2B1X B;  3EQQ B;  1AR0 A;  1AVL A;  1U5O A;  2RFR A;  3K5T A;  5IG0 A;  1IV9 A;  3KKG A;  1YJW 3;  1EQK A;  2V1L A;  2GU1 A;  3EJV A;  1FGR A;  3KII A;  3AMO B;  5AI1 A;  1ASK A;  1JNQ A;  2V7Q H;  1WTH A;  2PNC A;  3WOF B;  4I4K A;  3S29 A;  4O3V A;  4EXR A;  3LTC A;  2PZV A;  1GD4 A;  2OWP A;  5FGO A;  5EQL A;  1A90 A;  4HJL B;  3MSO A;  2W2C A;  4O2H A;  4XDW A;  3NBB A;  2HMJ B;  3B7C A;  4HM1 B;  1JB5 A;  3WA2 X;  3X41 A;  2P38 A;  3FSD A;  2QA4 3;  2CFD A;  3EFF K;  3EX9 A;  3CPO A;  2Z6B A;  4LMI A;  3SVA A;  3DGN A;  3G8Z A;  1RN7 A;  3WDG B;  3OW2 2;  1YGE A;  1AVK A;  4EV5 A;  2GEX A;  1W6G A;  1Q40 B;  1GY7 A;  3LH4 A;  3PCS A;  5HGR A;  4LZI A;  1WMP A;  5DRE A;  3FG1 A;  3B8L A;  5AIF A;  3E99 A;  3D3L A;  1S5A A;  4HVN A;  1FUW A;  3T8N A;  1TP6 A;  2W6J H;  2E2U A;  2W04 A;  2E2V A;  2IUJ A;  1IU7 A;  4J9A A;  3SED A;  1KWI A;  1RJO A;  5IEN A;  5AIG A;  1RKY A;  2FXT A;  3PXM A;  3FH1 A;  1O7W B;  2XSO B;  2CC3 A;  3NQY A;  1YI2 3;  1K28 A;  3DUK A;  1IT8 A;  3CME 3;  4XDV A;  3PJS K;  1A2V A;  1EKM A;  3HX8 A;  1SIH A;  4WHA A;  4J8T A;  1GY6 A;  1LVN A;  4EC6 A;  3B4O A;  3JUM A;  1HU9 A;  1IFP A;  4AKY A;  1UUW B;  3LOY A;  3MYT A;  2BHM A;  3S28 A;  3V98 A;  4EV2 A;  2XGN A;  1G96 A;  2P09 A;  5CXO A;  1F8N A;  1DVC A;  2RCD A;  3IMA B;  1Z1S A;  3CNM A;  2Y74 A;  2ZDJ A;  1L5G B;  1NU3 A;  4HZ9 B;  1WNH A;  1GS3 A;  1C7H A;  2RGQ A;  3SX1 A;  1ZX2 A;  3OXA A;  5BXQ A;  3Q90 A;  3FCS B;  2E5T A;  1JKG A;  1N5P A;  3EN8 A;  1OF5 A;  4HM2 B;  3G71 3;  3NUV A;  1N8Q A;  2F99 A;  3MWZ A;  4IT7 A;  4MMX B;  3CCS 3;  2STD A;  1M90 4;  4N6T A;  3BNB A;  3NX0 A;  3QRD A;  3GZR A;  1VQK 3;  4CCV A;  2YFL B;  3UL5 A;  3F8X A;  1YIT 3;  2WGQ A;  4ORL A;  1LOX A;  3IJE B;  1UI8 A;  4R4K A;  3A76 A;  4HM5 B;  2K54 A;  2F86 B;  2O9U X;  1M1X B;  3UNL A;  2XRX B;  2ZL8 A;  5JPU A;  1N5H A;  2HML B;  2Y73 A;  1QVF 2;  8CHO A;  2WSS H;  1EG9 B;  6STD A;  3CCJ 3;  1WMO A;  2UX0 A;  3KE7 A;  3GAX A;  1JRQ A;  4HYZ A;  1IK3 A;  2W9Q A;  1QAL A;  5CLK A;  3NV0 A;  3G6E 3;  1WQL B;  3CCV 3;  3K9M C;  1IVX A;  3PYJ A;  1VQO 3;  1JN5 A;  4QMA A;  2CIU A;  5EVH A;  3CCU 3;  2E5Y A;  2XGL A;  1DMM A;  3BND A;  1OGZ A;  3UB1 A;  2CFW A;  4L7K A;  2XFS A;  4K1V A;  3CD6 3;  3OX9 A;  1W4N A;  1ROV A;  3JUP A;  1VQ7 3;  2IUK A;  4U13 A;  4LGQ A;  4H61 A;  2HMN B;  1O7H B;  2OTL 3;  5I97 A;  4RBN A;  3DM8 A;  1N9J A;  2Z77 A;  1O7P B;  2KCD A;  3DGM A;  3I55 3;  4O8S A;  4YXW H;  3KZT A;  2WOF A;  3TDG A;  3F14 A;  3JVC A;  5STD A;  1T5Y A;  1IQY A;  1K41 A;  1N9E A;  2MF7 A;  2W56 B;  3NM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...