2W6JH

Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 5.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
b'SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL
publication title Improving diffraction by humidity control: a novel device compatible with X-ray beamlines.
pubmed doi rcsb
molecule tags Hydrolase
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2w6jH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w6jH01
3USSA 2WSSH 4WVZA 1BSHA 1AQTA 4DJGA 4TLFA 2CK3H 2JDIH 1E79H 2E5TA 3PJSK 1BSNA 2XNDH 3EFFK 4YXWH 2E5YA 4QMAA 2W6JH 1JEKA 1IFPA 2QE7H 1FS0E 2V7QH
chains in the Genus database with same CATH superfamily
2KOGA 3D4AA 3BCCD 3F14A 1QL1A 3SSUA 2WO0A 1JMBA 2YX9A 5AW4B 1LTIC 2RCDA 3CCSP 3JVCA 2ZFCA 2GU3A 1X9VA 1TRPA 1GU5A 2K54A 1U7MA 3LTDA 5M1AA 3SLUA 1TU3F 3D70A 1QVG2 2WOHA 4WFOA 2Z76A 3MUDA 4HM6B 2H7HA 1RNTA 2BIRA 1JY2O 2PP6A 1MGWA 2OTJ3 1KILD 3VYIA 1LQGC 4HH2A 3BCCE 5EFWB 1I3IA 2JO1A 3JCUH 1T2HA 3FLJA 3NBJA 1ROVA 2BO9B 1MOLA 1YHQ3 5KAFE 3S9OA 2UGIA 4EV2A 1IFNA 1NO3A 2Q9IA 2B24B 3L73J 3B5ND 2WSEH 3K7CA 1YQ3C 1JY3P 3DM8A 3X3ZA 5IENA 1X1UA 1N5HA 2P38A 3IAOA 1YI23 1N2DC 1L0LK 2FYUJ 3MP7B 1S72P 5APSA 5KLIC 3AE1C 1X1XA 1KILE 1YTZT 2WT7A 1VQ93 8RNTA 1FZUA 2D2CC 1NTZD 3AE4C 1A2VA 2HMOB 1ZW0A 1RN1A 2NRGA 1SS1A 4BRYA 3WOEB 1AVYA 1L0LG 1VF5C 2RSXA 3NMDA 1JY2P 3PCSA 4MEIA 3LTCA 1M90Q 1X8YA 2PRRA 2HLOA 2Q5UA 3K5TA 1KQFB 1EG9B 3BNDA 4R80A 5H2FH 1FOSF 3KSED 1BSEA 1NVOA 1CI6A 5CCHA 2W27A 4I7ZB 1EA2A 3PCRA 4GB5A 4N6UA 4YXDC 4HM5B 5A0OB 1LWUC 1NTZE 3FGAD 2W04A 1EQKA 2YXRB 2KXPB 2OYIB 1FUSA 3CL3D 1HWTC 4H13C 2B87B 1JB4A 5IG4A 1YNVX 3Q5PA 4U3FD 3E99A 1M904 1KQGB 3IF4A 5E79E 4HB1A 1L2PA 2XV5A 1VL2A 3SYUA 3QRDA 4LEHA 3AEEC 3CC7P 3CPW2 2H89C 5IEOA 1IU7A 1STDA 1V57A 4D6TD 3CX5D 3FWLA 3L74G 2M8RA 1UIXA 1SIHA 1ZGXA 2GU1A 1Y47A 1DMQA 3LT9A 3ITKA 3HD7B 4TT3H 3N54B 2DW3A 2R4IA 1DETA 1YJNP 1FGTA 1OVVA 4OK0A 3F40A 2BT3A 1FC2C 1SQXJ 1UW1A 3B5NA 4U3FE 2Z6BA 1OACA 3JCUE 2QJYB 3ER7A 2XDJA 1LT9A 4LYLB 1L4AB 1JB0J 3CX5E 4D6TE 1H8AA 5DRVA 1EUIC 4MMZB 2OARA 2ZYGA 3TDGA 1VQ83 3CNXA 1B21A 1SQVK 3OW22 1HJ0A 2RBIA 3WHOA 1BIRA 1G0TA 3L72G 1GL2A 2P1JA 1G1IA 5AVTB 2FFDA 3ZG5A 2QVAA 3T97B 1KFMA 3SWYA 2OYHA 3MHVA 2Q3EA 2JWAA 4IFMA 2RKLA 2WZ7A 2G3AA 4RBNA 1HVVA 1JV2B 2WSCH 2ZT9B 3HUSC 3LTAA 4EBGA 4FMCA 1LTJA 4ASVA 1T3BA 1IK7A 2BMOB 1ZRTD 1LVNA 2Y0EA 2GEXA 3G16A 1RGCA 1FZGA 2AEMA 2HG5D 3G3ZA 5AW6B 1B2XA 5AW2B 3CCS3 1OW7A 1G1JA 3V4QA 2E2VA 3CWBJ 1RGAA 1UCLA 3KIIA 3A0HH 1OFCX 2P58A 1I2GA 3G8ZA 2B88A 2ZL8A 3HE4A 1EZVD 3CCRP 3RBZA 3VGNA 5KKZC 3UNLA 1MNLA 3B8LA 2XSHB 1A67A 6STDA 4H0LD 2E76B 1M7LA 1BRSA 1DYUA 1ULJB 1OW8A 2NPSC 2E2TA 1ZRTE 1N7SB 1TU5A 4FCMA 2F86B 3KZIH 1Q90D 3GHGC 2LYXA 1T3JA 1O7PB 3H51A 2HODA 4IL6X 1DX7A 2V7QH 1ZOYC 3HX8A 1EZVE 4WVZA 5AVQB 4DOJA 1VQ73 2IDBA 1NAFA 1VQMP 4TLFA 3PLNA 1OGXA 3FG3A 5LC6A 1S723 1K8AQ 1PFIA 4N6JA 3B71A 1FZCB 1US1A 3CCJP 1RGEA 3AHWA 7STDA 2M3EA 4C7NB 3V5BA 3GLMA 4R4KA 1EDIA 1RCLA 1PZQA 1IDPA 4ORLA 2F98A 1L4AD 4NPFX 1SFCB 2IMJA 1S5AA 2KI7B 5JBSA 3IPTA 1IC2A 2YXQB 3WUVA 1BDCA 1W7CA 1K8A4 1SQBD 3EFGA 3N9HA 2JQ5A 3OV4A 3V92A 1NOHA 4H44C 1IFJA 3L75G 1RDSA 2V4HA 4N6V0 1Y9BA 1VQLP 3X41A 2P10A 2C10A 1GD2E 2LXCB 1TIJA 3CNMA 1BE3D 2P09A 4KT3B 1EXJA 1OGZA 1OXZA 3L0RA 4CCVA 1YQ4C 2WGQA 1RRLA 1X1WA 2LQVA 4HKVB 1HBWA 4X2HA 1KD1Q 5DJUB 1N8RQ 1ZXGA 2PNCA 1B2SA 1SQBE 1WQLB 3LOYA 3RL0C 3TNUB 1LTSC 3N4XA 2OYIA 1FDOA 4K90B 1FU1A 3NFQA 4MMYB 2GA1A 2JWDA 3H1KD 5IF6A 1I3FA 3OWYA 1BE3E 3AE5C 2B87A 1W00A 2RFRA 3PHLA 3IN6A 5KP4A 4ZKPA 1YJN3 3H6PA 4XBXA 2W9PA 1NTZJ 1KD14 3S1KA 1L0ND 1N8R4 4WY4C 3RK2C 1D6ZA 4HM7B 3TK1A 1OUNA 3L73G 3PZWA 3QK9A 3M9HA 1GOVA 3WR2A 3HD7A 5KAIH 1FW7A 3T8UA 3H1KE 1YITP 2CPSA 1Z1SA 2K0MA 2FYUG 2OTKE 1ZMEC 2L4VA 2Y0DA 1JJ22 2W0QA 4GOEA 3PYJA 1VQOP 4B86A 3Q1CA 1L0NE 1LXEA 1WT6A 1I2EA 3S67A 3VSYA 1L4AA 3ZDMA 1WNHA 3F7XA 1TP6A 4JYBA 1N73C 3CCU3 4U3FJ 3H3HA 4HZ9B 3AMOB 3C1LA 3F8XA 4FR9A 1PGQA 2C0XA 3RNTA 2XNXA 3OJAB 2HYNA 4L74A 3V2QA 1N5PA 1W6YA 3L74J 1EDLA 4D6TJ 1SFCD 2D42A 3T97A 2CKFB 1LNHA 4XM4A 2E75C 4NREA 4R9KA 5AIFA 1NU3A 1J1DB 2W6AA 3H32B 3HIIA 5JPPA 1W2B2 1NGMB 3HRNA 4JYCA 2QA43 5AVYB 1RE3A 2LKMA 4PV1D 3RK3B 5CCGC 1NYHA 3NUVA 1HKXA 1FJKA 3DXOA 5G2GA 3FF2A 1S5LH 1PPJG 1RH5B 1X0TA 1SQXK 1Q81Q 1I2FA 4RNYA 1IVXA 2GXFA 3EN8A 1EZVI 3DGOA 1FA3A 2ZDJA 5BVZA 3U1WA 1BUJA 1MGRA 4HAAA 1AQZA 2K1AA 2E74C 2HMNB 3UL6A 3AEAC 1CI6B 2E5TA 2XFSA 1PP9D 1N7SA 1Q814 3LH4A 1MKMA 4BL3A 1N7LA 3T0UA 3EJVA 2OQEC 3GZRA 3AHSA 3W67A 1NNVA 2XGNA 1BSHA 1OF5B 4OH8B 3T8NA 1RQUA 3STDA 3CCVP 3MGNA 5AIIA 3VP9A 1RF1C 3Q5SA 2WPRA 1VQNP 1FZCA 3WU2H 1PP9E 2KF5A 1HTLC 2W56B 3H1LD 1P84D 3GF3A 4EIJA 2JR8A 1FS0E 1VQL3 3CD6P 3UB1A 1IYYA 4Y28J 3G4SP 4C7NA 1KWIA 3NV0B 2QJPC 3JSVC 3H25A 5M19A 1XTGB 5KP1A 2P67A 3MUDC 1SFCA 5D83A 2YMYA 3JUQA 4WBAA 3WUTA 5KAFH 1NB5I 3KN4A 5AYRB 5HOHA 1T5YA 3RGUA 3BNCA 2KP8A 3CWBG 3DUKA 3H1LE 1P84E 2IUKA 3NM2A 4O2HA 1LOVA 2KNCB 5AVVB 2Z5HA 3CCMP 1RGHA 1A02J 4XE5B 1QALA 1SQQG 3AE7C 3M06A 5KJ7A 1QJGA 2KXGA 1URQA 5GTHE 3TNUA 3RGAA 2ZAEB 1QL2A 1YBKA 2KZIA 5KLIB 5TISE 1VQ8P 3BNBA 5D82A 5CK6A 1SIIA 2D2CB 3RL0g 3GZXB 3S27A 1RE4C 3AE3C 2JKVA 1KC84 2ML5A 1KN7A 4L8PA 2AADA 4RKUJ 5M1BA 3OWUA 3MZWB 1Q824 4CPGA 1VF5B 3CLQA 1SQQE 1UUWB 3DZLA 1JKGB 2WQYC 1FGOA 1VQO3 1BE3J 5CCHD 2UX0A 1JEKA 1I0XA 3CCEP 2ML6A 3GRDA 1BNIA 2WOFA 1RMSA 2GBXB 4N6OB 3U1AA 1TFKA 3BCCG 4EI2A 1O7HB 3II6A 5E79H 2W9QA 1LWUB 1LP1B 3IR9A 3PH0A 1IVVA 2O9UX 1SVFA 4WWUC 1K41A 1U57A 3CXHD 1NTMD 4H13B 4NPBA 2GEYA 3WU2E 1R4CA 4KFDA 4PD4D 7RNTA 2V7QJ 2HODB 3H1KJ 2ZYDA 1G2CB 3P8MC 1KYOD 3KFQC 1LTAC 1S1CX 1KILC 5EVHA 1EC5A 3K9MC 3KDPB 3AMOA 1R8EA 3ZG0A 1JCCA 1NU1D 2YFLB 1QX8A 1JCDA 3GF7A 5IG3A 1LGHB 3B5NC 3TF5A 1QAFA 5BU4A 3B4OA 3G9RA 1U8CB 5M18A 2K9YA 1NTZK 3CXHE 3CX5H 1NTME 3KSPA 3L70D 3H32A 1DH3A 2KF6A 2ZA4A 1VQ7P 2YO3A 3KPEA 4PD4E 2M7OA 5AIGA 3V6IA 1KYOE 3F7SA 2YNYA 3BU4A 4FMBA 2KCDA 3SFDC 2AEFA 4GT1A 1DEEG 2Y73A 3EN1B 1NU1E 3DMCA 4I2LC 1KQSO 1FZAA 1IFDA 4EYYQ 1F8NA 3AGOA 1IQ8A 1GSPA 4XBTA 1NTZG 3PS8A 1G96A 2Y0CA 1MWTA 2OWPA 1J2BA 1Q40B 1FDMA 3PGBA 3FGYA 3DGNA 1MWRA 1GL2D 3PP5A 3EX9A 1GMRA 2K9JB 4Z1MH 3NQYA 3RDEA 3CC4P 3L70E 2AEJA 1UCIA 1W5CE 1Q7Y4 4XDWA 1JRQA 2K3RA 1GK4A 5LC7A 1BNEA 3CCV3 1I70A 4KFFA 1K04A 1SARA 4AYCA 2IBZD 2QJKC 1VQN3 3U1CA 1JBRA 5GTIH 3U97A 3AEDC 3KXDA 4EV5A 1BRHA 5I97A 2R5BA 1BRIA 1OF5A 3EWKA 1JZDA 4U3FG 4OVNF 1EXIA 1R5LA 3CD63 2WWWA 5B66E 3G4S3 3V2NA 4BTYA 2J58A 5CF1A 4R9LA 1GMQA 2O1JA 4OGQB 5KKZB 2MKVA 1B2UA 4I5QA 1GU4A 3RGRA 4D6TG 1QVGO 1J1EC 3Q3FA 1YGWA 2BHMA 5FGOA 3NHXA 2W56A 1GTWA 4I6MC 2BU4A 2IBZE 4G1MB 3OX9A 1JBSA 5AW3B 3BVHA 1AY7A 3NV0A 1VQ4P 2MF7A 1DMNA 3GHGB 1OWAA 1ISKA 1HF9A 2IA7A 2NZ2A 1LTBC 1AVOA 1PP9J 1GOUA 2RNTA 1UUVB 3CCM3 1A2KA 5APQA 3AGNA 4LC1A 1DMMA 4JQ0D 1JY3N 4NPEA 1K734 2YKOA 3LYGA 4RNZA 3K5BA 2H0HA 3OAKA 4ZNCA 1Q864 3MKIA 2ZHXB 4KZ1A 3SVAA 2KNCA 5BIRA 2F5MA 1UI8A 1IVWA 4O8SA 1STFI 3JC22 1OHSA 3WMDA 3MIWA 2SARA 3FWNA 4K35A 3H1LJ 3CCUP 2QE7H 1KSIA 1NAYA 1JY2N 3LW5J 1RN4A 1ZV8A 3OWSA 3LTBA 4KHXA 4H44B 3CCE3 5AVWB 1T2IA 2UUGC 2R3SA 1BU4A 3WMM0 5TGNA 2IFMA 1BSCA 2W83C 1NJI4 1BANA 3AEGC 3M0DA 1W01A 2QA4P 1JKGA 1SQVD 1LNIA 1RRHA 3EBTA 1RY3A 2YIUB 1EZVG 4FMAA 1NHLA 3S4RA 4RZMA 5GTIE 4H0LC 1BRJA 3S28A 1IT7A 1FE6A 2KB7P 3O8YA 1LWUA 1LP1A 1PY3A 1SQQJ 3UJMA 2QIWA 2KK7A 2XSOB 4EDFA 1AA0A 1NKNA 1OIPA 2KS1B 3CPWO 1RQVA 1A02F 1KZUB 1MFTA 1TFOA 3S5CA 1MWUA 3NQZA 1HU9A 4OGQD 1SQVE 1RGLA 1G2CA 1Q2NA 1ZX2A 1W5ZA 2WSSH 1FGRA 1GYBA 1N9JA 4Q53A 4WY4B 2PGDA 3S29A 1VPCA 3HD7D 1VQQA 1CH0A 3FX0A 4HJLB 1K28A 5AW9B 1PL5A 3GW6A 4YXWH 1LOWA 1SP4A 3I55P 4GL6A 1WMPA 2OOVA 2CW9A 2R41A 4DT0A 2FYNB 1IVUA 3KE7A 4LZIA 1S2EA 2KYVA 1WMNA 2H43A 4JF8A 3BCCJ 2A06D 2Y74A 3OW2O 2OCTA 3PTZA 3CC43 1PFPA 2LXBA 6GSPA 2CX0A 9RNTA 1CEWI 5IERA 1K9MQ 2Z4EA 2YO2A 1NTMJ 5AIHA 1SQBG 1N73B 1JO5A 1T2KD 2WSFJ 1W4NA 1CSBA 1FZEA 1Q40A 2FXTA 4KFEA 5AW8B 3CCQ3 2A15A 2FGTA 3L71D 2K9JA 2O01N 2BCCD 1BE3G 1BVIA 1PGJA 3MG3A 1M1KQ 1AV1A 2FNQA 4ZKUA 3VF1A 3D5GA 5STDA 2A06E 2N1TB 1RGFA 1O7WB 2HR3A 4L75A 2QM7A 1V58A 2E75B 2H0GA 4HM3B 1K9M4 2ZT9D 1MUUA 2JDIH 4JBZA 3GMAA 1AJYA 2KZJA 3N7NA 2K88A 1URQB 2P05A 3HUSA 3L70J 2R3CA 1PIXA 3VOPA 5CJ4A 2HMJB 1RGKA 2IYJA 1M1K4 3H1KG 1BGSA 3NTNA 3L71E 3R4YA 2BCCE 3AE2C 4CDLA 1OX3A 1GMPA 3H1HD 1OCVA 2GSPA 1VQ43 1KORA 1GS3A 4N3YB 3B4PA 2KF4A 1L0NG 2FYUK 4HBRA 4N6LA 3SXXA 1RKYA 2E76D 1M56D 4YTPC 3CX5I 1DEBA 4HM4B 1USEA 5CLKA 5CBNA 3SOAA 1S3JA 2IYPA 2CWVA 3EBYA 3X40A 2XR8B 1ROAA 3I5CA 2E74B 1N7SD 3J7Yd 1Q7HA 1IK9A 3AEFC 2CX1A 2XH9A 2SPZA 2OQQA 1USDA 2N9YB 1BCCD 1YVSA 1BSDA 3GHGA 5KP3A 1TRQA 2QEXP 3H1HE 2P7JA 2K37A 1BSNA 2Y9ZA 4FCZA 4NHFA 1LTTC 1PYLA 4O02B 3A76A 4Y99C 1PGOA 2XEPA 4I4KA 1UCKA 4K1VA 3KCHA 1R5SA 5AVUB 4O9BA 2KLUA 1GY7A 1LNQA 3CI9A 4BIRA 2C0WA 1RF1B 2GBWB 1BOXA 5IG0A 1FYSA 3NBBA 1BUQA 1LRAA 1N86A 1BCCE 1SFCC 3EF8A 3FSDA 1OZHA 3Q90A 1T8ZA 3HTKB 1FBMA 2O01H 2AXCA 1FUWA 1K05A 2FKWB 4RO0A 3GAXA 4HM2B 4PV1C 1P84H 2RH0A 5ELJA 2JP3A 1L5GB 3LW5H 3JUMA 2WPQA 1RF0C 3AE6C 1QVF2 1DD3A 5AW5B 4FCJA 1RGGA 4ILFA 3KZTA 2N1TD 3D79A 1JB2A 5G1KA 5GTHH 1PGPA 4HVNA 3X3XA 5TISH 5KJ7D 4HKZH 3BNEA 4L76A 2YMKA 1VQK3 2RN0A 1URQD 1LOXA 2H88C 1CZQA 2M5AA 2RGQA 2E42A 2HMMB 1AQ5A 1FZFA 1VZZA 2H8PD 4HJGH 4IT7A 3A0BE 1JOCA 3A2AA 4HM1B 1FZBA 1PP9G 2KS1A 2F4YA 3M91A 3H1ID 1E3RA 1BGYD 1NWWA 2W6JH 2IYOA 2V1LA 3I553 3I56P 3GWRA 1PU4A 1M1JC 1A90A 1NWQA 2ZYAA 3BASA 1IO4A 2W6BA 4WY4A 5CBOA 3CC2P 1UCJA 1SQXD 1G02A 4STDA 1IZNB 3L37A 3LXUX 4LLHA 4MJDA 3EC9A 1LJ2A 1H88A 1Z56A 2D1WA 3LT8A 3DGMA 4HOHA 2Z5IA 1OMIA 3H1IE 1BGYE 1ZLLA 3H1LG 1TJDA 5EQLA 1VQPP 1NTKD 2P2UA 5KLVD 1B27A 2POHA 3BRTB 5AW1B 1J2JB 3HK4A 1W6CA 3H1JD 5CJ0A 1MWSA 1XTCC 2OTLP 1SQXE 4HM0B 3Q3DA 2XF3A 3D6YA 1BRGA 3FG1A 1W6GA 1N73A 3M0AA 1H89A 1FGQA 2QRXA 1KILB 3CXHH 1SQQK 3TYYA 4CPKA 1W2BO 2WSFH 2BEZF 4PD4H 5AVRB 1KYOH 1SLQA 4L8OA 1NTKE 4YPCA 5KLVE 2Q7CA 2N1TA 3TGUD 4U7JA 1KC8Q 3FXEA 3RK3D 3H1JE 4I1LA 3PJSK 1Q82Q 3ALAA 2O3OA 1M57D 5CCGA 2ZJSE 2CG0A 3GG2A 1GD4A 1OH0A 3FXDA 4W80A 5DREA 2B1XB 4ZMDA 1ZR4A 4BL2A 1CQSA 1C54A 3VP8A 4IL6E 3EHCA 1SQPD 2FXPA 1SQBJ 3TGUE 1VQ5P 2HFED 1VQ63 2I8DA 1AFOA 3UIAA 3EFFK 3RK3E 4M3LA 4EXRA 2E5YA 4R4LA 3Q5RA 1WMOA 2QEX3 5CCHC 1X22A 1NTMK 1BNGA 2BCCJ 1S4XA 2IPPA 1WMKA 1M9GA 4PJ0E 5B66H 1JMMA 1YTZI 3V99A 1RCKA 2OQEA 2QJKB 1SQPE 1FDIA 2L1SA 2A45H 3NM7A 2J8XB 1MFZA 5KTBA 4H3UA 1NTMG 4AKZA 4W7ZA 3EE1A 4UB8H 4RJTA 1NH4A 5APUA 2C11A 2XFTA 1ZP0C 1AR0A 4L73A 3Q1MA 1MV8A 2KSEA 1RF1A 3H1HJ 1NU1G 1OVUA 2BMRB 1J1EB 4AKYA 4MN4C 3VMXA 1L0NJ 1RHZB 1D6UA 3HTKA 4OUQA 1RNBA 5AVZB 2E2UA 2H0IA 3QH9A 1KFNA 3CMAP 1IFMA 3KQGA 2CH9A 2Q1KA 4H61A 2Z7AA 2HMKB 3L70G 3HOHA 1OW6A 1LT9C 3NBRA 3A5TA 2BMQB 3AE8C 3F89A 4J5KA 5CXOA 3VMZA 3X42A 3LZAA 1BCCJ 4GKGA 3CCLP 2CFWA 5C39A 1Q7YQ 2I1JA 3HZPA 1M8OB 1YJWP 2CFDA 2C4BA 3CU3A 5GSPA 1B2MA 2PFXA 1ZS7A 3O8ZA 5G1LA 3EQ2A 3SX1A 1GL2C 2FFDC 2AXTE 3MYTA 1YIJ3 3ABVC 2OYHC 3AE9C 3GZBA 4WP5A 2I9WA 3NXSA 3I563 4AUWA 1GOYA 4ZM8A 1RHLA 2WPSA 3W68A 2D2CD 1IV9A 1LTJC 4U13A 3CC23 2A45G 1BNSA 2CFLA 3CCQP 4GSPA 5L8RJ 3A3YB 3HUSB 3M9QA 1L0LD 2BNGA 1KTMA 2OYOA 1QAKA 2WMMA 1RE4A 3M0DC 2IBZG 2XKMA 1RLSA 3F9SA 1VF5D 1WRGA 4WHAA 4N78D 1H0TB 3F5HA 5BXQA 3TSIA 5IG5A 4HZBB 1AQTA 5APVA 4QWTA 5B5EE 4C46A 4BTWA 1VQP3 2HMLB 2C9NY 2O1KA 4CJNA 3E1RA 1BNFA 1YJ9P 2RMZA 4WWIA 4N6TA 3A5EA 3WA3A 3MG1A 3V4WA 5AW7B 2ZXEB 2OTL3 2PZVA 4H0LB 2B9BA 5AEUB 1ZN5A 5FW5A 2Z77A 4UB8E 4XDVA 1P84I 1K73Q 1L0LE 4AEQA 2NPSB 1JUNA 4H13D 4UB6H 3V98A 6RNTA 1AVLA 3BLZA 3K63A 3LIDA 1GMJA 4IOIH 4XFJA 2W8ZA 1Q86Q 4N78E 1DE3A 1W2EA 3L74D 2R5DA 2XNDH 1ULIB 5AVSB 4J8TA 3G6EP 1RN7A 3H1IJ 1BGYJ 4LMIA 1UUGB 1KILA 1YVBI 2WITA 5CMZA 1UIIA 2OOVC 1RJOA 3WOFB 4IPBA 2N9BA 5AW0B 2KIKA 3KKGA 2QG4A 5AVXB 3P7KA 2R32A 2J59M 3SFEC 1FGMA 1FOSE 2CK3H 1JBTA 1FUTA 2O01J 1Q9EA 2P0MA 1IV7A 2IFNA 4GDOA 1NJIQ 4GIFA 3L74E 4LSOA 2FXMA 2ZXXA 1DD4A 4JF7A 1VQ53 2E43A 1JNMA 3HE5B 1CW5A 1NTKJ 5KLVJ 3VMYA 3A7OA 1EKMA 4A7PA 1C7HA 1TUHA 3K0ZA 1HJBA 3H1JJ 1NO4A 3L72D 2FBWC 3O6QA 2Y9YA 1A2PA 1EDJA 1BSAA 2M0BA 1ASKA 3L4FA 2GM4A 3BB9A 2O3JA 4EOTA 3N8BA 1UGHI 1SQVG 4I7ZC 2F56A 1I8VA 3USSA 2CWTA 2OYIC 1W02A 1QMAA 3ZFZA 3OA7A 3WUUA 3TGUJ 2M5AB 4K61A 2L91A 3RL0B 3PXMA 3ROBA 5BU8B 2IUJA 3R2PA 2B89A 5H2FE 3ECFA 3JUPA 1JZOA 3L72E 3BIRA 5RNTA 3E7KA 4IIAA 3L35A 1SPUA 3CXHI 4DKIA 4QMAA 2YKPA 1EEJA 4C7RA 1VQKP 4OGQC 4PD4I 4GOFA 2QGUA 1KYOI 1S5LX 2W90A 3CMA3 2K3DA 1GY5A 2I1KA 4UB6E 1WTHA 4EW5A 1JN5B 1SQPJ 3HD7C 3RK2B 3G71P 5K5GB 3Q2YA 2NPSD 1TTOA 2WPVB 3CCL3 1YGEA 2Q6QA 3VMAA 1DVDA 3FZWA 2L5GB 1YJW3 1KB9H 2W2CA 3P32A 1OHOA 4TX4A 1SQBK 2STDA 5BVBA 2QJYC 1EDKA 2JEEA 1IFPA 1ZO2A 5TJHA 3DH2A 2GUSA 2KSJA 1L4AC 2A06G 4LGQA 4X2OA 3FCSB 4Y99B 2XGLA 4EYCA 5APXA 1T2KC 1RSNA 3MD0A 2YFIB 5IEPA 1QGKB 1JM0A 2CG1A 3AECC 3L71G 2BCCG 3B4SA 3UL5A 5AEWB 1NDOB 4R4MA 4HYTB 1NU1J 2INXA 1RE3C 4R1KA 1BRKA 1X1YA 4BTXA 3QWOC 1MZ9A 2ZT9C 4K1UA 1X79B 1M1XB 1E79H 2A45I 3L75D 4PV1B 1JTHB 3CXC2 4H44D 2QM8A 2HPCB 1YJ93 1L0NK 2UWJE 3VN0A 3DY5A 3CMEP 2W03A 2IBZI 4KT0J 1SJWA 1NB3I 1BAOA 2HOHA 4MMXB 3VTPC 3EQQB 1BNJA 1H0TA 1OVRA 2YIUC 1B3SA 4L7KA 1GW4A 2WTYA 3A0BH 1T3UA 4BWNA 3H1HG 1YYCA 1IK3A 3D3LA 3AEBC 1U7JA 1KB9D 1KQLA 2E76C 2KLVA 5APYA 1U5OA 3G0KA 3L75E 3DGYA 1LT1A 3CC73 1D6YA 3RL0D 3A0HE 3FG4A 4EC6A 2ITAA 3JUOA 4WYKB 3P8CD 1N7SC 1KMIZ 3G6E3 4J5GA 2F99A 1OHPA 2NPSA 3GZYB 3D9RA 3L36A 2J5UA 2WGOA 2CFKA 1VQ6P 1GD3A 1BCCG 2F5WA 4JPZB 2MC8A 1DVCA 5EEOA 4XB5A 4WY4D 3C8VA 3KZIE 1M1JB 3RK2D 1GK6A 3L73D 1KB9E 1L0LJ 1IQXA 3MHEA 3V2PA 3U59A 1FZCC 2PAJA 3P8CE 3LIEA 2CWUA 1LOYA 2QIYA 2FYNC 4XA4A 1CYVA 2FYUD 4OWFA 3M9BA 2Q3IA 5AI1A 3X3YA 3D71A 1O7GB 2QSIA 1O7NB 3BATA 2ZVOB 1HYFA 1BDDA 1SQWA 1BNRA 1IFIA 2QJPB 3SEDA 3L73E 4BXLA 3URPA 3C9IA 3I0YA 1DIPA 3HE5A 2KAAA 3NX0A 3GSPA 2CFGA 1N8QA 1FJPA 5D81A 2R44A 4GHOA 4KVHA 5BU5A 2FYUE 2WSEJ 4WB4A 5DJTB 4HM8B 5CHXA 1Q42A 2N1TC 3EB8A 2IZ1A 3KHUA 2YKQA 2LR2A 1V74A 1PV3A 4AQRD 3LMLA 2E75D 2OTJP 5JPUA 4IFDK 3MPHA 5KJ7C 4J9AA 2BEQD 1QEXA 3RBXA 4DCKA 3IFMA 1URQC 5CF2A 4KJMA 1IJDB 5CCGD 3CCR3 4RESB 1YHQP 1W2ZA 2XRXB 2WT7B 1GY6A 2XZRA 1UDII 4HYZA 2CC3A 4RNTA 4IL6H 1PPJD 3V2RA 1GZLA 1IQYA 4N3VA 2CIUA 3F8HA 3G713 4W7YA 1YIJP 2GUVA 4BRYB 1YI2P 2G8YA 3DGLA 1AV4A 3H1IG 2IY2A 1BGYG 1HGVA 1AVKA 3KYQA 3SWFA 2JJLA 1VQ9P 1T6AA 3IJEB 1GW3A 2M3BA 4PJ0H 3HI7A 3L72J 1I0VA 5AYSC 2AAEA 1JN5A 1E5WA 1NTKK 1SQXG 2E74D 5KLVK 1JNQA 3NXJA 1PPJE 2FXOA 1VQM3 2KRTA 2FYZA 1ZR2A 3FF0A 2CPBA 1SQVJ 1LTGC 3WDGB 4GODA 8CHOA 5APWA 1JB5A 3CCJ3 1BSBA 5ELUA 5KAIE 2C9LY 1NTKG 5KLVG 1FAVA 5APTA 2KUBA 3WA2X 2MJZA 3MG2A 2OGUA 3H1JG 1N9EA 4PEJA 3B8EB 1NKZB 2BASA 4BU4A 4OVMA 1KV4A 1GDTA 4NPDA 2KF3A 4JRFA 1E97A 1HGZA 1S9KD 1E3VA 2YFJB 4N6NB 4N6MA 4XBYA 3CME3 1BRNL 1QLED 1J1DC 3M8CA 1UGIA 3B5NB 3TDKA 2ZVNB 1UI7A 3TGUG 3RK3C 5HGRA 3MWZA 1QVFO 2WVRA 1O7MB 1JTHA 1LT9B 3IMAB 1SQPK 2SBLA 3MTUE 3D6ZA 1Y4KA 3CWBD 2HPCA 2AXTH 1CYUA 3HIGA 4O3VA 3B7CA 1B20A 1RF0A 1R4YA 2XU6A 1S9KE 1HH0A 2VRSA 2P0XA 3O6QB 1B2ZA 1GL2B 1SQQD 1IT8A 1VDFA 2FFDB 3WODG 1KQS2 1EQ7A 1S5LE 1SQPG 2IX7C 3SWKA 2OYHB 1KB9I 1LQMB 3OXAA 4K3AA 2WSCJ 5IW9A 3PRJA 3L71J 3CWBE 3Q2PA 3E1IA 4WYKA 1D7MA 3FKAA 1RTUA 1LTJB 2Q07A 3MSOA 4IFFA 5B5EH 1HZ1A 4DJGA 3SOYA 2CHCA 1YIT3 1OPYA 3L75J 3FH1A 3CPOA 3JUNA 1NU1K 2FY8A 4FMDA 2IZ0A 3D5IA 1M1JA 1JY3O 1Y8AA 3HE4B 3BRVB 7GSPA 1HUCA 4DZOA 4ASWA 4LGDE
chains in the Genus database with same CATH topology
2ZDJA 2OOVC 1RJOA 3U1WA 3WOFB 3MG3A 3F14A 4IPBA 2WO0A 2YX9A 2FNQA 3VF1A 2RCDA 3KKGA 5STDA 3JVCA 1O7WB 2GU3A 2HMNB 1FGMA 4HM3B 3UL6A 1K9M4 2CK3H 2K54A 2JDIH 3LTDA 2E5TA 2XFSA 3SLUA 2P0MA 1IV7A 1Q814 3LH4A 1QVG2 3T0UA 2WOHA 2P05A 4LSOA 3EJVA 1VQ53 2OQEC 4WFOA 2Z76A 3GZRA 2HMJB 4HM6B 2XGNA 1M1K4 1EKMA 2OTJ3 1BSHA 1OF5B 3T8NA 1C7HA 4CDLA 1TUHA 3K0ZA 3FLJA 3STDA 3NBJA 1OCVA 1ROVA 2BO9B 5AIIA 1MOLA 1VQ43 1GS3A 1YHQ3 1ASKA 3B4PA 4EV2A 1NO3A 4HBRA 4N6LA 3SXXA 1RKYA 2B24B 3BB9A 3K7CA 4HM4B 5CLKA 3DM8A 3SOAA 2W56B 3N8BA 2CWVA 3X3ZA 3EBYA 3X40A 2XR8B 1ROAA 5IENA 2P38A 1N5HA 1FS0E 3J7Yd 1VQL3 1YI23 3USSA 3UB1A 2CWTA 1KWIA 1W02A 2XH9A 3NV0B 1QMAA 5KP1A 4K61A 1VQ93 5D83A 3PXMA 3ROBA 5KP3A 3JUQA 2IUJA 3ECFA 3JUPA 1NB5I 3KN4A 1A2VA 2HMOB 5AYRB 4IIAA 1SPUA 1T5YA 1BSNA 3BNCA 4FCZA 4NHFA 4QMAA 4O02B 3A76A 3WOEB 3DUKA 2XEPA 4I4KA 2RSXA 4K1VA 2QGUA 3PCSA 4MEIA 1GY7A 2IUKA 3LTCA 3CMA3 1GY5A 1WTHA 2GBWB 3NM2A 4O2HA 1JN5B 5IG0A 3K5TA 3NBBA 3BNDA 1EG9B 4R80A 1BUQA 3KSED 1QALA 1EA2A 3EF8A 3FSDA 1YGEA 3PCRA 3Q90A 4GB5A 4HM5B 4N6UA 5A0OB 3FZWA 1YJW3 1DVDA 2W04A 1QJGA 2W2CA 1EQKA 2KXGA 1FUWA 1OHOA 3RGAA 4TX4A 2STDA 5BVBA 3GAXA 4HM2B 3BNBA 1IFPA 5D82A 1ZO2A 5CK6A 1SIIA 1JB4A 5IG4A 3E99A 1M904 3GZXB 5ELJA 3S27A 4LGQA 1L5GB 4X2OA 3JUMA 1KC84 3FCSB 2ML5A 4L8PA 2XGLA 3QRDA 4LEHA 1QVF2 4EYCA 3OWUA 4FCJA 3CPW2 1Q824 5IEOA 1IU7A 1STDA 3KZTA 1JB2A 1UUWB 3DZLA 1SIHA 1JKGB 1FGOA 2GU1A 4HVNA 1DMQA 2YFIB 3X3XA 5IEPA 1VQO3 2UX0A 3LT9A 1JEKA 2CG1A 2ML6A 3N54B 3GRDA 2WOFA 2R4IA 3BNEA 4OK0A 1FGTA 2GBXB 4N6OB 1VQK3 3UL5A 5AEWB 1TFKA 3F40A 2BT3A 1O7HB 1LOXA 1NDOB 2W9QA 2INXA 1UW1A 4R1KA 2RGQA 2Z6BA 1IVVA 2O9UX 2HMMB 4BTXA 1VZZA 4WWUC 1OACA 4IT7A 4K1UA 1K41A 1M1XB 1E79H 3CXC2 3ER7A 4HM1B 2GEYA 1YJ93 1E3RA 1NWWA 1R4CA 4KFDA 3DY5A 5DRVA 2W6JH 2W03A 2V1LA 1SJWA 3I553 3GWRA 4MMZB 1PU4A 3KFQC 1NB3I 4MMXB 3TDGA 1VQ83 3CNXA 5EVHA 3OW22 3K9MC 1A90A 3AMOA 3EQQB 4L7KA 2YFLB 4STDA 3LXUX 1IK3A 3D3LA 5IG3A 3G0KA 1QAFA 1U5OA 4MJDA 3B4OA 3EC9A 1U8CB 3CC73 1D6YA 3FG4A 2D1WA 4EC6A 3JUOA 4WYKB 3LT8A 3DGMA 3KSPA 4RBNA 3G6E3 1JV2B 5EQLA 2M7OA 5AIGA 2F99A 1OHPA 3F7SA 4FMBA 3LTAA 4EBGA 2KCDA 3GZYB 4FMCA 2BMOB 3D9RA 3HK4A 2WGOA 2CFKA 1LVNA 2Y73A 1W6CA 3EN1B 2GEXA 1GD3A 3G16A 3DMCA 4HM0B 1F8NA 2MC8A 3CCS3 2XF3A 1IQ8A 4XBTA 3FG1A 1DVCA 3PS8A 4XB5A 1G96A 1W6GA 5EEOA 2E2VA 2OWPA 1J2BA 1Q40B 1FGQA 3KIIA 3PGBA 3FGYA 3DGNA 1IQXA 3EX9A 3G8ZA 3MHEA 2ZL8A 3NQYA 3RDEA 3VGNA 3UNLA 1MNLA 3B8LA 2XSHB 2CWUA 1A67A 2QIYA 6STDA 1Q7Y4 4XDWA 1CYVA 4L8OA 1JRQA 1DYUA 1ULJB 5AI1A 5LC7A 3X3YA 1O7GB 2E2TA 1TU5A 1O7NB 4FCMA 3PJSK 3ALAA 4KFFA 2F86B 3CCV3 2LYXA 1SQWA 2O3OA 2CG0A 3SEDA 1O7PB 3H51A 1GD4A 1VQN3 1OH0A 2V7QH 3U97A 3I0YA 3HX8A 4EV5A 5DREA 5I97A 4WVZA 2B1XB 3NX0A 1VQ73 1OF5A 2CFGA 1CQSA 1N8QA 3CD63 3G4S3 5D81A 3EHCA 4KVHA 4TLFA 4BTYA 1OGXA 3FG3A 4HM8B 5LC6A 1S723 5CF1A 4R9LA 1VQ63 1Q42A 3EB8A 3EFFK 1US1A 3RGRA 2E5YA 4EXRA 1V74A 2BHMA 1WMOA 5FGOA 2QEX3 3NHXA 3LMLA 5JPUA 3MPHA 2W56A 7STDA 4J9AA 4R4KA 4G1MB 3OX9A 5CF2A 1IDPA 4ORLA 2F98A 3CCR3 1M9GA 3NV0A 2MF7A 2IMJA 1W2ZA 2XRXB 1S5AA 1DMNA 1GY6A 4HYZA 2CC3A 5JBSA 1ISKA 3IPTA 2IA7A 1IQYA 3V99A 1W7CA 1K8A4 3N9HA 4N3VA 2JQ5A 2OQEA 3OV4A 2CIUA 3F8HA 3V92A 3NM7A 1UUVB 3G713 3CCM3 4H3UA 1A2KA 4N6V0 4AKZA 1DMMA 3EE1A 3DGLA 3X41A 1AV4A 2C10A 1TIJA 1K734 1AVKA 3CNMA 3LYGA 2P09A 1OGZA 3L0RA 4RNZA 2C11A 4CCVA 3IJEB 2XFTA 3HI7A 1AR0A 5AYSC 1Q864 3MKIA 4KZ1A 2WGQA 1RRLA 3SVAA 2LQVA 1JN5A 2BMRB 4AKYA 4HKVB 1JNQA 1D6UA 4X2HA 1UI8A 1IVWA 3NXJA 4O8SA 1STFI 2PNCA 1OHSA 1VQM3 2KRTA 3WMDA 1WQLB 3LOYA 4OUQA 3FF0A 2E2UA 4K90B 3WDGB 8CHOA 2CH9A 4H61A 2Z7AA 1JB5A 3CCJ3 2QE7H 4MMYB 1KSIA 2HMKB 5ELUA 3NBRA 5IF6A 2BMQB 3OWYA 5CXOA 3OWSA 3LTBA 3X42A 3LZAA 1W00A 2RFRA 3CCE3 2CFWA 5KP4A 3WA2X 3HZPA 3MG2A 1YJN3 4XBXA 2W9PA 2CFDA 5TGNA 3CU3A 1KD14 1N9EA 4PEJA 1N8R4 1NJI4 4OVMA 1D6ZA 3SX1A 1W01A 4HM7B 1JKGA 1OUNA 3PZWA 1RRHA 3MYTA 1YIJ3 4JRFA 3QK9A 3EBTA 1E97A 4FMAA 4RZMA 1E3VA 2YFJB 4N6NB 4N6MA 4XBYA 3T8UA 3GZBA 3CME3 4WP5A 2I9WA 3M8CA 3CCL3 3S28A 1IT7A 3I563 1Z1SA 3O8YA 2K0MA 4ZM8A 1UI7A 3UJMA 2L4VA 5HGRA 3MWZA 1JJ22 1IV9A 2W0QA 2XSOB 4U13A 1O7MB 2CFLA 3CC23 3PYJA 3Q1CA 3IMAB 2SBLA 1LXEA 1Y4KA 1TFOA 3S5CA 3S67A 3VSYA 1WNHA 2BNGA 1TP6A 3F7XA 3NQZA 1CYUA 1HU9A 1QAKA 3HIGA 4O3VA 3B7CA 3F9SA 1ZX2A 3CCU3 4WHAA 1W5ZA 2WSSH 1FGRA 1GYBA 1N9JA 3AMOB 3H3HA 4HZ9B 4Q53A 3F8XA 5BXQA 3S29A 4FR9A 5IG5A 4HZBB 2P0XA 1AQTA 4QWTA 4BTWA 1VQP3 2HMLB 1IT8A 3WODG 1KQS2 1N5PA 1W6YA 4HJLB 4N6TA 3WA3A 1K28A 2D42A 3MG1A 2CKFB 3OXAA 4YXWH 1LNHA 4GL6A 2OTL3 2PZVA 4XM4A 1WMPA 2OOVA 4NREA 4R9KA 5AEUB 5AIFA 1NU3A 2CW9A 3HIIA 5FW5A 5JPPA 5IW9A 2Z77A 1IVUA 3KE7A 1W2B2 4LZIA 3Q2PA 4WYKA 4XDVA 2QA43 1WMNA 3FKAA 4JF8A 4AEQA 3NUVA 1HKXA 3V98A 2Y74A 2Q07A 1AVLA 2OCTA 3MSOA 3BLZA 3K63A 1PFPA 3DXOA 3CC43 4DJGA 3SOYA 5G2GA 2CHCA 1CEWI 5IERA 3FF2A 1YIT3 1OPYA 3FH1A 3CPOA 3JUNA 5AIHA 2XNDH 1ULIB 4FMDA 4J8TA 1RN7A 1W4NA 4LMIA 4RNYA 1Q40A 1YVBI 1IVXA 2FXTA 2GXFA 4KFEA 3EN8A 3CCQ3 2A15A 2FGTA 3DGOA 1FA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USS A;  2WSS H;  4WVZ A;  1BSH A;  1AQT A;  4DJG A;  4TLF A;  2CK3 H;  2JDI H;  1E79 H;  2E5T A;  3PJS K;  1BSN A;  2XND H;  3EFF K;  4YXW H;  2E5Y A;  4QMA A;  2W6J H;  1JEK A;  1IFP A;  2QE7 H;  1FS0 E;  2V7Q H; 
#chains in the Genus database with same CATH topology
 2KOG A;  3D4A A;  3BCC D;  3F14 A;  1QL1 A;  3SSU A;  2WO0 A;  1JMB A;  2YX9 A;  5AW4 B;  1LTI C;  2RCD A;  3CCS P;  3JVC A;  2ZFC A;  2GU3 A;  1X9V A;  1TRP A;  1GU5 A;  2K54 A;  1U7M A;  3LTD A;  5M1A A;  3SLU A;  1TU3 F;  3D70 A;  1QVG 2;  2WOH A;  4WFO A;  2Z76 A;  3MUD A;  4HM6 B;  2H7H A;  1RNT A;  2BIR A;  1JY2 O;  2PP6 A;  1MGW A;  2OTJ 3;  1KIL D;  3VYI A;  1LQG C;  4HH2 A;  3BCC E;  5EFW B;  1I3I A;  2JO1 A;  3JCU H;  1T2H A;  3FLJ A;  3NBJ A;  1ROV A;  2BO9 B;  1MOL A;  1YHQ 3;  5KAF E;  3S9O A;  2UGI A;  4EV2 A;  1IFN A;  1NO3 A;  2Q9I A;  2B24 B;  3L73 J;  3B5N D;  2WSE H;  3K7C A;  1YQ3 C;  1JY3 P;  3DM8 A;  3X3Z A;  5IEN A;  1X1U A;  1N5H A;  2P38 A;  3IAO A;  1YI2 3;  1N2D C;  1L0L K;  2FYU J;  3MP7 B;  1S72 P;  5APS A;  5KLI C;  3AE1 C;  1X1X A;  1KIL E;  1YTZ T;  2WT7 A;  1VQ9 3;  8RNT A;  1FZU A;  2D2C C;  1NTZ D;  3AE4 C;  1A2V A;  2HMO B;  1ZW0 A;  1RN1 A;  2NRG A;  1SS1 A;  4BRY A;  3WOE B;  1AVY A;  1L0L G;  1VF5 C;  2RSX A;  3NMD A;  1JY2 P;  3PCS A;  4MEI A;  3LTC A;  1M90 Q;  1X8Y A;  2PRR A;  2HLO A;  2Q5U A;  3K5T A;  1KQF B;  1EG9 B;  3BND A;  4R80 A;  5H2F H;  1FOS F;  3KSE D;  1BSE A;  1NVO A;  1CI6 A;  5CCH A;  2W27 A;  4I7Z B;  1EA2 A;  3PCR A;  4GB5 A;  4N6U A;  4YXD C;  4HM5 B;  5A0O B;  1LWU C;  1NTZ E;  3FGA D;  2W04 A;  1EQK A;  2YXR B;  2KXP B;  2OYI B;  1FUS A;  3CL3 D;  1HWT C;  4H13 C;  2B87 B;  1JB4 A;  5IG4 A;  1YNV X;  3Q5P A;  4U3F D;  3E99 A;  1M90 4;  1KQG B;  3IF4 A;  5E79 E;  4HB1 A;  1L2P A;  2XV5 A;  1VL2 A;  3SYU A;  3QRD A;  4LEH A;  3AEE C;  3CC7 P;  3CPW 2;  2H89 C;  5IEO A;  1IU7 A;  1STD A;  1V57 A;  4D6T D;  3CX5 D;  3FWL A;  3L74 G;  2M8R A;  1UIX A;  1SIH A;  1ZGX A;  2GU1 A;  1Y47 A;  1DMQ A;  3LT9 A;  3ITK A;  3HD7 B;  4TT3 H;  3N54 B;  2DW3 A;  2R4I A;  1DET A;  1YJN P;  1FGT A;  1OVV A;  4OK0 A;  3F40 A;  2BT3 A;  1FC2 C;  1SQX J;  1UW1 A;  3B5N A;  4U3F E;  2Z6B A;  1OAC A;  3JCU E;  2QJY B;  3ER7 A;  2XDJ A;  1LT9 A;  4LYL B;  1L4A B;  1JB0 J;  3CX5 E;  4D6T E;  1H8A A;  5DRV A;  1EUI C;  4MMZ B;  2OAR A;  2ZYG A;  3TDG A;  1VQ8 3;  3CNX A;  1B21 A;  1SQV K;  3OW2 2;  1HJ0 A;  2RBI A;  3WHO A;  1BIR A;  1G0T A;  3L72 G;  1GL2 A;  2P1J A;  1G1I A;  5AVT B;  2FFD A;  3ZG5 A;  2QVA A;  3T97 B;  1KFM A;  3SWY A;  2OYH A;  3MHV A;  2Q3E A;  2JWA A;  4IFM A;  2RKL A;  2WZ7 A;  2G3A A;  4RBN A;  1HVV A;  1JV2 B;  2WSC H;  2ZT9 B;  3HUS C;  3LTA A;  4EBG A;  4FMC A;  1LTJ A;  4ASV A;  1T3B A;  1IK7 A;  2BMO B;  1ZRT D;  1LVN A;  2Y0E A;  2GEX A;  3G16 A;  1RGC A;  1FZG A;  2AEM A;  2HG5 D;  3G3Z A;  5AW6 B;  1B2X A;  5AW2 B;  3CCS 3;  1OW7 A;  1G1J A;  3V4Q A;  2E2V A;  3CWB J;  1RGA A;  1UCL A;  3KII A;  3A0H H;  1OFC X;  2P58 A;  1I2G A;  3G8Z A;  2B88 A;  2ZL8 A;  3HE4 A;  1EZV D;  3CCR P;  3RBZ A;  3VGN A;  5KKZ C;  3UNL A;  1MNL A;  3B8L A;  2XSH B;  1A67 A;  6STD A;  4H0L D;  2E76 B;  1M7L A;  1BRS A;  1DYU A;  1ULJ B;  1OW8 A;  2NPS C;  2E2T A;  1ZRT E;  1N7S B;  1TU5 A;  4FCM A;  2F86 B;  3KZI H;  1Q90 D;  3GHG C;  2LYX A;  1T3J A;  1O7P B;  3H51 A;  2HOD A;  4IL6 X;  1DX7 A;  2V7Q H;  1ZOY C;  3HX8 A;  1EZV E;  4WVZ A;  5AVQ B;  4DOJ A;  1VQ7 3;  2IDB A;  1NAF A;  1VQM P;  4TLF A;  3PLN A;  1OGX A;  3FG3 A;  5LC6 A;  1S72 3;  1K8A Q;  1PFI A;  4N6J A;  3B71 A;  1FZC B;  1US1 A;  3CCJ P;  1RGE A;  3AHW A;  7STD A;  2M3E A;  4C7N B;  3V5B A;  3GLM A;  4R4K A;  1EDI A;  1RCL A;  1PZQ A;  1IDP A;  4ORL A;  2F98 A;  1L4A D;  4NPF X;  1SFC B;  2IMJ A;  1S5A A;  2KI7 B;  5JBS A;  3IPT A;  1IC2 A;  2YXQ B;  3WUV A;  1BDC A;  1W7C A;  1K8A 4;  1SQB D;  3EFG A;  3N9H A;  2JQ5 A;  3OV4 A;  3V92 A;  1NOH A;  4H44 C;  1IFJ A;  3L75 G;  1RDS A;  2V4H A;  4N6V 0;  1Y9B A;  1VQL P;  3X41 A;  2P10 A;  2C10 A;  1GD2 E;  2LXC B;  1TIJ A;  3CNM A;  1BE3 D;  2P09 A;  4KT3 B;  1EXJ A;  1OGZ A;  1OXZ A;  3L0R A;  4CCV A;  1YQ4 C;  2WGQ A;  1RRL A;  1X1W A;  2LQV A;  4HKV B;  1HBW A;  4X2H A;  1KD1 Q;  5DJU B;  1N8R Q;  1ZXG A;  2PNC A;  1B2S A;  1SQB E;  1WQL B;  3LOY A;  3RL0 C;  3TNU B;  1LTS C;  3N4X A;  2OYI A;  1FDO A;  4K90 B;  1FU1 A;  3NFQ A;  4MMY B;  2GA1 A;  2JWD A;  3H1K D;  5IF6 A;  1I3F A;  3OWY A;  1BE3 E;  3AE5 C;  2B87 A;  1W00 A;  2RFR A;  3PHL A;  3IN6 A;  5KP4 A;  4ZKP A;  1YJN 3;  3H6P A;  4XBX A;  2W9P A;  1NTZ J;  1KD1 4;  3S1K A;  1L0N D;  1N8R 4;  4WY4 C;  3RK2 C;  1D6Z A;  4HM7 B;  3TK1 A;  1OUN A;  3L73 G;  3PZW A;  3QK9 A;  3M9H A;  1GOV A;  3WR2 A;  3HD7 A;  5KAI H;  1FW7 A;  3T8U A;  3H1K E;  1YIT P;  2CPS A;  1Z1S A;  2K0M A;  2FYU G;  2OTK E;  1ZME C;  2L4V A;  2Y0D A;  1JJ2 2;  2W0Q A;  4GOE A;  3PYJ A;  1VQO P;  4B86 A;  3Q1C A;  1L0N E;  1LXE A;  1WT6 A;  1I2E A;  3S67 A;  3VSY A;  1L4A A;  3ZDM A;  1WNH A;  3F7X A;  1TP6 A;  4JYB A;  1N73 C;  3CCU 3;  4U3F J;  3H3H A;  4HZ9 B;  3AMO B;  3C1L A;  3F8X A;  4FR9 A;  1PGQ A;  2C0X A;  3RNT A;  2XNX A;  3OJA B;  2HYN A;  4L74 A;  3V2Q A;  1N5P A;  1W6Y A;  3L74 J;  1EDL A;  4D6T J;  1SFC D;  2D42 A;  3T97 A;  2CKF B;  1LNH A;  4XM4 A;  2E75 C;  4NRE A;  4R9K A;  5AIF A;  1NU3 A;  1J1D B;  2W6A A;  3H32 B;  3HII A;  5JPP A;  1W2B 2;  1NGM B;  3HRN A;  4JYC A;  2QA4 3;  5AVY B;  1RE3 A;  2LKM A;  4PV1 D;  3RK3 B;  5CCG C;  1NYH A;  3NUV A;  1HKX A;  1FJK A;  3DXO A;  5G2G A;  3FF2 A;  1S5L H;  1PPJ G;  1RH5 B;  1X0T A;  1SQX K;  1Q81 Q;  1I2F A;  4RNY A;  1IVX A;  2GXF A;  3EN8 A;  1EZV I;  3DGO A;  1FA3 A;  2ZDJ A;  5BVZ A;  3U1W A;  1BUJ A;  1MGR A;  4HAA A;  1AQZ A;  2K1A A;  2E74 C;  2HMN B;  3UL6 A;  3AEA C;  1CI6 B;  2E5T A;  2XFS A;  1PP9 D;  1N7S A;  1Q81 4;  3LH4 A;  1MKM A;  4BL3 A;  1N7L A;  3T0U A;  3EJV A;  2OQE C;  3GZR A;  3AHS A;  3W67 A;  1NNV A;  2XGN A;  1BSH A;  1OF5 B;  4OH8 B;  3T8N A;  1RQU A;  3STD A;  3CCV P;  3MGN A;  5AII A;  3VP9 A;  1RF1 C;  3Q5S A;  2WPR A;  1VQN P;  1FZC A;  3WU2 H;  1PP9 E;  2KF5 A;  1HTL C;  2W56 B;  3H1L D;  1P84 D;  3GF3 A;  4EIJ A;  2JR8 A;  1FS0 E;  1VQL 3;  3CD6 P;  3UB1 A;  1IYY A;  4Y28 J;  3G4S P;  4C7N A;  1KWI A;  3NV0 B;  2QJP C;  3JSV C;  3H25 A;  5M19 A;  1XTG B;  5KP1 A;  2P67 A;  3MUD C;  1SFC A;  5D83 A;  2YMY A;  3JUQ A;  4WBA A;  3WUT A;  5KAF H;  1NB5 I;  3KN4 A;  5AYR B;  5HOH A;  1T5Y A;  3RGU A;  3BNC A;  2KP8 A;  3CWB G;  3DUK A;  3H1L E;  1P84 E;  2IUK A;  3NM2 A;  4O2H A;  1LOV A;  2KNC B;  5AVV B;  2Z5H A;  3CCM P;  1RGH A;  1A02 J;  4XE5 B;  1QAL A;  1SQQ G;  3AE7 C;  3M06 A;  5KJ7 A;  1QJG A;  2KXG A;  1URQ A;  5GTH E;  3TNU A;  3RGA A;  2ZAE B;  1QL2 A;  1YBK A;  2KZI A;  5KLI B;  5TIS E;  1VQ8 P;  3BNB A;  5D82 A;  5CK6 A;  1SII A;  2D2C B;  3RL0 g;  3GZX B;  3S27 A;  1RE4 C;  3AE3 C;  2JKV A;  1KC8 4;  2ML5 A;  1KN7 A;  4L8P A;  2AAD A;  4RKU J;  5M1B A;  3OWU A;  3MZW B;  1Q82 4;  4CPG A;  1VF5 B;  3CLQ A;  1SQQ E;  1UUW B;  3DZL A;  1JKG B;  2WQY C;  1FGO A;  1VQO 3;  1BE3 J;  5CCH D;  2UX0 A;  1JEK A;  1I0X A;  3CCE P;  2ML6 A;  3GRD A;  1BNI A;  2WOF A;  1RMS A;  2GBX B;  4N6O B;  3U1A A;  1TFK A;  3BCC G;  4EI2 A;  1O7H B;  3II6 A;  5E79 H;  2W9Q A;  1LWU B;  1LP1 B;  3IR9 A;  3PH0 A;  1IVV A;  2O9U X;  1SVF A;  4WWU C;  1K41 A;  1U57 A;  3CXH D;  1NTM D;  4H13 B;  4NPB A;  2GEY A;  3WU2 E;  1R4C A;  4KFD A;  4PD4 D;  7RNT A;  2V7Q J;  2HOD B;  3H1K J;  2ZYD A;  1G2C B;  3P8M C;  1KYO D;  3KFQ C;  1LTA C;  1S1C X;  1KIL C;  5EVH A;  1EC5 A;  3K9M C;  3KDP B;  3AMO A;  1R8E A;  3ZG0 A;  1JCC A;  1NU1 D;  2YFL B;  1QX8 A;  1JCD A;  3GF7 A;  5IG3 A;  1LGH B;  3B5N C;  3TF5 A;  1QAF A;  5BU4 A;  3B4O A;  3G9R A;  1U8C B;  5M18 A;  2K9Y A;  1NTZ K;  3CXH E;  3CX5 H;  1NTM E;  3KSP A;  3L70 D;  3H32 A;  1DH3 A;  2KF6 A;  2ZA4 A;  1VQ7 P;  2YO3 A;  3KPE A;  4PD4 E;  2M7O A;  5AIG A;  3V6I A;  1KYO E;  3F7S A;  2YNY A;  3BU4 A;  4FMB A;  2KCD A;  3SFD C;  2AEF A;  4GT1 A;  1DEE G;  2Y73 A;  3EN1 B;  1NU1 E;  3DMC A;  4I2L C;  1KQS O;  1FZA A;  1IFD A;  4EYY Q;  1F8N A;  3AGO A;  1IQ8 A;  1GSP A;  4XBT A;  1NTZ G;  3PS8 A;  1G96 A;  2Y0C A;  1MWT A;  2OWP A;  1J2B A;  1Q40 B;  1FDM A;  3PGB A;  3FGY A;  3DGN A;  1MWR A;  1GL2 D;  3PP5 A;  3EX9 A;  1GMR A;  2K9J B;  4Z1M H;  3NQY A;  3RDE A;  3CC4 P;  3L70 E;  2AEJ A;  1UCI A;  1W5C E;  1Q7Y 4;  4XDW A;  1JRQ A;  2K3R A;  1GK4 A;  5LC7 A;  1BNE A;  3CCV 3;  1I70 A;  4KFF A;  1K04 A;  1SAR A;  4AYC A;  2IBZ D;  2QJK C;  1VQN 3;  3U1C A;  1JBR A;  5GTI H;  3U97 A;  3AED C;  3KXD A;  4EV5 A;  1BRH A;  5I97 A;  2R5B A;  1BRI A;  1OF5 A;  3EWK A;  1JZD A;  4U3F G;  4OVN F;  1EXI A;  1R5L A;  3CD6 3;  2WWW A;  5B66 E;  3G4S 3;  3V2N A;  4BTY A;  2J58 A;  5CF1 A;  4R9L A;  1GMQ A;  2O1J A;  4OGQ B;  5KKZ B;  2MKV A;  1B2U A;  4I5Q A;  1GU4 A;  3RGR A;  4D6T G;  1QVG O;  1J1E C;  3Q3F A;  1YGW A;  2BHM A;  5FGO A;  3NHX A;  2W56 A;  1GTW A;  4I6M C;  2BU4 A;  2IBZ E;  4G1M B;  3OX9 A;  1JBS A;  5AW3 B;  3BVH A;  1AY7 A;  3NV0 A;  1VQ4 P;  2MF7 A;  1DMN A;  3GHG B;  1OWA A;  1ISK A;  1HF9 A;  2IA7 A;  2NZ2 A;  1LTB C;  1AVO A;  1PP9 J;  1GOU A;  2RNT A;  1UUV B;  3CCM 3;  1A2K A;  5APQ A;  3AGN A;  4LC1 A;  1DMM A;  4JQ0 D;  1JY3 N;  4NPE A;  1K73 4;  2YKO A;  3LYG A;  4RNZ A;  3K5B A;  2H0H A;  3OAK A;  4ZNC A;  1Q86 4;  3MKI A;  2ZHX B;  4KZ1 A;  3SVA A;  2KNC A;  5BIR A;  2F5M A;  1UI8 A;  1IVW A;  4O8S A;  1STF I;  3JC2 2;  1OHS A;  3WMD A;  3MIW A;  2SAR A;  3FWN A;  4K35 A;  3H1L J;  3CCU P;  2QE7 H;  1KSI A;  1NAY A;  1JY2 N;  3LW5 J;  1RN4 A;  1ZV8 A;  3OWS A;  3LTB A;  4KHX A;  4H44 B;  3CCE 3;  5AVW B;  1T2I A;  2UUG C;  2R3S A;  1BU4 A;  3WMM 0;  5TGN A;  2IFM A;  1BSC A;  2W83 C;  1NJI 4;  1BAN A;  3AEG C;  3M0D A;  1W01 A;  2QA4 P;  1JKG A;  1SQV D;  1LNI A;  1RRH A;  3EBT A;  1RY3 A;  2YIU B;  1EZV G;  4FMA A;  1NHL A;  3S4R A;  4RZM A;  5GTI E;  4H0L C;  1BRJ A;  3S28 A;  1IT7 A;  1FE6 A;  2KB7 P;  3O8Y A;  1LWU A;  1LP1 A;  1PY3 A;  1SQQ J;  3UJM A;  2QIW A;  2KK7 A;  2XSO B;  4EDF A;  1AA0 A;  1NKN A;  1OIP A;  2KS1 B;  3CPW O;  1RQV A;  1A02 F;  1KZU B;  1MFT A;  1TFO A;  3S5C A;  1MWU A;  3NQZ A;  1HU9 A;  4OGQ D;  1SQV E;  1RGL A;  1G2C A;  1Q2N A;  1ZX2 A;  1W5Z A;  2WSS H;  1FGR A;  1GYB A;  1N9J A;  4Q53 A;  4WY4 B;  2PGD A;  3S29 A;  1VPC A;  3HD7 D;  1VQQ A;  1CH0 A;  3FX0 A;  4HJL B;  1K28 A;  5AW9 B;  1PL5 A;  3GW6 A;  4YXW H;  1LOW A;  1SP4 A;  3I55 P;  4GL6 A;  1WMP A;  2OOV A;  2CW9 A;  2R41 A;  4DT0 A;  2FYN B;  1IVU A;  3KE7 A;  4LZI A;  1S2E A;  2KYV A;  1WMN A;  2H43 A;  4JF8 A;  3BCC J;  2A06 D;  2Y74 A;  3OW2 O;  2OCT A;  3PTZ A;  3CC4 3;  1PFP A;  2LXB A;  6GSP A;  2CX0 A;  9RNT A;  1CEW I;  5IER A;  1K9M Q;  2Z4E A;  2YO2 A;  1NTM J;  5AIH A;  1SQB G;  1N73 B;  1JO5 A;  1T2K D;  2WSF J;  1W4N A;  1CSB A;  1FZE A;  1Q40 A;  2FXT A;  4KFE A;  5AW8 B;  3CCQ 3;  2A15 A;  2FGT A;  3L71 D;  2K9J A;  2O01 N;  2BCC D;  1BE3 G;  1BVI A;  1PGJ A;  3MG3 A;  1M1K Q;  1AV1 A;  2FNQ A;  4ZKU A;  3VF1 A;  3D5G A;  5STD A;  2A06 E;  2N1T B;  1RGF A;  1O7W B;  2HR3 A;  4L75 A;  2QM7 A;  1V58 A;  2E75 B;  2H0G A;  4HM3 B;  1K9M 4;  2ZT9 D;  1MUU A;  2JDI H;  4JBZ A;  3GMA A;  1AJY A;  2KZJ A;  3N7N A;  2K88 A;  1URQ B;  2P05 A;  3HUS A;  3L70 J;  2R3C A;  1PIX A;  3VOP A;  5CJ4 A;  2HMJ B;  1RGK A;  2IYJ A;  1M1K 4;  3H1K G;  1BGS A;  3NTN A;  3L71 E;  3R4Y A;  2BCC E;  3AE2 C;  4CDL A;  1OX3 A;  1GMP A;  3H1H D;  1OCV A;  2GSP A;  1VQ4 3;  1KOR A;  1GS3 A;  4N3Y B;  3B4P A;  2KF4 A;  1L0N G;  2FYU K;  4HBR A;  4N6L A;  3SXX A;  1RKY A;  2E76 D;  1M56 D;  4YTP C;  3CX5 I;  1DEB A;  4HM4 B;  1USE A;  5CLK A;  5CBN A;  3SOA A;  1S3J A;  2IYP A;  2CWV A;  3EBY A;  3X40 A;  2XR8 B;  1ROA A;  3I5C A;  2E74 B;  1N7S D;  3J7Y d;  1Q7H A;  1IK9 A;  3AEF C;  2CX1 A;  2XH9 A;  2SPZ A;  2OQQ A;  1USD A;  2N9Y B;  1BCC D;  1YVS A;  1BSD A;  3GHG A;  5KP3 A;  1TRQ A;  2QEX P;  3H1H E;  2P7J A;  2K37 A;  1BSN A;  2Y9Z A;  4FCZ A;  4NHF A;  1LTT C;  1PYL A;  4O02 B;  3A76 A;  4Y99 C;  1PGO A;  2XEP A;  4I4K A;  1UCK A;  4K1V A;  3KCH A;  1R5S A;  5AVU B;  4O9B A;  2KLU A;  1GY7 A;  1LNQ A;  3CI9 A;  4BIR A;  2C0W A;  1RF1 B;  2GBW B;  1BOX A;  5IG0 A;  1FYS A;  3NBB A;  1BUQ A;  1LRA A;  1N86 A;  1BCC E;  1SFC C;  3EF8 A;  3FSD A;  1OZH A;  3Q90 A;  1T8Z A;  3HTK B;  1FBM A;  2O01 H;  2AXC A;  1FUW A;  1K05 A;  2FKW B;  4RO0 A;  3GAX A;  4HM2 B;  4PV1 C;  1P84 H;  2RH0 A;  5ELJ A;  2JP3 A;  1L5G B;  3LW5 H;  3JUM A;  2WPQ A;  1RF0 C;  3AE6 C;  1QVF 2;  1DD3 A;  5AW5 B;  4FCJ A;  1RGG A;  4ILF A;  3KZT A;  2N1T D;  3D79 A;  1JB2 A;  5G1K A;  5GTH H;  1PGP A;  4HVN A;  3X3X A;  5TIS H;  5KJ7 D;  4HKZ H;  3BNE A;  4L76 A;  2YMK A;  1VQK 3;  2RN0 A;  1URQ D;  1LOX A;  2H88 C;  1CZQ A;  2M5A A;  2RGQ A;  2E42 A;  2HMM B;  1AQ5 A;  1FZF A;  1VZZ A;  2H8P D;  4HJG H;  4IT7 A;  3A0B E;  1JOC A;  3A2A A;  4HM1 B;  1FZB A;  1PP9 G;  2KS1 A;  2F4Y A;  3M91 A;  3H1I D;  1E3R A;  1BGY D;  1NWW A;  2W6J H;  2IYO A;  2V1L A;  3I55 3;  3I56 P;  3GWR A;  1PU4 A;  1M1J C;  1A90 A;  1NWQ A;  2ZYA A;  3BAS A;  1IO4 A;  2W6B A;  4WY4 A;  5CBO A;  3CC2 P;  1UCJ A;  1SQX D;  1G02 A;  4STD A;  1IZN B;  3L37 A;  3LXU X;  4LLH A;  4MJD A;  3EC9 A;  1LJ2 A;  1H88 A;  1Z56 A;  2D1W A;  3LT8 A;  3DGM A;  4HOH A;  2Z5I A;  1OMI A;  3H1I E;  1BGY E;  1ZLL A;  3H1L G;  1TJD A;  5EQL A;  1VQP P;  1NTK D;  2P2U A;  5KLV D;  1B27 A;  2POH A;  3BRT B;  5AW1 B;  1J2J B;  3HK4 A;  1W6C A;  3H1J D;  5CJ0 A;  1MWS A;  1XTC C;  2OTL P;  1SQX E;  4HM0 B;  3Q3D A;  2XF3 A;  3D6Y A;  1BRG A;  3FG1 A;  1W6G A;  1N73 A;  3M0A A;  1H89 A;  1FGQ A;  2QRX A;  1KIL B;  3CXH H;  1SQQ K;  3TYY A;  4CPK A;  1W2B O;  2WSF H;  2BEZ F;  4PD4 H;  5AVR B;  1KYO H;  1SLQ A;  4L8O A;  1NTK E;  4YPC A;  5KLV E;  2Q7C A;  2N1T A;  3TGU D;  4U7J A;  1KC8 Q;  3FXE A;  3RK3 D;  3H1J E;  4I1L A;  3PJS K;  1Q82 Q;  3ALA A;  2O3O A;  1M57 D;  5CCG A;  2ZJS E;  2CG0 A;  3GG2 A;  1GD4 A;  1OH0 A;  3FXD A;  4W80 A;  5DRE A;  2B1X B;  4ZMD A;  1ZR4 A;  4BL2 A;  1CQS A;  1C54 A;  3VP8 A;  4IL6 E;  3EHC A;  1SQP D;  2FXP A;  1SQB J;  3TGU E;  1VQ5 P;  2HFE D;  1VQ6 3;  2I8D A;  1AFO A;  3UIA A;  3EFF K;  3RK3 E;  4M3L A;  4EXR A;  2E5Y A;  4R4L A;  3Q5R A;  1WMO A;  2QEX 3;  5CCH C;  1X22 A;  1NTM K;  1BNG A;  2BCC J;  1S4X A;  2IPP A;  1WMK A;  1M9G A;  4PJ0 E;  5B66 H;  1JMM A;  1YTZ I;  3V99 A;  1RCK A;  2OQE A;  2QJK B;  1SQP E;  1FDI A;  2L1S A;  2A45 H;  3NM7 A;  2J8X B;  1MFZ A;  5KTB A;  4H3U A;  1NTM G;  4AKZ A;  4W7Z A;  3EE1 A;  4UB8 H;  4RJT A;  1NH4 A;  5APU A;  2C11 A;  2XFT A;  1ZP0 C;  1AR0 A;  4L73 A;  3Q1M A;  1MV8 A;  2KSE A;  1RF1 A;  3H1H J;  1NU1 G;  1OVU A;  2BMR B;  1J1E B;  4AKY A;  4MN4 C;  3VMX A;  1L0N J;  1RHZ B;  1D6U A;  3HTK A;  4OUQ A;  1RNB A;  5AVZ B;  2E2U A;  2H0I A;  3QH9 A;  1KFN A;  3CMA P;  1IFM A;  3KQG A;  2CH9 A;  2Q1K A;  4H61 A;  2Z7A A;  2HMK B;  3L70 G;  3HOH A;  1OW6 A;  1LT9 C;  3NBR A;  3A5T A;  2BMQ B;  3AE8 C;  3F89 A;  4J5K A;  5CXO A;  3VMZ A;  3X42 A;  3LZA A;  1BCC J;  4GKG A;  3CCL P;  2CFW A;  5C39 A;  1Q7Y Q;  2I1J A;  3HZP A;  1M8O B;  1YJW P;  2CFD A;  2C4B A;  3CU3 A;  5GSP A;  1B2M A;  2PFX A;  1ZS7 A;  3O8Z A;  5G1L A;  3EQ2 A;  3SX1 A;  1GL2 C;  2FFD C;  2AXT E;  3MYT A;  1YIJ 3;  3ABV C;  2OYH C;  3AE9 C;  3GZB A;  4WP5 A;  2I9W A;  3NXS A;  3I56 3;  4AUW A;  1GOY A;  4ZM8 A;  1RHL A;  2WPS A;  3W68 A;  2D2C D;  1IV9 A;  1LTJ C;  4U13 A;  3CC2 3;  2A45 G;  1BNS A;  2CFL A;  3CCQ P;  4GSP A;  5L8R J;  3A3Y B;  3HUS B;  3M9Q A;  1L0L D;  2BNG A;  1KTM A;  2OYO A;  1QAK A;  2WMM A;  1RE4 A;  3M0D C;  2IBZ G;  2XKM A;  1RLS A;  3F9S A;  1VF5 D;  1WRG A;  4WHA A;  4N78 D;  1H0T B;  3F5H A;  5BXQ A;  3TSI A;  5IG5 A;  4HZB B;  1AQT A;  5APV A;  4QWT A;  5B5E E;  4C46 A;  4BTW A;  1VQP 3;  2HML B;  2C9N Y;  2O1K A;  4CJN A;  3E1R A;  1BNF A;  1YJ9 P;  2RMZ A;  4WWI A;  4N6T A;  3A5E A;  3WA3 A;  3MG1 A;  3V4W A;  5AW7 B;  2ZXE B;  2OTL 3;  2PZV A;  4H0L B;  2B9B A;  5AEU B;  1ZN5 A;  5FW5 A;  2Z77 A;  4UB8 E;  4XDV A;  1P84 I;  1K73 Q;  1L0L E;  4AEQ A;  2NPS B;  1JUN A;  4H13 D;  4UB6 H;  3V98 A;  6RNT A;  1AVL A;  3BLZ A;  3K63 A;  3LID A;  1GMJ A;  4IOI H;  4XFJ A;  2W8Z A;  1Q86 Q;  4N78 E;  1DE3 A;  1W2E A;  3L74 D;  2R5D A;  2XND H;  1ULI B;  5AVS B;  4J8T A;  3G6E P;  1RN7 A;  3H1I J;  1BGY J;  4LMI A;  1UUG B;  1KIL A;  1YVB I;  2WIT A;  5CMZ A;  1UII A;  2OOV C;  1RJO A;  3WOF B;  4IPB A;  2N9B A;  5AW0 B;  2KIK A;  3KKG A;  2QG4 A;  5AVX B;  3P7K A;  2R32 A;  2J59 M;  3SFE C;  1FGM A;  1FOS E;  2CK3 H;  1JBT A;  1FUT A;  2O01 J;  1Q9E A;  2P0M A;  1IV7 A;  2IFN A;  4GDO A;  1NJI Q;  4GIF A;  3L74 E;  4LSO A;  2FXM A;  2ZXX A;  1DD4 A;  4JF7 A;  1VQ5 3;  2E43 A;  1JNM A;  3HE5 B;  1CW5 A;  1NTK J;  5KLV J;  3VMY A;  3A7O A;  1EKM A;  4A7P A;  1C7H A;  1TUH A;  3K0Z A;  1HJB A;  3H1J J;  1NO4 A;  3L72 D;  2FBW C;  3O6Q A;  2Y9Y A;  1A2P A;  1EDJ A;  1BSA A;  2M0B A;  1ASK A;  3L4F A;  2GM4 A;  3BB9 A;  2O3J A;  4EOT A;  3N8B A;  1UGH I;  1SQV G;  4I7Z C;  2F56 A;  1I8V A;  3USS A;  2CWT A;  2OYI C;  1W02 A;  1QMA A;  3ZFZ A;  3OA7 A;  3WUU A;  3TGU J;  2M5A B;  4K61 A;  2L91 A;  3RL0 B;  3PXM A;  3ROB A;  5BU8 B;  2IUJ A;  3R2P A;  2B89 A;  5H2F E;  3ECF A;  3JUP A;  1JZO A;  3L72 E;  3BIR A;  5RNT A;  3E7K A;  4IIA A;  3L35 A;  1SPU A;  3CXH I;  4DKI A;  4QMA A;  2YKP A;  1EEJ A;  4C7R A;  1VQK P;  4OGQ C;  4PD4 I;  4GOF A;  2QGU A;  1KYO I;  1S5L X;  2W90 A;  3CMA 3;  2K3D A;  1GY5 A;  2I1K A;  4UB6 E;  1WTH A;  4EW5 A;  1JN5 B;  1SQP J;  3HD7 C;  3RK2 B;  3G71 P;  5K5G B;  3Q2Y A;  2NPS D;  1TTO A;  2WPV B;  3CCL 3;  1YGE A;  2Q6Q A;  3VMA A;  1DVD A;  3FZW A;  2L5G B;  1YJW 3;  1KB9 H;  2W2C A;  3P32 A;  1OHO A;  4TX4 A;  1SQB K;  2STD A;  5BVB A;  2QJY C;  1EDK A;  2JEE A;  1IFP A;  1ZO2 A;  5TJH A;  3DH2 A;  2GUS A;  2KSJ A;  1L4A C;  2A06 G;  4LGQ A;  4X2O A;  3FCS B;  4Y99 B;  2XGL A;  4EYC A;  5APX A;  1T2K C;  1RSN A;  3MD0 A;  2YFI B;  5IEP A;  1QGK B;  1JM0 A;  2CG1 A;  3AEC C;  3L71 G;  2BCC G;  3B4S A;  3UL5 A;  5AEW B;  1NDO B;  4R4M A;  4HYT B;  1NU1 J;  2INX A;  1RE3 C;  4R1K A;  1BRK A;  1X1Y A;  4BTX A;  3QWO C;  1MZ9 A;  2ZT9 C;  4K1U A;  1X79 B;  1M1X B;  1E79 H;  2A45 I;  3L75 D;  4PV1 B;  1JTH B;  3CXC 2;  4H44 D;  2QM8 A;  2HPC B;  1YJ9 3;  1L0N K;  2UWJ E;  3VN0 A;  3DY5 A;  3CME P;  2W03 A;  2IBZ I;  4KT0 J;  1SJW A;  1NB3 I;  1BAO A;  2HOH A;  4MMX B;  3VTP C;  3EQQ B;  1BNJ A;  1H0T A;  1OVR A;  2YIU C;  1B3S A;  4L7K A;  1GW4 A;  2WTY A;  3A0B H;  1T3U A;  4BWN A;  3H1H G;  1YYC A;  1IK3 A;  3D3L A;  3AEB C;  1U7J A;  1KB9 D;  1KQL A;  2E76 C;  2KLV A;  5APY A;  1U5O A;  3G0K A;  3L75 E;  3DGY A;  1LT1 A;  3CC7 3;  1D6Y A;  3RL0 D;  3A0H E;  3FG4 A;  4EC6 A;  2ITA A;  3JUO A;  4WYK B;  3P8C D;  1N7S C;  1KMI Z;  3G6E 3;  4J5G A;  2F99 A;  1OHP A;  2NPS A;  3GZY B;  3D9R A;  3L36 A;  2J5U A;  2WGO A;  2CFK A;  1VQ6 P;  1GD3 A;  1BCC G;  2F5W A;  4JPZ B;  2MC8 A;  1DVC A;  5EEO A;  4XB5 A;  4WY4 D;  3C8V A;  3KZI E;  1M1J B;  3RK2 D;  1GK6 A;  3L73 D;  1KB9 E;  1L0L J;  1IQX A;  3MHE A;  3V2P A;  3U59 A;  1FZC C;  2PAJ A;  3P8C E;  3LIE A;  2CWU A;  1LOY A;  2QIY A;  2FYN C;  4XA4 A;  1CYV A;  2FYU D;  4OWF A;  3M9B A;  2Q3I A;  5AI1 A;  3X3Y A;  3D71 A;  1O7G B;  2QSI A;  1O7N B;  3BAT A;  2ZVO B;  1HYF A;  1BDD A;  1SQW A;  1BNR A;  1IFI A;  2QJP B;  3SED A;  3L73 E;  4BXL A;  3URP A;  3C9I A;  3I0Y A;  1DIP A;  3HE5 A;  2KAA A;  3NX0 A;  3GSP A;  2CFG A;  1N8Q A;  1FJP A;  5D81 A;  2R44 A;  4GHO A;  4KVH A;  5BU5 A;  2FYU E;  2WSE J;  4WB4 A;  5DJT B;  4HM8 B;  5CHX A;  1Q42 A;  2N1T C;  3EB8 A;  2IZ1 A;  3KHU A;  2YKQ A;  2LR2 A;  1V74 A;  1PV3 A;  4AQR D;  3LML A;  2E75 D;  2OTJ P;  5JPU A;  4IFD K;  3MPH A;  5KJ7 C;  4J9A A;  2BEQ D;  1QEX A;  3RBX A;  4DCK A;  3IFM A;  1URQ C;  5CF2 A;  4KJM A;  1IJD B;  5CCG D;  3CCR 3;  4RES B;  1YHQ P;  1W2Z A;  2XRX B;  2WT7 B;  1GY6 A;  2XZR A;  1UDI I;  4HYZ A;  2CC3 A;  4RNT A;  4IL6 H;  1PPJ D;  3V2R A;  1GZL A;  1IQY A;  4N3V A;  2CIU A;  3F8H A;  3G71 3;  4W7Y A;  1YIJ P;  2GUV A;  4BRY B;  1YI2 P;  2G8Y A;  3DGL A;  1AV4 A;  3H1I G;  2IY2 A;  1BGY G;  1HGV A;  1AVK A;  3KYQ A;  3SWF A;  2JJL A;  1VQ9 P;  1T6A A;  3IJE B;  1GW3 A;  2M3B A;  4PJ0 H;  3HI7 A;  3L72 J;  1I0V A;  5AYS C;  2AAE A;  1JN5 A;  1E5W A;  1NTK K;  1SQX G;  2E74 D;  5KLV K;  1JNQ A;  3NXJ A;  1PPJ E;  2FXO A;  1VQM 3;  2KRT A;  2FYZ A;  1ZR2 A;  3FF0 A;  2CPB A;  1SQV J;  1LTG C;  3WDG B;  4GOD A;  8CHO A;  5APW A;  1JB5 A;  3CCJ 3;  1BSB A;  5ELU A;  5KAI E;  2C9L Y;  1NTK G;  5KLV G;  1FAV A;  5APT A;  2KUB A;  3WA2 X;  2MJZ A;  3MG2 A;  2OGU A;  3H1J G;  1N9E A;  4PEJ A;  3B8E B;  1NKZ B;  2BAS A;  4BU4 A;  4OVM A;  1KV4 A;  1GDT A;  4NPD A;  2KF3 A;  4JRF A;  1E97 A;  1HGZ A;  1S9K D;  1E3V A;  2YFJ B;  4N6N B;  4N6M A;  4XBY A;  3CME 3;  1BRN L;  1QLE D;  1J1D C;  3M8C A;  1UGI A;  3B5N B;  3TDK A;  2ZVN B;  1UI7 A;  3TGU G;  3RK3 C;  5HGR A;  3MWZ A;  1QVF O;  2WVR A;  1O7M B;  1JTH A;  1LT9 B;  3IMA B;  1SQP K;  2SBL A;  3MTU E;  3D6Z A;  1Y4K A;  3CWB D;  2HPC A;  2AXT H;  1CYU A;  3HIG A;  4O3V A;  3B7C A;  1B20 A;  1RF0 A;  1R4Y A;  2XU6 A;  1S9K E;  1HH0 A;  2VRS A;  2P0X A;  3O6Q B;  1B2Z A;  1GL2 B;  1SQQ D;  1IT8 A;  1VDF A;  2FFD B;  3WOD G;  1KQS 2;  1EQ7 A;  1S5L E;  1SQP G;  2IX7 C;  3SWK A;  2OYH B;  1KB9 I;  1LQM B;  3OXA A;  4K3A A;  2WSC J;  5IW9 A;  3PRJ A;  3L71 J;  3CWB E;  3Q2P A;  3E1I A;  4WYK A;  1D7M A;  3FKA A;  1RTU A;  1LTJ B;  2Q07 A;  3MSO A;  4IFF A;  5B5E H;  1HZ1 A;  4DJG A;  3SOY A;  2CHC A;  1YIT 3;  1OPY A;  3L75 J;  3FH1 A;  3CPO A;  3JUN A;  1NU1 K;  2FY8 A;  4FMD A;  2IZ0 A;  3D5I A;  1M1J A;  1JY3 O;  1Y8A A;  3HE4 B;  3BRV B;  7GSP A;  1HUC A;  4DZO A;  4ASW A;  4LGD E; 
#chains in the Genus database with same CATH homology
 2ZDJ A;  2OOV C;  1RJO A;  3U1W A;  3WOF B;  3MG3 A;  3F14 A;  4IPB A;  2WO0 A;  2YX9 A;  2FNQ A;  3VF1 A;  2RCD A;  3KKG A;  5STD A;  3JVC A;  1O7W B;  2GU3 A;  2HMN B;  1FGM A;  4HM3 B;  3UL6 A;  1K9M 4;  2CK3 H;  2K54 A;  2JDI H;  3LTD A;  2E5T A;  2XFS A;  3SLU A;  2P0M A;  1IV7 A;  1Q81 4;  3LH4 A;  1QVG 2;  3T0U A;  2WOH A;  2P05 A;  4LSO A;  3EJV A;  1VQ5 3;  2OQE C;  4WFO A;  2Z76 A;  3GZR A;  2HMJ B;  4HM6 B;  2XGN A;  1M1K 4;  1EKM A;  2OTJ 3;  1BSH A;  1OF5 B;  3T8N A;  1C7H A;  4CDL A;  1TUH A;  3K0Z A;  3FLJ A;  3STD A;  3NBJ A;  1OCV A;  1ROV A;  2BO9 B;  5AII A;  1MOL A;  1VQ4 3;  1GS3 A;  1YHQ 3;  1ASK A;  3B4P A;  4EV2 A;  1NO3 A;  4HBR A;  4N6L A;  3SXX A;  1RKY A;  2B24 B;  3BB9 A;  3K7C A;  4HM4 B;  5CLK A;  3DM8 A;  3SOA A;  2W56 B;  3N8B A;  2CWV A;  3X3Z A;  3EBY A;  3X40 A;  2XR8 B;  1ROA A;  5IEN A;  2P38 A;  1N5H A;  1FS0 E;  3J7Y d;  1VQL 3;  1YI2 3;  3USS A;  3UB1 A;  2CWT A;  1KWI A;  1W02 A;  2XH9 A;  3NV0 B;  1QMA A;  5KP1 A;  4K61 A;  1VQ9 3;  5D83 A;  3PXM A;  3ROB A;  5KP3 A;  3JUQ A;  2IUJ A;  3ECF A;  3JUP A;  1NB5 I;  3KN4 A;  1A2V A;  2HMO B;  5AYR B;  4IIA A;  1SPU A;  1T5Y A;  1BSN A;  3BNC A;  4FCZ A;  4NHF A;  4QMA A;  4O02 B;  3A76 A;  3WOE B;  3DUK A;  2XEP A;  4I4K A;  2RSX A;  4K1V A;  2QGU A;  3PCS A;  4MEI A;  1GY7 A;  2IUK A;  3LTC A;  3CMA 3;  1GY5 A;  1WTH A;  2GBW B;  3NM2 A;  4O2H A;  1JN5 B;  5IG0 A;  3K5T A;  3NBB A;  3BND A;  1EG9 B;  4R80 A;  1BUQ A;  3KSE D;  1QAL A;  1EA2 A;  3EF8 A;  3FSD A;  1YGE A;  3PCR A;  3Q90 A;  4GB5 A;  4HM5 B;  4N6U A;  5A0O B;  3FZW A;  1YJW 3;  1DVD A;  2W04 A;  1QJG A;  2W2C A;  1EQK A;  2KXG A;  1FUW A;  1OHO A;  3RGA A;  4TX4 A;  2STD A;  5BVB A;  3GAX A;  4HM2 B;  3BNB A;  1IFP A;  5D82 A;  1ZO2 A;  5CK6 A;  1SII A;  1JB4 A;  5IG4 A;  3E99 A;  1M90 4;  3GZX B;  5ELJ A;  3S27 A;  4LGQ A;  1L5G B;  4X2O A;  3JUM A;  1KC8 4;  3FCS B;  2ML5 A;  4L8P A;  2XGL A;  3QRD A;  4LEH A;  1QVF 2;  4EYC A;  3OWU A;  4FCJ A;  3CPW 2;  1Q82 4;  5IEO A;  1IU7 A;  1STD A;  3KZT A;  1JB2 A;  1UUW B;  3DZL A;  1SIH A;  1JKG B;  1FGO A;  2GU1 A;  4HVN A;  1DMQ A;  2YFI B;  3X3X A;  5IEP A;  1VQO 3;  2UX0 A;  3LT9 A;  1JEK A;  2CG1 A;  2ML6 A;  3N54 B;  3GRD A;  2WOF A;  2R4I A;  3BNE A;  4OK0 A;  1FGT A;  2GBX B;  4N6O B;  1VQK 3;  3UL5 A;  5AEW B;  1TFK A;  3F40 A;  2BT3 A;  1O7H B;  1LOX A;  1NDO B;  2W9Q A;  2INX A;  1UW1 A;  4R1K A;  2RGQ A;  2Z6B A;  1IVV A;  2O9U X;  2HMM B;  4BTX A;  1VZZ A;  4WWU C;  1OAC A;  4IT7 A;  4K1U A;  1K41 A;  1M1X B;  1E79 H;  3CXC 2;  3ER7 A;  4HM1 B;  2GEY A;  1YJ9 3;  1E3R A;  1NWW A;  1R4C A;  4KFD A;  3DY5 A;  5DRV A;  2W6J H;  2W03 A;  2V1L A;  1SJW A;  3I55 3;  3GWR A;  4MMZ B;  1PU4 A;  3KFQ C;  1NB3 I;  4MMX B;  3TDG A;  1VQ8 3;  3CNX A;  5EVH A;  3OW2 2;  3K9M C;  1A90 A;  3AMO A;  3EQQ B;  4L7K A;  2YFL B;  4STD A;  3LXU X;  1IK3 A;  3D3L A;  5IG3 A;  3G0K A;  1QAF A;  1U5O A;  4MJD A;  3B4O A;  3EC9 A;  1U8C B;  3CC7 3;  1D6Y A;  3FG4 A;  2D1W A;  4EC6 A;  3JUO A;  4WYK B;  3LT8 A;  3DGM A;  3KSP A;  4RBN A;  3G6E 3;  1JV2 B;  5EQL A;  2M7O A;  5AIG A;  2F99 A;  1OHP A;  3F7S A;  4FMB A;  3LTA A;  4EBG A;  2KCD A;  3GZY B;  4FMC A;  2BMO B;  3D9R A;  3HK4 A;  2WGO A;  2CFK A;  1LVN A;  2Y73 A;  1W6C A;  3EN1 B;  2GEX A;  1GD3 A;  3G16 A;  3DMC A;  4HM0 B;  1F8N A;  2MC8 A;  3CCS 3;  2XF3 A;  1IQ8 A;  4XBT A;  3FG1 A;  1DVC A;  3PS8 A;  4XB5 A;  1G96 A;  1W6G A;  5EEO A;  2E2V A;  2OWP A;  1J2B A;  1Q40 B;  1FGQ A;  3KII A;  3PGB A;  3FGY A;  3DGN A;  1IQX A;  3EX9 A;  3G8Z A;  3MHE A;  2ZL8 A;  3NQY A;  3RDE A;  3VGN A;  3UNL A;  1MNL A;  3B8L A;  2XSH B;  2CWU A;  1A67 A;  2QIY A;  6STD A;  1Q7Y 4;  4XDW A;  1CYV A;  4L8O A;  1JRQ A;  1DYU A;  1ULJ B;  5AI1 A;  5LC7 A;  3X3Y A;  1O7G B;  2E2T A;  1TU5 A;  1O7N B;  4FCM A;  3PJS K;  3ALA A;  4KFF A;  2F86 B;  3CCV 3;  2LYX A;  1SQW A;  2O3O A;  2CG0 A;  3SED A;  1O7P B;  3H51 A;  1GD4 A;  1VQN 3;  1OH0 A;  2V7Q H;  3U97 A;  3I0Y A;  3HX8 A;  4EV5 A;  5DRE A;  5I97 A;  4WVZ A;  2B1X B;  3NX0 A;  1VQ7 3;  1OF5 A;  2CFG A;  1CQS A;  1N8Q A;  3CD6 3;  3G4S 3;  5D81 A;  3EHC A;  4KVH A;  4TLF A;  4BTY A;  1OGX A;  3FG3 A;  4HM8 B;  5LC6 A;  1S72 3;  5CF1 A;  4R9L A;  1VQ6 3;  1Q42 A;  3EB8 A;  3EFF K;  1US1 A;  3RGR A;  2E5Y A;  4EXR A;  1V74 A;  2BHM A;  1WMO A;  5FGO A;  2QEX 3;  3NHX A;  3LML A;  5JPU A;  3MPH A;  2W56 A;  7STD A;  4J9A A;  4R4K A;  4G1M B;  3OX9 A;  5CF2 A;  1IDP A;  4ORL A;  2F98 A;  3CCR 3;  1M9G A;  3NV0 A;  2MF7 A;  2IMJ A;  1W2Z A;  2XRX B;  1S5A A;  1DMN A;  1GY6 A;  4HYZ A;  2CC3 A;  5JBS A;  1ISK A;  3IPT A;  2IA7 A;  1IQY A;  3V99 A;  1W7C A;  1K8A 4;  3N9H A;  4N3V A;  2JQ5 A;  2OQE A;  3OV4 A;  2CIU A;  3F8H A;  3V92 A;  3NM7 A;  1UUV B;  3G71 3;  3CCM 3;  4H3U A;  1A2K A;  4N6V 0;  4AKZ A;  1DMM A;  3EE1 A;  3DGL A;  3X41 A;  1AV4 A;  2C10 A;  1TIJ A;  1K73 4;  1AVK A;  3CNM A;  3LYG A;  2P09 A;  1OGZ A;  3L0R A;  4RNZ A;  2C11 A;  4CCV A;  3IJE B;  2XFT A;  3HI7 A;  1AR0 A;  5AYS C;  1Q86 4;  3MKI A;  4KZ1 A;  2WGQ A;  1RRL A;  3SVA A;  2LQV A;  1JN5 A;  2BMR B;  4AKY A;  4HKV B;  1JNQ A;  1D6U A;  4X2H A;  1UI8 A;  1IVW A;  3NXJ A;  4O8S A;  1STF I;  2PNC A;  1OHS A;  1VQM 3;  2KRT A;  3WMD A;  1WQL B;  3LOY A;  4OUQ A;  3FF0 A;  2E2U A;  4K90 B;  3WDG B;  8CHO A;  2CH9 A;  4H61 A;  2Z7A A;  1JB5 A;  3CCJ 3;  2QE7 H;  4MMY B;  1KSI A;  2HMK B;  5ELU A;  3NBR A;  5IF6 A;  2BMQ B;  3OWY A;  5CXO A;  3OWS A;  3LTB A;  3X42 A;  3LZA A;  1W00 A;  2RFR A;  3CCE 3;  2CFW A;  5KP4 A;  3WA2 X;  3HZP A;  3MG2 A;  1YJN 3;  4XBX A;  2W9P A;  2CFD A;  5TGN A;  3CU3 A;  1KD1 4;  1N9E A;  4PEJ A;  1N8R 4;  1NJI 4;  4OVM A;  1D6Z A;  3SX1 A;  1W01 A;  4HM7 B;  1JKG A;  1OUN A;  3PZW A;  1RRH A;  3MYT A;  1YIJ 3;  4JRF A;  3QK9 A;  3EBT A;  1E97 A;  4FMA A;  4RZM A;  1E3V A;  2YFJ B;  4N6N B;  4N6M A;  4XBY A;  3T8U A;  3GZB A;  3CME 3;  4WP5 A;  2I9W A;  3M8C A;  3CCL 3;  3S28 A;  1IT7 A;  3I56 3;  1Z1S A;  3O8Y A;  2K0M A;  4ZM8 A;  1UI7 A;  3UJM A;  2L4V A;  5HGR A;  3MWZ A;  1JJ2 2;  1IV9 A;  2W0Q A;  2XSO B;  4U13 A;  1O7M B;  2CFL A;  3CC2 3;  3PYJ A;  3Q1C A;  3IMA B;  2SBL A;  1LXE A;  1Y4K A;  1TFO A;  3S5C A;  3S67 A;  3VSY A;  1WNH A;  2BNG A;  1TP6 A;  3F7X A;  3NQZ A;  1CYU A;  1HU9 A;  1QAK A;  3HIG A;  4O3V A;  3B7C A;  3F9S A;  1ZX2 A;  3CCU 3;  4WHA A;  1W5Z A;  2WSS H;  1FGR A;  1GYB A;  1N9J A;  3AMO B;  3H3H A;  4HZ9 B;  4Q53 A;  3F8X A;  5BXQ A;  3S29 A;  4FR9 A;  5IG5 A;  4HZB B;  2P0X A;  1AQT A;  4QWT A;  4BTW A;  1VQP 3;  2HML B;  1IT8 A;  3WOD G;  1KQS 2;  1N5P A;  1W6Y A;  4HJL B;  4N6T A;  3WA3 A;  1K28 A;  2D42 A;  3MG1 A;  2CKF B;  3OXA A;  4YXW H;  1LNH A;  4GL6 A;  2OTL 3;  2PZV A;  4XM4 A;  1WMP A;  2OOV A;  4NRE A;  4R9K A;  5AEU B;  5AIF A;  1NU3 A;  2CW9 A;  3HII A;  5FW5 A;  5JPP A;  5IW9 A;  2Z77 A;  1IVU A;  3KE7 A;  1W2B 2;  4LZI A;  3Q2P A;  4WYK A;  4XDV A;  2QA4 3;  1WMN A;  3FKA A;  4JF8 A;  4AEQ A;  3NUV A;  1HKX A;  3V98 A;  2Y74 A;  2Q07 A;  1AVL A;  2OCT A;  3MSO A;  3BLZ A;  3K63 A;  1PFP A;  3DXO A;  3CC4 3;  4DJG A;  3SOY A;  5G2G A;  2CHC A;  1CEW I;  5IER A;  3FF2 A;  1YIT 3;  1OPY A;  3FH1 A;  3CPO A;  3JUN A;  5AIH A;  2XND H;  1ULI B;  4FMD A;  4J8T A;  1RN7 A;  1W4N A;  4LMI A;  4RNY A;  1Q40 A;  1YVB I;  1IVX A;  2FXT A;  2GXF A;  4KFE A;  3EN8 A;  3CCQ 3;  2A15 A;  2FGT A;  3DGO A;  1FA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...