2W6JH

Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 5.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL
publication title Improving diffraction by humidity control: a novel device compatible with X-ray beamlines.
pubmed doi rcsb
molecule tags Hydrolase
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2w6jH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w6jH01
2QE7H 1AQTA 4QMAA 4DJGA 2XNDH 1IFPA 1FS0E 1E79H 1JEKA 4TLFA 3USSA 2CK3H 3EFFK 1BSHA 2W6JH 2E5TA 4YXWH 2JDIH 3PJSK 2V7QH 1BSNA 2E5YA 2WSSH 4WVZA
chains in the Genus database with same CATH superfamily
3MYTA 4WFOA 3RNTA 1NU1E 2E74D 4XDVA 2CHCA 2QVAA 1N7SA 3MG3A 3BLZA 4HJLB 1RNBA 3LIEA 1DEEG 3V98A 1LTJC 5GTHE 1EZVD 1S5AA 3BRVB 2GUVA 3WOEB 1AFOA 2UUGC 1SP4A 4HOHA 2W83C 2ZL8A 2W0QA 3PJSK 2BMOB 1AVYA 1NTME 1NU1K 1LQGC 5TJHA 2A06E 5CJ0A 2NZ2A 4TX4A 2P2UA 2K54A 2XGNA 3B4PA 2XKMA 3RK3B 1NTKE 2W6BA 1FJKA 1EDKA 2HMJB 4TLFA 3CD63 3DGOA 3WR2A 1RF1A 2KZIA 3PCSA 3BNCA 4AKYA 2V4HA 2P58A 4XBYA 4R4LA 4GL6A 1RE4A 3RGAA 1TFKA 2C0XA 2RMZA 1IQ8A 1X8YA 1YI23 2E76C 1NU1D 2R44A 4LLHA 2WVRA 4NPDA 1TIJA 1IVXA 2KAAA 3NV0B 1SJWA 3TGUE 3H1JG 1VQMP 1NTKK 3R2PA 4XA4A 1JY2O 1YJW3 4OGQB 4HM0B 1IV9A 1KWIA 3CCQP 2BCCE 2BU4A 2FYNB 1G2CA 5DJTB 1RNTA 3ITKA 1M1JA 3A0HE 4XBTA 1BUQA 2IZ1A 2UWJE 1IT8A 2A06D 1RGAA 4HJGH 1FC2C 3L74D 1DVCA 3Q5SA 3NM7A 3VN0A 1NTKD 4B86A 1JB0J 2G8YA 2KS1B 3LIDA 3H1LJ 1EEJA 5EFWB 3AMOA 3BNDA 4GIFA 3BVHA 1O7MB 5IEOA 1W2EA 3P7KA 4N3VA 2RNTA 3LTBA 3CCJ3 4BL2A 2Y9YA 2YX9A 2XSOB 3GZRA 5AVTB 1RQUA 1L5GB 3HX8A 2A45I 2AXCA 1GZLA 5M1BA 2ZT9D 3AE6C 1FW7A 2V7QJ 5IW9A 3TGUD 1IFIA 4N3YB 1TP6A 1Z1SA 1BNRA 3H32B 3D79A 3T97A 3AHSA 3L35A 3DM8A 1QVG2 2MC8A 3L75J 5KAFE 5KAIH 2J59M 3LTAA 1G1IA 4HZBB 3WUTA 4L75A 1KZUB 1X1YA 3V2RA 4ILFA 2QA43 4ZMDA 3GZYB 1Q90D 3L72J 3BCCD 1NVOA 4MMZB 2ZA4A 2OYHB 1JY2P 1NB5I 1SVFA 3NMDA 1FOSF 3JC22 4KJMA 1RGEA 3URPA 3WU2E 4RJTA 3AHWA 3NHXA 5AVWB 1Q9EA 1RF0A 1KYOE 3CCSP 3CC43 3CNMA 3C8VA 1GY5A 5LC6A 4I5QA 3MIWA 1L0LG 1JB4A 1W00A 1SQQJ 1NAFA 2JEEA 3MUDC 5CCGC 3UB1A 1LNHA 4ZKUA 3MZWB 1QMAA 1IZNB 4U7JA 1RCLA 1YNVX 4IFFA 3IJEB 4IT7A 1QVF2 2YKQA 1WQLB 3VP8A 2UX0A 1VQK3 1Q864 5CF1A 3IF4A 1I70A 1VQLP 3M0AA 4N6V0 1L0NJ 3RK2B 1CEWI 2PRRA 5HOHA 4K3AA 1M8OB 1BDDA 1S5LX 2GUSA 2YKPA 3WUVA 3PCRA 4J9AA 2FKWB 2WSEH 3MKIA 1BU4A 5C39A 2O01N 3F8HA 4GDOA 4EC6A 1Q824 2P09A 3DH2A 1JCDA 1KFNA 3GLMA 4D6TD 4DZOA 1VQN3 3PS8A 1LTTC 3LMLA 2H8PD 3CMAP 1OGZA 1JBTA 1SQXG 2AEFA 2H89C 1BSCA 1S1CX 3G4S3 4OGQC 1OF5B 2BMQB 1UGHI 3B4OA 2R32A 3NBJA 5G1KA 1UUGB 2FYNC 3AE1C 1PGPA 5AW7B 3CCL3 1I3IA 2GBWB 1YJNP 1UCKA 1RHLA 5LC7A 5AEWB 3CMEP 3H6PA 1B2ZA 1FU1A 1K28A 1RRHA 1FDOA 3FKAA 2OTLP 4PD4D 1JN5B 1RKYA 1VF5C 2HLOA 5AIFA 4LZIA 1JMMA 1LOWA 2AXTE 1G1JA 1PFPA 3VTPC 2E2TA 4EBGA 2C9NY 5G2GA 1W5CE 4C7NA 2Q3IA 2P67A 3EFGA 1NGMB 4RESB 1UCIA 5BVZA 3IMAB 2Y73A 4HKZH 2YKOA 1SQPE 3VYIA 3WODG 1BSHA 1JB2A 1VQP3 5KKZB 1TRQA 4FCMA 1C7HA 2IFMA 3BATA 1RLSA 1R5LA 4HH2A 2CFLA 2OOVA 2OYHC 2JJLA 4Q53A 1IYYA 5H2FH 2NPSB 2O3OA 1OW6A 3OAKA 2OARA 1BCCE 1KSIA 1NH4A 3V4QA 1SQPK 5APXA 3I553 1LT9A 2K9YA 1VQ8P 3AE8C 2L1SA 2W9QA 1SQWA 2AEMA 2QM8A 1BRJA 1S4XA 2XDJA 3M9QA 1EC5A 2GBXB 2YMYA 3L71D 2W56A 1M1JB 2YIUB 3CCV3 1BSAA 3EC9A 2OYIB 1S5LE 1S2EA 1MV8A 3B8EB 3S5CA 2CWTA 2W90A 3SLUA 2IA7A 1VPCA 1SQPD 1IFPA 3MHVA 1VQO3 3RK2C 4H61A 3AMOB 4BTYA 3LYGA 1STDA 2BMRB 4CJNA 2XEPA 1HZ1A 1FZCA 3LT9A 2UGIA 3WA2X 3GRDA 1ZLLA 2PFXA 3AEBC 2ZYDA 2KP8A 3FG3A 1MFZA 2Q9IA 1YJ93 1BCCD 2K88A 2ZFCA 1BE3J 2KRTA 1KYOI 1FDMA 2B24B 1Y47A 4AKZA 4BRYA 2YNYA 3EQ2A 1DETA 1GY7A 4FCJA 4ORLA 1M9GA 3M9HA 3V6IA 4FCZA 1YIJ3 1SARA 3QH9A 4NPEA 3FF0A 4JBZA 3CCRP 2PNCA 1YQ4C 3AGNA 1N73B 1KQGB 2QG4A 2IUKA 3F9SA 2N9YB 2KF3A 1TTOA 1N9EA 4K1UA 2E75B 3VMAA 1Q40A 4EI2A 1BSEA 1Q814 1A90A 3B5NB 3SFDC 2W27A 3K9MC 4OK0A 5B5EH 5IEPA 3CPOA 3H1JE 1HBWA 3UL6A 1T3UA 8RNTA 3IN6A 3V99A 3K0ZA 1KTMA 2QGUA 1C54A 1HGVA 1M1XB 4DT0A 3HTKA 2BIRA 1O7HB 1JKGB 4LGDE 3BNEA 1NO4A 3H1KG 2PZVA 3EB8A 3JUNA 2SPZA 1M1K4 3V5BA 3GAXA 1D6YA 1GMPA 1Y9BA 2QJYB 2R5DA 3HUSB 1LXEA 3U97A 2P0MA 4PV1D 2F86B 3N8BA 2QEX3 4N6MA 1XTGB 1RE4C 1GMQA 2ZXEB 1LOXA 2E5YA 1RGHA 3SEDA 1G0TA 1RMSA 1RHZB 2LXCB 1M90Q 3EQQB 1B21A 1J2JB 1B27A 3KSED 1NTZJ 1AR0A 1ZGXA 1KQS2 4LEHA 3H1JD 1X9VA 4WY4B 5AW4B 4HKVB 3MP7B 2GSPA 1GL2D 1JCCA 1M1JC 2YIUC 2ITAA 2OYIC 4PD4H 2HMNB 3F7XA 4KVHA 4H13D 2XH9A 1Y4KA 1KB9I 2O01H 2WQYC 2KSJA 1V58A 3F89A 4L8PA 3HOHA 5AW1B 3GZXB 1SIHA 2FYUE 4KFEA 1QL1A 1GU5A 1VQ9P 4NPBA 2I1JA 1LRAA 3W68A 3E99A 1BRSA 5AW8B 4C7NB 2QRXA 1RCKA 3CC73 1RY3A 2G3AA 3J7Yd 2ZVOB 1BGYJ 4KZ1A 3D5IA 3CCEP 2CWVA 3HE5B 1L0LE 1N8R4 2FY8A 1YHQP 5ELUA 1OVVA 3D9RA 5D83A 3DGNA 1OVRA 1UI8A 1N73C 5CBNA 2KUBA 3MG1A 2D2CB 1S723 1MFTA 2BO9B 2AADA 2N1TD 1AQTA 4STDA 4Y99B 2Z77A 3B7CA 5KLVG 3JUPA 2AXTH 1L0LK 3JSVC 2B87A 1BNJA 4KT0J 1E97A 4H44B 3FGYA 2OTJ3 3TF5A 2P1JA 3H1IG 5M1AA 1LT9B 2R3CA 3IAOA 1KD14 3N4XA 1MOLA 1SQXE 2N1TA 2YFLB 2PP6A 3WA3A 3RL0D 3SSUA 4J5GA 4CPKA 4CPGA 1USEA 2LYXA 4FR9A 2WSCJ 1PGJA 1ZOYC 3D71A 1OH0A 2KXPB 1KILE 1L0LD 1FS0E 3HD7D 3OW2O 2O9UX 1FDIA 2QJYC 2W6JH 2GM4A 1F8NA 2YFIB 5AVYB 3AEAC 3SOAA 1Z56A 3M0DA 1BGYG 4IL6X 1IJDB 3EN1B 1N86A 2FYZA 2F5WA 2KF5A 2WPVB 1WTHA 1URQD 2ZAEB 4RNZA 2IBZI 3FX0A 3PRJA 2CX0A 3L73J 3HD7A 3F7SA 4L8OA 4DJGA 1A2PA 4RBNA 2GEYA 1SQBJ 1DIPA 1RN4A 3GHGA 1ROAA 9RNTA 3JUMA 3TYYA 4KT3B 4WY4C 4O9BA 4OUQA 5FGOA 4N6TA 1BRKA 2QIWA 3AE2C 1URQA 3PGBA 1LVNA 1S5LH 3H1HG 2WGOA 2KNCB 4U3FG 2HPCB 4HZ9B 5B66H 3CCJP 4FMAA 1IC2A 1WMPA 1J1EC 2QSIA 2K1AA 1FZAA 1IFDA 1KILD 5H2FE 2H7HA 5CCHD 3NXSA 2GXFA 1Q40B 2WPRA 3VMXA 3TNUA 1SS1A 3CWBJ 5BXQA 1HTLC 1GU4A 3CXC2 3I563 3G6E3 1KILA 2WWWA 2XZRA 5AVVB 1QALA 1RGLA 3CI9A 2ZDJA 3L74E 5APVA 1LWUA 3CPW2 1CSBA 2J5UA 2W03A 1K73Q 2LR2A 3B71A 3QWOC 4JYBA 3DGYA 1ZW0A 3L70J 5KJ7D 4WHAA 4MMYB 4L76A 5AW2B 3OX9A 2D2CC 2HG5D 3F5HA 4FMCA 1O7NB 3NTNA 3CC4P 2R4IA 1X22A 4Y99C 2J8XB 3G713 1RH5B 1CH0A 2CFWA 1VQ5P 1TU3F 3NBBA 1EA2A 3GSPA 2BNGA 2KF4A 4H44C 4ASVA 2D1WA 2YXRB 4LC1A 2FFDA 1RRLA 4OVNF 1LT9C 3T8NA 1L4AD 3KQGA 2V1LA 4CCVA 3E1RA 1LTSC 2Q1KA 1YTZI 1T2KD 3B8LA 2Y74A 1KORA 2I8DA 1YIT3 5TGNA 1PFIA 3BCCE 4CDLA 3A0BH 2OGUA 1ZO2A 1GD3A 1LTGC 1NJIQ 3CWBG 3LW5J 3SWFA 1VF5B 1IVVA 1I8VA 2H88C 2IMJA 1L4AA 4KFDA 3IFMA 1UUVB 1HJBA 4BTXA 2R5BA 2IDBA 1MWTA 1QAFA 2H0IA 1H0TB 5AVSB 4GHOA 2JKVA 2O1JA 2WZ7A 3CPWO 4EIJA 1FZCC 2RH0A 5B5EE 2WSFH 3VSYA 2RBIA 3ZDMA 3AE3C 3VGNA 2L91A 1IVUA 1YYCA 3BRTB 1X1WA 2CPBA 3L70G 1ZX2A 1QEXA 1ZP0C 1ZR2A 3X3XA 1EXIA 4EDFA 2P7JA 3S1KA 1Y8AA 3HI7A 3FCSB 3FXEA 1T3BA 1T2HA 1SLQA 2GA1A 1RGGA 2LKMA 3FGAD 3K7CA 1AV1A 4PEJA 3PP5A 3MSOA 2OQQA 3KN4A 3H1KE 4EOTA 3T8UA 2Q5UA 1TFOA 3D5GA 4YTPC 3ZG5A 1IFNA 2HMMB 1NHLA 4D6TE 1ZXGA 1PP9J 1KV4A 5IF6A 1VDFA 2ZYAA 4EV2A 1EZVI 2CX1A 7GSPA 1PPJD 1JRQA 3X41A 4IFDK 2B87B 2POHA 4HM3B 3ZFZA 3LZAA 1B2SA 4H0LB 2RKLA 5CBOA 1EDLA 4R1KA 4KHXA 2KYVA 4N6OB 1BNEA 3H1LG 5EEOA 1KMIZ 1K8AQ 1E3VA 2HODB 4HM6B 4PD4E 1CZQA 2KLVA 2LXBA 1J1DB 4Y28J 2W9PA 1I3FA 1T8ZA 4RO0A 1DD3A 1FZBA 4I4KA 3U59A 2F98A 5AW0B 4HM2B 5K5GB 1SQVJ 2H43A 1VQM3 1FUSA 1SFCD 1FAVA 1LJ2A 3SOYA 3H1KD 2Z6BA 2V7QH 3EX9A 1W01A 1QVGO 4GT1A 5KTBA 3L75G 3CX5D 1GDTA 1DMQA 3CCQ3 1IK3A 1YTZT 2CKFB 2M0BA 2YO3A 3NBRA 1IV7A 3X3YA 3L72G 1MNLA 1UCJA 1JEKA 1I2GA 2A45G 1CI6A 1GYBA 1W4NA 2OQEA 4ZKPA 3ABVC 3HK4A 3NQZA 2FXPA 4BTWA 3AEFC 5AW5B 4L73A 1CYVA 3AE4C 1NU1J 4LYLB 4TT3H 1N5HA 1JY3O 1ISKA 4I6MC 3STDA 1Q2NA 1M56D 3GG2A 2YXQB 2XSHB 1NWWA 5TISE 8CHOA 1SQQG 3EBTA 2E5TA 1N7SB 1Q42A 4BL3A 1CYUA 1QVFO 5FW5A 1NTMJ 3CU3A 5KLVE 1R4CA 3TNUB 1NWQA 3ER7A 4WYKA 3L71E 1DEBA 1L0NG 1LT1A 1SQVG 1A02F 1NTKJ 2IZ0A 3I0YA 4JQ0D 3KSPA 4BXLA 3H1IE 1M57D 2E74B 2FXTA 1LTJA 2BASA 5M18A 1QLED 2XF3A 2GEXA 3KHUA 1VQQA 1FGQA 5KLVK 1RF1B 1BNSA 1OPYA 3LH4A 3TGUJ 1LNIA 1RE3C 2HFED 4HM1B 3HIGA 2E76D 2WPQA 1PZQA 3AGOA 2WT7A 3Q90A 2GU3A 1QGKB 3CCS3 3WUUA 1RSNA 1BGSA 4W7ZA 1OWAA 2K9JA 1CQSA 2BCCJ 1HF9A 5EQLA 2IYOA 1NTZD 4GOEA 1NOHA 1OFCX 3E7KA 1A02J 5CLKA 3SXXA 4H0LC 3AEDC 5KLVD 3TK1A 4FMDA 4AUWA 1G2CB 4O02B 1O7WB 1VQL3 4DKIA 1H88A 3V2QA 1FZGA 3VP9A 2ML6A 4RZMA 5B66E 3H1ID 1K9MQ 2CG1A 1J1DC 1BRNL 2QEXP 5E79H 1NTMG 3MGNA 1ZS7A 3RGRA 1FA3A 4ZNCA 3H1HE 3NUVA 4U3FE 3DY5A 1W5ZA 4GB5A 1FZFA 1T3JA 1BNGA 3CMA3 2KZJA 1JY3N 3W67A 1ZR4A 2FXOA 1UUWB 1SIIA 4LGQA 2CFGA 5APUA 1IQXA 1R4YA 3JUOA 3DGMA 1AVLA 1U8CB 1YJN3 1P84D 1X0TA 2HMOB 1BSBA 5AEUB 3HD7C 3CME3 3PHLA 1BGYD 4R9KA 1X1XA 3RK3E 2KI7B 3V92A 1D6ZA 2OTL3 1QX8A 3GW6A 5I97A 3T97B 3GHGC 1ZV8A 1I2EA 4I2LC 5AVXB 5APSA 1OUNA 3S28A 2BEQD 1IDPA 2BCCG 4PD4I 1I0XA 2ZT9B 4HM8B 4D6TJ 4BIRA 1PPJG 4IL6H 1GD4A 2KLUA 1ZMEC 3HIIA 2M3EA 4RKUJ 1KQLA 3CXHE 3EE1A 1B2UA 3H1HD 5AW9B 4U3FD 1N2DC 1YGWA 1N7SC 2Q3EA 5GSPA 1HVVA 3NFQA 3N9HA 2E42A 1K05A 1ZRTD 1AQ5A 3M9BA 1LOYA 1M7LA 5GTIH 1JV2B 1VQ4P 5CCGD 1LP1A 4WB4A 1FE6A 2E74C 3L37A 3RK3D 1DYUA 3A0BE 2KSEA 1LWUC 3DXOA 2QIYA 3H51A 3SYUA 4FMBA 3V2PA 5AIGA 1RF1C 1JJ22 4GSPA 1W2ZA 1PY3A 1FGRA 1MWRA 1BE3G 1OW7A 2JDIH 1W2B2 1NKZB 4DCKA 3WOFB 2BEZF 3CX5H 4I1LA 1JMBA 1VQ6P 4JYCA 1GD2E 4LMIA 4QMAA 3L73D 3SWKA 3P8MC 5BIRA 3CXHD 1HWTC 1PGQA 4A7PA 2W6AA 4OGQD 4JPZB 1JO5A 3TSIA 2N9BA 5IERA 3WDGB 3UL5A 1HH0A 1OHOA 1GK6A 3ZG0A 1YGEA 2Y9ZA 3NV0A 5APTA 2R41A 4AQRD 2I9WA 2WTYA 3NXJA 3EBYA 2KK7A 2C10A 2P10A 1R5SA 1QAKA 2IBZD 2CH9A 1J1EB 1USDA 2CC3A 1VF5D 1RGKA 3DMCA 4R9LA 1DX7A 1N8QA 3CC2P 5CK6A 5L8RJ 1KC8Q 3A3YB 1GL2A 2JWAA 3AE7C 1M904 1NNVA 3CWBD 1VQ7P 2O3JA 3CCMP 2KS1A 4AYCA 2QE7H 1ZN5A 4HB1A 1MGWA 1SQPJ 3IR9A 4W80A 3CCUP 1W7CA 3CCR3 3GZBA 1JTHA 3A7OA 3H1LE 3EJVA 3AE9C 3M06A 5D81A 2MF7A 3L70D 1BDCA 2ZT9C 2O1KA 4UB8H 4N6NB 3S9OA 1NTZG 1BCCJ 1KQSO 2XNXA 5TISH 1FZEA 2CIUA 5APQA 5AVZB 3L0RA 3IPTA 2D42A 2NRGA 1EQ7A 2XRXB 3L75E 3PTZA 1TJDA 3LOYA 1RF0C 2OYHA 4N78E 3Q5RA 1OW8A 3CD6P 3L72E 1NU3A 2AAEA 5IG4A 5M19A 2W56B 2CG0A 4UB6E 2B1XB 3LTCA 6RNTA 1G96A 3H1LD 2KB7P 2KCDA 2RCDA 2KIKA 1U7MA 1N5PA 1YI2P 1BANA 3C1LA 3RK2D 1ULJB 1I0VA 4PJ0H 4WP5A 3SFEC 1UIXA 1BNIA 1HKXA 1YJWP 1A2VA 2M7OA 1FZCB 1D6UA 1P84H 1KB9H 2HMLB 2WOFA 2BHMA 3G3ZA 4C46A 3DZLA 1OX3A 4O2HA 3L75D 2QJPB 1Q7YQ 1MGRA 5A0OB 1YVBI 4N78D 3P32A 5CHXA 1L0NE 4BRYB 4NHFA 2OQEC 4NREA 4RNTA 4GOFA 3PH0A 3S29A 3MTUE 1PGOA 2J58A 1FOSE 1OMIA 3G16A 3L72D 1BIRA 1OGXA 1SQQK 3D4AA 3KFQC 1FJPA 1OF5A 2DW3A 2Z7AA 1O7PB 2Z5HA 2FGTA 1VQ93 1MZ9A 3WMM0 2Q6QA 3X40A 1L0NK 3H1JJ 3PYJA 1SQVK 3L36A 3RDEA 1EXJA 3FLJA 3S4RA 4W7YA 4X2HA 1MWUA 3BIRA 3CCE3 1SQQD 1JN5A 1RDSA 2M5AA 2XR8B 5BU5A 1PU4A 2CW9A 2Q07A 1YHQ3 2WSCH 5CCHA 1JBRA 3KKGA 2P0XA 2QA4P 3HTKB 1H89A 1LP1B 1RN1A 1OCVA 1HYFA 1BRIA 5E79E 4J8TA 1L0ND 1SQVD 3L73G 3Q2PA 2YFJB 1EQKA 3D70A 2HR3A 2WSFJ 1SQBG 3BASA 1RJOA 1OVUA 3AEGC 1RGFA 1LNQA 2NPSD 2OOVC 2Y0CA 5DJUB 3BB9A 1GMJA 4BWNA 3CXHH 1BRHA 2SBLA 1LOVA 3V4WA 5KLIB 2F99A 1N7LA 3AECC 3C9IA 3VOPA 5KJ7A 1JNQA 1WMOA 1HJ0A 2IBZG 3D3LA 1NTMK 3NX0A 4PV1B 2K37A 1VQKP 2NPSA 2JP3A 1K734 3ALAA 2OYOA 2OCTA 5IG0A 5HGRA 1OZHA 2OWPA 3MPHA 3OXAA 5IG5A 4IL6E 2FYUJ 4IFMA 4U13A 3S67A 3MG2A 5IG3A 2HYNA 3ROBA 4XM4A 1VQNP 3KZIH 1B20A 2ZYGA 3GF3A 1PPJE 2OYIA 3G4SP 3Q5PA 1NTMD 2QM7A 1GL2B 1B3SA 3A5EA 3OA7A 5JPUA 1T5YA 1JZOA 2F4YA 3CCLP 7STDA 4H13B 4YPCA 5EVHA 5GTIE 1J2BA 3HZPA 1BUJA 1L0LJ 3PLNA 2Y0DA 1MKMA 2C11A 2QJPC 4DOJA 4OVMA 1B2XA 1RN7A 1JTHB 3A2AA 4IOIH 1FUTA 1W02A 2PAJA 1IFJA 2WSEJ 1NJI4 2JO1A 2Q7CA 5JPPA 1BSNA 3Q3DA 4WWIA 4HBRA 1WMNA 4BU4A 2XGLA 1OXZA 1DD4A 3CX5E 3RBXA 1AVKA 3I5CA 1GOVA 3LTDA 2E75D 2BCCD 1WMKA 1BE3E 2R3SA 1PL5A 3B5ND 3KCHA 2Z76A 1SQXJ 1N73A 1BOXA 2FYUG 2CPSA 1Q86Q 1D7MA 1W6GA 4MN4C 3H3HA 1B2MA 1VQPP 2N1TB 2K0MA 3JVCA 5IENA 3AEEC 1FZUA 1HGZA 4HAAA 1SPUA 2H0HA 3B5NA 3LW5H 3RL0g 1STFI 3F14A 1Q82Q 5RNTA 1OIPA 1HUCA 1JKGA 1JY2N 3U1AA 1X1UA 1VQ53 1UI7A 3Q3FA 3EF8A 3I55P 3RL0B 3UIAA 1IVWA 1TU5A 4QWTA 3GF7A 3RK3C 2E2VA 3M91A 5JBSA 1BE3D 5KLIC 2QJKB 3HUSA 2KF6A 3HD7B 1KQFB 1K8A4 5G1LA 3CCVP 2RFRA 1TUHA 1SFCA 4WY4D 2RGQA 3GHGB 1IT7A 4PV1C 3N7NA 3FWNA 1PP9G 4R4KA 4EXRA 2A45H 1JBSA 1VQOP 2P38A 4IPBA 4ZM8A 3KYQA 1URQB 4UB6H 1V74A 1VZZA 2FBWC 4UB8E 1WT6A 2ZVNB 3VMZA 3KE7A 3GWRA 5DREA 5AVRB 2WGQA 6GSPA 4WY4A 1KYOD 2AEJA 1OACA 1YJ9P 1AJYA 1NTZE 1LGHB 4YXWH 4JF7A 2HOHA 1GL2C 5CMZA 1JNMA 3SX1A 4AEQA 3L74J 4H13C 1YIJP 1EZVG 3BU4A 2M5AB 3EN8A 3SWYA 1KILB 5KP1A 2XNDH 1UGIA 7RNTA 2JR8A 4YXDC 2A15A 3JCUH 1MWSA 2LQVA 1NTZK 1LWUB 2WOHA 3KPEA 3T0UA 1DMMA 5AIIA 1YVSA 3NQYA 1EDJA 1EDIA 4PJ0E 4MEIA 2D2CD 5KP3A 3SVAA 2XFSA 3HRNA 2VRSA 4HYTB 3HE5A 1EUIC 2MKVA 3VMYA 2W8ZA 1P84E 1KB9E 2E43A 3KZTA 4H44D 2ZXXA 1NU1G 1BGYE 1FGTA 3HE4A 5ELJA 3MHEA 2L5GB 4EYCA 2FFDB 1BRGA 2W04A 2B89A 3BCCJ 2XV5A 3KDPB 5APYA 3WMDA 1JY3P 2Z5IA 3KXDA 4Z1MH 2N1TC 4HYZA 2W2CA 1PV3A 1U5OA 1JM0A 1NYHA 3A5TA 1V57A 4NPFX 1E5WA 3MD0A 3X3ZA 1HU9A 3FG4A 1DH3A 1AA0A 1BVIA 4X2OA 3S27A 5GTHH 1E79H 1RQVA 1DMNA 5AW6B 3LT8A 2A06G 3L74G 1JUNA 1W6YA 1L4AB 3KIIA 1NTKG 3TDGA 3Q1MA 3CX5I 3MWZA 4R4MA 3M0DC 3RL0C 1RTUA 1KN7A 4XB5A 3O6QA 1ZRTE 3P8CE 4K1VA 2IFNA 2QJKC 1KB9D 3V2NA 3CNXA 5AYSC 2F56A 4R80A 1NKNA 1EKMA 3TGUG 3G8ZA 3K63A 5BU8B 5AVQB 4KFFA 3FWLA 3ECFA 4H3UA 1K9M4 3VF1A 4O3VA 3OWUA 3H1KJ 1NDOB 1IO4A 5BU4A 3E1IA 1URQC 2RN0A 3OWSA 1Q81Q 4J5KA 3EWKA 1EG9B 1G02A 4K90B 4G1MB 3H25A 2E2UA 3L73E 2RSXA 1K41A 3BCCG 2WITA 3EHCA 4XE5B 1SQBE 3A0HH 3U1CA 3FG1A 3OWYA 1U7JA 2KNCA 2HPCA 3CC7P 2KXGA 3QK9A 1BSDA 4M3LA 4HVNA 4IIAA 2KOGA 3FF2A 3OV4A 3P8CD 1M1KQ 2CFKA 5DRVA 1TRPA 4EV5A 4XBXA 1KILC 2O01J 3D6ZA 4EW5A 4WWUC 2IBZE 3R4YA 5CCHC 1SQBK 1GTWA 1T6AA 5AVUB 1S72P 3LXUX 2WPSA 1PIXA 1LTBC 2XFTA 1NO3A 3DGLA 4GODA 4JRFA 1LTIC 3KZIE 1RGCA 2YMKA 3MUDA 5CCGA 1FBMA 2M3BA 5BVBA 1UW1A 1GK4A 1K04A 3CWBE 4WVZA 5AI1A 2OTJP 1VQ83 3Q1CA 5KAFH 4XDWA 4WBAA 1YQ3C 1GMRA 4O8SA 4HM5B 3GMAA 1OHPA 1DVDA 2I1KA 1SQBD 2JWDA 1VL2A 4XFJA 2BT3A 2CWUA 5KKZC 1GS3A 2ZHXB 4D6TG 1L2PA 2FNQA 3WHOA 2WO0A 2Z4EA 5KJ7C 1UDII 2OTKE 1JB5A 3FSDA 1LQMB 2C9LY 1CI6B 2FFDC 1SFCB 2MJZA 4I7ZB 2C4BA 1FGMA 3L70E 1AY7A 1MUUA 1S3JA 2NPSC 1W6CA 1FYSA 4N6JA 5AW3B 3WU2H 3NM2A 4K61A 1GW4A 3O8ZA 1AVOA 1KYOH 5AYRB 2ZJSE 3RBZA 2F5MA 4HM7B 4ASWA 1L4AC 5KAIE 1BNFA 5KLVJ 1QJGA 3FXDA 2IYPA 1KFMA 6STDA 1E3RA 2B9BA 1T2KC 3DUKA 3L71J 4C7RA 5D82A 4JF8A 1N9JA 2B88A 4MMXB 1P84I 3X42A 3H1IJ 1N8RQ 1AV4A 4WYKB 1T2IA 2STDA 1NB3I 1W2BO 4L74A 1ULIB 1NAYA 1H0TA 1H8AA 2HMKB 1LTJB 1Q7HA 3JUQA 1IK7A 3A76A 1IU7A 1QL2A 3OW22 3AE5C 1XTCC 3H32A 2P05A 1KC84 1S9KE 2WMMA 1JZDA 3UNLA 4L7KA 3BNBA 2IUJA 1LTAC 1WRGA 1FGOA 4N6LA 1WNHA 2CFDA 2WT7B 3O8YA 2FYUK 1KD1Q 3PXMA 3UJMA 3I56P 3G6EP 2CK3H 3EFFK 2YO2A 5CXOA 2K9JB 4K35A 1AQZA 1VQ43 1A2KA 4H0LD 1RE3A 3HE4B 4OWFA 2SARA 1A67A 1YBKA 2E76B 4RNYA 4GKGA 1GY6A 5AIHA 2IY2A 1BAOA 2E75C 2PGDA 5CF2A 5STDA 3F8XA 3H1HJ 4U3FJ 2K3RA 3L71G 2FYUD 3B5NC 3G0KA 3RGUA 1VQ63 1PP9E 3B4SA 3QRDA 1DE3A 2C0WA 2INXA 3PZWA 4HM4B 3OJAB 1IK9A 3K5TA 3G71P 3M8CA 2K3DA 1SQPG 2HODA 1S9KD 1JOCA 4EYYQ 3CXHI 3TDKA 3II6A 3FH1A 1SQQE 2Y0EA 3FZWA 1OHSA 2IPPA 3O6QB 3D6YA 4LSOA 5KP4A 2GU1A 1CW5A 1PYLA 2IX7C 1O7GB 3USSA 1GW3A 5CJ4A 1YITP 1X79B 3HUSC 2ML5A 1I2FA 1US1A 1BCCG 1SQXK 2FXMA 1GSPA 3G9RA 2L4VA 3JCUE 3Q2YA 1EZVE 1SFCC 4I7ZC 2H0GA 3U1WA 1SQVE 1U57A 2JQ5A 2IYJA 2XU6A 2WSSH 3CC23 1FUWA 3CLQA 3F40A 2M8RA 1ROVA 1ASKA 1IFMA 1PP9D 3CL3D 3N54B 1VQ73 1R8EA 3CCM3 1GOYA 1GOUA 4OH8B 3K5BA 1N7SD 3L4FA 5APWA 1UCLA 1SQXD 1IQYA 3CCU3 1UIIA 4MJDA 1Q7Y4 4N6UA
chains in the Genus database with same CATH topology
3MYTA 4KVHA 4WFOA 2ML6A 4RZMA 2XH9A 2K0MA 1Y4KA 3JVCA 5IENA 2CG1A 1SPUA 4L8PA 2CHCA 4XDVA 3MG3A 3BLZA 4HJLB 1STFI 3F14A 3RGRA 1FA3A 3GZXB 1SIHA 3NUVA 3DY5A 3V98A 1W5ZA 4GB5A 1S5AA 4KFEA 3WOEB 3CMA3 2ZL8A 1JKGA 1VQ53 2W0QA 3PJSK 1UI7A 1UUWB 2BMOB 1SIIA 3EF8A 1IVWA 4LGQA 3E99A 2CFGA 3JUOA 1IQXA 3DGMA 1AVLA 1TU5A 1U8CB 4QWTA 4TX4A 2K54A 2E2VA 1YJN3 3CC73 2HMOB 2XGNA 3B4PA 5AEUB 3J7Yd 5JBSA 3CME3 4R9KA 4KZ1A 2HMJB 4TLFA 2CWVA 1K8A4 3V92A 1D6ZA 3CD63 2RFRA 2OTL3 3DGOA 5I97A 1TUHA 1N8R4 3PCSA 5ELUA 3BNCA 1OUNA 2RGQA 3S28A 3D9RA 5D83A 4AKYA 1IDPA 1IT7A 3DGNA 4XBYA 4GL6A 1UI8A 3RGAA 1TFKA 4R4KA 4EXRA 1IQ8A 4HM8B 2P38A 4IPBA 3MG1A 4ZM8A 1YI23 1S723 2BO9B 3NV0B 1TIJA 1IVXA 1SJWA 1V74A 1VZZA 1GD4A 1AQTA 4STDA 2Z77A 3B7CA 3HIIA 3KE7A 3GWRA 5DREA 2WGQA 3JUPA 1YJW3 3EE1A 4HM0B 1IV9A 1KWIA 1E97A 1OACA 3FGYA 2OTJ3 3N9HA 4YXWH 1KD14 1MOLA 4XBTA 1BUQA 1IT8A 2YFLB 3SX1A 3WA3A 4AEQA 1JV2B 1DVCA 2LYXA 4FR9A 3NM7A 3EN8A 5KP1A 1OH0A 2XNDH 1DYUA 3AMOA 3BNDA 1FS0E 1O7MB 5IEOA 2A15A 4N3VA 2LQVA 3DXOA 3LTBA 2O9UX 2QIYA 3CCJ3 2YFIB 2W6JH 2WOHA 1F8NA 3H51A 4FMBA 3T0UA 2YX9A 2XSOB 3GZRA 1DMMA 5AIGA 3SOAA 5AIIA 1L5GB 1JJ22 3HX8A 1W2ZA 3NQYA 1FGRA 2JDIH 1W2B2 3WOFB 3EN1B 4MEIA 5IW9A 1WTHA 5KP3A 3SVAA 4RNZA 1TP6A 2XFSA 4LMIA 1Z1SA 4QMAA 3F7SA 4L8OA 4DJGA 4RBNA 2GEYA 3DM8A 1QVG2 2MC8A 1ROAA 3KZTA 3LTAA 3JUMA 1FGTA 4HZBB 5ELJA 5IERA 3MHEA 4OUQA 3WDGB 5FGOA 4EYCA 4N6TA 3UL5A 1OHOA 1YGEA 3NV0A 3PGBA 2QA43 3GZYB 1LVNA 2W04A 4HZ9B 2WGOA 4MMZB 2I9WA 3NXJA 3WMDA 3EBYA 2C10A 4FMAA 4HYZA 1NB5I 1WMPA 2W2CA 1QAKA 1U5OA 2CH9A 2CC3A 3X3ZA 1HU9A 3FG4A 4X2OA 3S27A 1E79H 3DMCA 1DMNA 4R9LA 3LT8A 1N8QA 3NHXA 5CK6A 2GXFA 1Q40B 1W6YA 3CC43 3CNMA 3KIIA 1M904 1GY5A 5LC6A 3TDGA 5BXQA 1JB4A 1W00A 3MWZA 3CXC2 3I563 3G6E3 4XB5A 3UB1A 1QALA 2QE7H 4K1VA 1LNHA 2ZDJA 1QMAA 4IT7A 1QVF2 3IJEB 1WQLB 1W7CA 3CPW2 3CCR3 3CNXA 2UX0A 3GZBA 1VQK3 5AYSC 5CF1A 4R80A 1Q864 2W03A 1EKMA 4N6V0 3G8ZA 3K63A 4KFFA 3EJVA 3ECFA 1CEWI 4H3UA 1K9M4 4J9AA 3PCRA 5D81A 2MF7A 3VF1A 4O3VA 3MKIA 3OWUA 4WHAA 1NDOB 4MMYB 3F8HA 3OX9A 4EC6A 1Q824 2P09A 4N6NB 4FMCA 1O7NB 2R4IA 3OWSA 1VQN3 3PS8A 3LMLA 1EG9B 1OGZA 4K90B 3G713 4G1MB 3G4S3 2CFWA 2E2UA 1OF5B 2BMQB 2RSXA 3B4OA 1K41A 3NBJA 3NBBA 1EA2A 2BNGA 2CIUA 3EHCA 3L0RA 2D1WA 3IPTA 2D42A 3FG1A 2XRXB 3OWYA 1RRLA 3CCL3 2GBWB 3T8NA 3LOYA 2KXGA 2V1LA 5LC7A 3QK9A 5AEWB 4CCVA 1K28A 1RRHA 4HVNA 3B8LA 2Y74A 4IIAA 1YIT3 3FF2A 3FKAA 3OV4A 5TGNA 1NU3A 2CFKA 5DRVA 4CDLA 4EV5A 5IG4A 2W56B 4XBXA 2CG0A 1ZO2A 1JN5B 1RKYA 2B1XB 1GD3A 4WWUC 3LTCA 5AIFA 1G96A 1IVVA 2IMJA 4LZIA 2KCDA 2RCDA 4KFDA 1N5PA 1UUVB 1PFPA 3LXUX 1ULJB 2E2TA 4BTXA 2XFTA 1NO3A 3DGLA 1QAFA 4WP5A 4JRFA 4EBGA 1HKXA 5G2GA 1A2VA 2M7OA 3VSYA 5BVBA 1UW1A 3VGNA 4WVZA 5AI1A 1IVUA 1D6UA 1VQ83 3Q1CA 1ZX2A 4XDWA 2HMLB 3IMAB 2WOFA 2Y73A 3X3XA 4O8SA 4HM5B 1OHPA 1DVDA 2BHMA 2BT3A 4O2HA 3DZLA 3HI7A 2CWUA 3WODG 1GS3A 3FCSB 1BSHA 1JB2A 2FNQA 1VQP3 2WO0A 1YVBI 4FCMA 5A0OB 1C7HA 4NHFA 1JB5A 3FSDA 3K7CA 2OQEC 4NREA 3S29A 1FGMA 3G16A 4PEJA 2OOVA 2CFLA 1OGXA 3MSOA 3KN4A 4Q53A 3T8UA 1TFOA 1W6CA 3KFQC 1OF5A 2O3OA 2HMMB 2Z7AA 3NM2A 1O7PB 4K61A 2FGTA 1KSIA 1VQ93 5IF6A 5AYRB 3X40A 4EV2A 3I553 4HM7B 1JRQA 3X41A 3PYJA 2W9QA 1SQWA 4HM3B 3RDEA 1QJGA 3LZAA 3FLJA 6STDA 2GBXB 1E3RA 4R1KA 3DUKA 4N6OB 4X2HA 5EEOA 2W56A 5D82A 3CCE3 1JN5A 4JF8A 3CCV3 1N9JA 3EC9A 1E3VA 2XR8B 4MMXB 1PU4A 2CW9A 3X42A 3S5CA 2Q07A 1YHQ3 2CWTA 1AV4A 4HM6B 3SLUA 2IA7A 4WYKB 3KKGA 2P0XA 2STDA 1NB3I 2W9PA 1OCVA 1IFPA 1ULIB 1VQO3 4I4KA 4H61A 4J8TA 2F98A 3AMOB 4HM2B 4BTYA 2HMKB 3LYGA 1STDA 2BMRB 2XEPA 1VQM3 3JUQA 3Q2PA 3LT9A 2YFJB 3A76A 1EQKA 1IU7A 3SOYA 3GRDA 3WA2X 3OW22 2Z6BA 2V7QH 3EX9A 1W01A 2P05A 1KC84 1RJOA 1DMQA 3FG3A 3CCQ3 3BB9A 2OOVC 2CKFB 3UNLA 1IK3A 1YJ93 4L7KA 3BNBA 2IUJA 4N6LA 1FGOA 1WNHA 2KRTA 2SBLA 2CFDA 3NBRA 2B24B 3O8YA 1IV7A 3X3YA 1MNLA 2F99A 3PXMA 3UJMA 1JEKA 4AKZA 2CK3H 1GY7A 1GYBA 1W4NA 4FCJA 3EFFK 3F7XA 4ORLA 1M9GA 5CXOA 2OQEA 1JNQA 4FCZA 1YIJ3 1WMOA 1VQ43 3HK4A 3NQZA 1A2KA 3D3LA 3FF0A 4BTWA 3NX0A 2PNCA 1K734 3ALAA 1CYVA 1A67A 2OCTA 5IG0A 1N5HA 4RNYA 2IUKA 3F9SA 1GY6A 5AIHA 5HGRA 1ISKA 3STDA 1N9EA 2OWPA 3MPHA 5CF2A 3OXAA 5STDA 3F8XA 4K1UA 5IG5A 2XSHB 1NWWA 1Q40A 4U13A 3S67A 3MG2A 3G0KA 8CHOA 1VQ63 3EBTA 5IG3A 3ROBA 1Q814 1A90A 4XM4A 2E5TA 3QRDA 1Q42A 2INXA 3K9MC 3PZWA 4HM4B 4OK0A 3K5TA 5IEPA 1CYUA 3CPOA 3M8CA 5FW5A 3UL6A 3CU3A 3V99A 3K0ZA 1R4CA 5JPUA 3ER7A 4WYKA 2QGUA 1T5YA 1M1XB 1O7HB 1JKGB 3FH1A 7STDA 3FZWA 1OHSA 3BNEA 5EVHA 3I0YA 3KSPA 1J2BA 3HZPA 4LSOA 5KP4A 2FXTA 2GU1A 1O7GB 2C11A 3USSA 2XF3A 2PZVA 3EB8A 3JUNA 4OVMA 1M1K4 3GAXA 2GEXA 1RN7A 1D6YA 2ML5A 1US1A 1LXEA 2L4VA 3U97A 1FGQA 1W02A 3U1WA 1NJI4 2P0MA 2F86B 3N8BA 1OPYA 2QEX3 4N6MA 5JPPA 3LH4A 2JQ5A 1BSNA 1LOXA 4HBRA 2E5YA 2WSSH 1WMNA 3HIGA 4HM1B 3CC23 1FUWA 2XGLA 3Q90A 3F40A 3SEDA 2GU3A 3CCS3 1AVKA 1ROVA 3LTDA 1ASKA 3EQQB 1CQSA 3N54B 1VQ73 3CCM3 5EQLA 3KSED 1AR0A 1KQS2 4LEHA 2Z76A 5CLKA 4HKVB 3SXXA 1IQYA 4FMDA 3CCU3 4O02B 1O7WB 1W6GA 1VQL3 3H3HA 4MJDA 1Q7Y4 4N6UA 2HMNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QE7 H;  1AQT A;  4QMA A;  4DJG A;  2XND H;  1IFP A;  1FS0 E;  1E79 H;  1JEK A;  4TLF A;  3USS A;  2CK3 H;  3EFF K;  1BSH A;  2W6J H;  2E5T A;  4YXW H;  2JDI H;  3PJS K;  2V7Q H;  1BSN A;  2E5Y A;  2WSS H;  4WVZ A; 
#chains in the Genus database with same CATH topology
 3MYT A;  4WFO A;  3RNT A;  1NU1 E;  2E74 D;  4XDV A;  2CHC A;  2QVA A;  1N7S A;  3MG3 A;  3BLZ A;  4HJL B;  1RNB A;  3LIE A;  1DEE G;  3V98 A;  1LTJ C;  5GTH E;  1EZV D;  1S5A A;  3BRV B;  2GUV A;  3WOE B;  1AFO A;  2UUG C;  1SP4 A;  4HOH A;  2W83 C;  2ZL8 A;  2W0Q A;  3PJS K;  2BMO B;  1AVY A;  1NTM E;  1NU1 K;  1LQG C;  5TJH A;  2A06 E;  5CJ0 A;  2NZ2 A;  4TX4 A;  2P2U A;  2K54 A;  2XGN A;  3B4P A;  2XKM A;  3RK3 B;  1NTK E;  2W6B A;  1FJK A;  1EDK A;  2HMJ B;  4TLF A;  3CD6 3;  3DGO A;  3WR2 A;  1RF1 A;  2KZI A;  3PCS A;  3BNC A;  4AKY A;  2V4H A;  2P58 A;  4XBY A;  4R4L A;  4GL6 A;  1RE4 A;  3RGA A;  1TFK A;  2C0X A;  2RMZ A;  1IQ8 A;  1X8Y A;  1YI2 3;  2E76 C;  1NU1 D;  2R44 A;  4LLH A;  2WVR A;  4NPD A;  1TIJ A;  1IVX A;  2KAA A;  3NV0 B;  1SJW A;  3TGU E;  3H1J G;  1VQM P;  1NTK K;  3R2P A;  4XA4 A;  1JY2 O;  1YJW 3;  4OGQ B;  4HM0 B;  1IV9 A;  1KWI A;  3CCQ P;  2BCC E;  2BU4 A;  2FYN B;  1G2C A;  5DJT B;  1RNT A;  3ITK A;  1M1J A;  3A0H E;  4XBT A;  1BUQ A;  2IZ1 A;  2UWJ E;  1IT8 A;  2A06 D;  1RGA A;  4HJG H;  1FC2 C;  3L74 D;  1DVC A;  3Q5S A;  3NM7 A;  3VN0 A;  1NTK D;  4B86 A;  1JB0 J;  2G8Y A;  2KS1 B;  3LID A;  3H1L J;  1EEJ A;  5EFW B;  3AMO A;  3BND A;  4GIF A;  3BVH A;  1O7M B;  5IEO A;  1W2E A;  3P7K A;  4N3V A;  2RNT A;  3LTB A;  3CCJ 3;  4BL2 A;  2Y9Y A;  2YX9 A;  2XSO B;  3GZR A;  5AVT B;  1RQU A;  1L5G B;  3HX8 A;  2A45 I;  2AXC A;  1GZL A;  5M1B A;  2ZT9 D;  3AE6 C;  1FW7 A;  2V7Q J;  5IW9 A;  3TGU D;  1IFI A;  4N3Y B;  1TP6 A;  1Z1S A;  1BNR A;  3H32 B;  3D79 A;  3T97 A;  3AHS A;  3L35 A;  3DM8 A;  1QVG 2;  2MC8 A;  3L75 J;  5KAF E;  5KAI H;  2J59 M;  3LTA A;  1G1I A;  4HZB B;  3WUT A;  4L75 A;  1KZU B;  1X1Y A;  3V2R A;  4ILF A;  2QA4 3;  4ZMD A;  3GZY B;  1Q90 D;  3L72 J;  3BCC D;  1NVO A;  4MMZ B;  2ZA4 A;  2OYH B;  1JY2 P;  1NB5 I;  1SVF A;  3NMD A;  1FOS F;  3JC2 2;  4KJM A;  1RGE A;  3URP A;  3WU2 E;  4RJT A;  3AHW A;  3NHX A;  5AVW B;  1Q9E A;  1RF0 A;  1KYO E;  3CCS P;  3CC4 3;  3CNM A;  3C8V A;  1GY5 A;  5LC6 A;  4I5Q A;  3MIW A;  1L0L G;  1JB4 A;  1W00 A;  1SQQ J;  1NAF A;  2JEE A;  3MUD C;  5CCG C;  3UB1 A;  1LNH A;  4ZKU A;  3MZW B;  1QMA A;  1IZN B;  4U7J A;  1RCL A;  1YNV X;  4IFF A;  3IJE B;  4IT7 A;  1QVF 2;  2YKQ A;  1WQL B;  3VP8 A;  2UX0 A;  1VQK 3;  1Q86 4;  5CF1 A;  3IF4 A;  1I70 A;  1VQL P;  3M0A A;  4N6V 0;  1L0N J;  3RK2 B;  1CEW I;  2PRR A;  5HOH A;  4K3A A;  1M8O B;  1BDD A;  1S5L X;  2GUS A;  2YKP A;  3WUV A;  3PCR A;  4J9A A;  2FKW B;  2WSE H;  3MKI A;  1BU4 A;  5C39 A;  2O01 N;  3F8H A;  4GDO A;  4EC6 A;  1Q82 4;  2P09 A;  3DH2 A;  1JCD A;  1KFN A;  3GLM A;  4D6T D;  4DZO A;  1VQN 3;  3PS8 A;  1LTT C;  3LML A;  2H8P D;  3CMA P;  1OGZ A;  1JBT A;  1SQX G;  2AEF A;  2H89 C;  1BSC A;  1S1C X;  3G4S 3;  4OGQ C;  1OF5 B;  2BMQ B;  1UGH I;  3B4O A;  2R32 A;  3NBJ A;  5G1K A;  1UUG B;  2FYN C;  3AE1 C;  1PGP A;  5AW7 B;  3CCL 3;  1I3I A;  2GBW B;  1YJN P;  1UCK A;  1RHL A;  5LC7 A;  5AEW B;  3CME P;  3H6P A;  1B2Z A;  1FU1 A;  1K28 A;  1RRH A;  1FDO A;  3FKA A;  2OTL P;  4PD4 D;  1JN5 B;  1RKY A;  1VF5 C;  2HLO A;  5AIF A;  4LZI A;  1JMM A;  1LOW A;  2AXT E;  1G1J A;  1PFP A;  3VTP C;  2E2T A;  4EBG A;  2C9N Y;  5G2G A;  1W5C E;  4C7N A;  2Q3I A;  2P67 A;  3EFG A;  1NGM B;  4RES B;  1UCI A;  5BVZ A;  3IMA B;  2Y73 A;  4HKZ H;  2YKO A;  1SQP E;  3VYI A;  3WOD G;  1BSH A;  1JB2 A;  1VQP 3;  5KKZ B;  1TRQ A;  4FCM A;  1C7H A;  2IFM A;  3BAT A;  1RLS A;  1R5L A;  4HH2 A;  2CFL A;  2OOV A;  2OYH C;  2JJL A;  4Q53 A;  1IYY A;  5H2F H;  2NPS B;  2O3O A;  1OW6 A;  3OAK A;  2OAR A;  1BCC E;  1KSI A;  1NH4 A;  3V4Q A;  1SQP K;  5APX A;  3I55 3;  1LT9 A;  2K9Y A;  1VQ8 P;  3AE8 C;  2L1S A;  2W9Q A;  1SQW A;  2AEM A;  2QM8 A;  1BRJ A;  1S4X A;  2XDJ A;  3M9Q A;  1EC5 A;  2GBX B;  2YMY A;  3L71 D;  2W56 A;  1M1J B;  2YIU B;  3CCV 3;  1BSA A;  3EC9 A;  2OYI B;  1S5L E;  1S2E A;  1MV8 A;  3B8E B;  3S5C A;  2CWT A;  2W90 A;  3SLU A;  2IA7 A;  1VPC A;  1SQP D;  1IFP A;  3MHV A;  1VQO 3;  3RK2 C;  4H61 A;  3AMO B;  4BTY A;  3LYG A;  1STD A;  2BMR B;  4CJN A;  2XEP A;  1HZ1 A;  1FZC A;  3LT9 A;  2UGI A;  3WA2 X;  3GRD A;  1ZLL A;  2PFX A;  3AEB C;  2ZYD A;  2KP8 A;  3FG3 A;  1MFZ A;  2Q9I A;  1YJ9 3;  1BCC D;  2K88 A;  2ZFC A;  1BE3 J;  2KRT A;  1KYO I;  1FDM A;  2B24 B;  1Y47 A;  4AKZ A;  4BRY A;  2YNY A;  3EQ2 A;  1DET A;  1GY7 A;  4FCJ A;  4ORL A;  1M9G A;  3M9H A;  3V6I A;  4FCZ A;  1YIJ 3;  1SAR A;  3QH9 A;  4NPE A;  3FF0 A;  4JBZ A;  3CCR P;  2PNC A;  1YQ4 C;  3AGN A;  1N73 B;  1KQG B;  2QG4 A;  2IUK A;  3F9S A;  2N9Y B;  2KF3 A;  1TTO A;  1N9E A;  4K1U A;  2E75 B;  3VMA A;  1Q40 A;  4EI2 A;  1BSE A;  1Q81 4;  1A90 A;  3B5N B;  3SFD C;  2W27 A;  3K9M C;  4OK0 A;  5B5E H;  5IEP A;  3CPO A;  3H1J E;  1HBW A;  3UL6 A;  1T3U A;  8RNT A;  3IN6 A;  3V99 A;  3K0Z A;  1KTM A;  2QGU A;  1C54 A;  1HGV A;  1M1X B;  4DT0 A;  3HTK A;  2BIR A;  1O7H B;  1JKG B;  4LGD E;  3BNE A;  1NO4 A;  3H1K G;  2PZV A;  3EB8 A;  3JUN A;  2SPZ A;  1M1K 4;  3V5B A;  3GAX A;  1D6Y A;  1GMP A;  1Y9B A;  2QJY B;  2R5D A;  3HUS B;  1LXE A;  3U97 A;  2P0M A;  4PV1 D;  2F86 B;  3N8B A;  2QEX 3;  4N6M A;  1XTG B;  1RE4 C;  1GMQ A;  2ZXE B;  1LOX A;  2E5Y A;  1RGH A;  3SED A;  1G0T A;  1RMS A;  1RHZ B;  2LXC B;  1M90 Q;  3EQQ B;  1B21 A;  1J2J B;  1B27 A;  3KSE D;  1NTZ J;  1AR0 A;  1ZGX A;  1KQS 2;  4LEH A;  3H1J D;  1X9V A;  4WY4 B;  5AW4 B;  4HKV B;  3MP7 B;  2GSP A;  1GL2 D;  1JCC A;  1M1J C;  2YIU C;  2ITA A;  2OYI C;  4PD4 H;  2HMN B;  3F7X A;  4KVH A;  4H13 D;  2XH9 A;  1Y4K A;  1KB9 I;  2O01 H;  2WQY C;  2KSJ A;  1V58 A;  3F89 A;  4L8P A;  3HOH A;  5AW1 B;  3GZX B;  1SIH A;  2FYU E;  4KFE A;  1QL1 A;  1GU5 A;  1VQ9 P;  4NPB A;  2I1J A;  1LRA A;  3W68 A;  3E99 A;  1BRS A;  5AW8 B;  4C7N B;  2QRX A;  1RCK A;  3CC7 3;  1RY3 A;  2G3A A;  3J7Y d;  2ZVO B;  1BGY J;  4KZ1 A;  3D5I A;  3CCE P;  2CWV A;  3HE5 B;  1L0L E;  1N8R 4;  2FY8 A;  1YHQ P;  5ELU A;  1OVV A;  3D9R A;  5D83 A;  3DGN A;  1OVR A;  1UI8 A;  1N73 C;  5CBN A;  2KUB A;  3MG1 A;  2D2C B;  1S72 3;  1MFT A;  2BO9 B;  2AAD A;  2N1T D;  1AQT A;  4STD A;  4Y99 B;  2Z77 A;  3B7C A;  5KLV G;  3JUP A;  2AXT H;  1L0L K;  3JSV C;  2B87 A;  1BNJ A;  4KT0 J;  1E97 A;  4H44 B;  3FGY A;  2OTJ 3;  3TF5 A;  2P1J A;  3H1I G;  5M1A A;  1LT9 B;  2R3C A;  3IAO A;  1KD1 4;  3N4X A;  1MOL A;  1SQX E;  2N1T A;  2YFL B;  2PP6 A;  3WA3 A;  3RL0 D;  3SSU A;  4J5G A;  4CPK A;  4CPG A;  1USE A;  2LYX A;  4FR9 A;  2WSC J;  1PGJ A;  1ZOY C;  3D71 A;  1OH0 A;  2KXP B;  1KIL E;  1L0L D;  1FS0 E;  3HD7 D;  3OW2 O;  2O9U X;  1FDI A;  2QJY C;  2W6J H;  2GM4 A;  1F8N A;  2YFI B;  5AVY B;  3AEA C;  3SOA A;  1Z56 A;  3M0D A;  1BGY G;  4IL6 X;  1IJD B;  3EN1 B;  1N86 A;  2FYZ A;  2F5W A;  2KF5 A;  2WPV B;  1WTH A;  1URQ D;  2ZAE B;  4RNZ A;  2IBZ I;  3FX0 A;  3PRJ A;  2CX0 A;  3L73 J;  3HD7 A;  3F7S A;  4L8O A;  4DJG A;  1A2P A;  4RBN A;  2GEY A;  1SQB J;  1DIP A;  1RN4 A;  3GHG A;  1ROA A;  9RNT A;  3JUM A;  3TYY A;  4KT3 B;  4WY4 C;  4O9B A;  4OUQ A;  5FGO A;  4N6T A;  1BRK A;  2QIW A;  3AE2 C;  1URQ A;  3PGB A;  1LVN A;  1S5L H;  3H1H G;  2WGO A;  2KNC B;  4U3F G;  2HPC B;  4HZ9 B;  5B66 H;  3CCJ P;  4FMA A;  1IC2 A;  1WMP A;  1J1E C;  2QSI A;  2K1A A;  1FZA A;  1IFD A;  1KIL D;  5H2F E;  2H7H A;  5CCH D;  3NXS A;  2GXF A;  1Q40 B;  2WPR A;  3VMX A;  3TNU A;  1SS1 A;  3CWB J;  5BXQ A;  1HTL C;  1GU4 A;  3CXC 2;  3I56 3;  3G6E 3;  1KIL A;  2WWW A;  2XZR A;  5AVV B;  1QAL A;  1RGL A;  3CI9 A;  2ZDJ A;  3L74 E;  5APV A;  1LWU A;  3CPW 2;  1CSB A;  2J5U A;  2W03 A;  1K73 Q;  2LR2 A;  3B71 A;  3QWO C;  4JYB A;  3DGY A;  1ZW0 A;  3L70 J;  5KJ7 D;  4WHA A;  4MMY B;  4L76 A;  5AW2 B;  3OX9 A;  2D2C C;  2HG5 D;  3F5H A;  4FMC A;  1O7N B;  3NTN A;  3CC4 P;  2R4I A;  1X22 A;  4Y99 C;  2J8X B;  3G71 3;  1RH5 B;  1CH0 A;  2CFW A;  1VQ5 P;  1TU3 F;  3NBB A;  1EA2 A;  3GSP A;  2BNG A;  2KF4 A;  4H44 C;  4ASV A;  2D1W A;  2YXR B;  4LC1 A;  2FFD A;  1RRL A;  4OVN F;  1LT9 C;  3T8N A;  1L4A D;  3KQG A;  2V1L A;  4CCV A;  3E1R A;  1LTS C;  2Q1K A;  1YTZ I;  1T2K D;  3B8L A;  2Y74 A;  1KOR A;  2I8D A;  1YIT 3;  5TGN A;  1PFI A;  3BCC E;  4CDL A;  3A0B H;  2OGU A;  1ZO2 A;  1GD3 A;  1LTG C;  1NJI Q;  3CWB G;  3LW5 J;  3SWF A;  1VF5 B;  1IVV A;  1I8V A;  2H88 C;  2IMJ A;  1L4A A;  4KFD A;  3IFM A;  1UUV B;  1HJB A;  4BTX A;  2R5B A;  2IDB A;  1MWT A;  1QAF A;  2H0I A;  1H0T B;  5AVS B;  4GHO A;  2JKV A;  2O1J A;  2WZ7 A;  3CPW O;  4EIJ A;  1FZC C;  2RH0 A;  5B5E E;  2WSF H;  3VSY A;  2RBI A;  3ZDM A;  3AE3 C;  3VGN A;  2L91 A;  1IVU A;  1YYC A;  3BRT B;  1X1W A;  2CPB A;  3L70 G;  1ZX2 A;  1QEX A;  1ZP0 C;  1ZR2 A;  3X3X A;  1EXI A;  4EDF A;  2P7J A;  3S1K A;  1Y8A A;  3HI7 A;  3FCS B;  3FXE A;  1T3B A;  1T2H A;  1SLQ A;  2GA1 A;  1RGG A;  2LKM A;  3FGA D;  3K7C A;  1AV1 A;  4PEJ A;  3PP5 A;  3MSO A;  2OQQ A;  3KN4 A;  3H1K E;  4EOT A;  3T8U A;  2Q5U A;  1TFO A;  3D5G A;  4YTP C;  3ZG5 A;  1IFN A;  2HMM B;  1NHL A;  4D6T E;  1ZXG A;  1PP9 J;  1KV4 A;  5IF6 A;  1VDF A;  2ZYA A;  4EV2 A;  1EZV I;  2CX1 A;  7GSP A;  1PPJ D;  1JRQ A;  3X41 A;  4IFD K;  2B87 B;  2POH A;  4HM3 B;  3ZFZ A;  3LZA A;  1B2S A;  4H0L B;  2RKL A;  5CBO A;  1EDL A;  4R1K A;  4KHX A;  2KYV A;  4N6O B;  1BNE A;  3H1L G;  5EEO A;  1KMI Z;  1K8A Q;  1E3V A;  2HOD B;  4HM6 B;  4PD4 E;  1CZQ A;  2KLV A;  2LXB A;  1J1D B;  4Y28 J;  2W9P A;  1I3F A;  1T8Z A;  4RO0 A;  1DD3 A;  1FZB A;  4I4K A;  3U59 A;  2F98 A;  5AW0 B;  4HM2 B;  5K5G B;  1SQV J;  2H43 A;  1VQM 3;  1FUS A;  1SFC D;  1FAV A;  1LJ2 A;  3SOY A;  3H1K D;  2Z6B A;  2V7Q H;  3EX9 A;  1W01 A;  1QVG O;  4GT1 A;  5KTB A;  3L75 G;  3CX5 D;  1GDT A;  1DMQ A;  3CCQ 3;  1IK3 A;  1YTZ T;  2CKF B;  2M0B A;  2YO3 A;  3NBR A;  1IV7 A;  3X3Y A;  3L72 G;  1MNL A;  1UCJ A;  1JEK A;  1I2G A;  2A45 G;  1CI6 A;  1GYB A;  1W4N A;  2OQE A;  4ZKP A;  3ABV C;  3HK4 A;  3NQZ A;  2FXP A;  4BTW A;  3AEF C;  5AW5 B;  4L73 A;  1CYV A;  3AE4 C;  1NU1 J;  4LYL B;  4TT3 H;  1N5H A;  1JY3 O;  1ISK A;  4I6M C;  3STD A;  1Q2N A;  1M56 D;  3GG2 A;  2YXQ B;  2XSH B;  1NWW A;  5TIS E;  8CHO A;  1SQQ G;  3EBT A;  2E5T A;  1N7S B;  1Q42 A;  4BL3 A;  1CYU A;  1QVF O;  5FW5 A;  1NTM J;  3CU3 A;  5KLV E;  1R4C A;  3TNU B;  1NWQ A;  3ER7 A;  4WYK A;  3L71 E;  1DEB A;  1L0N G;  1LT1 A;  1SQV G;  1A02 F;  1NTK J;  2IZ0 A;  3I0Y A;  4JQ0 D;  3KSP A;  4BXL A;  3H1I E;  1M57 D;  2E74 B;  2FXT A;  1LTJ A;  2BAS A;  5M18 A;  1QLE D;  2XF3 A;  2GEX A;  3KHU A;  1VQQ A;  1FGQ A;  5KLV K;  1RF1 B;  1BNS A;  1OPY A;  3LH4 A;  3TGU J;  1LNI A;  1RE3 C;  2HFE D;  4HM1 B;  3HIG A;  2E76 D;  2WPQ A;  1PZQ A;  3AGO A;  2WT7 A;  3Q90 A;  2GU3 A;  1QGK B;  3CCS 3;  3WUU A;  1RSN A;  1BGS A;  4W7Z A;  1OWA A;  2K9J A;  1CQS A;  2BCC J;  1HF9 A;  5EQL A;  2IYO A;  1NTZ D;  4GOE A;  1NOH A;  1OFC X;  3E7K A;  1A02 J;  5CLK A;  3SXX A;  4H0L C;  3AED C;  5KLV D;  3TK1 A;  4FMD A;  4AUW A;  1G2C B;  4O02 B;  1O7W B;  1VQL 3;  4DKI A;  1H88 A;  3V2Q A;  1FZG A;  3VP9 A;  2ML6 A;  4RZM A;  5B66 E;  3H1I D;  1K9M Q;  2CG1 A;  1J1D C;  1BRN L;  2QEX P;  5E79 H;  1NTM G;  3MGN A;  1ZS7 A;  3RGR A;  1FA3 A;  4ZNC A;  3H1H E;  3NUV A;  4U3F E;  3DY5 A;  1W5Z A;  4GB5 A;  1FZF A;  1T3J A;  1BNG A;  3CMA 3;  2KZJ A;  1JY3 N;  3W67 A;  1ZR4 A;  2FXO A;  1UUW B;  1SII A;  4LGQ A;  2CFG A;  5APU A;  1IQX A;  1R4Y A;  3JUO A;  3DGM A;  1AVL A;  1U8C B;  1YJN 3;  1P84 D;  1X0T A;  2HMO B;  1BSB A;  5AEU B;  3HD7 C;  3CME 3;  3PHL A;  1BGY D;  4R9K A;  1X1X A;  3RK3 E;  2KI7 B;  3V92 A;  1D6Z A;  2OTL 3;  1QX8 A;  3GW6 A;  5I97 A;  3T97 B;  3GHG C;  1ZV8 A;  1I2E A;  4I2L C;  5AVX B;  5APS A;  1OUN A;  3S28 A;  2BEQ D;  1IDP A;  2BCC G;  4PD4 I;  1I0X A;  2ZT9 B;  4HM8 B;  4D6T J;  4BIR A;  1PPJ G;  4IL6 H;  1GD4 A;  2KLU A;  1ZME C;  3HII A;  2M3E A;  4RKU J;  1KQL A;  3CXH E;  3EE1 A;  1B2U A;  3H1H D;  5AW9 B;  4U3F D;  1N2D C;  1YGW A;  1N7S C;  2Q3E A;  5GSP A;  1HVV A;  3NFQ A;  3N9H A;  2E42 A;  1K05 A;  1ZRT D;  1AQ5 A;  3M9B A;  1LOY A;  1M7L A;  5GTI H;  1JV2 B;  1VQ4 P;  5CCG D;  1LP1 A;  4WB4 A;  1FE6 A;  2E74 C;  3L37 A;  3RK3 D;  1DYU A;  3A0B E;  2KSE A;  1LWU C;  3DXO A;  2QIY A;  3H51 A;  3SYU A;  4FMB A;  3V2P A;  5AIG A;  1RF1 C;  1JJ2 2;  4GSP A;  1W2Z A;  1PY3 A;  1FGR A;  1MWR A;  1BE3 G;  1OW7 A;  2JDI H;  1W2B 2;  1NKZ B;  4DCK A;  3WOF B;  2BEZ F;  3CX5 H;  4I1L A;  1JMB A;  1VQ6 P;  4JYC A;  1GD2 E;  4LMI A;  4QMA A;  3L73 D;  3SWK A;  3P8M C;  5BIR A;  3CXH D;  1HWT C;  1PGQ A;  4A7P A;  2W6A A;  4OGQ D;  4JPZ B;  1JO5 A;  3TSI A;  2N9B A;  5IER A;  3WDG B;  3UL5 A;  1HH0 A;  1OHO A;  1GK6 A;  3ZG0 A;  1YGE A;  2Y9Z A;  3NV0 A;  5APT A;  2R41 A;  4AQR D;  2I9W A;  2WTY A;  3NXJ A;  3EBY A;  2KK7 A;  2C10 A;  2P10 A;  1R5S A;  1QAK A;  2IBZ D;  2CH9 A;  1J1E B;  1USD A;  2CC3 A;  1VF5 D;  1RGK A;  3DMC A;  4R9L A;  1DX7 A;  1N8Q A;  3CC2 P;  5CK6 A;  5L8R J;  1KC8 Q;  3A3Y B;  1GL2 A;  2JWA A;  3AE7 C;  1M90 4;  1NNV A;  3CWB D;  1VQ7 P;  2O3J A;  3CCM P;  2KS1 A;  4AYC A;  2QE7 H;  1ZN5 A;  4HB1 A;  1MGW A;  1SQP J;  3IR9 A;  4W80 A;  3CCU P;  1W7C A;  3CCR 3;  3GZB A;  1JTH A;  3A7O A;  3H1L E;  3EJV A;  3AE9 C;  3M06 A;  5D81 A;  2MF7 A;  3L70 D;  1BDC A;  2ZT9 C;  2O1K A;  4UB8 H;  4N6N B;  3S9O A;  1NTZ G;  1BCC J;  1KQS O;  2XNX A;  5TIS H;  1FZE A;  2CIU A;  5APQ A;  5AVZ B;  3L0R A;  3IPT A;  2D42 A;  2NRG A;  1EQ7 A;  2XRX B;  3L75 E;  3PTZ A;  1TJD A;  3LOY A;  1RF0 C;  2OYH A;  4N78 E;  3Q5R A;  1OW8 A;  3CD6 P;  3L72 E;  1NU3 A;  2AAE A;  5IG4 A;  5M19 A;  2W56 B;  2CG0 A;  4UB6 E;  2B1X B;  3LTC A;  6RNT A;  1G96 A;  3H1L D;  2KB7 P;  2KCD A;  2RCD A;  2KIK A;  1U7M A;  1N5P A;  1YI2 P;  1BAN A;  3C1L A;  3RK2 D;  1ULJ B;  1I0V A;  4PJ0 H;  4WP5 A;  3SFE C;  1UIX A;  1BNI A;  1HKX A;  1YJW P;  1A2V A;  2M7O A;  1FZC B;  1D6U A;  1P84 H;  1KB9 H;  2HML B;  2WOF A;  2BHM A;  3G3Z A;  4C46 A;  3DZL A;  1OX3 A;  4O2H A;  3L75 D;  2QJP B;  1Q7Y Q;  1MGR A;  5A0O B;  1YVB I;  4N78 D;  3P32 A;  5CHX A;  1L0N E;  4BRY B;  4NHF A;  2OQE C;  4NRE A;  4RNT A;  4GOF A;  3PH0 A;  3S29 A;  3MTU E;  1PGO A;  2J58 A;  1FOS E;  1OMI A;  3G16 A;  3L72 D;  1BIR A;  1OGX A;  1SQQ K;  3D4A A;  3KFQ C;  1FJP A;  1OF5 A;  2DW3 A;  2Z7A A;  1O7P B;  2Z5H A;  2FGT A;  1VQ9 3;  1MZ9 A;  3WMM 0;  2Q6Q A;  3X40 A;  1L0N K;  3H1J J;  3PYJ A;  1SQV K;  3L36 A;  3RDE A;  1EXJ A;  3FLJ A;  3S4R A;  4W7Y A;  4X2H A;  1MWU A;  3BIR A;  3CCE 3;  1SQQ D;  1JN5 A;  1RDS A;  2M5A A;  2XR8 B;  5BU5 A;  1PU4 A;  2CW9 A;  2Q07 A;  1YHQ 3;  2WSC H;  5CCH A;  1JBR A;  3KKG A;  2P0X A;  2QA4 P;  3HTK B;  1H89 A;  1LP1 B;  1RN1 A;  1OCV A;  1HYF A;  1BRI A;  5E79 E;  4J8T A;  1L0N D;  1SQV D;  3L73 G;  3Q2P A;  2YFJ B;  1EQK A;  3D70 A;  2HR3 A;  2WSF J;  1SQB G;  3BAS A;  1RJO A;  1OVU A;  3AEG C;  1RGF A;  1LNQ A;  2NPS D;  2OOV C;  2Y0C A;  5DJU B;  3BB9 A;  1GMJ A;  4BWN A;  3CXH H;  1BRH A;  2SBL A;  1LOV A;  3V4W A;  5KLI B;  2F99 A;  1N7L A;  3AEC C;  3C9I A;  3VOP A;  5KJ7 A;  1JNQ A;  1WMO A;  1HJ0 A;  2IBZ G;  3D3L A;  1NTM K;  3NX0 A;  4PV1 B;  2K37 A;  1VQK P;  2NPS A;  2JP3 A;  1K73 4;  3ALA A;  2OYO A;  2OCT A;  5IG0 A;  5HGR A;  1OZH A;  2OWP A;  3MPH A;  3OXA A;  5IG5 A;  4IL6 E;  2FYU J;  4IFM A;  4U13 A;  3S67 A;  3MG2 A;  5IG3 A;  2HYN A;  3ROB A;  4XM4 A;  1VQN P;  3KZI H;  1B20 A;  2ZYG A;  3GF3 A;  1PPJ E;  2OYI A;  3G4S P;  3Q5P A;  1NTM D;  2QM7 A;  1GL2 B;  1B3S A;  3A5E A;  3OA7 A;  5JPU A;  1T5Y A;  1JZO A;  2F4Y A;  3CCL P;  7STD A;  4H13 B;  4YPC A;  5EVH A;  5GTI E;  1J2B A;  3HZP A;  1BUJ A;  1L0L J;  3PLN A;  2Y0D A;  1MKM A;  2C11 A;  2QJP C;  4DOJ A;  4OVM A;  1B2X A;  1RN7 A;  1JTH B;  3A2A A;  4IOI H;  1FUT A;  1W02 A;  2PAJ A;  1IFJ A;  2WSE J;  1NJI 4;  2JO1 A;  2Q7C A;  5JPP A;  1BSN A;  3Q3D A;  4WWI A;  4HBR A;  1WMN A;  4BU4 A;  2XGL A;  1OXZ A;  1DD4 A;  3CX5 E;  3RBX A;  1AVK A;  3I5C A;  1GOV A;  3LTD A;  2E75 D;  2BCC D;  1WMK A;  1BE3 E;  2R3S A;  1PL5 A;  3B5N D;  3KCH A;  2Z76 A;  1SQX J;  1N73 A;  1BOX A;  2FYU G;  2CPS A;  1Q86 Q;  1D7M A;  1W6G A;  4MN4 C;  3H3H A;  1B2M A;  1VQP P;  2N1T B;  2K0M A;  3JVC A;  5IEN A;  3AEE C;  1FZU A;  1HGZ A;  4HAA A;  1SPU A;  2H0H A;  3B5N A;  3LW5 H;  3RL0 g;  1STF I;  3F14 A;  1Q82 Q;  5RNT A;  1OIP A;  1HUC A;  1JKG A;  1JY2 N;  3U1A A;  1X1U A;  1VQ5 3;  1UI7 A;  3Q3F A;  3EF8 A;  3I55 P;  3RL0 B;  3UIA A;  1IVW A;  1TU5 A;  4QWT A;  3GF7 A;  3RK3 C;  2E2V A;  3M91 A;  5JBS A;  1BE3 D;  5KLI C;  2QJK B;  3HUS A;  2KF6 A;  3HD7 B;  1KQF B;  1K8A 4;  5G1L A;  3CCV P;  2RFR A;  1TUH A;  1SFC A;  4WY4 D;  2RGQ A;  3GHG B;  1IT7 A;  4PV1 C;  3N7N A;  3FWN A;  1PP9 G;  4R4K A;  4EXR A;  2A45 H;  1JBS A;  1VQO P;  2P38 A;  4IPB A;  4ZM8 A;  3KYQ A;  1URQ B;  4UB6 H;  1V74 A;  1VZZ A;  2FBW C;  4UB8 E;  1WT6 A;  2ZVN B;  3VMZ A;  3KE7 A;  3GWR A;  5DRE A;  5AVR B;  2WGQ A;  6GSP A;  4WY4 A;  1KYO D;  2AEJ A;  1OAC A;  1YJ9 P;  1AJY A;  1NTZ E;  1LGH B;  4YXW H;  4JF7 A;  2HOH A;  1GL2 C;  5CMZ A;  1JNM A;  3SX1 A;  4AEQ A;  3L74 J;  4H13 C;  1YIJ P;  1EZV G;  3BU4 A;  2M5A B;  3EN8 A;  3SWY A;  1KIL B;  5KP1 A;  2XND H;  1UGI A;  7RNT A;  2JR8 A;  4YXD C;  2A15 A;  3JCU H;  1MWS A;  2LQV A;  1NTZ K;  1LWU B;  2WOH A;  3KPE A;  3T0U A;  1DMM A;  5AII A;  1YVS A;  3NQY A;  1EDJ A;  1EDI A;  4PJ0 E;  4MEI A;  2D2C D;  5KP3 A;  3SVA A;  2XFS A;  3HRN A;  2VRS A;  4HYT B;  3HE5 A;  1EUI C;  2MKV A;  3VMY A;  2W8Z A;  1P84 E;  1KB9 E;  2E43 A;  3KZT A;  4H44 D;  2ZXX A;  1NU1 G;  1BGY E;  1FGT A;  3HE4 A;  5ELJ A;  3MHE A;  2L5G B;  4EYC A;  2FFD B;  1BRG A;  2W04 A;  2B89 A;  3BCC J;  2XV5 A;  3KDP B;  5APY A;  3WMD A;  1JY3 P;  2Z5I A;  3KXD A;  4Z1M H;  2N1T C;  4HYZ A;  2W2C A;  1PV3 A;  1U5O A;  1JM0 A;  1NYH A;  3A5T A;  1V57 A;  4NPF X;  1E5W A;  3MD0 A;  3X3Z A;  1HU9 A;  3FG4 A;  1DH3 A;  1AA0 A;  1BVI A;  4X2O A;  3S27 A;  5GTH H;  1E79 H;  1RQV A;  1DMN A;  5AW6 B;  3LT8 A;  2A06 G;  3L74 G;  1JUN A;  1W6Y A;  1L4A B;  3KII A;  1NTK G;  3TDG A;  3Q1M A;  3CX5 I;  3MWZ A;  4R4M A;  3M0D C;  3RL0 C;  1RTU A;  1KN7 A;  4XB5 A;  3O6Q A;  1ZRT E;  3P8C E;  4K1V A;  2IFN A;  2QJK C;  1KB9 D;  3V2N A;  3CNX A;  5AYS C;  2F56 A;  4R80 A;  1NKN A;  1EKM A;  3TGU G;  3G8Z A;  3K63 A;  5BU8 B;  5AVQ B;  4KFF A;  3FWL A;  3ECF A;  4H3U A;  1K9M 4;  3VF1 A;  4O3V A;  3OWU A;  3H1K J;  1NDO B;  1IO4 A;  5BU4 A;  3E1I A;  1URQ C;  2RN0 A;  3OWS A;  1Q81 Q;  4J5K A;  3EWK A;  1EG9 B;  1G02 A;  4K90 B;  4G1M B;  3H25 A;  2E2U A;  3L73 E;  2RSX A;  1K41 A;  3BCC G;  2WIT A;  3EHC A;  4XE5 B;  1SQB E;  3A0H H;  3U1C A;  3FG1 A;  3OWY A;  1U7J A;  2KNC A;  2HPC A;  3CC7 P;  2KXG A;  3QK9 A;  1BSD A;  4M3L A;  4HVN A;  4IIA A;  2KOG A;  3FF2 A;  3OV4 A;  3P8C D;  1M1K Q;  2CFK A;  5DRV A;  1TRP A;  4EV5 A;  4XBX A;  1KIL C;  2O01 J;  3D6Z A;  4EW5 A;  4WWU C;  2IBZ E;  3R4Y A;  5CCH C;  1SQB K;  1GTW A;  1T6A A;  5AVU B;  1S72 P;  3LXU X;  2WPS A;  1PIX A;  1LTB C;  2XFT A;  1NO3 A;  3DGL A;  4GOD A;  4JRF A;  1LTI C;  3KZI E;  1RGC A;  2YMK A;  3MUD A;  5CCG A;  1FBM A;  2M3B A;  5BVB A;  1UW1 A;  1GK4 A;  1K04 A;  3CWB E;  4WVZ A;  5AI1 A;  2OTJ P;  1VQ8 3;  3Q1C A;  5KAF H;  4XDW A;  4WBA A;  1YQ3 C;  1GMR A;  4O8S A;  4HM5 B;  3GMA A;  1OHP A;  1DVD A;  2I1K A;  1SQB D;  2JWD A;  1VL2 A;  4XFJ A;  2BT3 A;  2CWU A;  5KKZ C;  1GS3 A;  2ZHX B;  4D6T G;  1L2P A;  2FNQ A;  3WHO A;  2WO0 A;  2Z4E A;  5KJ7 C;  1UDI I;  2OTK E;  1JB5 A;  3FSD A;  1LQM B;  2C9L Y;  1CI6 B;  2FFD C;  1SFC B;  2MJZ A;  4I7Z B;  2C4B A;  1FGM A;  3L70 E;  1AY7 A;  1MUU A;  1S3J A;  2NPS C;  1W6C A;  1FYS A;  4N6J A;  5AW3 B;  3WU2 H;  3NM2 A;  4K61 A;  1GW4 A;  3O8Z A;  1AVO A;  1KYO H;  5AYR B;  2ZJS E;  3RBZ A;  2F5M A;  4HM7 B;  4ASW A;  1L4A C;  5KAI E;  1BNF A;  5KLV J;  1QJG A;  3FXD A;  2IYP A;  1KFM A;  6STD A;  1E3R A;  2B9B A;  1T2K C;  3DUK A;  3L71 J;  4C7R A;  5D82 A;  4JF8 A;  1N9J A;  2B88 A;  4MMX B;  1P84 I;  3X42 A;  3H1I J;  1N8R Q;  1AV4 A;  4WYK B;  1T2I A;  2STD A;  1NB3 I;  1W2B O;  4L74 A;  1ULI B;  1NAY A;  1H0T A;  1H8A A;  2HMK B;  1LTJ B;  1Q7H A;  3JUQ A;  1IK7 A;  3A76 A;  1IU7 A;  1QL2 A;  3OW2 2;  3AE5 C;  1XTC C;  3H32 A;  2P05 A;  1KC8 4;  1S9K E;  2WMM A;  1JZD A;  3UNL A;  4L7K A;  3BNB A;  2IUJ A;  1LTA C;  1WRG A;  1FGO A;  4N6L A;  1WNH A;  2CFD A;  2WT7 B;  3O8Y A;  2FYU K;  1KD1 Q;  3PXM A;  3UJM A;  3I56 P;  3G6E P;  2CK3 H;  3EFF K;  2YO2 A;  5CXO A;  2K9J B;  4K35 A;  1AQZ A;  1VQ4 3;  1A2K A;  4H0L D;  1RE3 A;  3HE4 B;  4OWF A;  2SAR A;  1A67 A;  1YBK A;  2E76 B;  4RNY A;  4GKG A;  1GY6 A;  5AIH A;  2IY2 A;  1BAO A;  2E75 C;  2PGD A;  5CF2 A;  5STD A;  3F8X A;  3H1H J;  4U3F J;  2K3R A;  3L71 G;  2FYU D;  3B5N C;  3G0K A;  3RGU A;  1VQ6 3;  1PP9 E;  3B4S A;  3QRD A;  1DE3 A;  2C0W A;  2INX A;  3PZW A;  4HM4 B;  3OJA B;  1IK9 A;  3K5T A;  3G71 P;  3M8C A;  2K3D A;  1SQP G;  2HOD A;  1S9K D;  1JOC A;  4EYY Q;  3CXH I;  3TDK A;  3II6 A;  3FH1 A;  1SQQ E;  2Y0E A;  3FZW A;  1OHS A;  2IPP A;  3O6Q B;  3D6Y A;  4LSO A;  5KP4 A;  2GU1 A;  1CW5 A;  1PYL A;  2IX7 C;  1O7G B;  3USS A;  1GW3 A;  5CJ4 A;  1YIT P;  1X79 B;  3HUS C;  2ML5 A;  1I2F A;  1US1 A;  1BCC G;  1SQX K;  2FXM A;  1GSP A;  3G9R A;  2L4V A;  3JCU E;  3Q2Y A;  1EZV E;  1SFC C;  4I7Z C;  2H0G A;  3U1W A;  1SQV E;  1U57 A;  2JQ5 A;  2IYJ A;  2XU6 A;  2WSS H;  3CC2 3;  1FUW A;  3CLQ A;  3F40 A;  2M8R A;  1ROV A;  1ASK A;  1IFM A;  1PP9 D;  3CL3 D;  3N54 B;  1VQ7 3;  1R8E A;  3CCM 3;  1GOY A;  1GOU A;  4OH8 B;  3K5B A;  1N7S D;  3L4F A;  5APW A;  1UCL A;  1SQX D;  1IQY A;  3CCU 3;  1UII A;  4MJD A;  1Q7Y 4;  4N6U A; 
#chains in the Genus database with same CATH homology
 3MYT A;  4KVH A;  4WFO A;  2ML6 A;  4RZM A;  2XH9 A;  2K0M A;  1Y4K A;  3JVC A;  5IEN A;  2CG1 A;  1SPU A;  4L8P A;  2CHC A;  4XDV A;  3MG3 A;  3BLZ A;  4HJL B;  1STF I;  3F14 A;  3RGR A;  1FA3 A;  3GZX B;  1SIH A;  3NUV A;  3DY5 A;  3V98 A;  1W5Z A;  4GB5 A;  1S5A A;  4KFE A;  3WOE B;  3CMA 3;  2ZL8 A;  1JKG A;  1VQ5 3;  2W0Q A;  3PJS K;  1UI7 A;  1UUW B;  2BMO B;  1SII A;  3EF8 A;  1IVW A;  4LGQ A;  3E99 A;  2CFG A;  3JUO A;  1IQX A;  3DGM A;  1AVL A;  1TU5 A;  1U8C B;  4QWT A;  4TX4 A;  2K54 A;  2E2V A;  1YJN 3;  3CC7 3;  2HMO B;  2XGN A;  3B4P A;  5AEU B;  3J7Y d;  5JBS A;  3CME 3;  4R9K A;  4KZ1 A;  2HMJ B;  4TLF A;  2CWV A;  1K8A 4;  3V92 A;  1D6Z A;  3CD6 3;  2RFR A;  2OTL 3;  3DGO A;  5I97 A;  1TUH A;  1N8R 4;  3PCS A;  5ELU A;  3BNC A;  1OUN A;  2RGQ A;  3S28 A;  3D9R A;  5D83 A;  4AKY A;  1IDP A;  1IT7 A;  3DGN A;  4XBY A;  4GL6 A;  1UI8 A;  3RGA A;  1TFK A;  4R4K A;  4EXR A;  1IQ8 A;  4HM8 B;  2P38 A;  4IPB A;  3MG1 A;  4ZM8 A;  1YI2 3;  1S72 3;  2BO9 B;  3NV0 B;  1TIJ A;  1IVX A;  1SJW A;  1V74 A;  1VZZ A;  1GD4 A;  1AQT A;  4STD A;  2Z77 A;  3B7C A;  3HII A;  3KE7 A;  3GWR A;  5DRE A;  2WGQ A;  3JUP A;  1YJW 3;  3EE1 A;  4HM0 B;  1IV9 A;  1KWI A;  1E97 A;  1OAC A;  3FGY A;  2OTJ 3;  3N9H A;  4YXW H;  1KD1 4;  1MOL A;  4XBT A;  1BUQ A;  1IT8 A;  2YFL B;  3SX1 A;  3WA3 A;  4AEQ A;  1JV2 B;  1DVC A;  2LYX A;  4FR9 A;  3NM7 A;  3EN8 A;  5KP1 A;  1OH0 A;  2XND H;  1DYU A;  3AMO A;  3BND A;  1FS0 E;  1O7M B;  5IEO A;  2A15 A;  4N3V A;  2LQV A;  3DXO A;  3LTB A;  2O9U X;  2QIY A;  3CCJ 3;  2YFI B;  2W6J H;  2WOH A;  1F8N A;  3H51 A;  4FMB A;  3T0U A;  2YX9 A;  2XSO B;  3GZR A;  1DMM A;  5AIG A;  3SOA A;  5AII A;  1L5G B;  1JJ2 2;  3HX8 A;  1W2Z A;  3NQY A;  1FGR A;  2JDI H;  1W2B 2;  3WOF B;  3EN1 B;  4MEI A;  5IW9 A;  1WTH A;  5KP3 A;  3SVA A;  4RNZ A;  1TP6 A;  2XFS A;  4LMI A;  1Z1S A;  4QMA A;  3F7S A;  4L8O A;  4DJG A;  4RBN A;  2GEY A;  3DM8 A;  1QVG 2;  2MC8 A;  1ROA A;  3KZT A;  3LTA A;  3JUM A;  1FGT A;  4HZB B;  5ELJ A;  5IER A;  3MHE A;  4OUQ A;  3WDG B;  5FGO A;  4EYC A;  4N6T A;  3UL5 A;  1OHO A;  1YGE A;  3NV0 A;  3PGB A;  2QA4 3;  3GZY B;  1LVN A;  2W04 A;  4HZ9 B;  2WGO A;  4MMZ B;  2I9W A;  3NXJ A;  3WMD A;  3EBY A;  2C10 A;  4FMA A;  4HYZ A;  1NB5 I;  1WMP A;  2W2C A;  1QAK A;  1U5O A;  2CH9 A;  2CC3 A;  3X3Z A;  1HU9 A;  3FG4 A;  4X2O A;  3S27 A;  1E79 H;  3DMC A;  1DMN A;  4R9L A;  3LT8 A;  1N8Q A;  3NHX A;  5CK6 A;  2GXF A;  1Q40 B;  1W6Y A;  3CC4 3;  3CNM A;  3KII A;  1M90 4;  1GY5 A;  5LC6 A;  3TDG A;  5BXQ A;  1JB4 A;  1W00 A;  3MWZ A;  3CXC 2;  3I56 3;  3G6E 3;  4XB5 A;  3UB1 A;  1QAL A;  2QE7 H;  4K1V A;  1LNH A;  2ZDJ A;  1QMA A;  4IT7 A;  1QVF 2;  3IJE B;  1WQL B;  1W7C A;  3CPW 2;  3CCR 3;  3CNX A;  2UX0 A;  3GZB A;  1VQK 3;  5AYS C;  5CF1 A;  4R80 A;  1Q86 4;  2W03 A;  1EKM A;  4N6V 0;  3G8Z A;  3K63 A;  4KFF A;  3EJV A;  3ECF A;  1CEW I;  4H3U A;  1K9M 4;  4J9A A;  3PCR A;  5D81 A;  2MF7 A;  3VF1 A;  4O3V A;  3MKI A;  3OWU A;  4WHA A;  1NDO B;  4MMY B;  3F8H A;  3OX9 A;  4EC6 A;  1Q82 4;  2P09 A;  4N6N B;  4FMC A;  1O7N B;  2R4I A;  3OWS A;  1VQN 3;  3PS8 A;  3LML A;  1EG9 B;  1OGZ A;  4K90 B;  3G71 3;  4G1M B;  3G4S 3;  2CFW A;  2E2U A;  1OF5 B;  2BMQ B;  2RSX A;  3B4O A;  1K41 A;  3NBJ A;  3NBB A;  1EA2 A;  2BNG A;  2CIU A;  3EHC A;  3L0R A;  2D1W A;  3IPT A;  2D42 A;  3FG1 A;  2XRX B;  3OWY A;  1RRL A;  3CCL 3;  2GBW B;  3T8N A;  3LOY A;  2KXG A;  2V1L A;  5LC7 A;  3QK9 A;  5AEW B;  4CCV A;  1K28 A;  1RRH A;  4HVN A;  3B8L A;  2Y74 A;  4IIA A;  1YIT 3;  3FF2 A;  3FKA A;  3OV4 A;  5TGN A;  1NU3 A;  2CFK A;  5DRV A;  4CDL A;  4EV5 A;  5IG4 A;  2W56 B;  4XBX A;  2CG0 A;  1ZO2 A;  1JN5 B;  1RKY A;  2B1X B;  1GD3 A;  4WWU C;  3LTC A;  5AIF A;  1G96 A;  1IVV A;  2IMJ A;  4LZI A;  2KCD A;  2RCD A;  4KFD A;  1N5P A;  1UUV B;  1PFP A;  3LXU X;  1ULJ B;  2E2T A;  4BTX A;  2XFT A;  1NO3 A;  3DGL A;  1QAF A;  4WP5 A;  4JRF A;  4EBG A;  1HKX A;  5G2G A;  1A2V A;  2M7O A;  3VSY A;  5BVB A;  1UW1 A;  3VGN A;  4WVZ A;  5AI1 A;  1IVU A;  1D6U A;  1VQ8 3;  3Q1C A;  1ZX2 A;  4XDW A;  2HML B;  3IMA B;  2WOF A;  2Y73 A;  3X3X A;  4O8S A;  4HM5 B;  1OHP A;  1DVD A;  2BHM A;  2BT3 A;  4O2H A;  3DZL A;  3HI7 A;  2CWU A;  3WOD G;  1GS3 A;  3FCS B;  1BSH A;  1JB2 A;  2FNQ A;  1VQP 3;  2WO0 A;  1YVB I;  4FCM A;  5A0O B;  1C7H A;  4NHF A;  1JB5 A;  3FSD A;  3K7C A;  2OQE C;  4NRE A;  3S29 A;  1FGM A;  3G16 A;  4PEJ A;  2OOV A;  2CFL A;  1OGX A;  3MSO A;  3KN4 A;  4Q53 A;  3T8U A;  1TFO A;  1W6C A;  3KFQ C;  1OF5 A;  2O3O A;  2HMM B;  2Z7A A;  3NM2 A;  1O7P B;  4K61 A;  2FGT A;  1KSI A;  1VQ9 3;  5IF6 A;  5AYR B;  3X40 A;  4EV2 A;  3I55 3;  4HM7 B;  1JRQ A;  3X41 A;  3PYJ A;  2W9Q A;  1SQW A;  4HM3 B;  3RDE A;  1QJG A;  3LZA A;  3FLJ A;  6STD A;  2GBX B;  1E3R A;  4R1K A;  3DUK A;  4N6O B;  4X2H A;  5EEO A;  2W56 A;  5D82 A;  3CCE 3;  1JN5 A;  4JF8 A;  3CCV 3;  1N9J A;  3EC9 A;  1E3V A;  2XR8 B;  4MMX B;  1PU4 A;  2CW9 A;  3X42 A;  3S5C A;  2Q07 A;  1YHQ 3;  2CWT A;  1AV4 A;  4HM6 B;  3SLU A;  2IA7 A;  4WYK B;  3KKG A;  2P0X A;  2STD A;  1NB3 I;  2W9P A;  1OCV A;  1IFP A;  1ULI B;  1VQO 3;  4I4K A;  4H61 A;  4J8T A;  2F98 A;  3AMO B;  4HM2 B;  4BTY A;  2HMK B;  3LYG A;  1STD A;  2BMR B;  2XEP A;  1VQM 3;  3JUQ A;  3Q2P A;  3LT9 A;  2YFJ B;  3A76 A;  1EQK A;  1IU7 A;  3SOY A;  3GRD A;  3WA2 X;  3OW2 2;  2Z6B A;  2V7Q H;  3EX9 A;  1W01 A;  2P05 A;  1KC8 4;  1RJO A;  1DMQ A;  3FG3 A;  3CCQ 3;  3BB9 A;  2OOV C;  2CKF B;  3UNL A;  1IK3 A;  1YJ9 3;  4L7K A;  3BNB A;  2IUJ A;  4N6L A;  1FGO A;  1WNH A;  2KRT A;  2SBL A;  2CFD A;  3NBR A;  2B24 B;  3O8Y A;  1IV7 A;  3X3Y A;  1MNL A;  2F99 A;  3PXM A;  3UJM A;  1JEK A;  4AKZ A;  2CK3 H;  1GY7 A;  1GYB A;  1W4N A;  4FCJ A;  3EFF K;  3F7X A;  4ORL A;  1M9G A;  5CXO A;  2OQE A;  1JNQ A;  4FCZ A;  1YIJ 3;  1WMO A;  1VQ4 3;  3HK4 A;  3NQZ A;  1A2K A;  3D3L A;  3FF0 A;  4BTW A;  3NX0 A;  2PNC A;  1K73 4;  3ALA A;  1CYV A;  1A67 A;  2OCT A;  5IG0 A;  1N5H A;  4RNY A;  2IUK A;  3F9S A;  1GY6 A;  5AIH A;  5HGR A;  1ISK A;  3STD A;  1N9E A;  2OWP A;  3MPH A;  5CF2 A;  3OXA A;  5STD A;  3F8X A;  4K1U A;  5IG5 A;  2XSH B;  1NWW A;  1Q40 A;  4U13 A;  3S67 A;  3MG2 A;  3G0K A;  8CHO A;  1VQ6 3;  3EBT A;  5IG3 A;  3ROB A;  1Q81 4;  1A90 A;  4XM4 A;  2E5T A;  3QRD A;  1Q42 A;  2INX A;  3K9M C;  3PZW A;  4HM4 B;  4OK0 A;  3K5T A;  5IEP A;  1CYU A;  3CPO A;  3M8C A;  5FW5 A;  3UL6 A;  3CU3 A;  3V99 A;  3K0Z A;  1R4C A;  5JPU A;  3ER7 A;  4WYK A;  2QGU A;  1T5Y A;  1M1X B;  1O7H B;  1JKG B;  3FH1 A;  7STD A;  3FZW A;  1OHS A;  3BNE A;  5EVH A;  3I0Y A;  3KSP A;  1J2B A;  3HZP A;  4LSO A;  5KP4 A;  2FXT A;  2GU1 A;  1O7G B;  2C11 A;  3USS A;  2XF3 A;  2PZV A;  3EB8 A;  3JUN A;  4OVM A;  1M1K 4;  3GAX A;  2GEX A;  1RN7 A;  1D6Y A;  2ML5 A;  1US1 A;  1LXE A;  2L4V A;  3U97 A;  1FGQ A;  1W02 A;  3U1W A;  1NJI 4;  2P0M A;  2F86 B;  3N8B A;  1OPY A;  2QEX 3;  4N6M A;  5JPP A;  3LH4 A;  2JQ5 A;  1BSN A;  1LOX A;  4HBR A;  2E5Y A;  2WSS H;  1WMN A;  3HIG A;  4HM1 B;  3CC2 3;  1FUW A;  2XGL A;  3Q90 A;  3F40 A;  3SED A;  2GU3 A;  3CCS 3;  1AVK A;  1ROV A;  3LTD A;  1ASK A;  3EQQ B;  1CQS A;  3N54 B;  1VQ7 3;  3CCM 3;  5EQL A;  3KSE D;  1AR0 A;  1KQS 2;  4LEH A;  2Z76 A;  5CLK A;  4HKV B;  3SXX A;  1IQY A;  4FMD A;  3CCU 3;  4O02 B;  1O7W B;  1W6G A;  1VQL 3;  3H3H A;  4MJD A;  1Q7Y 4;  4N6U A;  2HMN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...