3MWZA

Crystal structure of the selenomethionine derivative of the l 22,47,100 m mutant of sialostatin l2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
MELALRGGYRERSNQDDPEYLEMAHYATSTWSAQQPGKTHFDTVVEVMKVETQTVAGTNYRLTLKVAESTCELTSTYNKDTCQANANAAQRTCTTVIYRNMQGEKSINSFECAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords sialostatin L2
publication title The crystal structures of two salivary cystatins from the tick Ixodes scapularis and the effect of these inhibitors on the establishment of Borrelia burgdorferi infection in a murine model.
pubmed doi rcsb
source organism Ixodes scapularis
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3mwzA00
3QRDA 2O9UX 1STFI 1TIJA 2CH9A 1FA3A 4N6OB 1YVBI 1IV9A 1CYVA 4IT7A 5EQLA 1MOLA 3Q2PA 4CCVA 3LH4A 1N5HA 3UL6A 3IMAB 4N6NB 1G96A 1EQKA 5LC7A 4N6MA 3S67A 3K9MC 2KXGA 1M9GA 1GD3A 4TX4A 3MWZA 3KSED 5A0OB 1WNHA 5LC6A 1IV7A 4N6LA 1RN7A 1PFPA 3PYJA 1GD4A 2BO9B 1DVDA 1CYUA 1KWIA 4N6TA 5ELJA 4N6UA 4N6V0 1A67A 3SVAA 1ROAA 1CEWI 1A90A 3L0RA 2W9PA 3UL5A 4EYCA 5ELUA 4ZM8A 1MNLA 1R4CA 1LXEA 4LZIA 3PS8A 3PXMA 1NB3I 1N5PA 3GAXA 3KFQC 1FUWA 3NX0A 2OCTA 1NB5I 1DVCA 1N9JA 2W9QA
chains in the Genus database with same CATH superfamily
1TFOA 4WYKA 3U97A 2O9UX 1STFI 3T0UA 1US1A 1JKGA 1JN5A 3I0YA 6GSPA 1A2VA 2F5MA 5AEUB 1LNHA 3M8CA 1ULIB 3KCHA 4HM6B 2KAAA 1BRJA 1BRKA 4Q53A 1QJGA 3V98A 4LMIA 4CDLA 1K9M4 4AKZA 2OTJ3 3LXUX 4LGQA 1YVBI 1Q814 1IV9A 4K1UA 3WDGB 3G0KA 4X2OA 2QGUA 3SOAA 2XFTA 2OQEA 1I3IA 5EQLA 1MOLA 1YGEA 3LH4A 1AQZA 1UGHI 2HMKB 1L5GB 3SLUA 3H3HA 2RFRA 1G96A 3DY5A 3ALAA 2KRTA 3LTBA 3LTCA 3F7SA 4IIAA 1OF5A 1UW1A 3MHEA 1W4NA 3N8BA 1JB5A 4OVMA 4N6MA 4HM5B 1LVNA 1VQP3 1JBRA 2XR8B 4HM8B 4BTXA 3DZLA 1GY6A 2K3DA 3HZPA 3F8XA 5BXQA 5A0OB 1TFKA 1ULJB 1DMNA 1MGWA 2IA7A 4GSPA 4MMXB 3T8UA 3GSPA 5LC6A 1IV7A 5I97A 1VQ63 1TP6A 2W6JH 4FMAA 4L8OA 1JKGB 3DMCA 4R9KA 1JJ22 3FGYA 1VQ83 1VQN3 5AIIA 4HM2B 1PU4A 3DM8A 1B2ZA 1BGSA 1RN7A 3VF1A 3J7Yd 3KE7A 1W2B2 3ZFZA 3PYJA 1GD4A 2KF5A 5GSPA 1A2KA 3D9RA 2MC8A 1RGAA 4HM0B 3CPW2 1WMPA 3KSPA 1WMOA 2CFWA 1YHQ3 1ZS7A 1MWSA 1Y4KA 3ER7A 3ZG5A 5IEOA 4RNZA 5D82A 1IT8A 3SXXA 3CCE3 1AVKA 3NBRA 1C7HA 3CXC2 4HAAA 2W03A 4KVHA 4N6UA 1O7NB 4H3UA 1FZUA 1SARA 8RNTA 3BB9A 2F4YA 3CCR3 4XBTA 3K63A 3ROBA 3CPOA 1GS3A 3L0RA 3LOYA 3S5CA 2OWPA 1K41A 4HZBB 1NO3A 3BU4A 1DMQA 1RDSA 5KP3A 1QVF2 2HOHA 3D3LA 4FCJA 1RRLA 3AGOA 7GSPA 1S5AA 2OOVC 3BNDA 5CLKA 4XDVA 1GOUA 4HYZA 4R4KA 1RN1A 2Z77A 4ILFA 1YJ93 5HGRA 6STDA 1CQSA 1R4CA 2L1SA 4GB5A 4LZIA 5KP4A 4G1MB 1DETA 1BNSA 3LTAA 2E2VA 1OPYA 3PXMA 4R80A 1VQ43 3SEDA 1AVLA 2C4BA 3IPTA 2KCDA 4STDA 2IMJA 4LEHA 4WP5A 4EV2A 1N9EA 2BMOB 1MWUA 1I0VA 1RGGA 1J2BA 1IYYA 1FGRA 3OWYA 1HYFA 3CME3 1YJN3 1SQWA 3WHOA 2AADA 2F56A 1W6GA 4RBNA 2SARA 1LOXA 3V99A 1EEJA 3JUNA 1ZO2A 3F14A 1DVCA 1N9JA 1SJWA 2K0MA 2Q07A 2B1XB 1ZGXA 1HU9A 1VQQA 2V1LA 2W9QA 2RNTA 5AYSC 1C54A 1BSEA 1IU7A 2RCDA 3GWRA 3QRDA 4U13A 1B2XA 2GBXB 2XFSA 2ZL8A 3NUVA 4XB5A 1FGOA 1TRPA 3GRDA 1AV4A 1TUHA 1GMPA 2CH9A 1AY7A 2UUGC 1WQLB 3I553 1FA3A 1OGZA 2F98A 1YNVX 2UX0A 3F7XA 3O8YA 2RGQA 4MEIA 4N6OB 1V57A 1BSDA 1RHLA 1NJI4 1SIIA 4EC6A 4XM4A 1DMMA 2F99A 2QIYA 5AEWB 1QMAA 2H0IA 4K61A 1RGCA 2W56A 1OGXA 2XGLA 3Q90A 3X3ZA 3G713 1B2SA 2CX1A 4N6NB 4WFOA 3UL6A 2P05A 1T5YA 2D42A 1ROVA 5KP1A 1YJW3 1WTHA 3S67A 1O7HB 4EV5A 1LRAA 1MGRA 1OACA 4BTWA 1RSNA 4TX4A 1BSBA 1EA2A 3JUPA 5IG3A 4L8PA 2BIRA 2PNCA 1WNHA 2Z76A 5CF2A 3MYTA 1LOWA 1W6CA 2ZDJA 3LZAA 3CCL3 3EF8A 2D1WA 4KFEA 5AI1A 4HM3B 1E3RA 2CWVA 1JZOA 2LYXA 3KKGA 3CC73 2XF3A 1BANA 1RTUA 4N3VA 3U1WA 2BMQB 2L4VA 2KF3A 4EXRA 3RNTA 4BL2A 3FG4A 3JVCA 3K5TA 2W56B 3UJMA 2OQEC 4MMZB 5BIRA 1O7WB 1SIHA 2C11A 1A2PA 4FR9A 4JRFA 1KWIA 1I2EA 3X3YA 4BTYA 3G4S3 1W6YA 5G1KA 3DGMA 2P09A 3RGAA 2GBWB 1BOXA 1TJDA 1RJOA 1CEWI 1UUWB 4HM7B 5DREA 5JPPA 1RCLA 1WMNA 1KQS2 3EN1B 2W2CA 2W9PA 1U5OA 1FUTA 1CH0A 3MG1A 3CMA3 6RNTA 1E97A 3CNXA 2E2TA 1KC84 3NHXA 3CU3A 1OHSA 2CG1A 1BVIA 1IVWA 1X1YA 2GU3A 3WR2A 4MMYB 3SYUA 1VQ93 3BNEA 3AHWA 1YI23 1JZDA 3FF0A 5M19A 3NBJA 2WGQA 1RLSA 3D4AA 2LQVA 3URPA 1VQ73 2CHCA 3PS8A 3UNLA 1GYBA 5IF6A 3GAXA 1JV2B 3B4OA 3PCRA 4O2HA 1JBTA 1B20A 1OUNA 4RNTA 2IUJA 3WOFB 3S29A 3WMDA 1YIJ3 1UCJA 3CCM3 1FGTA 2HMJB 3DH2A 2JDIH 3FSDA 1M1K4 2CFGA 1N8QA 2E2UA 2GU1A 3BNCA 1IK3A 1RKYA 1BUQA 1U8CB 1ZX2A 1RGKA 5EEOA 3I563 4AKYA 1VQK3 2XSHB 3Q3FA 3FZWA 3EE1A 1E3VA 2CWUA 2F5WA 1OH0A 3BNBA 4BL3A 1TIJA 4J9AA 5TGNA 5EVHA 2I9WA 2XSOB 4WHAA 1GY7A 2YX9A 5D81A 4KFFA 1I0XA 4RNYA 2R41A 1M904 3PGBA 3T8NA 1R4YA 1IQ8A 4KZ1A 1S723 3E99A 3HI7A 3G8ZA 1I70A 1FGQA 2BNGA 2WOFA 1UCIA 1LOYA 2CFLA 4H61A 4IT7A 3GZRA 1RN4A 3HIIA 3IMAB 3DUKA 1PY3A 2M7OA 3WA3A 5LC7A 3NM7A 1BNJA 4FMDA 1BAOA 2UGIA 1ISKA 1HKXA 1BRGA 3FKAA 4HBRA 1K734 1M9GA 1FW7A 1IVUA 1GD3A 3CCJ3 1BNIA 3KZTA 1I2FA 3MWZA 2BT3A 3X41A 3B8LA 3DGOA 4EBGA 3CC23 2WOHA 4ORLA 3D5GA 1UI8A 5BU4A 1KD14 3EBYA 2P0XA 2CFKA 5CK6A 1NNVA 3SOYA 3DGYA 3G6E3 5FW5A 3HOHA 3B7CA 1M1XB 1VQM3 4N6LA 1LQGC 1PFPA 4R1KA 3B4PA 5AIHA 4OUQA 1LQMB 5G1LA 1FGMA 2BO9B 3AHSA 1UCLA 3NV0A 3EBTA 1MWRA 3DGNA 3EQQB 3PCSA 1W01A 5IG0A 1BNGA 1X1XA 2K54A 1V74A 1D6ZA 2XEPA 3OWSA 3LT8A 1CYUA 2C10A 1PYLA 4O3VA 4HM4B 1OHOA 2Y74A 1BRIA 1QVG2 1W02A 5ELJA 1G02A 2J8XB 2W0QA 3D5IA 4N6V0 3OW22 2IYJA 1W00A 9RNTA 2XRXB 4HZ9B 1A67A 2CW9A 3QK9A 3SVAA 1ROAA 2CK3H 8CHOA 1A90A 3OV4A 1GOVA 1BRHA 1RNBA 1GY5A 1UGIA 1O7PB 3K0ZA 4XBXA 4CPKA 4HM1B 5JBSA 3CC43 2FNQA 4FCZA 3EJVA 4XDWA 4XBYA 1G0TA 1HZ1A 3PZWA 1X1UA 3EC9A 3K7CA 3UL5A 2CFDA 2ZA4A 2BHMA 4HJLB 4LSOA 1BSAA 2CWTA 4JF8A 3OXAA 2MF7A 1GSPA 1IVXA 2BU4A 2ML6A 3LMLA 3SX1A 4ZM8A 3NV0B 3OX9A 1MNLA 5AIGA 1QALA 2XH9A 2Y73A 3CCS3 1LXEA 3H51A 1UDII 2CX0A 3Q1CA 3IJEB 3MKIA 3CCQ3 1MWTA 1N5PA 5IW9A 3FCSB 3S28A 1FUWA 2WO0A 1EG9B 3HX8A 1ASKA 1RNTA 2OCTA 3MSOA 4BU4A 5AIFA 1SPUA 3BIRA 1F8NA 1N8R4 1O7GB 3FG3A 1FYSA 4I4KA 2RBIA 4HVNA 4O02B 3X42A 1UI7A 2F86B 2HMMB 3LT9A 4EW5A 5IG5A 1JNQA 2QEX3 2BMRB 4BIRA 3EB8A 5IG4A 1NB5I 1B21A 3NQYA 1Q40B 1LOVA 1BNEA 1IT7A 2ML5A 1Q7HA 3G16A 2P0MA 4OK0A 5G2GA 3N54B 1NU3A 3GZXB 1NDOB 3AGNA 1TTOA 4X2HA 3F9SA 2CG0A 1TU5A 4PEJA 1T3BA 7RNTA 3RGRA 3N9HA 3RDEA 5JPUA 3MG3A 3WODG 3CCU3 1K8A4 3A5EA 3NXJA 7STDA 1YIT3 4WYKB 1B27A 4MJDA 1Q824 1JN5B 3MPHA 1STDA 1RGHA 4QWTA 1CYVA 2IUKA 4CJNA 2Z6BA 4HOHA 1W7CA 1VQL3 4J5KA 3Q2PA 4CCVA 1N5HA 1NWWA 1Q42A 1VZZA 1IVVA 5DRVA 5IENA 2AAEA 2GSPA 1EQKA 5CF1A 1JRQA 3VSYA 3EX9A 4LYLB 2GEYA 3DGLA 3K9MC 1QAFA 3JUOA 3NM2A 2KXGA 3X3XA 4AEQA 2W04A 1Q7Y4 2PZVA 1RCKA 1O7MB 1OF5B 1UUVB 2GEXA 3A76A 3KSED 4J8TA 1OCVA 2ZHXB 1B2MA 1VQO3 5AYRB 1BNRA 1LNIA 1D6YA 2O3OA 2CIUA 5CXOA 5M1AA 3CNMA 1RGFA 1BSCA 2INXA 1DYUA 3JUQA 3ECFA 1B3SA 1FUSA 2OOVA 5RNTA 1Q864 3OWUA 3KN4A 3ZG0A 3GZYB 4K1VA 1YGWA 2H0GA 1JB2A 2FGTA 3AMOA 1GMRA 2IY2A 3NBBA 1I8VA 3VGNA 2QA43 4WWUC 1DVDA 5D83A 2YFLB 1RMSA 1T2IA 1B2UA 1KSIA 2KF4A 2XGNA 5FGOA 3S27A 3NQZA 2R4IA 2FXTA 1IQXA 1BRNL 4FCMA 2RSXA 3FG1A 3JUMA 4L7KA 3WOEB 3X40A 4NPBA 4N6TA 3HK4A 4R9LA 2OTL3 2CKFB 3WA2X 4GL6A 2H0HA 4FMCA 3V92A 1AR0A 4FMBA 1BNFA 1EUIC 5HOHA 1I2GA 2GXFA 4K90B 1GOYA 2A15A 1JBSA 3HIGA 4RZMA 1BU4A 1UUGB 2CC3A 4NHFA 1VQ53 4NREA 2YFJB 1W2ZA 3F40A 4EYCA 3KIIA 4J5GA 1T2HA 2JQ5A 3UB1A 4KFDA 2B24B 1D6UA 3D79A 3AMOB 5ELUA 3FH1A 1TRQA 4GHOA 3CCV3 2WGOA 1BIRA 1Q9EA 5IERA 3STDA 1I3FA 1BRSA 4IPBA 5IEPA 1NB3I 1RGLA 4I5QA 5M18A 3KFQC 1QAKA 3FLJA 3NX0A 2KF6A 3LYGA 1RRHA 1UCKA 1JB4A 4O8SA 2YFIB 2Z7AA 3TDGA 1K28A 2STDA 3DXOA 3BLZA 5BVBA 1GMQA 3EN8A 4KT3B 1V58A 2HMLB 1BUJA 1OHPA 1IDPA 1Q40A 2HMOB 1X1WA 1IQYA 1DE3A 3GZBA 1YVSA 2SBLA 1EKMA 5STDA 1W5ZA 3MG2A 1Z1SA 1RGEA 2P38A 3CD63 2HMNB 3LTDA 4DKIA 4HKVB 3F8HA 3FF2A 3EHCA
chains in the Genus database with same CATH topology
1TFOA 4WYKA 3U97A 2O9UX 1STFI 3T0UA 1US1A 1JKGA 1JN5A 3I0YA 1A2VA 5AEUB 1LNHA 3M8CA 1ULIB 4HM6B 1K9M4 4Q53A 1QJGA 3V98A 4LMIA 4CDLA 4AKZA 2OTJ3 3LXUX 4LGQA 1YVBI 1Q814 1IV9A 4K1UA 3WDGB 3G0KA 4X2OA 2QGUA 3SOAA 2XFTA 2OQEA 5EQLA 1MOLA 1YGEA 3LH4A 1L5GB 2HMKB 3UL6A 3SLUA 3H3HA 2RFRA 1G96A 3DY5A 3ALAA 2KRTA 3LTBA 3LTCA 3F7SA 4IIAA 1OF5A 1UW1A 3MHEA 1W4NA 3N8BA 1JB5A 4OVMA 4N6MA 4HM5B 1LVNA 1VQP3 2XR8B 4HM8B 4BTXA 3DZLA 1GY6A 3HZPA 3F8XA 5BXQA 5A0OB 1TFKA 1ULJB 1DMNA 2IA7A 4MMXB 3T8UA 5LC6A 1IV7A 5I97A 1VQ63 1TP6A 2W6JH 4FMAA 4L8OA 1JKGB 3DMCA 4R9KA 1JJ22 3FGYA 1VQ83 1VQN3 5AIIA 4HM2B 1PU4A 3DM8A 1RN7A 3VF1A 3J7Yd 3KE7A 1W2B2 3PYJA 1GD4A 1A2KA 3D9RA 2MC8A 4HM0B 3CPW2 1WMPA 3KSPA 1WMOA 2CFWA 1YHQ3 1Y4KA 3ER7A 5IEOA 4RNZA 5D82A 1IT8A 3SXXA 3CCE3 1AVKA 3NBRA 1C7HA 3CXC2 2W03A 4KVHA 4N6UA 1O7NB 4H3UA 3BB9A 3CCR3 4XBTA 3K63A 3ROBA 3CPOA 1GS3A 3L0RA 3LOYA 3S5CA 2OWPA 1K41A 4HZBB 1NO3A 1DMQA 5KP3A 1QVF2 3D3LA 4FCJA 1RRLA 1S5AA 2OOVC 3BNDA 5CLKA 4XDVA 4HYZA 4R4KA 2Z77A 1YJ93 5HGRA 6STDA 1CQSA 1R4CA 4GB5A 4LZIA 5KP4A 4G1MB 1VQ43 4R80A 3LTAA 2E2VA 1OPYA 3PXMA 3SEDA 1AVLA 3IPTA 4STDA 2KCDA 2IMJA 4LEHA 4WP5A 4EV2A 1N9EA 2BMOB 1J2BA 1FGRA 3OWYA 3CME3 1YJN3 1SQWA 1W6GA 4RBNA 1LOXA 3V99A 3JUNA 1ZO2A 3F14A 1DVCA 1N9JA 1SJWA 2K0MA 2Q07A 2B1XB 1HU9A 2V1LA 2W9QA 5AYSC 1IU7A 2RCDA 3GWRA 3QRDA 4U13A 2GBXB 3NUVA 2XFSA 2ZL8A 4XB5A 1FGOA 3GRDA 1AV4A 1TUHA 2CH9A 3I553 1WQLB 1FA3A 1OGZA 2F98A 2UX0A 3F7XA 3O8YA 2RGQA 4MEIA 4N6OB 1NJI4 1SIIA 4EC6A 4XM4A 1DMMA 2F99A 2QIYA 5AEWB 1QMAA 4K61A 2XGLA 2W56A 1OGXA 3X3ZA 3Q90A 3G713 4N6NB 4WFOA 2P05A 1T5YA 2D42A 1ROVA 5KP1A 1YJW3 1WTHA 3S67A 1O7HB 4EV5A 1OACA 4BTWA 4TX4A 1EA2A 3JUPA 5IG3A 4L8PA 2PNCA 1WNHA 2Z76A 5CF2A 3MYTA 1W6CA 2ZDJA 3LZAA 3CCL3 3EF8A 2D1WA 4KFEA 5AI1A 4HM3B 1E3RA 2CWVA 2LYXA 3KKGA 3CC73 2XF3A 4N3VA 3U1WA 2BMQB 2L4VA 4EXRA 3FG4A 3JVCA 3K5TA 2W56B 3UJMA 2OQEC 4MMZB 1O7WB 1SIHA 2C11A 4JRFA 4FR9A 1KWIA 3X3YA 4BTYA 3G4S3 1W6YA 3DGMA 2P09A 3RGAA 2GBWB 1RJOA 1CEWI 1UUWB 4HM7B 5DREA 5JPPA 1KQS2 1WMNA 3EN1B 2W2CA 2W9PA 1U5OA 3MG1A 3CMA3 1E97A 3CNXA 2E2TA 1KC84 3NHXA 3CU3A 1OHSA 2CG1A 1IVWA 2GU3A 4MMYB 1VQ93 3BNEA 1YI23 3FF0A 3NBJA 2WGQA 2LQVA 1VQ73 2CHCA 3PS8A 3UNLA 1GYBA 5IF6A 3GAXA 1JV2B 3B4OA 3PCRA 4O2HA 1OUNA 2IUJA 3WOFB 3S29A 3WMDA 1YIJ3 3CCM3 1FGTA 2HMJB 2JDIH 3FSDA 1M1K4 2CFGA 1N8QA 2E2UA 2GU1A 3BNCA 1IK3A 1RKYA 1BUQA 1U8CB 1ZX2A 1VQK3 5EEOA 3I563 4AKYA 2XSHB 3FZWA 3EE1A 1E3VA 2CWUA 1OH0A 3BNBA 1TIJA 4J9AA 5TGNA 5EVHA 2I9WA 2XSOB 4WHAA 1GY7A 2YX9A 5D81A 4KFFA 4RNYA 1M904 3PGBA 3T8NA 1IQ8A 4KZ1A 1S723 3E99A 3HI7A 3G8ZA 1FGQA 2BNGA 2WOFA 2CFLA 4H61A 4IT7A 3GZRA 3HIIA 3IMAB 3DUKA 2M7OA 3WA3A 5LC7A 3NM7A 4FMDA 1ISKA 1HKXA 3FKAA 4HBRA 1K734 1M9GA 1GD3A 1IVUA 3CCJ3 3KZTA 3MWZA 3X41A 2BT3A 3B8LA 3DGOA 4EBGA 3CC23 2WOHA 4ORLA 1UI8A 1KD14 3EBYA 2P0XA 2CFKA 5CK6A 3SOYA 3G6E3 5FW5A 1VQM3 3B7CA 1M1XB 4N6LA 1PFPA 4R1KA 3B4PA 5AIHA 4OUQA 1FGMA 2BO9B 3NV0A 3EBTA 3EQQB 3DGNA 3PCSA 1W01A 5IG0A 2K54A 1V74A 1D6ZA 2XEPA 3OWSA 3LT8A 1CYUA 2C10A 4O3VA 4HM4B 1OHOA 2Y74A 1QVG2 1W02A 5ELJA 3OW22 2W0QA 4N6V0 1A67A 1W00A 2XRXB 4HZ9B 2CW9A 3QK9A 3SVAA 1ROAA 2CK3H 8CHOA 1A90A 3OV4A 1GY5A 1O7PB 3K0ZA 4XBXA 5JBSA 4HM1B 3CC43 2FNQA 4FCZA 3EJVA 4XDWA 4XBYA 3PZWA 3UL5A 3EC9A 3K7CA 2CFDA 4HJLB 2BHMA 4LSOA 2CWTA 4JF8A 3OXAA 2MF7A 4ZM8A 1IVXA 2ML6A 3LMLA 3SX1A 3NV0B 3OX9A 1MNLA 5AIGA 1QALA 2XH9A 2Y73A 3CCS3 1LXEA 3H51A 3Q1CA 3IJEB 3MKIA 3CCQ3 1N5PA 5IW9A 3FCSB 3S28A 1FUWA 2WO0A 1EG9B 3HX8A 1ASKA 2OCTA 3MSOA 5AIFA 1SPUA 1F8NA 1N8R4 1O7GB 3FG3A 4I4KA 4HVNA 4O02B 3X42A 1UI7A 2F86B 2HMMB 3LT9A 5IG5A 2QEX3 1JNQA 2BMRB 3EB8A 5IG4A 1NB5I 3NQYA 1Q40B 1IT7A 2ML5A 3G16A 4OK0A 2P0MA 5G2GA 3N54B 1NU3A 3GZXB 1NDOB 4X2HA 3F9SA 2CG0A 1TU5A 4PEJA 3RGRA 3N9HA 3RDEA 5JPUA 3MG3A 3WODG 3CCU3 1K8A4 3NXJA 7STDA 1YIT3 4WYKB 4MJDA 1Q824 1JN5B 3MPHA 1STDA 4QWTA 1CYVA 2IUKA 2Z6BA 1VQL3 1W7CA 3Q2PA 4CCVA 1N5HA 1NWWA 1Q42A 1VZZA 1IVVA 5DRVA 5IENA 1EQKA 5CF1A 1JRQA 3VSYA 3EX9A 2GEYA 3DGLA 3K9MC 1QAFA 3JUOA 3NM2A 2KXGA 3X3XA 4AEQA 2W04A 1Q7Y4 2PZVA 1O7MB 1OF5B 1UUVB 2GEXA 3A76A 3KSED 4J8TA 1OCVA 1VQO3 5AYRB 1D6YA 2O3OA 2CIUA 5CXOA 3CNMA 2INXA 1DYUA 3JUQA 3ECFA 2OOVA 1Q864 3OWUA 3KN4A 3GZYB 4K1VA 1JB2A 2FGTA 3AMOA 3VGNA 3NBBA 2QA43 4WWUC 1DVDA 5D83A 2YFLB 1KSIA 2XGNA 3S27A 5FGOA 3NQZA 2R4IA 2FXTA 1IQXA 4FCMA 2RSXA 3FG1A 3JUMA 4L7KA 3WOEB 3X40A 4N6TA 3HK4A 4R9LA 2OTL3 2CKFB 3WA2X 4GL6A 4FMCA 3V92A 1AR0A 4FMBA 2GXFA 4K90B 2A15A 3HIGA 4RZMA 2CC3A 4NHFA 1VQ53 4NREA 2YFJB 1W2ZA 3F40A 4EYCA 3KIIA 2JQ5A 3UB1A 4KFDA 2B24B 1D6UA 3AMOB 5ELUA 3FH1A 3CCV3 2WGOA 5IERA 3STDA 4IPBA 5IEPA 1NB3I 3KFQC 1QAKA 3FLJA 3NX0A 3LYGA 1RRHA 1JB4A 4O8SA 2YFIB 2Z7AA 3TDGA 1K28A 2STDA 3DXOA 3BLZA 5BVBA 3EN8A 2HMLB 1OHPA 2HMOB 1IDPA 1Q40A 1IQYA 3GZBA 2SBLA 1EKMA 5STDA 1W5ZA 3MG2A 1Z1SA 2P38A 3CD63 2HMNB 3LTDA 4HKVB 3F8HA 3FF2A 3EHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRD A;  2O9U X;  1STF I;  1TIJ A;  2CH9 A;  1FA3 A;  4N6O B;  1YVB I;  1IV9 A;  1CYV A;  4IT7 A;  5EQL A;  1MOL A;  3Q2P A;  4CCV A;  3LH4 A;  1N5H A;  3UL6 A;  3IMA B;  4N6N B;  1G96 A;  1EQK A;  5LC7 A;  4N6M A;  3S67 A;  3K9M C;  2KXG A;  1M9G A;  1GD3 A;  4TX4 A;  3MWZ A;  3KSE D;  5A0O B;  1WNH A;  5LC6 A;  1IV7 A;  4N6L A;  1RN7 A;  1PFP A;  3PYJ A;  1GD4 A;  2BO9 B;  1DVD A;  1CYU A;  1KWI A;  4N6T A;  5ELJ A;  4N6U A;  4N6V 0;  1A67 A;  3SVA A;  1ROA A;  1CEW I;  1A90 A;  3L0R A;  2W9P A;  3UL5 A;  4EYC A;  5ELU A;  4ZM8 A;  1MNL A;  1R4C A;  1LXE A;  4LZI A;  3PS8 A;  3PXM A;  1NB3 I;  1N5P A;  3GAX A;  3KFQ C;  1FUW A;  3NX0 A;  2OCT A;  1NB5 I;  1DVC A;  1N9J A;  2W9Q A; 
#chains in the Genus database with same CATH topology
 1TFO A;  4WYK A;  3U97 A;  2O9U X;  1STF I;  3T0U A;  1US1 A;  1JKG A;  1JN5 A;  3I0Y A;  6GSP A;  1A2V A;  2F5M A;  5AEU B;  1LNH A;  3M8C A;  1ULI B;  3KCH A;  4HM6 B;  2KAA A;  1BRJ A;  1BRK A;  4Q53 A;  1QJG A;  3V98 A;  4LMI A;  4CDL A;  1K9M 4;  4AKZ A;  2OTJ 3;  3LXU X;  4LGQ A;  1YVB I;  1Q81 4;  1IV9 A;  4K1U A;  3WDG B;  3G0K A;  4X2O A;  2QGU A;  3SOA A;  2XFT A;  2OQE A;  1I3I A;  5EQL A;  1MOL A;  1YGE A;  3LH4 A;  1AQZ A;  1UGH I;  2HMK B;  1L5G B;  3SLU A;  3H3H A;  2RFR A;  1G96 A;  3DY5 A;  3ALA A;  2KRT A;  3LTB A;  3LTC A;  3F7S A;  4IIA A;  1OF5 A;  1UW1 A;  3MHE A;  1W4N A;  3N8B A;  1JB5 A;  4OVM A;  4N6M A;  4HM5 B;  1LVN A;  1VQP 3;  1JBR A;  2XR8 B;  4HM8 B;  4BTX A;  3DZL A;  1GY6 A;  2K3D A;  3HZP A;  3F8X A;  5BXQ A;  5A0O B;  1TFK A;  1ULJ B;  1DMN A;  1MGW A;  2IA7 A;  4GSP A;  4MMX B;  3T8U A;  3GSP A;  5LC6 A;  1IV7 A;  5I97 A;  1VQ6 3;  1TP6 A;  2W6J H;  4FMA A;  4L8O A;  1JKG B;  3DMC A;  4R9K A;  1JJ2 2;  3FGY A;  1VQ8 3;  1VQN 3;  5AII A;  4HM2 B;  1PU4 A;  3DM8 A;  1B2Z A;  1BGS A;  1RN7 A;  3VF1 A;  3J7Y d;  3KE7 A;  1W2B 2;  3ZFZ A;  3PYJ A;  1GD4 A;  2KF5 A;  5GSP A;  1A2K A;  3D9R A;  2MC8 A;  1RGA A;  4HM0 B;  3CPW 2;  1WMP A;  3KSP A;  1WMO A;  2CFW A;  1YHQ 3;  1ZS7 A;  1MWS A;  1Y4K A;  3ER7 A;  3ZG5 A;  5IEO A;  4RNZ A;  5D82 A;  1IT8 A;  3SXX A;  3CCE 3;  1AVK A;  3NBR A;  1C7H A;  3CXC 2;  4HAA A;  2W03 A;  4KVH A;  4N6U A;  1O7N B;  4H3U A;  1FZU A;  1SAR A;  8RNT A;  3BB9 A;  2F4Y A;  3CCR 3;  4XBT A;  3K63 A;  3ROB A;  3CPO A;  1GS3 A;  3L0R A;  3LOY A;  3S5C A;  2OWP A;  1K41 A;  4HZB B;  1NO3 A;  3BU4 A;  1DMQ A;  1RDS A;  5KP3 A;  1QVF 2;  2HOH A;  3D3L A;  4FCJ A;  1RRL A;  3AGO A;  7GSP A;  1S5A A;  2OOV C;  3BND A;  5CLK A;  4XDV A;  1GOU A;  4HYZ A;  4R4K A;  1RN1 A;  2Z77 A;  4ILF A;  1YJ9 3;  5HGR A;  6STD A;  1CQS A;  1R4C A;  2L1S A;  4GB5 A;  4LZI A;  5KP4 A;  4G1M B;  1DET A;  1BNS A;  3LTA A;  2E2V A;  1OPY A;  3PXM A;  4R80 A;  1VQ4 3;  3SED A;  1AVL A;  2C4B A;  3IPT A;  2KCD A;  4STD A;  2IMJ A;  4LEH A;  4WP5 A;  4EV2 A;  1N9E A;  2BMO B;  1MWU A;  1I0V A;  1RGG A;  1J2B A;  1IYY A;  1FGR A;  3OWY A;  1HYF A;  3CME 3;  1YJN 3;  1SQW A;  3WHO A;  2AAD A;  2F56 A;  1W6G A;  4RBN A;  2SAR A;  1LOX A;  3V99 A;  1EEJ A;  3JUN A;  1ZO2 A;  3F14 A;  1DVC A;  1N9J A;  1SJW A;  2K0M A;  2Q07 A;  2B1X B;  1ZGX A;  1HU9 A;  1VQQ A;  2V1L A;  2W9Q A;  2RNT A;  5AYS C;  1C54 A;  1BSE A;  1IU7 A;  2RCD A;  3GWR A;  3QRD A;  4U13 A;  1B2X A;  2GBX B;  2XFS A;  2ZL8 A;  3NUV A;  4XB5 A;  1FGO A;  1TRP A;  3GRD A;  1AV4 A;  1TUH A;  1GMP A;  2CH9 A;  1AY7 A;  2UUG C;  1WQL B;  3I55 3;  1FA3 A;  1OGZ A;  2F98 A;  1YNV X;  2UX0 A;  3F7X A;  3O8Y A;  2RGQ A;  4MEI A;  4N6O B;  1V57 A;  1BSD A;  1RHL A;  1NJI 4;  1SII A;  4EC6 A;  4XM4 A;  1DMM A;  2F99 A;  2QIY A;  5AEW B;  1QMA A;  2H0I A;  4K61 A;  1RGC A;  2W56 A;  1OGX A;  2XGL A;  3Q90 A;  3X3Z A;  3G71 3;  1B2S A;  2CX1 A;  4N6N B;  4WFO A;  3UL6 A;  2P05 A;  1T5Y A;  2D42 A;  1ROV A;  5KP1 A;  1YJW 3;  1WTH A;  3S67 A;  1O7H B;  4EV5 A;  1LRA A;  1MGR A;  1OAC A;  4BTW A;  1RSN A;  4TX4 A;  1BSB A;  1EA2 A;  3JUP A;  5IG3 A;  4L8P A;  2BIR A;  2PNC A;  1WNH A;  2Z76 A;  5CF2 A;  3MYT A;  1LOW A;  1W6C A;  2ZDJ A;  3LZA A;  3CCL 3;  3EF8 A;  2D1W A;  4KFE A;  5AI1 A;  4HM3 B;  1E3R A;  2CWV A;  1JZO A;  2LYX A;  3KKG A;  3CC7 3;  2XF3 A;  1BAN A;  1RTU A;  4N3V A;  3U1W A;  2BMQ B;  2L4V A;  2KF3 A;  4EXR A;  3RNT A;  4BL2 A;  3FG4 A;  3JVC A;  3K5T A;  2W56 B;  3UJM A;  2OQE C;  4MMZ B;  5BIR A;  1O7W B;  1SIH A;  2C11 A;  1A2P A;  4FR9 A;  4JRF A;  1KWI A;  1I2E A;  3X3Y A;  4BTY A;  3G4S 3;  1W6Y A;  5G1K A;  3DGM A;  2P09 A;  3RGA A;  2GBW B;  1BOX A;  1TJD A;  1RJO A;  1CEW I;  1UUW B;  4HM7 B;  5DRE A;  5JPP A;  1RCL A;  1WMN A;  1KQS 2;  3EN1 B;  2W2C A;  2W9P A;  1U5O A;  1FUT A;  1CH0 A;  3MG1 A;  3CMA 3;  6RNT A;  1E97 A;  3CNX A;  2E2T A;  1KC8 4;  3NHX A;  3CU3 A;  1OHS A;  2CG1 A;  1BVI A;  1IVW A;  1X1Y A;  2GU3 A;  3WR2 A;  4MMY B;  3SYU A;  1VQ9 3;  3BNE A;  3AHW A;  1YI2 3;  1JZD A;  3FF0 A;  5M19 A;  3NBJ A;  2WGQ A;  1RLS A;  3D4A A;  2LQV A;  3URP A;  1VQ7 3;  2CHC A;  3PS8 A;  3UNL A;  1GYB A;  5IF6 A;  3GAX A;  1JV2 B;  3B4O A;  3PCR A;  4O2H A;  1JBT A;  1B20 A;  1OUN A;  4RNT A;  2IUJ A;  3WOF B;  3S29 A;  3WMD A;  1YIJ 3;  1UCJ A;  3CCM 3;  1FGT A;  2HMJ B;  3DH2 A;  2JDI H;  3FSD A;  1M1K 4;  2CFG A;  1N8Q A;  2E2U A;  2GU1 A;  3BNC A;  1IK3 A;  1RKY A;  1BUQ A;  1U8C B;  1ZX2 A;  1RGK A;  5EEO A;  3I56 3;  4AKY A;  1VQK 3;  2XSH B;  3Q3F A;  3FZW A;  3EE1 A;  1E3V A;  2CWU A;  2F5W A;  1OH0 A;  3BNB A;  4BL3 A;  1TIJ A;  4J9A A;  5TGN A;  5EVH A;  2I9W A;  2XSO B;  4WHA A;  1GY7 A;  2YX9 A;  5D81 A;  4KFF A;  1I0X A;  4RNY A;  2R41 A;  1M90 4;  3PGB A;  3T8N A;  1R4Y A;  1IQ8 A;  4KZ1 A;  1S72 3;  3E99 A;  3HI7 A;  3G8Z A;  1I70 A;  1FGQ A;  2BNG A;  2WOF A;  1UCI A;  1LOY A;  2CFL A;  4H61 A;  4IT7 A;  3GZR A;  1RN4 A;  3HII A;  3IMA B;  3DUK A;  1PY3 A;  2M7O A;  3WA3 A;  5LC7 A;  3NM7 A;  1BNJ A;  4FMD A;  1BAO A;  2UGI A;  1ISK A;  1HKX A;  1BRG A;  3FKA A;  4HBR A;  1K73 4;  1M9G A;  1FW7 A;  1IVU A;  1GD3 A;  3CCJ 3;  1BNI A;  3KZT A;  1I2F A;  3MWZ A;  2BT3 A;  3X41 A;  3B8L A;  3DGO A;  4EBG A;  3CC2 3;  2WOH A;  4ORL A;  3D5G A;  1UI8 A;  5BU4 A;  1KD1 4;  3EBY A;  2P0X A;  2CFK A;  5CK6 A;  1NNV A;  3SOY A;  3DGY A;  3G6E 3;  5FW5 A;  3HOH A;  3B7C A;  1M1X B;  1VQM 3;  4N6L A;  1LQG C;  1PFP A;  4R1K A;  3B4P A;  5AIH A;  4OUQ A;  1LQM B;  5G1L A;  1FGM A;  2BO9 B;  3AHS A;  1UCL A;  3NV0 A;  3EBT A;  1MWR A;  3DGN A;  3EQQ B;  3PCS A;  1W01 A;  5IG0 A;  1BNG A;  1X1X A;  2K54 A;  1V74 A;  1D6Z A;  2XEP A;  3OWS A;  3LT8 A;  1CYU A;  2C10 A;  1PYL A;  4O3V A;  4HM4 B;  1OHO A;  2Y74 A;  1BRI A;  1QVG 2;  1W02 A;  5ELJ A;  1G02 A;  2J8X B;  2W0Q A;  3D5I A;  4N6V 0;  3OW2 2;  2IYJ A;  1W00 A;  9RNT A;  2XRX B;  4HZ9 B;  1A67 A;  2CW9 A;  3QK9 A;  3SVA A;  1ROA A;  2CK3 H;  8CHO A;  1A90 A;  3OV4 A;  1GOV A;  1BRH A;  1RNB A;  1GY5 A;  1UGI A;  1O7P B;  3K0Z A;  4XBX A;  4CPK A;  4HM1 B;  5JBS A;  3CC4 3;  2FNQ A;  4FCZ A;  3EJV A;  4XDW A;  4XBY A;  1G0T A;  1HZ1 A;  3PZW A;  1X1U A;  3EC9 A;  3K7C A;  3UL5 A;  2CFD A;  2ZA4 A;  2BHM A;  4HJL B;  4LSO A;  1BSA A;  2CWT A;  4JF8 A;  3OXA A;  2MF7 A;  1GSP A;  1IVX A;  2BU4 A;  2ML6 A;  3LML A;  3SX1 A;  4ZM8 A;  3NV0 B;  3OX9 A;  1MNL A;  5AIG A;  1QAL A;  2XH9 A;  2Y73 A;  3CCS 3;  1LXE A;  3H51 A;  1UDI I;  2CX0 A;  3Q1C A;  3IJE B;  3MKI A;  3CCQ 3;  1MWT A;  1N5P A;  5IW9 A;  3FCS B;  3S28 A;  1FUW A;  2WO0 A;  1EG9 B;  3HX8 A;  1ASK A;  1RNT A;  2OCT A;  3MSO A;  4BU4 A;  5AIF A;  1SPU A;  3BIR A;  1F8N A;  1N8R 4;  1O7G B;  3FG3 A;  1FYS A;  4I4K A;  2RBI A;  4HVN A;  4O02 B;  3X42 A;  1UI7 A;  2F86 B;  2HMM B;  3LT9 A;  4EW5 A;  5IG5 A;  1JNQ A;  2QEX 3;  2BMR B;  4BIR A;  3EB8 A;  5IG4 A;  1NB5 I;  1B21 A;  3NQY A;  1Q40 B;  1LOV A;  1BNE A;  1IT7 A;  2ML5 A;  1Q7H A;  3G16 A;  2P0M A;  4OK0 A;  5G2G A;  3N54 B;  1NU3 A;  3GZX B;  1NDO B;  3AGN A;  1TTO A;  4X2H A;  3F9S A;  2CG0 A;  1TU5 A;  4PEJ A;  1T3B A;  7RNT A;  3RGR A;  3N9H A;  3RDE A;  5JPU A;  3MG3 A;  3WOD G;  3CCU 3;  1K8A 4;  3A5E A;  3NXJ A;  7STD A;  1YIT 3;  4WYK B;  1B27 A;  4MJD A;  1Q82 4;  1JN5 B;  3MPH A;  1STD A;  1RGH A;  4QWT A;  1CYV A;  2IUK A;  4CJN A;  2Z6B A;  4HOH A;  1W7C A;  1VQL 3;  4J5K A;  3Q2P A;  4CCV A;  1N5H A;  1NWW A;  1Q42 A;  1VZZ A;  1IVV A;  5DRV A;  5IEN A;  2AAE A;  2GSP A;  1EQK A;  5CF1 A;  1JRQ A;  3VSY A;  3EX9 A;  4LYL B;  2GEY A;  3DGL A;  3K9M C;  1QAF A;  3JUO A;  3NM2 A;  2KXG A;  3X3X A;  4AEQ A;  2W04 A;  1Q7Y 4;  2PZV A;  1RCK A;  1O7M B;  1OF5 B;  1UUV B;  2GEX A;  3A76 A;  3KSE D;  4J8T A;  1OCV A;  2ZHX B;  1B2M A;  1VQO 3;  5AYR B;  1BNR A;  1LNI A;  1D6Y A;  2O3O A;  2CIU A;  5CXO A;  5M1A A;  3CNM A;  1RGF A;  1BSC A;  2INX A;  1DYU A;  3JUQ A;  3ECF A;  1B3S A;  1FUS A;  2OOV A;  5RNT A;  1Q86 4;  3OWU A;  3KN4 A;  3ZG0 A;  3GZY B;  4K1V A;  1YGW A;  2H0G A;  1JB2 A;  2FGT A;  3AMO A;  1GMR A;  2IY2 A;  3NBB A;  1I8V A;  3VGN A;  2QA4 3;  4WWU C;  1DVD A;  5D83 A;  2YFL B;  1RMS A;  1T2I A;  1B2U A;  1KSI A;  2KF4 A;  2XGN A;  5FGO A;  3S27 A;  3NQZ A;  2R4I A;  2FXT A;  1IQX A;  1BRN L;  4FCM A;  2RSX A;  3FG1 A;  3JUM A;  4L7K A;  3WOE B;  3X40 A;  4NPB A;  4N6T A;  3HK4 A;  4R9L A;  2OTL 3;  2CKF B;  3WA2 X;  4GL6 A;  2H0H A;  4FMC A;  3V92 A;  1AR0 A;  4FMB A;  1BNF A;  1EUI C;  5HOH A;  1I2G A;  2GXF A;  4K90 B;  1GOY A;  2A15 A;  1JBS A;  3HIG A;  4RZM A;  1BU4 A;  1UUG B;  2CC3 A;  4NHF A;  1VQ5 3;  4NRE A;  2YFJ B;  1W2Z A;  3F40 A;  4EYC A;  3KII A;  4J5G A;  1T2H A;  2JQ5 A;  3UB1 A;  4KFD A;  2B24 B;  1D6U A;  3D79 A;  3AMO B;  5ELU A;  3FH1 A;  1TRQ A;  4GHO A;  3CCV 3;  2WGO A;  1BIR A;  1Q9E A;  5IER A;  3STD A;  1I3F A;  1BRS A;  4IPB A;  5IEP A;  1NB3 I;  1RGL A;  4I5Q A;  5M18 A;  3KFQ C;  1QAK A;  3FLJ A;  3NX0 A;  2KF6 A;  3LYG A;  1RRH A;  1UCK A;  1JB4 A;  4O8S A;  2YFI B;  2Z7A A;  3TDG A;  1K28 A;  2STD A;  3DXO A;  3BLZ A;  5BVB A;  1GMQ A;  3EN8 A;  4KT3 B;  1V58 A;  2HML B;  1BUJ A;  1OHP A;  1IDP A;  1Q40 A;  2HMO B;  1X1W A;  1IQY A;  1DE3 A;  3GZB A;  1YVS A;  2SBL A;  1EKM A;  5STD A;  1W5Z A;  3MG2 A;  1Z1S A;  1RGE A;  2P38 A;  3CD6 3;  2HMN B;  3LTD A;  4DKI A;  4HKV B;  3F8H A;  3FF2 A;  3EHC A; 
#chains in the Genus database with same CATH homology
 1TFO A;  4WYK A;  3U97 A;  2O9U X;  1STF I;  3T0U A;  1US1 A;  1JKG A;  1JN5 A;  3I0Y A;  1A2V A;  5AEU B;  1LNH A;  3M8C A;  1ULI B;  4HM6 B;  1K9M 4;  4Q53 A;  1QJG A;  3V98 A;  4LMI A;  4CDL A;  4AKZ A;  2OTJ 3;  3LXU X;  4LGQ A;  1YVB I;  1Q81 4;  1IV9 A;  4K1U A;  3WDG B;  3G0K A;  4X2O A;  2QGU A;  3SOA A;  2XFT A;  2OQE A;  5EQL A;  1MOL A;  1YGE A;  3LH4 A;  1L5G B;  2HMK B;  3UL6 A;  3SLU A;  3H3H A;  2RFR A;  1G96 A;  3DY5 A;  3ALA A;  2KRT A;  3LTB A;  3LTC A;  3F7S A;  4IIA A;  1OF5 A;  1UW1 A;  3MHE A;  1W4N A;  3N8B A;  1JB5 A;  4OVM A;  4N6M A;  4HM5 B;  1LVN A;  1VQP 3;  2XR8 B;  4HM8 B;  4BTX A;  3DZL A;  1GY6 A;  3HZP A;  3F8X A;  5BXQ A;  5A0O B;  1TFK A;  1ULJ B;  1DMN A;  2IA7 A;  4MMX B;  3T8U A;  5LC6 A;  1IV7 A;  5I97 A;  1VQ6 3;  1TP6 A;  2W6J H;  4FMA A;  4L8O A;  1JKG B;  3DMC A;  4R9K A;  1JJ2 2;  3FGY A;  1VQ8 3;  1VQN 3;  5AII A;  4HM2 B;  1PU4 A;  3DM8 A;  1RN7 A;  3VF1 A;  3J7Y d;  3KE7 A;  1W2B 2;  3PYJ A;  1GD4 A;  1A2K A;  3D9R A;  2MC8 A;  4HM0 B;  3CPW 2;  1WMP A;  3KSP A;  1WMO A;  2CFW A;  1YHQ 3;  1Y4K A;  3ER7 A;  5IEO A;  4RNZ A;  5D82 A;  1IT8 A;  3SXX A;  3CCE 3;  1AVK A;  3NBR A;  1C7H A;  3CXC 2;  2W03 A;  4KVH A;  4N6U A;  1O7N B;  4H3U A;  3BB9 A;  3CCR 3;  4XBT A;  3K63 A;  3ROB A;  3CPO A;  1GS3 A;  3L0R A;  3LOY A;  3S5C A;  2OWP A;  1K41 A;  4HZB B;  1NO3 A;  1DMQ A;  5KP3 A;  1QVF 2;  3D3L A;  4FCJ A;  1RRL A;  1S5A A;  2OOV C;  3BND A;  5CLK A;  4XDV A;  4HYZ A;  4R4K A;  2Z77 A;  1YJ9 3;  5HGR A;  6STD A;  1CQS A;  1R4C A;  4GB5 A;  4LZI A;  5KP4 A;  4G1M B;  1VQ4 3;  4R80 A;  3LTA A;  2E2V A;  1OPY A;  3PXM A;  3SED A;  1AVL A;  3IPT A;  4STD A;  2KCD A;  2IMJ A;  4LEH A;  4WP5 A;  4EV2 A;  1N9E A;  2BMO B;  1J2B A;  1FGR A;  3OWY A;  3CME 3;  1YJN 3;  1SQW A;  1W6G A;  4RBN A;  1LOX A;  3V99 A;  3JUN A;  1ZO2 A;  3F14 A;  1DVC A;  1N9J A;  1SJW A;  2K0M A;  2Q07 A;  2B1X B;  1HU9 A;  2V1L A;  2W9Q A;  5AYS C;  1IU7 A;  2RCD A;  3GWR A;  3QRD A;  4U13 A;  2GBX B;  3NUV A;  2XFS A;  2ZL8 A;  4XB5 A;  1FGO A;  3GRD A;  1AV4 A;  1TUH A;  2CH9 A;  3I55 3;  1WQL B;  1FA3 A;  1OGZ A;  2F98 A;  2UX0 A;  3F7X A;  3O8Y A;  2RGQ A;  4MEI A;  4N6O B;  1NJI 4;  1SII A;  4EC6 A;  4XM4 A;  1DMM A;  2F99 A;  2QIY A;  5AEW B;  1QMA A;  4K61 A;  2XGL A;  2W56 A;  1OGX A;  3X3Z A;  3Q90 A;  3G71 3;  4N6N B;  4WFO A;  2P05 A;  1T5Y A;  2D42 A;  1ROV A;  5KP1 A;  1YJW 3;  1WTH A;  3S67 A;  1O7H B;  4EV5 A;  1OAC A;  4BTW A;  4TX4 A;  1EA2 A;  3JUP A;  5IG3 A;  4L8P A;  2PNC A;  1WNH A;  2Z76 A;  5CF2 A;  3MYT A;  1W6C A;  2ZDJ A;  3LZA A;  3CCL 3;  3EF8 A;  2D1W A;  4KFE A;  5AI1 A;  4HM3 B;  1E3R A;  2CWV A;  2LYX A;  3KKG A;  3CC7 3;  2XF3 A;  4N3V A;  3U1W A;  2BMQ B;  2L4V A;  4EXR A;  3FG4 A;  3JVC A;  3K5T A;  2W56 B;  3UJM A;  2OQE C;  4MMZ B;  1O7W B;  1SIH A;  2C11 A;  4JRF A;  4FR9 A;  1KWI A;  3X3Y A;  4BTY A;  3G4S 3;  1W6Y A;  3DGM A;  2P09 A;  3RGA A;  2GBW B;  1RJO A;  1CEW I;  1UUW B;  4HM7 B;  5DRE A;  5JPP A;  1KQS 2;  1WMN A;  3EN1 B;  2W2C A;  2W9P A;  1U5O A;  3MG1 A;  3CMA 3;  1E97 A;  3CNX A;  2E2T A;  1KC8 4;  3NHX A;  3CU3 A;  1OHS A;  2CG1 A;  1IVW A;  2GU3 A;  4MMY B;  1VQ9 3;  3BNE A;  1YI2 3;  3FF0 A;  3NBJ A;  2WGQ A;  2LQV A;  1VQ7 3;  2CHC A;  3PS8 A;  3UNL A;  1GYB A;  5IF6 A;  3GAX A;  1JV2 B;  3B4O A;  3PCR A;  4O2H A;  1OUN A;  2IUJ A;  3WOF B;  3S29 A;  3WMD A;  1YIJ 3;  3CCM 3;  1FGT A;  2HMJ B;  2JDI H;  3FSD A;  1M1K 4;  2CFG A;  1N8Q A;  2E2U A;  2GU1 A;  3BNC A;  1IK3 A;  1RKY A;  1BUQ A;  1U8C B;  1ZX2 A;  1VQK 3;  5EEO A;  3I56 3;  4AKY A;  2XSH B;  3FZW A;  3EE1 A;  1E3V A;  2CWU A;  1OH0 A;  3BNB A;  1TIJ A;  4J9A A;  5TGN A;  5EVH A;  2I9W A;  2XSO B;  4WHA A;  1GY7 A;  2YX9 A;  5D81 A;  4KFF A;  4RNY A;  1M90 4;  3PGB A;  3T8N A;  1IQ8 A;  4KZ1 A;  1S72 3;  3E99 A;  3HI7 A;  3G8Z A;  1FGQ A;  2BNG A;  2WOF A;  2CFL A;  4H61 A;  4IT7 A;  3GZR A;  3HII A;  3IMA B;  3DUK A;  2M7O A;  3WA3 A;  5LC7 A;  3NM7 A;  4FMD A;  1ISK A;  1HKX A;  3FKA A;  4HBR A;  1K73 4;  1M9G A;  1GD3 A;  1IVU A;  3CCJ 3;  3KZT A;  3MWZ A;  3X41 A;  2BT3 A;  3B8L A;  3DGO A;  4EBG A;  3CC2 3;  2WOH A;  4ORL A;  1UI8 A;  1KD1 4;  3EBY A;  2P0X A;  2CFK A;  5CK6 A;  3SOY A;  3G6E 3;  5FW5 A;  1VQM 3;  3B7C A;  1M1X B;  4N6L A;  1PFP A;  4R1K A;  3B4P A;  5AIH A;  4OUQ A;  1FGM A;  2BO9 B;  3NV0 A;  3EBT A;  3EQQ B;  3DGN A;  3PCS A;  1W01 A;  5IG0 A;  2K54 A;  1V74 A;  1D6Z A;  2XEP A;  3OWS A;  3LT8 A;  1CYU A;  2C10 A;  4O3V A;  4HM4 B;  1OHO A;  2Y74 A;  1QVG 2;  1W02 A;  5ELJ A;  3OW2 2;  2W0Q A;  4N6V 0;  1A67 A;  1W00 A;  2XRX B;  4HZ9 B;  2CW9 A;  3QK9 A;  3SVA A;  1ROA A;  2CK3 H;  8CHO A;  1A90 A;  3OV4 A;  1GY5 A;  1O7P B;  3K0Z A;  4XBX A;  5JBS A;  4HM1 B;  3CC4 3;  2FNQ A;  4FCZ A;  3EJV A;  4XDW A;  4XBY A;  3PZW A;  3UL5 A;  3EC9 A;  3K7C A;  2CFD A;  4HJL B;  2BHM A;  4LSO A;  2CWT A;  4JF8 A;  3OXA A;  2MF7 A;  4ZM8 A;  1IVX A;  2ML6 A;  3LML A;  3SX1 A;  3NV0 B;  3OX9 A;  1MNL A;  5AIG A;  1QAL A;  2XH9 A;  2Y73 A;  3CCS 3;  1LXE A;  3H51 A;  3Q1C A;  3IJE B;  3MKI A;  3CCQ 3;  1N5P A;  5IW9 A;  3FCS B;  3S28 A;  1FUW A;  2WO0 A;  1EG9 B;  3HX8 A;  1ASK A;  2OCT A;  3MSO A;  5AIF A;  1SPU A;  1F8N A;  1N8R 4;  1O7G B;  3FG3 A;  4I4K A;  4HVN A;  4O02 B;  3X42 A;  1UI7 A;  2F86 B;  2HMM B;  3LT9 A;  5IG5 A;  2QEX 3;  1JNQ A;  2BMR B;  3EB8 A;  5IG4 A;  1NB5 I;  3NQY A;  1Q40 B;  1IT7 A;  2ML5 A;  3G16 A;  4OK0 A;  2P0M A;  5G2G A;  3N54 B;  1NU3 A;  3GZX B;  1NDO B;  4X2H A;  3F9S A;  2CG0 A;  1TU5 A;  4PEJ A;  3RGR A;  3N9H A;  3RDE A;  5JPU A;  3MG3 A;  3WOD G;  3CCU 3;  1K8A 4;  3NXJ A;  7STD A;  1YIT 3;  4WYK B;  4MJD A;  1Q82 4;  1JN5 B;  3MPH A;  1STD A;  4QWT A;  1CYV A;  2IUK A;  2Z6B A;  1VQL 3;  1W7C A;  3Q2P A;  4CCV A;  1N5H A;  1NWW A;  1Q42 A;  1VZZ A;  1IVV A;  5DRV A;  5IEN A;  1EQK A;  5CF1 A;  1JRQ A;  3VSY A;  3EX9 A;  2GEY A;  3DGL A;  3K9M C;  1QAF A;  3JUO A;  3NM2 A;  2KXG A;  3X3X A;  4AEQ A;  2W04 A;  1Q7Y 4;  2PZV A;  1O7M B;  1OF5 B;  1UUV B;  2GEX A;  3A76 A;  3KSE D;  4J8T A;  1OCV A;  1VQO 3;  5AYR B;  1D6Y A;  2O3O A;  2CIU A;  5CXO A;  3CNM A;  2INX A;  1DYU A;  3JUQ A;  3ECF A;  2OOV A;  1Q86 4;  3OWU A;  3KN4 A;  3GZY B;  4K1V A;  1JB2 A;  2FGT A;  3AMO A;  3VGN A;  3NBB A;  2QA4 3;  4WWU C;  1DVD A;  5D83 A;  2YFL B;  1KSI A;  2XGN A;  3S27 A;  5FGO A;  3NQZ A;  2R4I A;  2FXT A;  1IQX A;  4FCM A;  2RSX A;  3FG1 A;  3JUM A;  4L7K A;  3WOE B;  3X40 A;  4N6T A;  3HK4 A;  4R9L A;  2OTL 3;  2CKF B;  3WA2 X;  4GL6 A;  4FMC A;  3V92 A;  1AR0 A;  4FMB A;  2GXF A;  4K90 B;  2A15 A;  3HIG A;  4RZM A;  2CC3 A;  4NHF A;  1VQ5 3;  4NRE A;  2YFJ B;  1W2Z A;  3F40 A;  4EYC A;  3KII A;  2JQ5 A;  3UB1 A;  4KFD A;  2B24 B;  1D6U A;  3AMO B;  5ELU A;  3FH1 A;  3CCV 3;  2WGO A;  5IER A;  3STD A;  4IPB A;  5IEP A;  1NB3 I;  3KFQ C;  1QAK A;  3FLJ A;  3NX0 A;  3LYG A;  1RRH A;  1JB4 A;  4O8S A;  2YFI B;  2Z7A A;  3TDG A;  1K28 A;  2STD A;  3DXO A;  3BLZ A;  5BVB A;  3EN8 A;  2HML B;  1OHP A;  2HMO B;  1IDP A;  1Q40 A;  1IQY A;  3GZB A;  2SBL A;  1EKM A;  5STD A;  1W5Z A;  3MG2 A;  1Z1S A;  2P38 A;  3CD6 3;  2HMN B;  3LTD A;  4HKV B;  3F8H A;  3FF2 A;  3EHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...