3MWZA

Crystal structure of the selenomethionine derivative of the l 22,47,100 m mutant of sialostatin l2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
MELALRGGYRERSNQDDPEYLEMAHYATSTWSAQQPGKTHFDTVVEVMKVETQTVAGTNYRLTLKVAESTCELTSTYNKDTCQANANAAQRTCTTVIYRNMQGEKSINSFECAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sialostatin L2
publication title The crystal structures of two salivary cystatins from the tick Ixodes scapularis and the effect of these inhibitors on the establishment of Borrelia burgdorferi infection in a murine model.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Hydrolase inhibitor
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3mwzA00
1ROAA 3MWZA 3KSED 1G96A 3LH4A 2BO9B 4N6OB 4CCVA 2O9UX 5LC6A 5A0OB 1RN7A 3IMAB 1PFPA 1CYUA 2W9QA 3KFQC 2W9PA 1N5PA 3PS8A 1STFI 1YVBI 1NB3I 4N6LA 1LXEA 3NX0A 1TIJA 5LC7A 1GD3A 4N6UA 3GAXA 3K9MC 3UL6A 3UL5A 4LZIA 1M9GA 3PYJA 1A67A 2CH9A 2KXGA 1FUWA 1CEWI 1DVDA 3QRDA 3L0RA 1CYVA 4TX4A 5ELUA 1WNHA 4N6TA 1MOLA 1N9JA 1N5HA 4EYCA 4N6MA 3PXMA 1IV9A 4N6NB 5ELJA 4N6V0 1FA3A 1GD4A 4IT7A 1NB5I 1KWIA 3S67A 1EQKA 1R4CA 5EQLA 1MNLA 1A90A 1DVCA 3SVAA 3Q2PA 1IV7A 4ZM8A 2OCTA
chains in the Genus database with same CATH superfamily
4FCMA 3LYGA 1O7GB 1Z1SA 4FR9A 1O7WB 2B24B 3OW22 4HM2B 2QIYA 3K63A 1GOUA 2BO9B 2GEYA 3G4S3 3WA3A 3EE1A 1B2XA 1UCIA 4J5KA 1CQSA 1M1XB 2BMOB 4FCZA 4OUQA 3RNTA 1TUHA 3PCSA 1EUIC 1U5OA 3HOHA 3N54B 4X2OA 4J8TA 1YJ93 1QVG2 3NHXA 8RNTA 4I5QA 1BRIA 1R4YA 5A0OB 3V92A 2IMJA 4CDLA 1JZDA 2BMRB 2XF3A 1BANA 2CFLA 3SX1A 2YFLB 2R41A 3SXXA 3SYUA 3X3XA 1JRQA 1SPUA 1Q40B 1YVBI 5JBSA 1IQ8A 1MGWA 1O7MB 1LXEA 3NX0A 3WR2A 1T2HA 2XSOB 2YFIB 1US1A 4N6UA 1O7NB 1GY5A 3GAXA 1QJGA 2IUJA 3UL5A 3UL6A 3LTDA 1Q7Y4 1UUVB 4KT3B 1Q42A 3GZXB 2Y74A 2GU3A 1OUNA 1TJDA 2XFTA 3A76A 5D81A 2W6JH 1RCLA 2QEX3 1FW7A 4FMAA 2ZA4A 2L4VA 1QVF2 3NQZA 3S28A 2XEPA 3FKAA 1W5ZA 1HZ1A 3D5GA 1NJI4 3D3LA 3QRDA 1W7CA 6GSPA 1M1K4 1G02A 1BAOA 1X1UA 2XRXB 5CF1A 2CWVA 2KF3A 1S5AA 1WNHA 1L5GB 5IG0A 1OF5A 1RN4A 1V74A 3F9SA 2FXTA 3NBJA 1IVWA 4BIRA 1UCJA 1X1WA 1QAKA 3LTCA 1E97A 5GSPA 1NWWA 1VQ83 2B1XB 2RGQA 3DZLA 4CJNA 2K0MA 3ER7A 3CCE3 1GY7A 1LVNA 3NQYA 4U13A 2OQEC 3MG1A 1BU4A 3PXMA 4XDWA 2V1LA 7RNTA 3KZTA 3VSYA 1RSNA 4QWTA 1JN5A 1OGXA 2W56B 1EKMA 2CFGA 4RZMA 4N3VA 5G1KA 5IENA 1A2VA 4L8PA 3D79A 3DGOA 4G1MB 2HMJB 1LOWA 3GZYB 5IG5A 1SIIA 1W00A 4AKZA 1I0VA 2ML6A 3F8XA 1VQK3 1VQ43 1N8QA 3LOYA 3H3HA 3T0UA 3TDGA 3CPW2 1MWRA 4H3UA 1LQGC 3LT9A 1BIRA 1AQZA 4R1KA 4R80A 1DVCA 1GOYA 1MWUA 2BU4A 3BLZA 4O8SA 3SVAA 4BL3A 1IK3A 1KD14 1C7HA 1WMOA 3Q1CA 2H0GA 4RNZA 5HOHA 1SARA 3AHSA 5IW9A 5JPPA 2WGQA 4O2HA 1ROVA 1JKGA 1IQXA 1A2KA 2CFKA 2CFWA 2ZL8A 4NHFA 1ISKA 3RDEA 1FGRA 4KFEA 3EQQB 3KSED 2F99A 2GEXA 1I8VA 5AEWB 3U97A 2CWTA 3BB9A 3CCQ3 3DGNA 3SLUA 2O9UX 3MG2A 1NNVA 2Z77A 3JUQA 4LYLB 5M19A 4LGQA 1FGTA 3K0ZA 3OX9A 1UCKA 1LOVA 3DM8A 4EV5A 4HJLB 1RGCA 1BRNL 5LC6A 6RNTA 4JRFA 4R4KA 1FUSA 4EC6A 1BNGA 1RN7A 3Q90A 2ZHXB 4BTXA 4STDA 3BIRA 2HMOB 1PFPA 2GSPA 2RCDA 1VQN3 1ZX2A 1GOVA 3KFQC 1RGGA 2CG1A 5IEPA 2W9PA 4K1UA 3CC43 3PS8A 1OHSA 1RHLA 5HGRA 2QGUA 3VGNA 1STFI 5BVBA 3EBYA 2O3OA 5FW5A 3VF1A 1JJ22 2XH9A 1GY6A 4J5GA 3X3ZA 1NB3I 1D6ZA 4N6LA 4EW5A 1BRSA 1TIJA 2AADA 2W0QA 1TTOA 3F7SA 3JUNA 4XB5A 3FCSB 1GD3A 1UDII 2P0XA 3OWYA 1W6GA 3GZRA 3FG3A 3EB8A 2Q07A 2GXFA 3ZG5A 1M9GA 1BOXA 3EHCA 3JUPA 3PYJA 3FG1A 3F14A 2KXGA 2CFDA 2P05A 3CU3A 1OH0A 5CXOA 2A15A 1ZO2A 2YFJB 4J9AA 3G8ZA 1RGEA 1NDOB 2SARA 3UB1A 5IEOA 1OACA 3B7CA 3N9HA 5FGOA 4HVNA 3S29A 1B2MA 2FNQA 4HOHA 3ROBA 3I563 2MF7A 1X1YA 4RNTA 1YJW3 1B27A 2RFRA 4N6TA 2RSXA 2CIUA 4EBGA 1B3SA 1BUQA 5AI1A 5EVHA 1DETA 1AVKA 3CPOA 4BU4A 3LTAA 1N5HA 1HYFA 2HOHA 2GU1A 2H0IA 2OOVC 3G0KA 1YGWA 1EA2A 5DREA 1K41A 1BGSA 3DXOA 4LSOA 4HM5B 1LNHA 4MJDA 5AIGA 1BNJA 2IY2A 2Z7AA 1W2ZA 2YX9A 2BT3A 2LQVA 3MSOA 4BTYA 1GMQA 3NV0A 1IVXA 4WFOA 3CCL3 1F8NA 3H51A 5AIFA 3CCR3 2CX0A 2W2CA 2P38A 2W04A 1K9M4 1FA3A 4IT7A 1BSEA 1IVVA 1NU3A 4HAAA 3WA2X 1T3BA 4WYKA 4MMXB 3UJMA 3K7CA 4HZ9B 3X42A 1I0XA 1JKGB 1I2EA 1UI8A 2BIRA 1Q824 1I70A 2RBIA 1YJN3 5D82A 1KQS2 3HIIA 5EQLA 2STDA 1UGHI 3U1WA 1DMNA 3AHWA 3ECFA 3SEDA 1RGAA 1RNTA 3RGRA 3BNDA 1RRHA 1DE3A 1O7PB 1I3IA 1BRKA 2KF5A 3KCHA 1N8R4 1VQQA 2HMMB 1ZGXA 1SQWA 1GYBA 1N9EA 1BSAA 3I0YA 3WOEB 2Y73A 2ZDJA 1E3VA 1EG9B 2OTL3 1PU4A 3GWRA 1MGRA 3MWZA 1PYLA 3HZPA 4AKYA 2CKFB 1BUJA 1E3RA 1FGOA 4RNYA 3ZFZA 5G1LA 1ULJB 1UUGB 4LEHA 1RGHA 5CK6A 2HMNB 3BU4A 4JF8A 3OWSA 1QALA 4HM0B 1I2FA 2J8XB 1IT7A 1Y4KA 1HU9A 3EJVA 1OGZA 3J7Yd 3K5TA 4AEQA 3OWUA 3MPHA 1W02A 2Z6BA 2C4BA 3LXUX 3GSPA 3F40A 4MMZB 1YIT3 1K8A4 1UCLA 3CNMA 2E2VA 3AGNA 1B2ZA 3FZWA 2W03A 1JBTA 4K90B 3B8LA 2WOHA 3EC9A 4GSPA 3CCJ3 1VQL3 1N5PA 4GB5A 5AYRB 2E2TA 1BRJA 2R4IA 3NBRA 1T2IA 3MG3A 5AIHA 2OQEA 1QAFA 1B20A 1B2SA 3EN8A 1U8CB 3JUOA 1JZOA 1JB4A 2F56A 3NM2A 1AR0A 3PGBA 2BHMA 3K9MC 3HIGA 4LZIA 3STDA 2WGOA 2CH9A 3MKIA 5KP3A 1FUWA 2CW9A 1D6YA 4HM1B 1DVDA 1DYUA 1IT8A 2GBWB 1SIHA 3DY5A 1OCVA 2CWUA 3FLJA 3ZG0A 3CC73 1CH0A 1IDPA 5KP4A 1SJWA 4K61A 2KRTA 3EBTA 1WMNA 3WHOA 1TFKA 2L1SA 4HKVB 3NXJA 5BXQA 1LRAA 2CG0A 1PY3A 1GS3A 1K734 1ASKA 1BNFA 1MOLA 1BRGA 1D6UA 1K28A 1N9JA 1VZZA 1VQ93 1DMMA 3NV0B 3BNBA 4HM6B 1GSPA 2CC3A 4IPBA 1M904 3NUVA 3PZWA 1RRLA 4N6MA 3M8CA 3G16A 1VQM3 1WQLB 2CHCA 2KF4A 1V58A 4DKIA 3MHEA 1OF5B 1IV9A 1FGQA 4WHAA 4KVHA 4WP5A 4N6NB 3KSPA 1YIJ3 2WOFA 1GMPA 2XFSA 3AMOA 2UGIA 4LMIA 2I9WA 4ILFA 1BSDA 4N6V0 4ORLA 2K54A 5M18A 1JBSA 5DRVA 1W2B2 4MMYB 1NB5I 1KWIA 3LZAA 5TGNA 9RNTA 3RGAA 1EEJA 3JVCA 3G713 1TRQA 1AVLA 2F5WA 3SOYA 1BRHA 1Q814 3ALAA 3GRDA 1Q864 1J2BA 1JN5B 1JB2A 3OV4A 4XDVA 1O7HB 1IYYA 1VQ53 3DMCA 5I97A 1ZS7A 3WODG 4K1VA 2E2UA 1RGKA 3DH2A 1YNVX 4KFFA 1VQP3 1IV7A 3Q3FA 3EX9A 6STDA 1RMSA 2KF6A 3FH1A 3KN4A 4Q53A 3T8UA 2HMLB 3X40A 4HZBB 2XR8B 1FUTA 3IJEB 3KIIA 4IIAA 3E99A 2UUGC 3HX8A 1IVUA 1ROAA 2HMKB 2K3DA 1JB5A 2LYXA 3FF2A 3DGLA 4OVMA 1YI23 1I3FA 1S723 1G96A 3LH4A 3CCM3 2XSHB 4EV2A 4WWUC 2F4YA 5KP1A 1G0TA 1AV4A 3KKGA 2FGTA 4HBRA 3FSDA 2INXA 2PZVA 4N6OB 4CCVA 5AYSC 3V98A 2UX0A 1T5YA 3F8HA 3QK9A 1WTHA 4XBYA 1RKYA 1B2UA 1NO3A 3JUMA 4R9KA 3HI7A 4KZ1A 8CHOA 3NBBA 2BNGA 5IG3A 3AGOA 2XGLA 4BL2A 2F86B 4FMDA 5IG4A 3CME3 3G6E3 1BSCA 3N8BA 1RN1A 1RJOA 5IF6A 5JPUA 1BSBA 1MWTA 3IMAB 3LT8A 5EEOA 1Q9EA 2MC8A 7GSPA 2ML5A 1CYUA 3BNEA 2W9QA 4I4KA 4X2HA 3I553 1W6YA 1YGEA 2M7OA 3NM7A 1IQYA 1VQ63 3B4OA 3WOFB 1RLSA 3CMA3 3CC23 1UUWB 4XM4A 2OOVA 3EN1B 2RNTA 2PNCA 1KSIA 3D5IA 3OXAA 3CXC2 1C54A 7STDA 1TU5A 1LOXA 1A2PA 5LC7A 1DMQA 1B21A 3MYTA 3O8YA 4FMCA 2WO0A 4R9LA 4EXRA 1HKXA 3HK4A 1FGMA 3LMLA 4O3VA 4BTWA 2QA43 4XBXA 1FZUA 1QMAA 3FF0A 3T8NA 1LQMB 1W6CA 4NPBA 1A67A 2C11A 4HM3B 1Q40A 3D9RA 2D1WA 5G2GA 1JBRA 3UNLA 3V99A 1RGFA 3WDGB 4HM7B 1CEWI 1FYSA 1W01A 2BMQB 2KCDA 3DUKA 4NREA 1V57A 2P09A 2SBLA 3FGYA 3IPTA 1RNBA 3EF8A 2AAEA 3PCRA 3DGMA 1VQ73 3S27A 1KC84 4RBNA 3CD63 3FG4A 2P0MA 1WMPA 2KAAA 4XBTA 1VQO3 3A5EA 1UGIA 3L0RA 4FMBA 1MWSA 1CYVA 2IA7A 3GZBA 4TX4A 2H0HA 1AY7A 1LOYA 3KE7A 5ELUA 1STDA 2Z76A 1GMRA 2OWPA 2F98A 1BNSA 2C10A 3CNXA 5CF2A 4H61A 4OK0A 2IYJA 2F5MA 1LNIA 3AMOB 5AEUB 4GL6A 1I2GA 5D83A 4KFDA 3WMDA 5BIRA 4HM8B 4HM4B 4EYCA 1IU7A 1YVSA 3CCU3 1UI7A 1RGLA 5IERA 2D42A 1OPYA 4L7KA 3URPA 5RNTA 3DGYA 1X1XA 1RCKA 5CLKA 5BU4A 2GBXB 1BNIA 3S5CA 3F7XA 5AIIA 2OTJ3 1BNEA 1TFOA 4PEJA 3CCS3 5ELJA 1JNQA 1OHPA 4CPKA 1OHOA 1BVIA 1GD4A 3X41A 2IUKA 1Q7HA 3S67A 1EQKA 4MEIA 2XGNA 1RTUA 1R4CA 3SOAA 1TRPA 2CK3H 2W56A 4HYZA 1MNLA 3BNCA 1A90A 3B4PA 5STDA 1ULIB 3D4AA 1JV2B 4GHOA 3X3YA 1TP6A 2JDIH 3Q2PA 4FCJA 2JQ5A 4ZM8A 3CCV3 5M1AA 1UW1A 1W4NA 2CX1A 4L8OA 4WYKB 2OCTA 1BNRA 3LTBA 1RDSA 1YHQ3 4O02B
chains in the Genus database with same CATH topology
4FCMA 3LYGA 1O7GB 1Z1SA 4FR9A 1O7WB 2B24B 3OW22 4HM2B 2QIYA 3K63A 2BO9B 2GEYA 3G4S3 3WA3A 3EE1A 1CQSA 1M1XB 2BMOB 4FCZA 4OUQA 1TUHA 3PCSA 1U5OA 1YJ93 3N54B 4X2OA 4J8TA 1QVG2 3NHXA 5A0OB 3V92A 2IMJA 4CDLA 2BMRB 2XF3A 2CFLA 3SX1A 2YFLB 3SXXA 3X3XA 1JRQA 1SPUA 1Q40B 1YVBI 5JBSA 1IQ8A 1O7MB 1LXEA 3NX0A 2XSOB 2YFIB 1US1A 4N6UA 1O7NB 1GY5A 3GAXA 1QJGA 2IUJA 3UL5A 3UL6A 3LTDA 1Q7Y4 1UUVB 1Q42A 3GZXB 2Y74A 2GU3A 1OUNA 2XFTA 3A76A 5D81A 2W6JH 2QEX3 4FMAA 2L4VA 1QVF2 3NQZA 3S28A 2XEPA 3FKAA 1W5ZA 1NJI4 3D3LA 3QRDA 1W7CA 1M1K4 2XRXB 5CF1A 2CWVA 1S5AA 1WNHA 1L5GB 5IG0A 1OF5A 1V74A 3F9SA 2FXTA 3NBJA 1IVWA 1QAKA 3LTCA 1E97A 1NWWA 1VQ83 2B1XB 2RGQA 3DZLA 2K0MA 3ER7A 3CCE3 1GY7A 1LVNA 3NQYA 4U13A 2OQEC 3MG1A 3PXMA 4XDWA 2V1LA 3KZTA 3VSYA 4QWTA 1JN5A 1OGXA 2W56B 1EKMA 2CFGA 4RZMA 4N3VA 5IENA 1A2VA 4L8PA 3DGOA 4G1MB 2HMJB 3GZYB 5IG5A 1SIIA 1W00A 4AKZA 2ML6A 3F8XA 1VQ43 1VQK3 1N8QA 3LOYA 3H3HA 3T0UA 3TDGA 3CPW2 4H3UA 3LT9A 4R1KA 4R80A 1DVCA 3BLZA 4O8SA 3SVAA 1IK3A 1KD14 1C7HA 1WMOA 3Q1CA 4RNZA 5IW9A 5JPPA 2WGQA 4O2HA 1ROVA 2CFKA 1JKGA 2CFWA 1IQXA 1A2KA 2ZL8A 4NHFA 1ISKA 3RDEA 1FGRA 4KFEA 3EQQB 3KSED 2F99A 2GEXA 5AEWB 3U97A 2CWTA 3BB9A 3CCQ3 3DGNA 3SLUA 2O9UX 3MG2A 2Z77A 3JUQA 4LGQA 1FGTA 3K0ZA 3OX9A 3DM8A 4EV5A 4HJLB 5LC6A 4JRFA 4R4KA 4EC6A 1RN7A 3Q90A 4BTXA 4STDA 2HMOB 1PFPA 1VQN3 2RCDA 1ZX2A 3KFQC 2CG1A 5IEPA 2W9PA 4K1UA 3CC43 3PS8A 1OHSA 5HGRA 2QGUA 3VGNA 1STFI 5BVBA 3EBYA 2O3OA 5FW5A 3VF1A 1JJ22 2XH9A 1GY6A 3X3ZA 1NB3I 1D6ZA 4N6LA 1TIJA 2W0QA 3F7SA 3JUNA 4XB5A 3FCSB 1GD3A 2P0XA 3OWYA 1W6GA 3GZRA 3FG3A 3EB8A 2Q07A 2GXFA 1M9GA 3EHCA 3JUPA 3PYJA 3FG1A 3F14A 2KXGA 2CFDA 2P05A 3CU3A 1OH0A 5CXOA 2A15A 1ZO2A 2YFJB 4J9AA 3G8ZA 1NDOB 3UB1A 1OACA 3B7CA 3N9HA 5FGOA 4HVNA 3S29A 2FNQA 3ROBA 3I563 2MF7A 1YJW3 2RFRA 4N6TA 2RSXA 2CIUA 4EBGA 1BUQA 5AI1A 5EVHA 1AVKA 3CPOA 3LTAA 1N5HA 2GU1A 3G0KA 2OOVC 1EA2A 5DREA 1K41A 4LSOA 3DXOA 4HM5B 1LNHA 4MJDA 5AIGA 2Z7AA 1W2ZA 2YX9A 2BT3A 2LQVA 3MSOA 4BTYA 3NV0A 1IVXA 4WFOA 3CCL3 1F8NA 3H51A 5AIFA 3CCR3 2W2CA 2P38A 2W04A 1K9M4 1FA3A 4IT7A 1IVVA 1NU3A 3WA2X 4WYKA 4MMXB 3UJMA 3K7CA 4HZ9B 3X42A 1JKGB 1Q824 1UI8A 1YJN3 5D82A 1KQS2 3HIIA 5EQLA 2STDA 3U1WA 1DMNA 3ECFA 3SEDA 3RGRA 3BNDA 1RRHA 1O7PB 1N8R4 2HMMB 1SQWA 1GYBA 1N9EA 3I0YA 3WOEB 2Y73A 2ZDJA 1E3VA 1EG9B 2OTL3 1PU4A 3GWRA 3MWZA 3HZPA 4AKYA 2CKFB 1E3RA 1FGOA 4RNYA 1ULJB 4LEHA 5CK6A 2HMNB 4JF8A 3OWSA 1QALA 4HM0B 1IT7A 1Y4KA 1HU9A 3EJVA 1OGZA 3J7Yd 3K5TA 4AEQA 3OWUA 3MPHA 1W02A 2Z6BA 3LXUX 3F40A 4MMZB 1YIT3 1K8A4 3CNMA 2E2VA 3FZWA 2W03A 4K90B 3B8LA 2WOHA 3EC9A 3CCJ3 1VQL3 1N5PA 4GB5A 5AYRB 2E2TA 2R4IA 3NBRA 3MG3A 5AIHA 2OQEA 1QAFA 3EN8A 1U8CB 3JUOA 1JB4A 3NM2A 1AR0A 3PGBA 2BHMA 3K9MC 3HIGA 4LZIA 3STDA 2WGOA 2CH9A 3MKIA 5KP3A 1FUWA 2CW9A 1D6YA 4HM1B 1DVDA 1DYUA 1IT8A 2GBWB 1SIHA 3DY5A 1OCVA 2CWUA 3FLJA 3CC73 1IDPA 5KP4A 1SJWA 4K61A 2KRTA 3EBTA 1WMNA 1TFKA 4HKVB 5BXQA 3NXJA 2CG0A 1GS3A 1K734 1ASKA 1MOLA 1VZZA 1D6UA 1K28A 1N9JA 1VQ93 1DMMA 3NV0B 3BNBA 4HM6B 2CC3A 4IPBA 1M904 3NUVA 3PZWA 1RRLA 4N6MA 3M8CA 3G16A 1VQM3 1WQLB 2CHCA 3MHEA 1OF5B 1IV9A 1FGQA 4WHAA 4KVHA 4WP5A 4N6NB 3KSPA 1YIJ3 2WOFA 2XFSA 3AMOA 4LMIA 4N6V0 5IEOA 2I9WA 4ORLA 2K54A 5DRVA 1W2B2 4MMYB 1NB5I 1KWIA 3LZAA 5TGNA 3RGAA 3JVCA 3G713 1AVLA 3SOYA 1Q814 3ALAA 3GRDA 1Q864 1J2BA 1JN5B 1JB2A 3OV4A 4XDVA 1O7HB 1VQ53 3DMCA 5I97A 3WODG 4K1VA 2E2UA 4KFFA 1VQP3 1IV7A 6STDA 3EX9A 3FH1A 3T8UA 4Q53A 3KN4A 3X40A 2HMLB 4HZBB 2XR8B 3IJEB 3KIIA 4IIAA 3E99A 3HX8A 1IVUA 1ROAA 2HMKB 2LYXA 1JB5A 4OVMA 3FF2A 3DGLA 1YI23 1S723 1G96A 3LH4A 3CCM3 2XSHB 4EV2A 4WWUC 5KP1A 1AV4A 3KKGA 2FGTA 4HBRA 3FSDA 2INXA 2PZVA 4N6OB 4CCVA 5AYSC 3V98A 2UX0A 1T5YA 3F8HA 3QK9A 1WTHA 4XBYA 1RKYA 1NO3A 3JUMA 4R9KA 3HI7A 4KZ1A 8CHOA 3NBBA 2BNGA 5IG3A 2XGLA 2F86B 4FMDA 5IG4A 3CME3 3G6E3 3N8BA 5IF6A 1RJOA 5JPUA 3IMAB 3LT8A 5EEOA 2MC8A 1CYUA 2ML5A 3BNEA 2W9QA 4I4KA 4X2HA 3I553 1W6YA 1YGEA 2M7OA 3NM7A 1IQYA 1VQ63 3B4OA 3WOFB 3CMA3 3CC23 1UUWB 4XM4A 2OOVA 3EN1B 2PNCA 1KSIA 3OXAA 3CXC2 7STDA 1TU5A 1LOXA 5LC7A 1DMQA 3MYTA 3O8YA 4FMCA 2WO0A 4R9LA 4EXRA 1HKXA 3HK4A 1FGMA 3LMLA 4O3VA 4BTWA 2QA43 4XBXA 1QMAA 3FF0A 3T8NA 1W6CA 1A67A 2C11A 4HM3B 1Q40A 3D9RA 2D1WA 5G2GA 3UNLA 3V99A 3WDGB 4HM7B 1CEWI 1W01A 2BMQB 2KCDA 3DUKA 4NREA 2P09A 2SBLA 3FGYA 3IPTA 3EF8A 3PCRA 3DGMA 1VQ73 3S27A 1KC84 4RBNA 3CD63 3FG4A 2P0MA 1WMPA 4XBTA 1VQO3 3L0RA 4FMBA 1CYVA 2IA7A 3GZBA 4TX4A 3KE7A 5ELUA 1STDA 2Z76A 2OWPA 2F98A 2C10A 3CNXA 5CF2A 4H61A 4OK0A 3AMOB 5AEUB 4GL6A 5D83A 4KFDA 3WMDA 4HM8B 4HM4B 4EYCA 1IU7A 3CCU3 1UI7A 5IERA 2D42A 1OPYA 4L7KA 5CLKA 2GBXB 3S5CA 3F7XA 5AIIA 2OTJ3 1TFOA 4PEJA 3CCS3 5ELJA 1JNQA 1OHPA 1OHOA 1GD4A 3X41A 2IUKA 3S67A 1EQKA 4MEIA 2XGNA 1R4CA 3SOAA 2CK3H 2W56A 4HYZA 1MNLA 3BNCA 1A90A 3B4PA 5STDA 1ULIB 3X3YA 1JV2B 1TP6A 2JDIH 3Q2PA 4FCJA 2JQ5A 4ZM8A 3CCV3 1UW1A 1W4NA 4L8OA 4WYKB 2OCTA 3LTBA 1YHQ3 4O02B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROA A;  3MWZ A;  3KSE D;  1G96 A;  3LH4 A;  2BO9 B;  4N6O B;  4CCV A;  2O9U X;  5LC6 A;  5A0O B;  1RN7 A;  3IMA B;  1PFP A;  1CYU A;  2W9Q A;  3KFQ C;  2W9P A;  1N5P A;  3PS8 A;  1STF I;  1YVB I;  1NB3 I;  4N6L A;  1LXE A;  3NX0 A;  1TIJ A;  5LC7 A;  1GD3 A;  4N6U A;  3GAX A;  3K9M C;  3UL6 A;  3UL5 A;  4LZI A;  1M9G A;  3PYJ A;  1A67 A;  2CH9 A;  2KXG A;  1FUW A;  1CEW I;  1DVD A;  3QRD A;  3L0R A;  1CYV A;  4TX4 A;  5ELU A;  1WNH A;  4N6T A;  1MOL A;  1N9J A;  1N5H A;  4EYC A;  4N6M A;  3PXM A;  1IV9 A;  4N6N B;  5ELJ A;  4N6V 0;  1FA3 A;  1GD4 A;  4IT7 A;  1NB5 I;  1KWI A;  3S67 A;  1EQK A;  1R4C A;  5EQL A;  1MNL A;  1A90 A;  1DVC A;  3SVA A;  3Q2P A;  1IV7 A;  4ZM8 A;  2OCT A; 
#chains in the Genus database with same CATH topology
 4FCM A;  3LYG A;  1O7G B;  1Z1S A;  4FR9 A;  1O7W B;  2B24 B;  3OW2 2;  4HM2 B;  2QIY A;  3K63 A;  1GOU A;  2BO9 B;  2GEY A;  3G4S 3;  3WA3 A;  3EE1 A;  1B2X A;  1UCI A;  4J5K A;  1CQS A;  1M1X B;  2BMO B;  4FCZ A;  4OUQ A;  3RNT A;  1TUH A;  3PCS A;  1EUI C;  1U5O A;  3HOH A;  3N54 B;  4X2O A;  4J8T A;  1YJ9 3;  1QVG 2;  3NHX A;  8RNT A;  4I5Q A;  1BRI A;  1R4Y A;  5A0O B;  3V92 A;  2IMJ A;  4CDL A;  1JZD A;  2BMR B;  2XF3 A;  1BAN A;  2CFL A;  3SX1 A;  2YFL B;  2R41 A;  3SXX A;  3SYU A;  3X3X A;  1JRQ A;  1SPU A;  1Q40 B;  1YVB I;  5JBS A;  1IQ8 A;  1MGW A;  1O7M B;  1LXE A;  3NX0 A;  3WR2 A;  1T2H A;  2XSO B;  2YFI B;  1US1 A;  4N6U A;  1O7N B;  1GY5 A;  3GAX A;  1QJG A;  2IUJ A;  3UL5 A;  3UL6 A;  3LTD A;  1Q7Y 4;  1UUV B;  4KT3 B;  1Q42 A;  3GZX B;  2Y74 A;  2GU3 A;  1OUN A;  1TJD A;  2XFT A;  3A76 A;  5D81 A;  2W6J H;  1RCL A;  2QEX 3;  1FW7 A;  4FMA A;  2ZA4 A;  2L4V A;  1QVF 2;  3NQZ A;  3S28 A;  2XEP A;  3FKA A;  1W5Z A;  1HZ1 A;  3D5G A;  1NJI 4;  3D3L A;  3QRD A;  1W7C A;  6GSP A;  1M1K 4;  1G02 A;  1BAO A;  1X1U A;  2XRX B;  5CF1 A;  2CWV A;  2KF3 A;  1S5A A;  1WNH A;  1L5G B;  5IG0 A;  1OF5 A;  1RN4 A;  1V74 A;  3F9S A;  2FXT A;  3NBJ A;  1IVW A;  4BIR A;  1UCJ A;  1X1W A;  1QAK A;  3LTC A;  1E97 A;  5GSP A;  1NWW A;  1VQ8 3;  2B1X B;  2RGQ A;  3DZL A;  4CJN A;  2K0M A;  3ER7 A;  3CCE 3;  1GY7 A;  1LVN A;  3NQY A;  4U13 A;  2OQE C;  3MG1 A;  1BU4 A;  3PXM A;  4XDW A;  2V1L A;  7RNT A;  3KZT A;  3VSY A;  1RSN A;  4QWT A;  1JN5 A;  1OGX A;  2W56 B;  1EKM A;  2CFG A;  4RZM A;  4N3V A;  5G1K A;  5IEN A;  1A2V A;  4L8P A;  3D79 A;  3DGO A;  4G1M B;  2HMJ B;  1LOW A;  3GZY B;  5IG5 A;  1SII A;  1W00 A;  4AKZ A;  1I0V A;  2ML6 A;  3F8X A;  1VQK 3;  1VQ4 3;  1N8Q A;  3LOY A;  3H3H A;  3T0U A;  3TDG A;  3CPW 2;  1MWR A;  4H3U A;  1LQG C;  3LT9 A;  1BIR A;  1AQZ A;  4R1K A;  4R80 A;  1DVC A;  1GOY A;  1MWU A;  2BU4 A;  3BLZ A;  4O8S A;  3SVA A;  4BL3 A;  1IK3 A;  1KD1 4;  1C7H A;  1WMO A;  3Q1C A;  2H0G A;  4RNZ A;  5HOH A;  1SAR A;  3AHS A;  5IW9 A;  5JPP A;  2WGQ A;  4O2H A;  1ROV A;  1JKG A;  1IQX A;  1A2K A;  2CFK A;  2CFW A;  2ZL8 A;  4NHF A;  1ISK A;  3RDE A;  1FGR A;  4KFE A;  3EQQ B;  3KSE D;  2F99 A;  2GEX A;  1I8V A;  5AEW B;  3U97 A;  2CWT A;  3BB9 A;  3CCQ 3;  3DGN A;  3SLU A;  2O9U X;  3MG2 A;  1NNV A;  2Z77 A;  3JUQ A;  4LYL B;  5M19 A;  4LGQ A;  1FGT A;  3K0Z A;  3OX9 A;  1UCK A;  1LOV A;  3DM8 A;  4EV5 A;  4HJL B;  1RGC A;  1BRN L;  5LC6 A;  6RNT A;  4JRF A;  4R4K A;  1FUS A;  4EC6 A;  1BNG A;  1RN7 A;  3Q90 A;  2ZHX B;  4BTX A;  4STD A;  3BIR A;  2HMO B;  1PFP A;  2GSP A;  2RCD A;  1VQN 3;  1ZX2 A;  1GOV A;  3KFQ C;  1RGG A;  2CG1 A;  5IEP A;  2W9P A;  4K1U A;  3CC4 3;  3PS8 A;  1OHS A;  1RHL A;  5HGR A;  2QGU A;  3VGN A;  1STF I;  5BVB A;  3EBY A;  2O3O A;  5FW5 A;  3VF1 A;  1JJ2 2;  2XH9 A;  1GY6 A;  4J5G A;  3X3Z A;  1NB3 I;  1D6Z A;  4N6L A;  4EW5 A;  1BRS A;  1TIJ A;  2AAD A;  2W0Q A;  1TTO A;  3F7S A;  3JUN A;  4XB5 A;  3FCS B;  1GD3 A;  1UDI I;  2P0X A;  3OWY A;  1W6G A;  3GZR A;  3FG3 A;  3EB8 A;  2Q07 A;  2GXF A;  3ZG5 A;  1M9G A;  1BOX A;  3EHC A;  3JUP A;  3PYJ A;  3FG1 A;  3F14 A;  2KXG A;  2CFD A;  2P05 A;  3CU3 A;  1OH0 A;  5CXO A;  2A15 A;  1ZO2 A;  2YFJ B;  4J9A A;  3G8Z A;  1RGE A;  1NDO B;  2SAR A;  3UB1 A;  5IEO A;  1OAC A;  3B7C A;  3N9H A;  5FGO A;  4HVN A;  3S29 A;  1B2M A;  2FNQ A;  4HOH A;  3ROB A;  3I56 3;  2MF7 A;  1X1Y A;  4RNT A;  1YJW 3;  1B27 A;  2RFR A;  4N6T A;  2RSX A;  2CIU A;  4EBG A;  1B3S A;  1BUQ A;  5AI1 A;  5EVH A;  1DET A;  1AVK A;  3CPO A;  4BU4 A;  3LTA A;  1N5H A;  1HYF A;  2HOH A;  2GU1 A;  2H0I A;  2OOV C;  3G0K A;  1YGW A;  1EA2 A;  5DRE A;  1K41 A;  1BGS A;  3DXO A;  4LSO A;  4HM5 B;  1LNH A;  4MJD A;  5AIG A;  1BNJ A;  2IY2 A;  2Z7A A;  1W2Z A;  2YX9 A;  2BT3 A;  2LQV A;  3MSO A;  4BTY A;  1GMQ A;  3NV0 A;  1IVX A;  4WFO A;  3CCL 3;  1F8N A;  3H51 A;  5AIF A;  3CCR 3;  2CX0 A;  2W2C A;  2P38 A;  2W04 A;  1K9M 4;  1FA3 A;  4IT7 A;  1BSE A;  1IVV A;  1NU3 A;  4HAA A;  3WA2 X;  1T3B A;  4WYK A;  4MMX B;  3UJM A;  3K7C A;  4HZ9 B;  3X42 A;  1I0X A;  1JKG B;  1I2E A;  1UI8 A;  2BIR A;  1Q82 4;  1I70 A;  2RBI A;  1YJN 3;  5D82 A;  1KQS 2;  3HII A;  5EQL A;  2STD A;  1UGH I;  3U1W A;  1DMN A;  3AHW A;  3ECF A;  3SED A;  1RGA A;  1RNT A;  3RGR A;  3BND A;  1RRH A;  1DE3 A;  1O7P B;  1I3I A;  1BRK A;  2KF5 A;  3KCH A;  1N8R 4;  1VQQ A;  2HMM B;  1ZGX A;  1SQW A;  1GYB A;  1N9E A;  1BSA A;  3I0Y A;  3WOE B;  2Y73 A;  2ZDJ A;  1E3V A;  1EG9 B;  2OTL 3;  1PU4 A;  3GWR A;  1MGR A;  3MWZ A;  1PYL A;  3HZP A;  4AKY A;  2CKF B;  1BUJ A;  1E3R A;  1FGO A;  4RNY A;  3ZFZ A;  5G1L A;  1ULJ B;  1UUG B;  4LEH A;  1RGH A;  5CK6 A;  2HMN B;  3BU4 A;  4JF8 A;  3OWS A;  1QAL A;  4HM0 B;  1I2F A;  2J8X B;  1IT7 A;  1Y4K A;  1HU9 A;  3EJV A;  1OGZ A;  3J7Y d;  3K5T A;  4AEQ A;  3OWU A;  3MPH A;  1W02 A;  2Z6B A;  2C4B A;  3LXU X;  3GSP A;  3F40 A;  4MMZ B;  1YIT 3;  1K8A 4;  1UCL A;  3CNM A;  2E2V A;  3AGN A;  1B2Z A;  3FZW A;  2W03 A;  1JBT A;  4K90 B;  3B8L A;  2WOH A;  3EC9 A;  4GSP A;  3CCJ 3;  1VQL 3;  1N5P A;  4GB5 A;  5AYR B;  2E2T A;  1BRJ A;  2R4I A;  3NBR A;  1T2I A;  3MG3 A;  5AIH A;  2OQE A;  1QAF A;  1B20 A;  1B2S A;  3EN8 A;  1U8C B;  3JUO A;  1JZO A;  1JB4 A;  2F56 A;  3NM2 A;  1AR0 A;  3PGB A;  2BHM A;  3K9M C;  3HIG A;  4LZI A;  3STD A;  2WGO A;  2CH9 A;  3MKI A;  5KP3 A;  1FUW A;  2CW9 A;  1D6Y A;  4HM1 B;  1DVD A;  1DYU A;  1IT8 A;  2GBW B;  1SIH A;  3DY5 A;  1OCV A;  2CWU A;  3FLJ A;  3ZG0 A;  3CC7 3;  1CH0 A;  1IDP A;  5KP4 A;  1SJW A;  4K61 A;  2KRT A;  3EBT A;  1WMN A;  3WHO A;  1TFK A;  2L1S A;  4HKV B;  3NXJ A;  5BXQ A;  1LRA A;  2CG0 A;  1PY3 A;  1GS3 A;  1K73 4;  1ASK A;  1BNF A;  1MOL A;  1BRG A;  1D6U A;  1K28 A;  1N9J A;  1VZZ A;  1VQ9 3;  1DMM A;  3NV0 B;  3BNB A;  4HM6 B;  1GSP A;  2CC3 A;  4IPB A;  1M90 4;  3NUV A;  3PZW A;  1RRL A;  4N6M A;  3M8C A;  3G16 A;  1VQM 3;  1WQL B;  2CHC A;  2KF4 A;  1V58 A;  4DKI A;  3MHE A;  1OF5 B;  1IV9 A;  1FGQ A;  4WHA A;  4KVH A;  4WP5 A;  4N6N B;  3KSP A;  1YIJ 3;  2WOF A;  1GMP A;  2XFS A;  3AMO A;  2UGI A;  4LMI A;  2I9W A;  4ILF A;  1BSD A;  4N6V 0;  4ORL A;  2K54 A;  5M18 A;  1JBS A;  5DRV A;  1W2B 2;  4MMY B;  1NB5 I;  1KWI A;  3LZA A;  5TGN A;  9RNT A;  3RGA A;  1EEJ A;  3JVC A;  3G71 3;  1TRQ A;  1AVL A;  2F5W A;  3SOY A;  1BRH A;  1Q81 4;  3ALA A;  3GRD A;  1Q86 4;  1J2B A;  1JN5 B;  1JB2 A;  3OV4 A;  4XDV A;  1O7H B;  1IYY A;  1VQ5 3;  3DMC A;  5I97 A;  1ZS7 A;  3WOD G;  4K1V A;  2E2U A;  1RGK A;  3DH2 A;  1YNV X;  4KFF A;  1VQP 3;  1IV7 A;  3Q3F A;  3EX9 A;  6STD A;  1RMS A;  2KF6 A;  3FH1 A;  3KN4 A;  4Q53 A;  3T8U A;  2HML B;  3X40 A;  4HZB B;  2XR8 B;  1FUT A;  3IJE B;  3KII A;  4IIA A;  3E99 A;  2UUG C;  3HX8 A;  1IVU A;  1ROA A;  2HMK B;  2K3D A;  1JB5 A;  2LYX A;  3FF2 A;  3DGL A;  4OVM A;  1YI2 3;  1I3F A;  1S72 3;  1G96 A;  3LH4 A;  3CCM 3;  2XSH B;  4EV2 A;  4WWU C;  2F4Y A;  5KP1 A;  1G0T A;  1AV4 A;  3KKG A;  2FGT A;  4HBR A;  3FSD A;  2INX A;  2PZV A;  4N6O B;  4CCV A;  5AYS C;  3V98 A;  2UX0 A;  1T5Y A;  3F8H A;  3QK9 A;  1WTH A;  4XBY A;  1RKY A;  1B2U A;  1NO3 A;  3JUM A;  4R9K A;  3HI7 A;  4KZ1 A;  8CHO A;  3NBB A;  2BNG A;  5IG3 A;  3AGO A;  2XGL A;  4BL2 A;  2F86 B;  4FMD A;  5IG4 A;  3CME 3;  3G6E 3;  1BSC A;  3N8B A;  1RN1 A;  1RJO A;  5IF6 A;  5JPU A;  1BSB A;  1MWT A;  3IMA B;  3LT8 A;  5EEO A;  1Q9E A;  2MC8 A;  7GSP A;  2ML5 A;  1CYU A;  3BNE A;  2W9Q A;  4I4K A;  4X2H A;  3I55 3;  1W6Y A;  1YGE A;  2M7O A;  3NM7 A;  1IQY A;  1VQ6 3;  3B4O A;  3WOF B;  1RLS A;  3CMA 3;  3CC2 3;  1UUW B;  4XM4 A;  2OOV A;  3EN1 B;  2RNT A;  2PNC A;  1KSI A;  3D5I A;  3OXA A;  3CXC 2;  1C54 A;  7STD A;  1TU5 A;  1LOX A;  1A2P A;  5LC7 A;  1DMQ A;  1B21 A;  3MYT A;  3O8Y A;  4FMC A;  2WO0 A;  4R9L A;  4EXR A;  1HKX A;  3HK4 A;  1FGM A;  3LML A;  4O3V A;  4BTW A;  2QA4 3;  4XBX A;  1FZU A;  1QMA A;  3FF0 A;  3T8N A;  1LQM B;  1W6C A;  4NPB A;  1A67 A;  2C11 A;  4HM3 B;  1Q40 A;  3D9R A;  2D1W A;  5G2G A;  1JBR A;  3UNL A;  3V99 A;  1RGF A;  3WDG B;  4HM7 B;  1CEW I;  1FYS A;  1W01 A;  2BMQ B;  2KCD A;  3DUK A;  4NRE A;  1V57 A;  2P09 A;  2SBL A;  3FGY A;  3IPT A;  1RNB A;  3EF8 A;  2AAE A;  3PCR A;  3DGM A;  1VQ7 3;  3S27 A;  1KC8 4;  4RBN A;  3CD6 3;  3FG4 A;  2P0M A;  1WMP A;  2KAA A;  4XBT A;  1VQO 3;  3A5E A;  1UGI A;  3L0R A;  4FMB A;  1MWS A;  1CYV A;  2IA7 A;  3GZB A;  4TX4 A;  2H0H A;  1AY7 A;  1LOY A;  3KE7 A;  5ELU A;  1STD A;  2Z76 A;  1GMR A;  2OWP A;  2F98 A;  1BNS A;  2C10 A;  3CNX A;  5CF2 A;  4H61 A;  4OK0 A;  2IYJ A;  2F5M A;  1LNI A;  3AMO B;  5AEU B;  4GL6 A;  1I2G A;  5D83 A;  4KFD A;  3WMD A;  5BIR A;  4HM8 B;  4HM4 B;  4EYC A;  1IU7 A;  1YVS A;  3CCU 3;  1UI7 A;  1RGL A;  5IER A;  2D42 A;  1OPY A;  4L7K A;  3URP A;  5RNT A;  3DGY A;  1X1X A;  1RCK A;  5CLK A;  5BU4 A;  2GBX B;  1BNI A;  3S5C A;  3F7X A;  5AII A;  2OTJ 3;  1BNE A;  1TFO A;  4PEJ A;  3CCS 3;  5ELJ A;  1JNQ A;  1OHP A;  4CPK A;  1OHO A;  1BVI A;  1GD4 A;  3X41 A;  2IUK A;  1Q7H A;  3S67 A;  1EQK A;  4MEI A;  2XGN A;  1RTU A;  1R4C A;  3SOA A;  1TRP A;  2CK3 H;  2W56 A;  4HYZ A;  1MNL A;  3BNC A;  1A90 A;  3B4P A;  5STD A;  1ULI B;  3D4A A;  1JV2 B;  4GHO A;  3X3Y A;  1TP6 A;  2JDI H;  3Q2P A;  4FCJ A;  2JQ5 A;  4ZM8 A;  3CCV 3;  5M1A A;  1UW1 A;  1W4N A;  2CX1 A;  4L8O A;  4WYK B;  2OCT A;  1BNR A;  3LTB A;  1RDS A;  1YHQ 3;  4O02 B; 
#chains in the Genus database with same CATH homology
 4FCM A;  3LYG A;  1O7G B;  1Z1S A;  4FR9 A;  1O7W B;  2B24 B;  3OW2 2;  4HM2 B;  2QIY A;  3K63 A;  2BO9 B;  2GEY A;  3G4S 3;  3WA3 A;  3EE1 A;  1CQS A;  1M1X B;  2BMO B;  4FCZ A;  4OUQ A;  1TUH A;  3PCS A;  1U5O A;  1YJ9 3;  3N54 B;  4X2O A;  4J8T A;  1QVG 2;  3NHX A;  5A0O B;  3V92 A;  2IMJ A;  4CDL A;  2BMR B;  2XF3 A;  2CFL A;  3SX1 A;  2YFL B;  3SXX A;  3X3X A;  1JRQ A;  1SPU A;  1Q40 B;  1YVB I;  5JBS A;  1IQ8 A;  1O7M B;  1LXE A;  3NX0 A;  2XSO B;  2YFI B;  1US1 A;  4N6U A;  1O7N B;  1GY5 A;  3GAX A;  1QJG A;  2IUJ A;  3UL5 A;  3UL6 A;  3LTD A;  1Q7Y 4;  1UUV B;  1Q42 A;  3GZX B;  2Y74 A;  2GU3 A;  1OUN A;  2XFT A;  3A76 A;  5D81 A;  2W6J H;  2QEX 3;  4FMA A;  2L4V A;  1QVF 2;  3NQZ A;  3S28 A;  2XEP A;  3FKA A;  1W5Z A;  1NJI 4;  3D3L A;  3QRD A;  1W7C A;  1M1K 4;  2XRX B;  5CF1 A;  2CWV A;  1S5A A;  1WNH A;  1L5G B;  5IG0 A;  1OF5 A;  1V74 A;  3F9S A;  2FXT A;  3NBJ A;  1IVW A;  1QAK A;  3LTC A;  1E97 A;  1NWW A;  1VQ8 3;  2B1X B;  2RGQ A;  3DZL A;  2K0M A;  3ER7 A;  3CCE 3;  1GY7 A;  1LVN A;  3NQY A;  4U13 A;  2OQE C;  3MG1 A;  3PXM A;  4XDW A;  2V1L A;  3KZT A;  3VSY A;  4QWT A;  1JN5 A;  1OGX A;  2W56 B;  1EKM A;  2CFG A;  4RZM A;  4N3V A;  5IEN A;  1A2V A;  4L8P A;  3DGO A;  4G1M B;  2HMJ B;  3GZY B;  5IG5 A;  1SII A;  1W00 A;  4AKZ A;  2ML6 A;  3F8X A;  1VQ4 3;  1VQK 3;  1N8Q A;  3LOY A;  3H3H A;  3T0U A;  3TDG A;  3CPW 2;  4H3U A;  3LT9 A;  4R1K A;  4R80 A;  1DVC A;  3BLZ A;  4O8S A;  3SVA A;  1IK3 A;  1KD1 4;  1C7H A;  1WMO A;  3Q1C A;  4RNZ A;  5IW9 A;  5JPP A;  2WGQ A;  4O2H A;  1ROV A;  2CFK A;  1JKG A;  2CFW A;  1IQX A;  1A2K A;  2ZL8 A;  4NHF A;  1ISK A;  3RDE A;  1FGR A;  4KFE A;  3EQQ B;  3KSE D;  2F99 A;  2GEX A;  5AEW B;  3U97 A;  2CWT A;  3BB9 A;  3CCQ 3;  3DGN A;  3SLU A;  2O9U X;  3MG2 A;  2Z77 A;  3JUQ A;  4LGQ A;  1FGT A;  3K0Z A;  3OX9 A;  3DM8 A;  4EV5 A;  4HJL B;  5LC6 A;  4JRF A;  4R4K A;  4EC6 A;  1RN7 A;  3Q90 A;  4BTX A;  4STD A;  2HMO B;  1PFP A;  1VQN 3;  2RCD A;  1ZX2 A;  3KFQ C;  2CG1 A;  5IEP A;  2W9P A;  4K1U A;  3CC4 3;  3PS8 A;  1OHS A;  5HGR A;  2QGU A;  3VGN A;  1STF I;  5BVB A;  3EBY A;  2O3O A;  5FW5 A;  3VF1 A;  1JJ2 2;  2XH9 A;  1GY6 A;  3X3Z A;  1NB3 I;  1D6Z A;  4N6L A;  1TIJ A;  2W0Q A;  3F7S A;  3JUN A;  4XB5 A;  3FCS B;  1GD3 A;  2P0X A;  3OWY A;  1W6G A;  3GZR A;  3FG3 A;  3EB8 A;  2Q07 A;  2GXF A;  1M9G A;  3EHC A;  3JUP A;  3PYJ A;  3FG1 A;  3F14 A;  2KXG A;  2CFD A;  2P05 A;  3CU3 A;  1OH0 A;  5CXO A;  2A15 A;  1ZO2 A;  2YFJ B;  4J9A A;  3G8Z A;  1NDO B;  3UB1 A;  1OAC A;  3B7C A;  3N9H A;  5FGO A;  4HVN A;  3S29 A;  2FNQ A;  3ROB A;  3I56 3;  2MF7 A;  1YJW 3;  2RFR A;  4N6T A;  2RSX A;  2CIU A;  4EBG A;  1BUQ A;  5AI1 A;  5EVH A;  1AVK A;  3CPO A;  3LTA A;  1N5H A;  2GU1 A;  3G0K A;  2OOV C;  1EA2 A;  5DRE A;  1K41 A;  4LSO A;  3DXO A;  4HM5 B;  1LNH A;  4MJD A;  5AIG A;  2Z7A A;  1W2Z A;  2YX9 A;  2BT3 A;  2LQV A;  3MSO A;  4BTY A;  3NV0 A;  1IVX A;  4WFO A;  3CCL 3;  1F8N A;  3H51 A;  5AIF A;  3CCR 3;  2W2C A;  2P38 A;  2W04 A;  1K9M 4;  1FA3 A;  4IT7 A;  1IVV A;  1NU3 A;  3WA2 X;  4WYK A;  4MMX B;  3UJM A;  3K7C A;  4HZ9 B;  3X42 A;  1JKG B;  1Q82 4;  1UI8 A;  1YJN 3;  5D82 A;  1KQS 2;  3HII A;  5EQL A;  2STD A;  3U1W A;  1DMN A;  3ECF A;  3SED A;  3RGR A;  3BND A;  1RRH A;  1O7P B;  1N8R 4;  2HMM B;  1SQW A;  1GYB A;  1N9E A;  3I0Y A;  3WOE B;  2Y73 A;  2ZDJ A;  1E3V A;  1EG9 B;  2OTL 3;  1PU4 A;  3GWR A;  3MWZ A;  3HZP A;  4AKY A;  2CKF B;  1E3R A;  1FGO A;  4RNY A;  1ULJ B;  4LEH A;  5CK6 A;  2HMN B;  4JF8 A;  3OWS A;  1QAL A;  4HM0 B;  1IT7 A;  1Y4K A;  1HU9 A;  3EJV A;  1OGZ A;  3J7Y d;  3K5T A;  4AEQ A;  3OWU A;  3MPH A;  1W02 A;  2Z6B A;  3LXU X;  3F40 A;  4MMZ B;  1YIT 3;  1K8A 4;  3CNM A;  2E2V A;  3FZW A;  2W03 A;  4K90 B;  3B8L A;  2WOH A;  3EC9 A;  3CCJ 3;  1VQL 3;  1N5P A;  4GB5 A;  5AYR B;  2E2T A;  2R4I A;  3NBR A;  3MG3 A;  5AIH A;  2OQE A;  1QAF A;  3EN8 A;  1U8C B;  3JUO A;  1JB4 A;  3NM2 A;  1AR0 A;  3PGB A;  2BHM A;  3K9M C;  3HIG A;  4LZI A;  3STD A;  2WGO A;  2CH9 A;  3MKI A;  5KP3 A;  1FUW A;  2CW9 A;  1D6Y A;  4HM1 B;  1DVD A;  1DYU A;  1IT8 A;  2GBW B;  1SIH A;  3DY5 A;  1OCV A;  2CWU A;  3FLJ A;  3CC7 3;  1IDP A;  5KP4 A;  1SJW A;  4K61 A;  2KRT A;  3EBT A;  1WMN A;  1TFK A;  4HKV B;  5BXQ A;  3NXJ A;  2CG0 A;  1GS3 A;  1K73 4;  1ASK A;  1MOL A;  1VZZ A;  1D6U A;  1K28 A;  1N9J A;  1VQ9 3;  1DMM A;  3NV0 B;  3BNB A;  4HM6 B;  2CC3 A;  4IPB A;  1M90 4;  3NUV A;  3PZW A;  1RRL A;  4N6M A;  3M8C A;  3G16 A;  1VQM 3;  1WQL B;  2CHC A;  3MHE A;  1OF5 B;  1IV9 A;  1FGQ A;  4WHA A;  4KVH A;  4WP5 A;  4N6N B;  3KSP A;  1YIJ 3;  2WOF A;  2XFS A;  3AMO A;  4LMI A;  4N6V 0;  5IEO A;  2I9W A;  4ORL A;  2K54 A;  5DRV A;  1W2B 2;  4MMY B;  1NB5 I;  1KWI A;  3LZA A;  5TGN A;  3RGA A;  3JVC A;  3G71 3;  1AVL A;  3SOY A;  1Q81 4;  3ALA A;  3GRD A;  1Q86 4;  1J2B A;  1JN5 B;  1JB2 A;  3OV4 A;  4XDV A;  1O7H B;  1VQ5 3;  3DMC A;  5I97 A;  3WOD G;  4K1V A;  2E2U A;  4KFF A;  1VQP 3;  1IV7 A;  6STD A;  3EX9 A;  3FH1 A;  3T8U A;  4Q53 A;  3KN4 A;  3X40 A;  2HML B;  4HZB B;  2XR8 B;  3IJE B;  3KII A;  4IIA A;  3E99 A;  3HX8 A;  1IVU A;  1ROA A;  2HMK B;  2LYX A;  1JB5 A;  4OVM A;  3FF2 A;  3DGL A;  1YI2 3;  1S72 3;  1G96 A;  3LH4 A;  3CCM 3;  2XSH B;  4EV2 A;  4WWU C;  5KP1 A;  1AV4 A;  3KKG A;  2FGT A;  4HBR A;  3FSD A;  2INX A;  2PZV A;  4N6O B;  4CCV A;  5AYS C;  3V98 A;  2UX0 A;  1T5Y A;  3F8H A;  3QK9 A;  1WTH A;  4XBY A;  1RKY A;  1NO3 A;  3JUM A;  4R9K A;  3HI7 A;  4KZ1 A;  8CHO A;  3NBB A;  2BNG A;  5IG3 A;  2XGL A;  2F86 B;  4FMD A;  5IG4 A;  3CME 3;  3G6E 3;  3N8B A;  5IF6 A;  1RJO A;  5JPU A;  3IMA B;  3LT8 A;  5EEO A;  2MC8 A;  1CYU A;  2ML5 A;  3BNE A;  2W9Q A;  4I4K A;  4X2H A;  3I55 3;  1W6Y A;  1YGE A;  2M7O A;  3NM7 A;  1IQY A;  1VQ6 3;  3B4O A;  3WOF B;  3CMA 3;  3CC2 3;  1UUW B;  4XM4 A;  2OOV A;  3EN1 B;  2PNC A;  1KSI A;  3OXA A;  3CXC 2;  7STD A;  1TU5 A;  1LOX A;  5LC7 A;  1DMQ A;  3MYT A;  3O8Y A;  4FMC A;  2WO0 A;  4R9L A;  4EXR A;  1HKX A;  3HK4 A;  1FGM A;  3LML A;  4O3V A;  4BTW A;  2QA4 3;  4XBX A;  1QMA A;  3FF0 A;  3T8N A;  1W6C A;  1A67 A;  2C11 A;  4HM3 B;  1Q40 A;  3D9R A;  2D1W A;  5G2G A;  3UNL A;  3V99 A;  3WDG B;  4HM7 B;  1CEW I;  1W01 A;  2BMQ B;  2KCD A;  3DUK A;  4NRE A;  2P09 A;  2SBL A;  3FGY A;  3IPT A;  3EF8 A;  3PCR A;  3DGM A;  1VQ7 3;  3S27 A;  1KC8 4;  4RBN A;  3CD6 3;  3FG4 A;  2P0M A;  1WMP A;  4XBT A;  1VQO 3;  3L0R A;  4FMB A;  1CYV A;  2IA7 A;  3GZB A;  4TX4 A;  3KE7 A;  5ELU A;  1STD A;  2Z76 A;  2OWP A;  2F98 A;  2C10 A;  3CNX A;  5CF2 A;  4H61 A;  4OK0 A;  3AMO B;  5AEU B;  4GL6 A;  5D83 A;  4KFD A;  3WMD A;  4HM8 B;  4HM4 B;  4EYC A;  1IU7 A;  3CCU 3;  1UI7 A;  5IER A;  2D42 A;  1OPY A;  4L7K A;  5CLK A;  2GBX B;  3S5C A;  3F7X A;  5AII A;  2OTJ 3;  1TFO A;  4PEJ A;  3CCS 3;  5ELJ A;  1JNQ A;  1OHP A;  1OHO A;  1GD4 A;  3X41 A;  2IUK A;  3S67 A;  1EQK A;  4MEI A;  2XGN A;  1R4C A;  3SOA A;  2CK3 H;  2W56 A;  4HYZ A;  1MNL A;  3BNC A;  1A90 A;  3B4P A;  5STD A;  1ULI B;  3X3Y A;  1JV2 B;  1TP6 A;  2JDI H;  3Q2P A;  4FCJ A;  2JQ5 A;  4ZM8 A;  3CCV 3;  1UW1 A;  1W4N A;  4L8O A;  4WYK B;  2OCT A;  3LTB A;  1YHQ 3;  4O02 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...