3LTCA

X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.0 a by multi-wavelength anomalous dispersion
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP BINDING PROTEIN-DX
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltcA00
3DGMA 3DGNA 3LTCA 3LT8A 3LTBA 2P05A 2P09A 3LTAA 1UW1A 3DGLA 3DGOA 3LT9A 3LTDA 2P0XA
chains in the Genus database with same CATH superfamily
2ZL8A 2W56A 1JB5A 3FKAA 4MJDA 4R1KA 5KP4A 2MF7A 1US1A 1MOLA 1OCVA 1T2HA 3SVAA 1EKMA 2P38A 1CH0A 3X41A 1YJ93 2IY2A 3K5TA 3GZXB 2OTJ3 1IQXA 3NUVA 4J5KA 1RRHA 2CG1A 5BVBA 3K9MC 4WP5A 3CU3A 3LZAA 1NNVA 3ECFA 1D6ZA 1JZOA 2HMNB 2YFLB 4MMXB 2BU4A 4TX4A 1OHOA 1BGSA 4H3UA 3S27A 1STFI 1FYSA 3AGOA 1FZUA 3MPHA 6STDA 1GY6A 4G1MB 3UNLA 1DMNA 1FUWA 1TP6A 5EQLA 1NO3A 1IV7A 2WO0A 4O8SA 3I553 1BUJA 1UCJA 3AMOB 2IYJA 3B4OA 3F8XA 3HIIA 2Z7AA 3GZRA 1LRAA 1SIHA 1S723 3DGMA 3EHCA 3A76A 1BSBA 1TFOA 2F99A 3PZWA 2F98A 2AADA 3RGRA 3ZG5A 3FH1A 4R9LA 1IT7A 1RGAA 2BHMA 3GAXA 2D42A 4U13A 2RNTA 3DMCA 3NM7A 2P09A 1RGHA 3STDA 1DVDA 2CG0A 3EBTA 3CD63 3CC43 5EVHA 3HK4A 3RDEA 1QJGA 3JUPA 3K7CA 5AIGA 4ILFA 4WWUC 2XGNA 2W9QA 4STDA 2RCDA 2XSHB 3V98A 3QK9A 5CXOA 1KWIA 1ASKA 4IIAA 5BU4A 2UUGC 4CPKA 1ULIB 1IVWA 3DGYA 1ZO2A 1IVUA 3RNTA 3NX0A 3F9SA 1A67A 1WMOA 1K28A 4HZBB 1YVBI 3EQQB 1TIJA 1RN4A 4IT7A 4LEHA 2FXTA 1E3VA 1C54A 4OUQA 1MGRA 5KP3A 3DXOA 3D5IA 4RNTA 4XB5A 1BRJA 1Q864 3OXAA 1BNSA 2HMKB 3G713 1TRQA 2F5MA 3CCQ3 5HGRA 1LXEA 4WYKB 3E99A 3AHSA 3IMAB 3G16A 4HM3B 4R4KA 1RNTA 1KSIA 3T0UA 5BXQA 2IA7A 3CPW2 2E2UA 3BNCA 5IG4A 1I2GA 1QMAA 4AEQA 3D3LA 4HM7B 1OHSA 1YJN3 5IW9A 1MWTA 2ZHXB 1OGXA 3CCV3 2IMJA 1VZZA 3LT9A 1YVSA 2Z77A 4LMIA 1BRKA 4EBGA 1X1WA 3WA3A 3CCS3 4MMYB 1AR0A 1Q824 1VQ53 2OQEA 1BVIA 3GZBA 3DY5A 1K734 3LTBA 3PGBA 3G4S3 3WOFB 8RNTA 3NV0A 4BTXA 5JPUA 1BSDA 1VQ83 1OPYA 4EV5A 3LT8A 3CCM3 1GYBA 3NBRA 5IERA 1AV4A 2CFKA 2W03A 1BRNL 3BB9A 3PYJA 1JJ22 3UL6A 4EC6A 1Q7Y4 1JBTA 1IDPA 1MWSA 4QWTA 4FCJA 2J8XB 1U5OA 4I4KA 3HOHA 1IU7A 1BNIA 2GEXA 4J9AA 3SYUA 3V99A 3LYGA 1OHPA 2R41A 1FUSA 2CFGA 1J2BA 1AVKA 3F14A 7STDA 5G1KA 2MC8A 1M904 1CEWI 2A15A 1BAOA 1JBRA 4N6V0 1GD3A 1WTHA 1ISKA 7GSPA 1HZ1A 4LSOA 1SJWA 3N9HA 3WOEB 1UW1A 3V92A 1A2KA 3SEDA 1W2B2 1JN5B 2SARA 4BIRA 1O7NB 3N54B 4O3VA 1N9JA 3D5GA 1WMPA 1DETA 1LNHA 3LOYA 1S5AA 1I70A 3AHWA 1JKGA 1W7CA 5BIRA 3EC9A 3LXUX 4XDVA 3CC23 4HBRA 2Y73A 3OW22 2YFJB 3ER7A 5AIFA 2GXFA 2XF3A 1SARA 1BNEA 3JUMA 2SBLA 4N6NB 3X40A 2BNGA 5IEOA 1DVCA 3KE7A 5RNTA 3FF2A 2F86B 1I2EA 2OTL3 2F56A 1FGQA 1CYVA 4KFDA 3VSYA 1QVF2 3DGNA 3AGNA 3F7SA 1VQP3 3OX9A 1IQYA 2W2CA 3D79A 2RFRA 5ELUA 3ZG0A 1VQ93 3AMOA 3GSPA 1QVG2 4K1VA 3BNDA 1RDSA 2OOVA 5M19A 2KF3A 2XGLA 5IF6A 3HZPA 1B2MA 2QIYA 2W56B 1RLSA 2Y74A 3JVCA 2RSXA 1W5ZA 3LTCA 1T2IA 4JF8A 4AKYA 3CXC2 4Q53A 6GSPA 4LZIA 1QAFA 3EN1B 5FW5A 3F8HA 3G6E3 1BNJA 1FUTA 1GOYA 3KN4A 4XM4A 2V1LA 4HKVB 4DKIA 2RBIA 1EA2A 3LH4A 1UGHI 3S29A 1NJI4 1JBSA 1AVLA 1QAKA 1B2UA 1Q40B 4XDWA 3MKIA 1L5GB 1V58A 3WHOA 1FGOA 2LYXA 1ZS7A 3Q3FA 4HYZA 4HJLB 3WDGB 5IEPA 3BNBA 3GRDA 1ZX2A 3KCHA 4AKZA 1GSPA 1LQGC 3K0ZA 3X3XA 1YI23 2I9WA 1ROVA 3OWUA 4EV2A 5D81A 4HM2B 1W00A 3NHXA 1D6YA 1SPUA 2OOVC 5AEUB 3DGOA 1RGFA 1UI7A 2XR8B 2HMMB 1AQZA 3JUOA 1C7HA 2L4VA 3F7XA 3FG3A 4HM8B 1W4NA 4K1UA 4XBXA 1DMMA 1BRHA 3NM2A 9RNTA 5I97A 1CQSA 2STDA 3EB8A 1VQ73 3EJVA 3MG1A 1NDOB 1RJOA 2BMOB 2L1SA 1MGWA 2QGUA 3DUKA 3EF8A 2IUKA 4N6OB 1Y4KA 2BO9B 2W9PA 4H61A 1RSNA 1SIIA 4KVHA 5AYSC 2CFWA 4FCMA 3OWSA 2PZVA 1EQKA 4LGQA 1JRQA 2UX0A 2UGIA 1O7WB 4RBNA 3RGAA 1ULJB 1VQM3 3T8NA 1UI8A 2JDIH 3CMA3 3GWRA 1MNLA 2P0MA 4BU4A 7RNTA 2ML6A 3BNEA 1AY7A 3WR2A 3CCL3 1I0XA 4RNYA 5FGOA 5IG5A 2XFSA 1FGRA 4HOHA 3NXJA 3JUQA 1IYYA 1X1YA 2WOFA 8CHOA 5STDA 1NB3I 5DREA 3B8LA 1X1UA 3I563 1RCKA 4N3VA 2GU1A 3X42A 1OUNA 3SX1A 3CPOA 1G0TA 4HM5B 2Z6BA 3ROBA 4R9KA 3D4AA 2INXA 4NHFA 1VQL3 1A90A 1RGKA 2C4BA 1RN1A 1A2VA 1K8A4 1NB5I 2CWTA 3KFQC 1R4YA 3MWZA 1U8CB 2HOHA 3DM8A 3DH2A 1BRGA 1FGTA 3Q2PA 4JRFA 1RCLA 4N6LA 1KC84 2XRXB 2M7OA 1OH0A 2IUJA 1FA3A 1YIT3 5TGNA 2O9UX 1YGEA 1GMPA 2GSPA 5DRVA 3VGNA 3WA2X 3EBYA 1UDII 2CWUA 3KSPA 3QRDA 1N5HA 1OF5B 4WFOA 1K9M4 4GL6A 2GU3A 1IQ8A 1JZDA 1FGMA 2CC3A 1ZGXA 2HMLB 4KFEA 1TRPA 3B7CA 3BU4A 4CCVA 4FMCA 2H0HA 3S67A 5EEOA 5JPPA 1BNRA 5D83A 1Q9EA 3PS8A 4K90B 1IT8A 1QALA 5AYRB 1BSCA 2XFTA 1JV2B 3LMLA 1TTOA 3K63A 1JN5A 3FG1A 2CFDA 3NV0B 4NPBA 4BL3A 1NU3A 3F40A 3CCE3 4N6TA 2QEX3 3LTDA 2KF6A 4OK0A 1HYFA 2JQ5A 4IPBA 5M18A 1TJDA 2W6JH 2F5WA 4CDLA 1B27A 2ML5A 3PCSA 1I3IA 1LOWA 5LC7A 2H0IA 1GY5A 4KZ1A 3U1WA 3VF1A 1YHQ3 1M1K4 3NBJA 5G1LA 1JNQA 1BRIA 3IJEB 4GSPA 5IENA 1UCKA 1B20A 1X1XA 2B1XB 1SQWA 2P05A 4J5GA 1BNGA 4O02B 1UUWB 2ZDJA 3UJMA 1FW7A 3FSDA 3S5CA 4HM1B 1VQ63 3BLZA 4CJNA 1I0VA 1PU4A 3N8BA 1VQO3 1BNFA 2CHCA 5HOHA 3CC73 3WODG 1RMSA 1LOXA 2E2TA 4XBYA 3LTAA 2O3OA 4HVNA 4FMBA 2XEPA 4X2HA 1VQ43 3SXXA 1RTUA 1Q42A 3BIRA 5AIIA 1E3RA 1BU4A 1T5YA 3FG4A 1RGCA 3HIGA 1JKGB 1OGZA 3NQZA 4L7KA 1E97A 1Q40A 1W01A 2BT3A 3UB1A 2CIUA 1WNHA 1OACA 1W2ZA 5M1AA 2HMJB 3T8UA 4RNZA 2RGQA 5CF2A 1B2ZA 3CNXA 5JBSA 1I8VA 3CCU3 3URPA 1RGLA 1IK3A 2CX1A 2PNCA 3H3HA 1W6CA 3OV4A 2LQVA 2FGTA 2BMRB 1MWUA 1LOYA 1GMRA 1M9GA 2GBWB 2P0XA 3EN8A 4HAAA 3TDGA 2B24B 2CW9A 2Q07A 3OWYA 5AIHA 3JUNA 1IVVA 1BSEA 3B4PA 3L0RA 5LC6A 1ROAA 3CCJ3 1O7PB 3Q1CA 1PYLA 1BRSA 3MG2A 4HM0B 1VQN3 4KFFA 1IVXA 3FGYA 4KT3B 1EEJA 4GHOA 2KXGA 1WQLB 2KAAA 3FZWA 5IG0A 1G02A 1I2FA 1KQS2 5D82A 1N8QA 1A2PA 4FR9A 4X2OA 3X3YA 1GS3A 2CH9A 4J8TA 5CK6A 4WYKA 5A0OB 2KF5A 5IG3A 2K0MA 3FF0A 3J7Yd 3HX8A 3IPTA 1GOUA 1Q7HA 1B3SA 1BOXA 2E2VA 3KZTA 3KIIA 4LYLB 1KD14 4ORLA 1LNIA 2GBXB 2OCTA 3MG3A 3DGLA 1DYUA 3MHEA 1I3FA 5CF1A 1RGGA 1RHLA 3KSED 1M1XB 1EG9B 2CWVA 3X3ZA 5GSPA 3I0YA 3A5EA 1HU9A 3HI7A 1Z1SA 3SLUA 1LVNA 3WMDA 4PEJA 1YGWA 1STDA 1BANA 4MEIA 1TU5A 5ELJA 3O8YA 1IV9A 1V57A 1EUIC 3CCR3 2YFIB 1O7HB 4HM4B 2BIRA 1R4CA 3CME3 3PXMA 4N6UA 1YIJ3 4EYCA 1V74A 2WGOA 3D9RA 2CK3H 3MYTA 3NBBA 2Z76A 1HKXA 2C11A 2ZA4A 1LOVA 2KCDA 1UUVB 2CX0A 4O2HA 2BMQB 1UGIA 2H0GA 3S28A 1N5PA 1PY3A 2CKFB 4BL2A 1O7MB 2F4YA 1VQK3 3FLJA 2W04A 3M8CA 3UL5A 1JB4A 1OF5A 2OWPA 1N8R4 1RKYA 2KF4A 4WHAA 2K54A 1RN7A 1F8NA 1UCIA 1O7GB 1T3BA 2XSOB 1N9EA 3EE1A 1LQMB 3G0KA 1B2XA 1W6GA 3GZYB 1UCLA 3KKGA 2GEYA 4FMAA 3NQYA 1WMNA 3FCSB 3PCRA 1PFPA 4K61A 4MMZB 1D6UA 1B2SA 1DE3A 1RGEA 3ZFZA 3MSOA 1Q814 2CFLA 1GOVA 4BTWA 5KP1A 3ALAA 1BUQA 1VQQA 1YNVX 1TFKA 1TUHA 3SOYA 5G2GA 1GD4A 2QA43 4OVMA 4ZM8A 1W6YA 4GB5A 4HM6B 4L8OA 1GMQA 1W02A 2K3DA 5AI1A 2FNQA 1JB2A 1BIRA 4EXRA 1UUGB 2W0QA 4HZ9B 1MWRA 3U97A 2AAEA 1GY7A 4N6MA 4FCZA 6RNTA 2XH9A 1K41A 4RZMA 5CLKA 1B21A 1G96A 2C10A 3Q90A 1NWWA 3EX9A 3G8ZA 2OQEC 4BTYA 3H51A 1DMQA 4XBTA 3SOAA 1RNBA 2WOHA 2R4IA 2HMOB 2D1WA 4NREA 1RRLA 5AEWB 2KRTA 2WGQA 4R80A 4EW5A 4FMDA 4L8PA 2YX9A 1YJW3 3CNMA 4I5QA 1CYUA 1BSAA 3DZLA
chains in the Genus database with same CATH topology
2ZL8A 2W56A 1JB5A 3FKAA 4MJDA 4R1KA 5KP4A 2MF7A 1US1A 1MOLA 1OCVA 3SVAA 1EKMA 2P38A 3X41A 1YJ93 3K5TA 3GZXB 2OTJ3 1IQXA 3NUVA 1RRHA 2CG1A 5BVBA 3K9MC 4WP5A 3CU3A 3LZAA 3ECFA 1D6ZA 2HMNB 2YFLB 4MMXB 4TX4A 1OHOA 4H3UA 3S27A 1STFI 3MPHA 6STDA 1GY6A 4G1MB 3UNLA 1DMNA 1FUWA 1TP6A 5EQLA 1NO3A 1IV7A 2WO0A 4O8SA 3I553 3AMOB 3B4OA 3F8XA 3HIIA 2Z7AA 3GZRA 1SIHA 1S723 3DGMA 3EHCA 3A76A 1TFOA 2F99A 3PZWA 2F98A 3RGRA 3FH1A 4R9LA 1IT7A 2BHMA 3GAXA 4U13A 2D42A 3DMCA 3NM7A 2P09A 3STDA 1DVDA 2CG0A 3EBTA 3CD63 3CC43 5EVHA 3HK4A 3RDEA 1QJGA 3JUPA 3K7CA 5AIGA 4WWUC 2XGNA 2W9QA 4STDA 2RCDA 2XSHB 3V98A 3QK9A 5CXOA 1KWIA 1ASKA 4IIAA 1ULIB 1IVWA 1ZO2A 1IVUA 3NX0A 3F9SA 1WMOA 1K28A 4HZBB 1YVBI 3EQQB 1TIJA 4LEHA 4IT7A 2FXTA 1E3VA 4OUQA 5KP3A 3DXOA 1Q864 4XB5A 3OXAA 2HMKB 3G713 3CCQ3 5HGRA 1LXEA 4WYKB 3E99A 3IMAB 4HM3B 3G16A 4R4KA 3T0UA 5BXQA 1KSIA 2IA7A 3CPW2 2E2UA 3BNCA 5IG4A 1QMAA 4AEQA 3D3LA 4HM7B 1OHSA 1YJN3 5IW9A 1OGXA 3CCV3 2IMJA 1VZZA 3LT9A 2Z77A 4LMIA 4EBGA 3WA3A 3CCS3 4MMYB 1AR0A 1Q824 1VQ53 2OQEA 3GZBA 3DY5A 1K734 3LTBA 3PGBA 3G4S3 3WOFB 3NV0A 4BTXA 5JPUA 1VQ83 1OPYA 4EV5A 3LT8A 3CCM3 1GYBA 3NBRA 5IERA 1AV4A 2CFKA 2W03A 3BB9A 3PYJA 1JJ22 3UL6A 4EC6A 1Q7Y4 1IDPA 4QWTA 4FCJA 1U5OA 4I4KA 1IU7A 4J9AA 2GEXA 3V99A 3LYGA 1OHPA 2CFGA 1J2BA 1AVKA 3F14A 7STDA 2MC8A 1M904 1CEWI 2A15A 4N6V0 1GD3A 1WTHA 1ISKA 4LSOA 1SJWA 3N9HA 3WOEB 1UW1A 3V92A 1A2KA 3SEDA 1W2B2 1JN5B 1O7NB 3N54B 4O3VA 1N9JA 1WMPA 1LNHA 3LOYA 1S5AA 1JKGA 1W7CA 3EC9A 3LXUX 4XDVA 3CC23 4HBRA 2Y73A 3OW22 2YFJB 3ER7A 5AIFA 2GXFA 2XF3A 3JUMA 2SBLA 4N6NB 3X40A 2BNGA 5IEOA 1DVCA 3KE7A 3FF2A 2F86B 2OTL3 1FGQA 1CYVA 4KFDA 3VSYA 1QVF2 3DGNA 3F7SA 1VQP3 3OX9A 1IQYA 2W2CA 5ELUA 2RFRA 1VQ93 3AMOA 1QVG2 4K1VA 3BNDA 2OOVA 2XGLA 5IF6A 3HZPA 2QIYA 2W56B 2Y74A 3JVCA 2RSXA 1W5ZA 3LTCA 4JF8A 4AKYA 3CXC2 4Q53A 4LZIA 1QAFA 3EN1B 5FW5A 3F8HA 3G6E3 3KN4A 4XM4A 2V1LA 4HKVB 1NJI4 3LH4A 1EA2A 3S29A 1AVLA 1QAKA 1Q40B 4XDWA 3MKIA 1L5GB 1FGOA 2LYXA 4HYZA 3WDGB 5IEPA 4HJLB 3BNBA 3GRDA 1ZX2A 4AKZA 3K0ZA 3X3XA 1YI23 2I9WA 1ROVA 3OWUA 4EV2A 5D81A 4HM2B 1W00A 3NHXA 1D6YA 1SPUA 2OOVC 5AEUB 3DGOA 1UI7A 2XR8B 2HMMB 3JUOA 1C7HA 2L4VA 3F7XA 3FG3A 4HM8B 1W4NA 4K1UA 4XBXA 1DMMA 3NM2A 5I97A 1CQSA 2STDA 3EB8A 1VQ73 3EJVA 3MG1A 1NDOB 1RJOA 2BMOB 2QGUA 3DUKA 3EF8A 2IUKA 4N6OB 1Y4KA 2BO9B 2W9PA 4H61A 1SIIA 4KVHA 5AYSC 2CFWA 4FCMA 3OWSA 2PZVA 1EQKA 4LGQA 1JRQA 2UX0A 4RBNA 1O7WB 3RGAA 1VQM3 1ULJB 3CMA3 3T8NA 1UI8A 2JDIH 3GWRA 2P0MA 1MNLA 2ML6A 3BNEA 3CCL3 4RNYA 5FGOA 5IG5A 2XFSA 1FGRA 3NXJA 3JUQA 2WOFA 8CHOA 5STDA 1NB3I 5DREA 3B8LA 3I563 4N3VA 2GU1A 3X42A 1OUNA 3SX1A 3CPOA 4HM5B 2Z6BA 3ROBA 4R9KA 2INXA 4NHFA 1VQL3 1A90A 1A2VA 1K8A4 1NB5I 2CWTA 3KFQC 3MWZA 1U8CB 3DM8A 1FGTA 3Q2PA 4JRFA 4N6LA 1KC84 2XRXB 2M7OA 1OH0A 2IUJA 1FA3A 1YIT3 5TGNA 2O9UX 1YGEA 5DRVA 3WA2X 3VGNA 3EBYA 3KSPA 2CWUA 3QRDA 1N5HA 1OF5B 4WFOA 1K9M4 4GL6A 2GU3A 1IQ8A 2CC3A 1FGMA 4KFEA 2HMLB 4CCVA 3B7CA 4FMCA 3S67A 5EEOA 5JPPA 5D83A 3PS8A 4K90B 1IT8A 1QALA 5AYRB 2XFTA 1JV2B 3LMLA 3K63A 1JN5A 3FG1A 2CFDA 3NV0B 1NU3A 3F40A 3CCE3 4N6TA 2QEX3 3LTDA 4OK0A 2JQ5A 4IPBA 2W6JH 4CDLA 2ML5A 3PCSA 3VF1A 5LC7A 3U1WA 1GY5A 4KZ1A 1YHQ3 1M1K4 3NBJA 1JNQA 3IJEB 5IENA 2B1XB 1SQWA 2P05A 4O02B 1UUWB 2ZDJA 3UJMA 3FSDA 3S5CA 4HM1B 1VQ63 3BLZA 1PU4A 3N8BA 1VQO3 2CHCA 3CC73 3WODG 2E2TA 1LOXA 4XBYA 3LTAA 2O3OA 4HVNA 4FMBA 2XEPA 4X2HA 1VQ43 3SXXA 1Q42A 5AIIA 1E3RA 1T5YA 3FG4A 3HIGA 1JKGB 1OGZA 3NQZA 4L7KA 1E97A 1Q40A 1W01A 2BT3A 3UB1A 2CIUA 1WNHA 1OACA 1W2ZA 2HMJB 3T8UA 4RNZA 2RGQA 5CF2A 3CNXA 5JBSA 3CCU3 1IK3A 2PNCA 3H3HA 1W6CA 2LQVA 2FGTA 2BMRB 2GBWB 1M9GA 3EN8A 2P0XA 1A67A 3TDGA 2B24B 2CW9A 2Q07A 3OWYA 5AIHA 3JUNA 1IVVA 3B4PA 3L0RA 5LC6A 1ROAA 3CCJ3 1O7PB 3Q1CA 1VQN3 3MG2A 4HM0B 4KFFA 1IVXA 3FGYA 2KXGA 1WQLB 3FZWA 5IG0A 1KQS2 5D82A 1N8QA 4X2OA 4FR9A 3X3YA 1GS3A 2CH9A 4J8TA 5CK6A 4WYKA 5A0OB 5IG3A 3J7Yd 2K0MA 3FF0A 3HX8A 3IPTA 2E2VA 3KZTA 3KIIA 1KD14 4ORLA 2GBXB 2OCTA 3MG3A 3MHEA 3DGLA 1DYUA 5CF1A 3KSED 1M1XB 1EG9B 2CWVA 3X3ZA 3I0YA 1HU9A 3HI7A 1Z1SA 3SLUA 1LVNA 3WMDA 4PEJA 1STDA 4MEIA 1TU5A 5ELJA 3O8YA 1IV9A 3CCR3 2YFIB 1O7HB 4HM4B 1R4CA 3CME3 3PXMA 4N6UA 1YIJ3 4EYCA 1V74A 2WGOA 3D9RA 2CK3H 3MYTA 3NBBA 2Z76A 1HKXA 2C11A 2KCDA 4O2HA 1UUVB 2BMQB 3S28A 1N5PA 2CKFB 1O7MB 1VQK3 3FLJA 2W04A 3M8CA 3UL5A 1JB4A 1OF5A 2OWPA 1N8R4 1RKYA 4WHAA 2K54A 1RN7A 1F8NA 1O7GB 2XSOB 1N9EA 3EE1A 3G0KA 3GZYB 1W6GA 3KKGA 2GEYA 4FMAA 3NQYA 1WMNA 3FCSB 3PCRA 1PFPA 4K61A 4MMZB 1D6UA 3MSOA 1Q814 2CFLA 4BTWA 5KP1A 3ALAA 1BUQA 1TFKA 1TUHA 3SOYA 5G2GA 1GD4A 2QA43 4OVMA 4ZM8A 1W6YA 4GB5A 4HM6B 4L8OA 1W02A 5AI1A 2FNQA 1JB2A 4EXRA 2W0QA 4HZ9B 3U97A 1GY7A 4N6MA 4FCZA 2XH9A 1K41A 4RZMA 5CLKA 1G96A 2C10A 3Q90A 1NWWA 3EX9A 3G8ZA 2OQEC 4BTYA 3H51A 1DMQA 4XBTA 3SOAA 2WOHA 2R4IA 2HMOB 2D1WA 4NREA 1RRLA 5AEWB 2KRTA 2WGQA 4R80A 1YJW3 4FMDA 4L8PA 2YX9A 3CNMA 1CYUA 3OV4A 3DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGM A;  3DGN A;  3LTC A;  3LT8 A;  3LTB A;  2P05 A;  2P09 A;  3LTA A;  1UW1 A;  3DGL A;  3DGO A;  3LT9 A;  3LTD A;  2P0X A; 
#chains in the Genus database with same CATH topology
 2ZL8 A;  2W56 A;  1JB5 A;  3FKA A;  4MJD A;  4R1K A;  5KP4 A;  2MF7 A;  1US1 A;  1MOL A;  1OCV A;  1T2H A;  3SVA A;  1EKM A;  2P38 A;  1CH0 A;  3X41 A;  1YJ9 3;  2IY2 A;  3K5T A;  3GZX B;  2OTJ 3;  1IQX A;  3NUV A;  4J5K A;  1RRH A;  2CG1 A;  5BVB A;  3K9M C;  4WP5 A;  3CU3 A;  3LZA A;  1NNV A;  3ECF A;  1D6Z A;  1JZO A;  2HMN B;  2YFL B;  4MMX B;  2BU4 A;  4TX4 A;  1OHO A;  1BGS A;  4H3U A;  3S27 A;  1STF I;  1FYS A;  3AGO A;  1FZU A;  3MPH A;  6STD A;  1GY6 A;  4G1M B;  3UNL A;  1DMN A;  1FUW A;  1TP6 A;  5EQL A;  1NO3 A;  1IV7 A;  2WO0 A;  4O8S A;  3I55 3;  1BUJ A;  1UCJ A;  3AMO B;  2IYJ A;  3B4O A;  3F8X A;  3HII A;  2Z7A A;  3GZR A;  1LRA A;  1SIH A;  1S72 3;  3DGM A;  3EHC A;  3A76 A;  1BSB A;  1TFO A;  2F99 A;  3PZW A;  2F98 A;  2AAD A;  3RGR A;  3ZG5 A;  3FH1 A;  4R9L A;  1IT7 A;  1RGA A;  2BHM A;  3GAX A;  2D42 A;  4U13 A;  2RNT A;  3DMC A;  3NM7 A;  2P09 A;  1RGH A;  3STD A;  1DVD A;  2CG0 A;  3EBT A;  3CD6 3;  3CC4 3;  5EVH A;  3HK4 A;  3RDE A;  1QJG A;  3JUP A;  3K7C A;  5AIG A;  4ILF A;  4WWU C;  2XGN A;  2W9Q A;  4STD A;  2RCD A;  2XSH B;  3V98 A;  3QK9 A;  5CXO A;  1KWI A;  1ASK A;  4IIA A;  5BU4 A;  2UUG C;  4CPK A;  1ULI B;  1IVW A;  3DGY A;  1ZO2 A;  1IVU A;  3RNT A;  3NX0 A;  3F9S A;  1A67 A;  1WMO A;  1K28 A;  4HZB B;  1YVB I;  3EQQ B;  1TIJ A;  1RN4 A;  4IT7 A;  4LEH A;  2FXT A;  1E3V A;  1C54 A;  4OUQ A;  1MGR A;  5KP3 A;  3DXO A;  3D5I A;  4RNT A;  4XB5 A;  1BRJ A;  1Q86 4;  3OXA A;  1BNS A;  2HMK B;  3G71 3;  1TRQ A;  2F5M A;  3CCQ 3;  5HGR A;  1LXE A;  4WYK B;  3E99 A;  3AHS A;  3IMA B;  3G16 A;  4HM3 B;  4R4K A;  1RNT A;  1KSI A;  3T0U A;  5BXQ A;  2IA7 A;  3CPW 2;  2E2U A;  3BNC A;  5IG4 A;  1I2G A;  1QMA A;  4AEQ A;  3D3L A;  4HM7 B;  1OHS A;  1YJN 3;  5IW9 A;  1MWT A;  2ZHX B;  1OGX A;  3CCV 3;  2IMJ A;  1VZZ A;  3LT9 A;  1YVS A;  2Z77 A;  4LMI A;  1BRK A;  4EBG A;  1X1W A;  3WA3 A;  3CCS 3;  4MMY B;  1AR0 A;  1Q82 4;  1VQ5 3;  2OQE A;  1BVI A;  3GZB A;  3DY5 A;  1K73 4;  3LTB A;  3PGB A;  3G4S 3;  3WOF B;  8RNT A;  3NV0 A;  4BTX A;  5JPU A;  1BSD A;  1VQ8 3;  1OPY A;  4EV5 A;  3LT8 A;  3CCM 3;  1GYB A;  3NBR A;  5IER A;  1AV4 A;  2CFK A;  2W03 A;  1BRN L;  3BB9 A;  3PYJ A;  1JJ2 2;  3UL6 A;  4EC6 A;  1Q7Y 4;  1JBT A;  1IDP A;  1MWS A;  4QWT A;  4FCJ A;  2J8X B;  1U5O A;  4I4K A;  3HOH A;  1IU7 A;  1BNI A;  2GEX A;  4J9A A;  3SYU A;  3V99 A;  3LYG A;  1OHP A;  2R41 A;  1FUS A;  2CFG A;  1J2B A;  1AVK A;  3F14 A;  7STD A;  5G1K A;  2MC8 A;  1M90 4;  1CEW I;  2A15 A;  1BAO A;  1JBR A;  4N6V 0;  1GD3 A;  1WTH A;  1ISK A;  7GSP A;  1HZ1 A;  4LSO A;  1SJW A;  3N9H A;  3WOE B;  1UW1 A;  3V92 A;  1A2K A;  3SED A;  1W2B 2;  1JN5 B;  2SAR A;  4BIR A;  1O7N B;  3N54 B;  4O3V A;  1N9J A;  3D5G A;  1WMP A;  1DET A;  1LNH A;  3LOY A;  1S5A A;  1I70 A;  3AHW A;  1JKG A;  1W7C A;  5BIR A;  3EC9 A;  3LXU X;  4XDV A;  3CC2 3;  4HBR A;  2Y73 A;  3OW2 2;  2YFJ B;  3ER7 A;  5AIF A;  2GXF A;  2XF3 A;  1SAR A;  1BNE A;  3JUM A;  2SBL A;  4N6N B;  3X40 A;  2BNG A;  5IEO A;  1DVC A;  3KE7 A;  5RNT A;  3FF2 A;  2F86 B;  1I2E A;  2OTL 3;  2F56 A;  1FGQ A;  1CYV A;  4KFD A;  3VSY A;  1QVF 2;  3DGN A;  3AGN A;  3F7S A;  1VQP 3;  3OX9 A;  1IQY A;  2W2C A;  3D79 A;  2RFR A;  5ELU A;  3ZG0 A;  1VQ9 3;  3AMO A;  3GSP A;  1QVG 2;  4K1V A;  3BND A;  1RDS A;  2OOV A;  5M19 A;  2KF3 A;  2XGL A;  5IF6 A;  3HZP A;  1B2M A;  2QIY A;  2W56 B;  1RLS A;  2Y74 A;  3JVC A;  2RSX A;  1W5Z A;  3LTC A;  1T2I A;  4JF8 A;  4AKY A;  3CXC 2;  4Q53 A;  6GSP A;  4LZI A;  1QAF A;  3EN1 B;  5FW5 A;  3F8H A;  3G6E 3;  1BNJ A;  1FUT A;  1GOY A;  3KN4 A;  4XM4 A;  2V1L A;  4HKV B;  4DKI A;  2RBI A;  1EA2 A;  3LH4 A;  1UGH I;  3S29 A;  1NJI 4;  1JBS A;  1AVL A;  1QAK A;  1B2U A;  1Q40 B;  4XDW A;  3MKI A;  1L5G B;  1V58 A;  3WHO A;  1FGO A;  2LYX A;  1ZS7 A;  3Q3F A;  4HYZ A;  4HJL B;  3WDG B;  5IEP A;  3BNB A;  3GRD A;  1ZX2 A;  3KCH A;  4AKZ A;  1GSP A;  1LQG C;  3K0Z A;  3X3X A;  1YI2 3;  2I9W A;  1ROV A;  3OWU A;  4EV2 A;  5D81 A;  4HM2 B;  1W00 A;  3NHX A;  1D6Y A;  1SPU A;  2OOV C;  5AEU B;  3DGO A;  1RGF A;  1UI7 A;  2XR8 B;  2HMM B;  1AQZ A;  3JUO A;  1C7H A;  2L4V A;  3F7X A;  3FG3 A;  4HM8 B;  1W4N A;  4K1U A;  4XBX A;  1DMM A;  1BRH A;  3NM2 A;  9RNT A;  5I97 A;  1CQS A;  2STD A;  3EB8 A;  1VQ7 3;  3EJV A;  3MG1 A;  1NDO B;  1RJO A;  2BMO B;  2L1S A;  1MGW A;  2QGU A;  3DUK A;  3EF8 A;  2IUK A;  4N6O B;  1Y4K A;  2BO9 B;  2W9P A;  4H61 A;  1RSN A;  1SII A;  4KVH A;  5AYS C;  2CFW A;  4FCM A;  3OWS A;  2PZV A;  1EQK A;  4LGQ A;  1JRQ A;  2UX0 A;  2UGI A;  1O7W B;  4RBN A;  3RGA A;  1ULJ B;  1VQM 3;  3T8N A;  1UI8 A;  2JDI H;  3CMA 3;  3GWR A;  1MNL A;  2P0M A;  4BU4 A;  7RNT A;  2ML6 A;  3BNE A;  1AY7 A;  3WR2 A;  3CCL 3;  1I0X A;  4RNY A;  5FGO A;  5IG5 A;  2XFS A;  1FGR A;  4HOH A;  3NXJ A;  3JUQ A;  1IYY A;  1X1Y A;  2WOF A;  8CHO A;  5STD A;  1NB3 I;  5DRE A;  3B8L A;  1X1U A;  3I56 3;  1RCK A;  4N3V A;  2GU1 A;  3X42 A;  1OUN A;  3SX1 A;  3CPO A;  1G0T A;  4HM5 B;  2Z6B A;  3ROB A;  4R9K A;  3D4A A;  2INX A;  4NHF A;  1VQL 3;  1A90 A;  1RGK A;  2C4B A;  1RN1 A;  1A2V A;  1K8A 4;  1NB5 I;  2CWT A;  3KFQ C;  1R4Y A;  3MWZ A;  1U8C B;  2HOH A;  3DM8 A;  3DH2 A;  1BRG A;  1FGT A;  3Q2P A;  4JRF A;  1RCL A;  4N6L A;  1KC8 4;  2XRX B;  2M7O A;  1OH0 A;  2IUJ A;  1FA3 A;  1YIT 3;  5TGN A;  2O9U X;  1YGE A;  1GMP A;  2GSP A;  5DRV A;  3VGN A;  3WA2 X;  3EBY A;  1UDI I;  2CWU A;  3KSP A;  3QRD A;  1N5H A;  1OF5 B;  4WFO A;  1K9M 4;  4GL6 A;  2GU3 A;  1IQ8 A;  1JZD A;  1FGM A;  2CC3 A;  1ZGX A;  2HML B;  4KFE A;  1TRP A;  3B7C A;  3BU4 A;  4CCV A;  4FMC A;  2H0H A;  3S67 A;  5EEO A;  5JPP A;  1BNR A;  5D83 A;  1Q9E A;  3PS8 A;  4K90 B;  1IT8 A;  1QAL A;  5AYR B;  1BSC A;  2XFT A;  1JV2 B;  3LML A;  1TTO A;  3K63 A;  1JN5 A;  3FG1 A;  2CFD A;  3NV0 B;  4NPB A;  4BL3 A;  1NU3 A;  3F40 A;  3CCE 3;  4N6T A;  2QEX 3;  3LTD A;  2KF6 A;  4OK0 A;  1HYF A;  2JQ5 A;  4IPB A;  5M18 A;  1TJD A;  2W6J H;  2F5W A;  4CDL A;  1B27 A;  2ML5 A;  3PCS A;  1I3I A;  1LOW A;  5LC7 A;  2H0I A;  1GY5 A;  4KZ1 A;  3U1W A;  3VF1 A;  1YHQ 3;  1M1K 4;  3NBJ A;  5G1L A;  1JNQ A;  1BRI A;  3IJE B;  4GSP A;  5IEN A;  1UCK A;  1B20 A;  1X1X A;  2B1X B;  1SQW A;  2P05 A;  4J5G A;  1BNG A;  4O02 B;  1UUW B;  2ZDJ A;  3UJM A;  1FW7 A;  3FSD A;  3S5C A;  4HM1 B;  1VQ6 3;  3BLZ A;  4CJN A;  1I0V A;  1PU4 A;  3N8B A;  1VQO 3;  1BNF A;  2CHC A;  5HOH A;  3CC7 3;  3WOD G;  1RMS A;  1LOX A;  2E2T A;  4XBY A;  3LTA A;  2O3O A;  4HVN A;  4FMB A;  2XEP A;  4X2H A;  1VQ4 3;  3SXX A;  1RTU A;  1Q42 A;  3BIR A;  5AII A;  1E3R A;  1BU4 A;  1T5Y A;  3FG4 A;  1RGC A;  3HIG A;  1JKG B;  1OGZ A;  3NQZ A;  4L7K A;  1E97 A;  1Q40 A;  1W01 A;  2BT3 A;  3UB1 A;  2CIU A;  1WNH A;  1OAC A;  1W2Z A;  5M1A A;  2HMJ B;  3T8U A;  4RNZ A;  2RGQ A;  5CF2 A;  1B2Z A;  3CNX A;  5JBS A;  1I8V A;  3CCU 3;  3URP A;  1RGL A;  1IK3 A;  2CX1 A;  2PNC A;  3H3H A;  1W6C A;  3OV4 A;  2LQV A;  2FGT A;  2BMR B;  1MWU A;  1LOY A;  1GMR A;  1M9G A;  2GBW B;  2P0X A;  3EN8 A;  4HAA A;  3TDG A;  2B24 B;  2CW9 A;  2Q07 A;  3OWY A;  5AIH A;  3JUN A;  1IVV A;  1BSE A;  3B4P A;  3L0R A;  5LC6 A;  1ROA A;  3CCJ 3;  1O7P B;  3Q1C A;  1PYL A;  1BRS A;  3MG2 A;  4HM0 B;  1VQN 3;  4KFF A;  1IVX A;  3FGY A;  4KT3 B;  1EEJ A;  4GHO A;  2KXG A;  1WQL B;  2KAA A;  3FZW A;  5IG0 A;  1G02 A;  1I2F A;  1KQS 2;  5D82 A;  1N8Q A;  1A2P A;  4FR9 A;  4X2O A;  3X3Y A;  1GS3 A;  2CH9 A;  4J8T A;  5CK6 A;  4WYK A;  5A0O B;  2KF5 A;  5IG3 A;  2K0M A;  3FF0 A;  3J7Y d;  3HX8 A;  3IPT A;  1GOU A;  1Q7H A;  1B3S A;  1BOX A;  2E2V A;  3KZT A;  3KII A;  4LYL B;  1KD1 4;  4ORL A;  1LNI A;  2GBX B;  2OCT A;  3MG3 A;  3DGL A;  1DYU A;  3MHE A;  1I3F A;  5CF1 A;  1RGG A;  1RHL A;  3KSE D;  1M1X B;  1EG9 B;  2CWV A;  3X3Z A;  5GSP A;  3I0Y A;  3A5E A;  1HU9 A;  3HI7 A;  1Z1S A;  3SLU A;  1LVN A;  3WMD A;  4PEJ A;  1YGW A;  1STD A;  1BAN A;  4MEI A;  1TU5 A;  5ELJ A;  3O8Y A;  1IV9 A;  1V57 A;  1EUI C;  3CCR 3;  2YFI B;  1O7H B;  4HM4 B;  2BIR A;  1R4C A;  3CME 3;  3PXM A;  4N6U A;  1YIJ 3;  4EYC A;  1V74 A;  2WGO A;  3D9R A;  2CK3 H;  3MYT A;  3NBB A;  2Z76 A;  1HKX A;  2C11 A;  2ZA4 A;  1LOV A;  2KCD A;  1UUV B;  2CX0 A;  4O2H A;  2BMQ B;  1UGI A;  2H0G A;  3S28 A;  1N5P A;  1PY3 A;  2CKF B;  4BL2 A;  1O7M B;  2F4Y A;  1VQK 3;  3FLJ A;  2W04 A;  3M8C A;  3UL5 A;  1JB4 A;  1OF5 A;  2OWP A;  1N8R 4;  1RKY A;  2KF4 A;  4WHA A;  2K54 A;  1RN7 A;  1F8N A;  1UCI A;  1O7G B;  1T3B A;  2XSO B;  1N9E A;  3EE1 A;  1LQM B;  3G0K A;  1B2X A;  1W6G A;  3GZY B;  1UCL A;  3KKG A;  2GEY A;  4FMA A;  3NQY A;  1WMN A;  3FCS B;  3PCR A;  1PFP A;  4K61 A;  4MMZ B;  1D6U A;  1B2S A;  1DE3 A;  1RGE A;  3ZFZ A;  3MSO A;  1Q81 4;  2CFL A;  1GOV A;  4BTW A;  5KP1 A;  3ALA A;  1BUQ A;  1VQQ A;  1YNV X;  1TFK A;  1TUH A;  3SOY A;  5G2G A;  1GD4 A;  2QA4 3;  4OVM A;  4ZM8 A;  1W6Y A;  4GB5 A;  4HM6 B;  4L8O A;  1GMQ A;  1W02 A;  2K3D A;  5AI1 A;  2FNQ A;  1JB2 A;  1BIR A;  4EXR A;  1UUG B;  2W0Q A;  4HZ9 B;  1MWR A;  3U97 A;  2AAE A;  1GY7 A;  4N6M A;  4FCZ A;  6RNT A;  2XH9 A;  1K41 A;  4RZM A;  5CLK A;  1B21 A;  1G96 A;  2C10 A;  3Q90 A;  1NWW A;  3EX9 A;  3G8Z A;  2OQE C;  4BTY A;  3H51 A;  1DMQ A;  4XBT A;  3SOA A;  1RNB A;  2WOH A;  2R4I A;  2HMO B;  2D1W A;  4NRE A;  1RRL A;  5AEW B;  2KRT A;  2WGQ A;  4R80 A;  4EW5 A;  4FMD A;  4L8P A;  2YX9 A;  1YJW 3;  3CNM A;  4I5Q A;  1CYU A;  1BSA A;  3DZL A; 
#chains in the Genus database with same CATH homology
 2ZL8 A;  2W56 A;  1JB5 A;  3FKA A;  4MJD A;  4R1K A;  5KP4 A;  2MF7 A;  1US1 A;  1MOL A;  1OCV A;  3SVA A;  1EKM A;  2P38 A;  3X41 A;  1YJ9 3;  3K5T A;  3GZX B;  2OTJ 3;  1IQX A;  3NUV A;  1RRH A;  2CG1 A;  5BVB A;  3K9M C;  4WP5 A;  3CU3 A;  3LZA A;  3ECF A;  1D6Z A;  2HMN B;  2YFL B;  4MMX B;  4TX4 A;  1OHO A;  4H3U A;  3S27 A;  1STF I;  3MPH A;  6STD A;  1GY6 A;  4G1M B;  3UNL A;  1DMN A;  1FUW A;  1TP6 A;  5EQL A;  1NO3 A;  1IV7 A;  2WO0 A;  4O8S A;  3I55 3;  3AMO B;  3B4O A;  3F8X A;  3HII A;  2Z7A A;  3GZR A;  1SIH A;  1S72 3;  3DGM A;  3EHC A;  3A76 A;  1TFO A;  2F99 A;  3PZW A;  2F98 A;  3RGR A;  3FH1 A;  4R9L A;  1IT7 A;  2BHM A;  3GAX A;  4U13 A;  2D42 A;  3DMC A;  3NM7 A;  2P09 A;  3STD A;  1DVD A;  2CG0 A;  3EBT A;  3CD6 3;  3CC4 3;  5EVH A;  3HK4 A;  3RDE A;  1QJG A;  3JUP A;  3K7C A;  5AIG A;  4WWU C;  2XGN A;  2W9Q A;  4STD A;  2RCD A;  2XSH B;  3V98 A;  3QK9 A;  5CXO A;  1KWI A;  1ASK A;  4IIA A;  1ULI B;  1IVW A;  1ZO2 A;  1IVU A;  3NX0 A;  3F9S A;  1WMO A;  1K28 A;  4HZB B;  1YVB I;  3EQQ B;  1TIJ A;  4LEH A;  4IT7 A;  2FXT A;  1E3V A;  4OUQ A;  5KP3 A;  3DXO A;  1Q86 4;  4XB5 A;  3OXA A;  2HMK B;  3G71 3;  3CCQ 3;  5HGR A;  1LXE A;  4WYK B;  3E99 A;  3IMA B;  4HM3 B;  3G16 A;  4R4K A;  3T0U A;  5BXQ A;  1KSI A;  2IA7 A;  3CPW 2;  2E2U A;  3BNC A;  5IG4 A;  1QMA A;  4AEQ A;  3D3L A;  4HM7 B;  1OHS A;  1YJN 3;  5IW9 A;  1OGX A;  3CCV 3;  2IMJ A;  1VZZ A;  3LT9 A;  2Z77 A;  4LMI A;  4EBG A;  3WA3 A;  3CCS 3;  4MMY B;  1AR0 A;  1Q82 4;  1VQ5 3;  2OQE A;  3GZB A;  3DY5 A;  1K73 4;  3LTB A;  3PGB A;  3G4S 3;  3WOF B;  3NV0 A;  4BTX A;  5JPU A;  1VQ8 3;  1OPY A;  4EV5 A;  3LT8 A;  3CCM 3;  1GYB A;  3NBR A;  5IER A;  1AV4 A;  2CFK A;  2W03 A;  3BB9 A;  3PYJ A;  1JJ2 2;  3UL6 A;  4EC6 A;  1Q7Y 4;  1IDP A;  4QWT A;  4FCJ A;  1U5O A;  4I4K A;  1IU7 A;  4J9A A;  2GEX A;  3V99 A;  3LYG A;  1OHP A;  2CFG A;  1J2B A;  1AVK A;  3F14 A;  7STD A;  2MC8 A;  1M90 4;  1CEW I;  2A15 A;  4N6V 0;  1GD3 A;  1WTH A;  1ISK A;  4LSO A;  1SJW A;  3N9H A;  3WOE B;  1UW1 A;  3V92 A;  1A2K A;  3SED A;  1W2B 2;  1JN5 B;  1O7N B;  3N54 B;  4O3V A;  1N9J A;  1WMP A;  1LNH A;  3LOY A;  1S5A A;  1JKG A;  1W7C A;  3EC9 A;  3LXU X;  4XDV A;  3CC2 3;  4HBR A;  2Y73 A;  3OW2 2;  2YFJ B;  3ER7 A;  5AIF A;  2GXF A;  2XF3 A;  3JUM A;  2SBL A;  4N6N B;  3X40 A;  2BNG A;  5IEO A;  1DVC A;  3KE7 A;  3FF2 A;  2F86 B;  2OTL 3;  1FGQ A;  1CYV A;  4KFD A;  3VSY A;  1QVF 2;  3DGN A;  3F7S A;  1VQP 3;  3OX9 A;  1IQY A;  2W2C A;  5ELU A;  2RFR A;  1VQ9 3;  3AMO A;  1QVG 2;  4K1V A;  3BND A;  2OOV A;  2XGL A;  5IF6 A;  3HZP A;  2QIY A;  2W56 B;  2Y74 A;  3JVC A;  2RSX A;  1W5Z A;  3LTC A;  4JF8 A;  4AKY A;  3CXC 2;  4Q53 A;  4LZI A;  1QAF A;  3EN1 B;  5FW5 A;  3F8H A;  3G6E 3;  3KN4 A;  4XM4 A;  2V1L A;  4HKV B;  1NJI 4;  3LH4 A;  1EA2 A;  3S29 A;  1AVL A;  1QAK A;  1Q40 B;  4XDW A;  3MKI A;  1L5G B;  1FGO A;  2LYX A;  4HYZ A;  3WDG B;  5IEP A;  4HJL B;  3BNB A;  3GRD A;  1ZX2 A;  4AKZ A;  3K0Z A;  3X3X A;  1YI2 3;  2I9W A;  1ROV A;  3OWU A;  4EV2 A;  5D81 A;  4HM2 B;  1W00 A;  3NHX A;  1D6Y A;  1SPU A;  2OOV C;  5AEU B;  3DGO A;  1UI7 A;  2XR8 B;  2HMM B;  3JUO A;  1C7H A;  2L4V A;  3F7X A;  3FG3 A;  4HM8 B;  1W4N A;  4K1U A;  4XBX A;  1DMM A;  3NM2 A;  5I97 A;  1CQS A;  2STD A;  3EB8 A;  1VQ7 3;  3EJV A;  3MG1 A;  1NDO B;  1RJO A;  2BMO B;  2QGU A;  3DUK A;  3EF8 A;  2IUK A;  4N6O B;  1Y4K A;  2BO9 B;  2W9P A;  4H61 A;  1SII A;  4KVH A;  5AYS C;  2CFW A;  4FCM A;  3OWS A;  2PZV A;  1EQK A;  4LGQ A;  1JRQ A;  2UX0 A;  4RBN A;  1O7W B;  3RGA A;  1VQM 3;  1ULJ B;  3CMA 3;  3T8N A;  1UI8 A;  2JDI H;  3GWR A;  2P0M A;  1MNL A;  2ML6 A;  3BNE A;  3CCL 3;  4RNY A;  5FGO A;  5IG5 A;  2XFS A;  1FGR A;  3NXJ A;  3JUQ A;  2WOF A;  8CHO A;  5STD A;  1NB3 I;  5DRE A;  3B8L A;  3I56 3;  4N3V A;  2GU1 A;  3X42 A;  1OUN A;  3SX1 A;  3CPO A;  4HM5 B;  2Z6B A;  3ROB A;  4R9K A;  2INX A;  4NHF A;  1VQL 3;  1A90 A;  1A2V A;  1K8A 4;  1NB5 I;  2CWT A;  3KFQ C;  3MWZ A;  1U8C B;  3DM8 A;  1FGT A;  3Q2P A;  4JRF A;  4N6L A;  1KC8 4;  2XRX B;  2M7O A;  1OH0 A;  2IUJ A;  1FA3 A;  1YIT 3;  5TGN A;  2O9U X;  1YGE A;  5DRV A;  3WA2 X;  3VGN A;  3EBY A;  3KSP A;  2CWU A;  3QRD A;  1N5H A;  1OF5 B;  4WFO A;  1K9M 4;  4GL6 A;  2GU3 A;  1IQ8 A;  2CC3 A;  1FGM A;  4KFE A;  2HML B;  4CCV A;  3B7C A;  4FMC A;  3S67 A;  5EEO A;  5JPP A;  5D83 A;  3PS8 A;  4K90 B;  1IT8 A;  1QAL A;  5AYR B;  2XFT A;  1JV2 B;  3LML A;  3K63 A;  1JN5 A;  3FG1 A;  2CFD A;  3NV0 B;  1NU3 A;  3F40 A;  3CCE 3;  4N6T A;  2QEX 3;  3LTD A;  4OK0 A;  2JQ5 A;  4IPB A;  2W6J H;  4CDL A;  2ML5 A;  3PCS A;  3VF1 A;  5LC7 A;  3U1W A;  1GY5 A;  4KZ1 A;  1YHQ 3;  1M1K 4;  3NBJ A;  1JNQ A;  3IJE B;  5IEN A;  2B1X B;  1SQW A;  2P05 A;  4O02 B;  1UUW B;  2ZDJ A;  3UJM A;  3FSD A;  3S5C A;  4HM1 B;  1VQ6 3;  3BLZ A;  1PU4 A;  3N8B A;  1VQO 3;  2CHC A;  3CC7 3;  3WOD G;  2E2T A;  1LOX A;  4XBY A;  3LTA A;  2O3O A;  4HVN A;  4FMB A;  2XEP A;  4X2H A;  1VQ4 3;  3SXX A;  1Q42 A;  5AII A;  1E3R A;  1T5Y A;  3FG4 A;  3HIG A;  1JKG B;  1OGZ A;  3NQZ A;  4L7K A;  1E97 A;  1Q40 A;  1W01 A;  2BT3 A;  3UB1 A;  2CIU A;  1WNH A;  1OAC A;  1W2Z A;  2HMJ B;  3T8U A;  4RNZ A;  2RGQ A;  5CF2 A;  3CNX A;  5JBS A;  3CCU 3;  1IK3 A;  2PNC A;  3H3H A;  1W6C A;  2LQV A;  2FGT A;  2BMR B;  2GBW B;  1M9G A;  3EN8 A;  2P0X A;  1A67 A;  3TDG A;  2B24 B;  2CW9 A;  2Q07 A;  3OWY A;  5AIH A;  3JUN A;  1IVV A;  3B4P A;  3L0R A;  5LC6 A;  1ROA A;  3CCJ 3;  1O7P B;  3Q1C A;  1VQN 3;  3MG2 A;  4HM0 B;  4KFF A;  1IVX A;  3FGY A;  2KXG A;  1WQL B;  3FZW A;  5IG0 A;  1KQS 2;  5D82 A;  1N8Q A;  4X2O A;  4FR9 A;  3X3Y A;  1GS3 A;  2CH9 A;  4J8T A;  5CK6 A;  4WYK A;  5A0O B;  5IG3 A;  3J7Y d;  2K0M A;  3FF0 A;  3HX8 A;  3IPT A;  2E2V A;  3KZT A;  3KII A;  1KD1 4;  4ORL A;  2GBX B;  2OCT A;  3MG3 A;  3MHE A;  3DGL A;  1DYU A;  5CF1 A;  3KSE D;  1M1X B;  1EG9 B;  2CWV A;  3X3Z A;  3I0Y A;  1HU9 A;  3HI7 A;  1Z1S A;  3SLU A;  1LVN A;  3WMD A;  4PEJ A;  1STD A;  4MEI A;  1TU5 A;  5ELJ A;  3O8Y A;  1IV9 A;  3CCR 3;  2YFI B;  1O7H B;  4HM4 B;  1R4C A;  3CME 3;  3PXM A;  4N6U A;  1YIJ 3;  4EYC A;  1V74 A;  2WGO A;  3D9R A;  2CK3 H;  3MYT A;  3NBB A;  2Z76 A;  1HKX A;  2C11 A;  2KCD A;  4O2H A;  1UUV B;  2BMQ B;  3S28 A;  1N5P A;  2CKF B;  1O7M B;  1VQK 3;  3FLJ A;  2W04 A;  3M8C A;  3UL5 A;  1JB4 A;  1OF5 A;  2OWP A;  1N8R 4;  1RKY A;  4WHA A;  2K54 A;  1RN7 A;  1F8N A;  1O7G B;  2XSO B;  1N9E A;  3EE1 A;  3G0K A;  3GZY B;  1W6G A;  3KKG A;  2GEY A;  4FMA A;  3NQY A;  1WMN A;  3FCS B;  3PCR A;  1PFP A;  4K61 A;  4MMZ B;  1D6U A;  3MSO A;  1Q81 4;  2CFL A;  4BTW A;  5KP1 A;  3ALA A;  1BUQ A;  1TFK A;  1TUH A;  3SOY A;  5G2G A;  1GD4 A;  2QA4 3;  4OVM A;  4ZM8 A;  1W6Y A;  4GB5 A;  4HM6 B;  4L8O A;  1W02 A;  5AI1 A;  2FNQ A;  1JB2 A;  4EXR A;  2W0Q A;  4HZ9 B;  3U97 A;  1GY7 A;  4N6M A;  4FCZ A;  2XH9 A;  1K41 A;  4RZM A;  5CLK A;  1G96 A;  2C10 A;  3Q90 A;  1NWW A;  3EX9 A;  3G8Z A;  2OQE C;  4BTY A;  3H51 A;  1DMQ A;  4XBT A;  3SOA A;  2WOH A;  2R4I A;  2HMO B;  2D1W A;  4NRE A;  1RRL A;  5AEW B;  2KRT A;  2WGQ A;  4R80 A;  1YJW 3;  4FMD A;  4L8P A;  2YX9 A;  3CNM A;  1CYU A;  3OV4 A;  3DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...