3LTCA

X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.0 a by multi-wavelength anomalous dispersion
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP BINDING PROTEIN-DX
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltcA00
3DGMA 3LTAA 3DGLA 2P0XA 1UW1A 3LTBA 3LT9A 3LTDA 3LT8A 2P05A 3DGOA 2P09A 3DGNA 3LTCA
chains in the Genus database with same CATH superfamily
3DZLA 1ZS7A 3S5CA 1STDA 2H0HA 1N9EA 1LOYA 1I2FA 3A5EA 2LYXA 3CCQ3 4HJLB 1BANA 3DUKA 3G713 1MWTA 1RGAA 2STDA 2GU1A 1VQN3 1M1XB 1TUHA 3BNCA 2A15A 3CNXA 3NV0A 4XDVA 1CH0A 2ZL8A 3CCE3 1OGXA 4RNTA 4HZBB 1UCJA 3KIIA 4HM8B 5AIGA 3D5IA 3K7CA 1FW7A 2OTL3 1GOYA 3EF8A 1RGFA 3CCS3 1JB4A 2P05A 3EX9A 1O7GB 1LVNA 4ILFA 3STDA 1RSNA 1FUSA 3EJVA 3KKGA 4WWUC 1OF5B 3CPOA 3LTDA 2IUJA 4O02B 1T2IA 3NM2A 2ML6A 4LGQA 3RDEA 1EQKA 5JPUA 3TDGA 1IVXA 4BU4A 3FSDA 3X3YA 1B2ZA 2CW9A 5AYSC 1O7NB 2O9UX 3HZPA 1BSDA 1JKGB 3U1WA 1NDOB 1X1XA 3FZWA 3WOFB 1WTHA 3BNEA 1LOXA 4N6UA 3WODG 5CF2A 1GMQA 8CHOA 5G1KA 4L7KA 2Q07A 1TJDA 3F14A 3I0YA 6STDA 1GY6A 1RDSA 1BNEA 2CG1A 3IJEB 2YFLB 3CNMA 5AIIA 4RZMA 2YFIB 2P38A 2KF6A 3NBJA 2YX9A 2KXGA 3M8CA 1I8VA 3PCRA 1W4NA 3X40A 1LQMB 4ZM8A 1N8QA 7GSPA 4U13A 1MWUA 1VQ53 3FG1A 1O7MB 4WYKB 1K28A 5LC6A 2XGNA 3D79A 2IY2A 4NREA 4WP5A 1UGIA 3CPW2 2W6JH 3NHXA 1G0TA 2XSHB 4K1VA 4FCMA 5M18A 1IVVA 5IERA 1IV7A 1VZZA 2JDIH 3B4PA 3D9RA 1UCKA 2XRXB 3GSPA 3SLUA 3K5TA 1GMPA 1F8NA 2INXA 1LNHA 2HMLB 3X3ZA 3T8NA 5IG3A 1BRHA 1FYSA 1UCIA 1WMOA 3Q3FA 4N6MA 5IEPA 4O3VA 1RNTA 2GU3A 3F8HA 1QAFA 1JNQA 2CC3A 2K0MA 1BNSA 1Q40B 2KRTA 4KFDA 3SXXA 5IG4A 4XM4A 1VQM3 2CFLA 3AHSA 1FUTA 2GSPA 1X1UA 4HOHA 2F4YA 1GSPA 3CCV3 1DMQA 3G0KA 3KFQC 5I97A 1FGQA 2HMMB 3RNTA 1YIJ3 6GSPA 4N6LA 3SVAA 4H61A 1GOUA 1SJWA 1RRLA 3ROBA 3D5GA 1FGTA 2KF4A 5KP3A 3X42A 2W56A 3CMA3 4GL6A 3DM8A 3MG2A 1T5YA 2FXTA 3URPA 3CCU3 1LRAA 3CC43 1O7WB 5JPPA 3SX1A 1WQLB 3IMAB 4LMIA 1RCKA 4I4KA 1RRHA 3GZBA 1L5GB 3OX9A 2IUKA 4N6V0 2HOHA 3LT8A 1BU4A 2C4BA 1NU3A 3DH2A 3PS8A 4WFOA 1JN5B 7STDA 2ML5A 3OWSA 5KP1A 3ECFA 1VQL3 3LYGA 3FCSB 5AEUB 3MSOA 3SOAA 4G1MB 1IYYA 4FCJA 4O8SA 1VQO3 2BHMA 2WGOA 1LOVA 2F5WA 5G1LA 1GY7A 1Q9EA 1D6YA 2WOFA 1BRGA 3GRDA 5D82A 2K3DA 3CC73 1IU7A 3LTCA 1OUNA 2Y73A 4FMDA 4R4KA 3S67A 3BNBA 1BSAA 1JB5A 3F7XA 3FH1A 3JUOA 2AAEA 2RBIA 2PNCA 1DVCA 1CQSA 4HKVB 1YJN3 2OTJ3 3BB9A 3T0UA 5CK6A 8RNTA 1RGKA 1I0XA 3CCR3 1RTUA 1Q42A 3F9SA 1JB2A 2OWPA 2HMOB 3BLZA 1JKGA 4GSPA 1HU9A 3K9MC 1EEJA 1DYUA 3HIIA 3NXJA 1BNRA 1QAKA 1TRPA 1EKMA 1MGWA 1DETA 2BO9B 3Q1CA 4GB5A 1UI7A 2CWVA 3FF2A 1AVKA 4EC6A 2CX0A 1VQ93 3OXAA 1RCLA 5BU4A 5M1AA 1K41A 1J2BA 1D6ZA 2PZVA 1W2B2 1AY7A 1JZOA 3DGOA 3LOYA 5IF6A 3X41A 2W0QA 1JJ22 3ALAA 1IQ8A 4HM7B 4L8PA 2M7OA 3O8YA 3EBTA 4IT7A 4RBNA 1UW1A 4WYKA 4EBGA 3EE1A 2HMKB 3HK4A 3H3HA 1BSEA 3Q2PA 4HM1B 1W01A 5AI1A 1SARA 1R4CA 4K1UA 1RNBA 1M9GA 1X1YA 9RNTA 4CPKA 1BNGA 1BRKA 2KF3A 2UUGC 3F7SA 2R41A 5G2GA 4BTYA 1EUIC 3OW22 1GD3A 2E2UA 1OPYA 3K0ZA 5EQLA 1A2KA 3F40A 3KZTA 5LC7A 1UUWB 1W5ZA 3WHOA 1OHOA 3E99A 4KT3B 1LQGC 2QEX3 1OACA 4FR9A 1YJW3 3MHEA 4HM3B 1KD14 4BL3A 1Q40A 2L1SA 1W6YA 2RNTA 3EN1B 5IENA 2W9QA 2H0GA 1N8R4 3DGLA 1OHSA 1RN1A 4Q53A 1KWIA 1JZDA 1MNLA 3F8XA 5JBSA 3FF0A 4IIAA 4EV2A 4MMXB 3UB1A 3ER7A 2FGTA 4O2HA 5AEWB 1N9JA 1HZ1A 1I2EA 4CJNA 2WOHA 1JBRA 4I5QA 2BNGA 3DY5A 1ZGXA 1MGRA 1US1A 1B2MA 1S5AA 1GY5A 1JBTA 1ZO2A 1RGCA 1BGSA 2C11A 3WA3A 2D1WA 4XB5A 1BRNL 4J5KA 2RCDA 2I9WA 2L4VA 4MMYB 4XBTA 1Q7HA 1Y4KA 3SOYA 2CH9A 2Z7AA 1RGEA 1B2XA 3MYTA 3LTBA 5FGOA 1E3VA 2BIRA 1RN7A 2MF7A 1IT7A 3VF1A 1CYVA 4KZ1A 1VQQA 1IV9A 2HMNB 1DE3A 1BNIA 1V57A 1I70A 3EC9A 4HM5B 3AMOB 1E97A 4NHFA 1JN5A 3CCM3 1Q7Y4 3DGMA 3MG1A 5CXOA 1W2ZA 3RGRA 1YIT3 3G4S3 4FMBA 5BXQA 4J8TA 4HM6B 1IDPA 1SIHA 2XFTA 2XR8B 3EQQB 4HBRA 5FW5A 3CC23 5IW9A 4OVMA 1RGHA 2QIYA 1VQK3 1AQZA 4HM0B 1NJI4 1B2SA 1BSCA 1G96A 2UX0A 4EXRA 3RGAA 1PFPA 1ROVA 1W00A 2CWTA 4FCZA 2CIUA 3D4AA 3WA2X 4JRFA 3CD63 1WNHA 5IG0A 3JVCA 4HYZA 2P09A 5D83A 1UGHI 1A90A 3KCHA 4AKYA 4EV5A 1BRSA 2Z76A 5AIFA 3JUNA 2BT3A 4GHOA 5AIHA 1NWWA 3PXMA 4KFFA 4L8OA 2H0IA 5DRVA 2BMRB 1U5OA 1TTOA 5D81A 1LXEA 1M904 4HZ9B 5BIRA 3FG4A 3L0RA 2GXFA 3OWYA 1GMRA 3BNDA 1W02A 1KSIA 2CK3H 3WMDA 1IK3A 2GBXB 3G6E3 3CCJ3 3CCL3 4R9KA 2P0XA 1TFOA 2E2TA 3LMLA 3WDGB 3MKIA 2BMOB 4MJDA 2QGUA 4N6NB 3DMCA 3GAXA 1EA2A 1YVSA 4AKZA 4BIRA 5A0OB 4J9AA 1IQYA 3QRDA 1OGZA 3HOHA 1RJOA 1BUQA 1FA3A 1IVUA 1B2UA 4BTXA 4MMZB 1G02A 1BOXA 3D3LA 1QJGA 3HX8A 1ULIB 3EN8A 2RFRA 4XBYA 2C10A 1IT8A 1TIJA 4LYLB 4LSOA 1GS3A 1VQ63 1A67A 3GZRA 1KC84 1YJ93 5EVHA 3NQZA 3N54B 3DGYA 3OV4A 1NO3A 1PY3A 1YVBI 3ZFZA 5IG5A 5HOHA 1A2PA 1SQWA 4K90B 2D42A 1ZX2A 2KCDA 3HIGA 3U97A 4WHAA 3WOEB 3NBBA 4NPBA 5ELJA 3DGNA 1VQ83 1R4YA 1YI23 1S723 5AYRB 3PGBA 3KE7A 3A76A 2B24B 3J7Yd 2E2VA 3V98A 4R80A 5RNTA 2XSOB 1N5HA 4KVHA 2Z77A 3AHWA 2F86B 3GWRA 2KF5A 1ROAA 1JRQA 3B8LA 1VQP3 2CKFB 5GSPA 3MWZA 1X1WA 2OCTA 4X2OA 1K734 3PYJA 2CFGA 2CFDA 1RKYA 3N8BA 1DMNA 1GOVA 2F5MA 2W03A 1B20A 3VSYA 4FMCA 1BRIA 4MEIA 1FGMA 3GZYB 1Z1SA 5ELUA 1A2VA 1W7CA 3GZXB 4BTWA 5CLKA 5BVBA 3CU3A 3H51A 2P0MA 1BIRA 1BVIA 1YGEA 2OOVC 3V99A 2J8XB 1T2HA 1GD4A 3KSED 3UL5A 4HVNA 4OK0A 1MOLA 1MWSA 1OCVA 2YFJB 3CME3 3FGYA 2ZA4A 1PU4A 1Q824 1OH0A 1RGGA 3IPTA 1QVG2 3OWUA 4CCVA 4IPBA 2Y74A 1AV4A 1UDII 4RNZA 3LTAA 1C7HA 3KN4A 5IEOA 1TP6A 3WR2A 1HKXA 1UI8A 1QVF2 3PZWA 1DVDA 4LZIA 5HGRA 3AMOA 3JUPA 3UJMA 1AR0A 4X2HA 3SEDA 2XEPA 1T3BA 3NV0B 1WMPA 4HM4B 1ULJB 4EYCA 4QWTA 5TGNA 1D6UA 1U8CB 2XGLA 3AGNA 4BL2A 1UUVB 3DXOA 4CDLA 1O7PB 4H3UA 3K63A 3Q90A 1I2GA 3AGOA 1KQS2 1FZUA 2IA7A 2SBLA 1IVWA 4LEHA 1W6CA 4PEJA 3I563 1VQ43 1EG9B 1W6GA 3I553 1CYUA 4TX4A 3LT9A 5STDA 2WGQA 2ZDJA 3NM7A 2OOVA 1K9M4 1SIIA 3HI7A 2OQEC 2RSXA 2K54A 3S27A 1YNVX 1V58A 1OHPA 2F99A 5EEOA 2JQ5A 3SYUA 2O3OA 3UNLA 1RMSA 2KAAA 3CXC2 1NNVA 1C54A 2SARA 3MPHA 3G16A 4XDWA 1BNFA 4STDA 2LQVA 5M19A 1RN4A 3EBYA 1B21A 1BSBA 1BAOA 1RLSA 4N6TA 3FLJA 1JBSA 1RGLA 1IQXA 1UUGB 2CWUA 1Q814 5KP4A 4JF8A 4KFEA 3ZG5A 2FNQA 3JUQA 1CEWI 3ZG0A 1O7HB 3FKAA 2XF3A 1TRQA 1ASKA 2QA43 3S29A 3V92A 4ORLA 1FUWA 4AEQA 1I3FA 4K61A 2OQEA 2Z6BA 4J5GA 4HM2B 1BUJA 2HMJB 2ZHXB 1FGOA 1PYLA 2F98A 2GBWB 2BMQB 2RGQA 3NUVA 1YHQ3 2CFKA 3G8ZA 1QMAA 3EHCA 5DREA 2CG0A 1NB5I 2WO0A 3JUMA 3BIRA 2CX1A 1N5PA 1TU5A 1LOWA 2CFWA 3X3XA 3FG3A 1DMMA 3BU4A 4OUQA 2MC8A 1LNIA 4R1KA 1FGRA 1TFKA 1QALA 4DKIA 1VQ73 1I3IA 1I0VA 3S28A 1UCLA 3B4OA 2XH9A 1V74A 2V1LA 7RNTA 3NQYA 1ISKA 3LZAA 3N9HA 1BNJA 2CHCA 1RHLA 2F56A 3LH4A 1K8A4 2BU4A 4RNYA 3UL6A 2IMJA 4XBXA 1E3RA 3T8UA 2XFSA 2GEXA 2W04A 3QK9A 4R9LA 1WMNA 3NBRA 3EB8A 1GYBA 1M1K4 3KSPA 3NX0A 3B7CA 2UGIA 1MWRA 2W56B 4N6OB 3MG3A 1NB3I 6RNTA 1B3SA 4N3VA 4EW5A 1B27A 1JV2B 1SPUA 4FMAA 3LXUX 1Q864 3VGNA 2GEYA 2IYJA 2B1XB 4HAAA 1AVLA 2R4IA 2W2CA 1OF5A 5CF1A 1HYFA 3PCSA 2AADA 1BRJA 2W9PA 1STFI 1YGWA
chains in the Genus database with same CATH topology
3DZLA 3S5CA 1STDA 1N9EA 2LYXA 3CCQ3 4HJLB 3DUKA 3G713 2STDA 2GU1A 1VQN3 1M1XB 1TUHA 3BNCA 2A15A 3CNXA 3NV0A 4XDVA 2ZL8A 3CCE3 1OGXA 4HZBB 3KIIA 4HM8B 5AIGA 3K7CA 2OTL3 3EF8A 3CCS3 1JB4A 2P05A 3EX9A 1O7GB 1LVNA 3STDA 3EJVA 3KKGA 4WWUC 1OF5B 3CPOA 3LTDA 2IUJA 4O02B 3NM2A 2ML6A 4LGQA 3RDEA 1EQKA 5JPUA 3TDGA 1IVXA 3FSDA 3X3YA 2CW9A 5AYSC 1O7NB 2O9UX 3HZPA 1JKGB 3U1WA 3WOFB 1NDOB 3FZWA 3WODG 5CF2A 1WTHA 3BNEA 1LOXA 4N6UA 8CHOA 3CCV3 4L7KA 2Q07A 3F14A 3I0YA 6STDA 1GY6A 2CG1A 3IJEB 2YFLB 3CNMA 5AIIA 4RZMA 2YFIB 2P38A 3NBJA 2YX9A 2KXGA 3M8CA 3PCRA 1W4NA 3X40A 4ZM8A 1N8QA 4U13A 1VQ53 3FG1A 1O7MB 4WYKB 1K28A 5LC6A 2XGNA 4NREA 4WP5A 3CPW2 2W6JH 3NHXA 2XSHB 4K1VA 4FCMA 1IVVA 5IERA 1IV7A 1VZZA 2JDIH 3B4PA 3D9RA 2XRXB 3SLUA 3K5TA 1F8NA 2INXA 1LNHA 3X3ZA 3T8NA 5IG3A 1WMOA 4N6MA 5IEPA 4O3VA 2GU3A 3F8HA 1QAFA 1JNQA 2CC3A 2K0MA 2KRTA 1Q40B 4KFDA 3SXXA 5IG4A 4XM4A 1VQM3 2CFLA 1DMQA 3G0KA 3KFQC 5I97A 1FGQA 2HMMB 1YIJ3 4N6LA 3SVAA 4H61A 1RRLA 1SJWA 3ROBA 1FGTA 3X42A 5KP3A 2W56A 3CMA3 4GL6A 3DM8A 3MG2A 1T5YA 2FXTA 3CCU3 3CC43 1O7WB 5JPPA 3SX1A 1WQLB 3IMAB 4LMIA 4I4KA 1RRHA 3GZBA 1L5GB 3OX9A 2IUKA 4N6V0 3LT8A 1NU3A 3PS8A 4WFOA 1JN5B 2ML5A 3OWSA 5KP1A 3ECFA 1VQL3 3LYGA 3FCSB 5AEUB 3MSOA 3SOAA 4G1MB 4FCJA 4O8SA 1VQO3 2BHMA 2WGOA 1GY7A 2WOFA 1D6YA 3GRDA 5D82A 3CC73 1IU7A 3LTCA 1OUNA 2Y73A 4FMDA 4R4KA 3S67A 3BNBA 1JB5A 3F7XA 3FH1A 3JUOA 2PNCA 1DVCA 1CQSA 4HKVB 1YJN3 2OTJ3 3BB9A 3T0UA 5CK6A 3CCR3 1Q42A 3F9SA 1JB2A 2OWPA 2HMOB 3BLZA 1JKGA 1HU9A 3K9MC 1DYUA 3HIIA 3NXJA 1QAKA 1EKMA 2BO9B 3Q1CA 4GB5A 1UI7A 2CWVA 3FF2A 1AVKA 4EC6A 1VQ93 3OXAA 1K41A 1J2BA 1D6ZA 2PZVA 1W2B2 3LOYA 3DGOA 5IF6A 3X41A 2W0QA 1JJ22 3ALAA 1IQ8A 4HM7B 4L8PA 2M7OA 3O8YA 3EBTA 4IT7A 4RBNA 1UW1A 4WYKA 4EBGA 3EE1A 2HMKB 3HK4A 3H3HA 3Q2PA 4HM1B 1W01A 5AI1A 1R4CA 4K1UA 1M9GA 3F7SA 4BTYA 5G2GA 3OW22 1GD3A 2E2UA 1OPYA 3K0ZA 5EQLA 1A2KA 3F40A 3KZTA 5LC7A 1UUWB 1W5ZA 1OHOA 3E99A 2QEX3 1OACA 4FR9A 1YJW3 3MHEA 4HM3B 1KD14 1Q40A 3EN1B 1W6YA 5IENA 2W9QA 1N8R4 3DGLA 1OHSA 4Q53A 1KWIA 1MNLA 3F8XA 5JBSA 3FF0A 4IIAA 4EV2A 4MMXB 3UB1A 3ER7A 2FGTA 4O2HA 5AEWB 1N9JA 2WOHA 2BNGA 3DY5A 1US1A 1S5AA 1GY5A 1ZO2A 2C11A 3WA3A 2D1WA 4XB5A 2RCDA 2I9WA 2L4VA 4MMYB 4XBTA 1Y4KA 3SOYA 2CH9A 2Z7AA 3MYTA 3LTBA 5FGOA 1E3VA 2MF7A 1RN7A 1IT7A 3VF1A 1CYVA 4KZ1A 1IV9A 2HMNB 4HM5B 3EC9A 4NHFA 3CCM3 3AMOB 1E97A 1Q7Y4 1JN5A 3DGMA 3MG1A 5CXOA 1W2ZA 3RGRA 1YIT3 3G4S3 4FMBA 5BXQA 4J8TA 4HM6B 1IDPA 1SIHA 2XFTA 2XR8B 3EQQB 4HBRA 5FW5A 3CC23 5IW9A 4OVMA 2QIYA 1VQK3 4HM0B 1NJI4 1G96A 2UX0A 4EXRA 3RGAA 1PFPA 1ROVA 1W00A 2CWTA 4FCZA 2CIUA 3WA2X 4JRFA 3CD63 1WNHA 5IG0A 3JVCA 4HYZA 2P09A 5D83A 1A90A 4AKYA 4EV5A 2Z76A 5AIFA 3JUNA 2BT3A 5AIHA 1NWWA 3PXMA 4KFFA 4L8OA 5DRVA 2BMRB 1U5OA 5D81A 1M904 1LXEA 4HZ9B 3FG4A 3L0RA 2GXFA 3OWYA 3BNDA 1DVDA 1W02A 1KSIA 2CK3H 3WMDA 1IK3A 2GBXB 3G6E3 3CCJ3 3CCL3 4R9KA 2P0XA 1TFOA 2E2TA 3LMLA 3WDGB 3MKIA 2BMOB 4MJDA 2QGUA 4N6NB 3DMCA 3GAXA 1EA2A 4AKZA 5A0OB 4J9AA 1IQYA 3QRDA 1OGZA 1RJOA 1BUQA 1FA3A 1IVUA 4BTXA 4MMZB 3D3LA 1QJGA 3HX8A 1ULIB 3EN8A 2RFRA 4XBYA 2C10A 1IT8A 1TIJA 4LSOA 1GS3A 1VQ63 1A67A 3GZRA 1KC84 1YJ93 5EVHA 3NQZA 3N54B 3OV4A 1NO3A 1YVBI 5IG5A 1SQWA 4K90B 2D42A 1ZX2A 2KCDA 3HIGA 3U97A 4WHAA 3WOEB 3NBBA 5ELJA 7STDA 3DGNA 1VQ83 1YI23 1S723 5AYRB 3PGBA 3KE7A 3A76A 2B24B 3J7Yd 2E2VA 3V98A 4R80A 2XSOB 1N5HA 4KVHA 2Z77A 2F86B 3GWRA 3B8LA 1ROAA 1JRQA 1VQP3 2CKFB 3MWZA 2OCTA 4X2OA 1K734 3PYJA 2CFGA 2CFDA 1RKYA 3N8BA 1DMNA 2W03A 3VSYA 4FMCA 4MEIA 1FGMA 3GZYB 1Z1SA 5ELUA 1A2VA 1W7CA 3GZXB 4BTWA 5CLKA 5BVBA 3CU3A 3H51A 2P0MA 2OOVC 1YGEA 3V99A 1GD4A 3KSED 3UL5A 4HVNA 4OK0A 1MOLA 1OCVA 2YFJB 3CME3 3FGYA 1PU4A 1Q824 1OH0A 3IPTA 1QVG2 3OWUA 4CCVA 4IPBA 2Y74A 1AV4A 4RNZA 3LTAA 1C7HA 3KN4A 5IEOA 1TP6A 1QVF2 1HKXA 1UI8A 3PZWA 4LZIA 5HGRA 3AMOA 3JUPA 3UJMA 1AR0A 4X2HA 3SEDA 2XEPA 4HM4B 3NV0B 1WMPA 1ULJB 4EYCA 4QWTA 5TGNA 1D6UA 1U8CB 2XGLA 1UUVB 3DXOA 4CDLA 1O7PB 4H3UA 3K63A 3Q90A 1KQS2 2IA7A 2SBLA 1IVWA 4LEHA 1W6CA 4PEJA 3I563 1VQ43 1EG9B 1W6GA 3I553 1CYUA 4TX4A 3LT9A 5STDA 2WGQA 2ZDJA 3NM7A 2OOVA 1K9M4 1SIIA 3HI7A 2OQEC 2RSXA 2K54A 3S27A 2F99A 1OHPA 5EEOA 2JQ5A 2O3OA 3UNLA 3CXC2 3MPHA 3G16A 4XDWA 4STDA 2LQVA 3EBYA 4N6TA 3FLJA 1IQXA 1Q814 2CWUA 5KP4A 4JF8A 4KFEA 2FNQA 3JUQA 1CEWI 1O7HB 3FKAA 2XF3A 1ASKA 2QA43 3S29A 3V92A 4ORLA 1FUWA 4AEQA 4K61A 2OQEA 2Z6BA 4HM2B 2HMJB 1FGOA 2F98A 2GBWB 2BMQB 2RGQA 3NUVA 1YHQ3 2CFKA 3G8ZA 1QMAA 3EHCA 5DREA 2CG0A 1NB5I 2WO0A 3JUMA 1TU5A 1N5PA 2CFWA 3X3XA 3FG3A 1DMMA 2MC8A 4OUQA 4R1KA 1FGRA 1TFKA 1QALA 1VQ73 3S28A 3B4OA 2XH9A 1V74A 2V1LA 3NQYA 1ISKA 3LZAA 3N9HA 2CHCA 3LH4A 1K8A4 4RNYA 3UL6A 2IMJA 4XBXA 1E3RA 3T8UA 2XFSA 2GEXA 2W04A 3QK9A 4R9LA 1WMNA 3NBRA 3EB8A 1GYBA 1M1K4 3KSPA 3NX0A 3B7CA 2W56B 4N6OB 3MG3A 1NB3I 4N3VA 1JV2B 1SPUA 4FMAA 3LXUX 1Q864 3VGNA 2GEYA 2B1XB 1AVLA 2R4IA 2W2CA 1OF5A 5CF1A 3PCSA 2HMLB 2W9PA 1STFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGM A;  3LTA A;  3DGL A;  2P0X A;  1UW1 A;  3LTB A;  3LT9 A;  3LTD A;  3LT8 A;  2P05 A;  3DGO A;  2P09 A;  3DGN A;  3LTC A; 
#chains in the Genus database with same CATH topology
 3DZL A;  1ZS7 A;  3S5C A;  1STD A;  2H0H A;  1N9E A;  1LOY A;  1I2F A;  3A5E A;  2LYX A;  3CCQ 3;  4HJL B;  1BAN A;  3DUK A;  3G71 3;  1MWT A;  1RGA A;  2STD A;  2GU1 A;  1VQN 3;  1M1X B;  1TUH A;  3BNC A;  2A15 A;  3CNX A;  3NV0 A;  4XDV A;  1CH0 A;  2ZL8 A;  3CCE 3;  1OGX A;  4RNT A;  4HZB B;  1UCJ A;  3KII A;  4HM8 B;  5AIG A;  3D5I A;  3K7C A;  1FW7 A;  2OTL 3;  1GOY A;  3EF8 A;  1RGF A;  3CCS 3;  1JB4 A;  2P05 A;  3EX9 A;  1O7G B;  1LVN A;  4ILF A;  3STD A;  1RSN A;  1FUS A;  3EJV A;  3KKG A;  4WWU C;  1OF5 B;  3CPO A;  3LTD A;  2IUJ A;  4O02 B;  1T2I A;  3NM2 A;  2ML6 A;  4LGQ A;  3RDE A;  1EQK A;  5JPU A;  3TDG A;  1IVX A;  4BU4 A;  3FSD A;  3X3Y A;  1B2Z A;  2CW9 A;  5AYS C;  1O7N B;  2O9U X;  3HZP A;  1BSD A;  1JKG B;  3U1W A;  1NDO B;  1X1X A;  3FZW A;  3WOF B;  1WTH A;  3BNE A;  1LOX A;  4N6U A;  3WOD G;  5CF2 A;  1GMQ A;  8CHO A;  5G1K A;  4L7K A;  2Q07 A;  1TJD A;  3F14 A;  3I0Y A;  6STD A;  1GY6 A;  1RDS A;  1BNE A;  2CG1 A;  3IJE B;  2YFL B;  3CNM A;  5AII A;  4RZM A;  2YFI B;  2P38 A;  2KF6 A;  3NBJ A;  2YX9 A;  2KXG A;  3M8C A;  1I8V A;  3PCR A;  1W4N A;  3X40 A;  1LQM B;  4ZM8 A;  1N8Q A;  7GSP A;  4U13 A;  1MWU A;  1VQ5 3;  3FG1 A;  1O7M B;  4WYK B;  1K28 A;  5LC6 A;  2XGN A;  3D79 A;  2IY2 A;  4NRE A;  4WP5 A;  1UGI A;  3CPW 2;  2W6J H;  3NHX A;  1G0T A;  2XSH B;  4K1V A;  4FCM A;  5M18 A;  1IVV A;  5IER A;  1IV7 A;  1VZZ A;  2JDI H;  3B4P A;  3D9R A;  1UCK A;  2XRX B;  3GSP A;  3SLU A;  3K5T A;  1GMP A;  1F8N A;  2INX A;  1LNH A;  2HML B;  3X3Z A;  3T8N A;  5IG3 A;  1BRH A;  1FYS A;  1UCI A;  1WMO A;  3Q3F A;  4N6M A;  5IEP A;  4O3V A;  1RNT A;  2GU3 A;  3F8H A;  1QAF A;  1JNQ A;  2CC3 A;  2K0M A;  1BNS A;  1Q40 B;  2KRT A;  4KFD A;  3SXX A;  5IG4 A;  4XM4 A;  1VQM 3;  2CFL A;  3AHS A;  1FUT A;  2GSP A;  1X1U A;  4HOH A;  2F4Y A;  1GSP A;  3CCV 3;  1DMQ A;  3G0K A;  3KFQ C;  5I97 A;  1FGQ A;  2HMM B;  3RNT A;  1YIJ 3;  6GSP A;  4N6L A;  3SVA A;  4H61 A;  1GOU A;  1SJW A;  1RRL A;  3ROB A;  3D5G A;  1FGT A;  2KF4 A;  5KP3 A;  3X42 A;  2W56 A;  3CMA 3;  4GL6 A;  3DM8 A;  3MG2 A;  1T5Y A;  2FXT A;  3URP A;  3CCU 3;  1LRA A;  3CC4 3;  1O7W B;  5JPP A;  3SX1 A;  1WQL B;  3IMA B;  4LMI A;  1RCK A;  4I4K A;  1RRH A;  3GZB A;  1L5G B;  3OX9 A;  2IUK A;  4N6V 0;  2HOH A;  3LT8 A;  1BU4 A;  2C4B A;  1NU3 A;  3DH2 A;  3PS8 A;  4WFO A;  1JN5 B;  7STD A;  2ML5 A;  3OWS A;  5KP1 A;  3ECF A;  1VQL 3;  3LYG A;  3FCS B;  5AEU B;  3MSO A;  3SOA A;  4G1M B;  1IYY A;  4FCJ A;  4O8S A;  1VQO 3;  2BHM A;  2WGO A;  1LOV A;  2F5W A;  5G1L A;  1GY7 A;  1Q9E A;  1D6Y A;  2WOF A;  1BRG A;  3GRD A;  5D82 A;  2K3D A;  3CC7 3;  1IU7 A;  3LTC A;  1OUN A;  2Y73 A;  4FMD A;  4R4K A;  3S67 A;  3BNB A;  1BSA A;  1JB5 A;  3F7X A;  3FH1 A;  3JUO A;  2AAE A;  2RBI A;  2PNC A;  1DVC A;  1CQS A;  4HKV B;  1YJN 3;  2OTJ 3;  3BB9 A;  3T0U A;  5CK6 A;  8RNT A;  1RGK A;  1I0X A;  3CCR 3;  1RTU A;  1Q42 A;  3F9S A;  1JB2 A;  2OWP A;  2HMO B;  3BLZ A;  1JKG A;  4GSP A;  1HU9 A;  3K9M C;  1EEJ A;  1DYU A;  3HII A;  3NXJ A;  1BNR A;  1QAK A;  1TRP A;  1EKM A;  1MGW A;  1DET A;  2BO9 B;  3Q1C A;  4GB5 A;  1UI7 A;  2CWV A;  3FF2 A;  1AVK A;  4EC6 A;  2CX0 A;  1VQ9 3;  3OXA A;  1RCL A;  5BU4 A;  5M1A A;  1K41 A;  1J2B A;  1D6Z A;  2PZV A;  1W2B 2;  1AY7 A;  1JZO A;  3DGO A;  3LOY A;  5IF6 A;  3X41 A;  2W0Q A;  1JJ2 2;  3ALA A;  1IQ8 A;  4HM7 B;  4L8P A;  2M7O A;  3O8Y A;  3EBT A;  4IT7 A;  4RBN A;  1UW1 A;  4WYK A;  4EBG A;  3EE1 A;  2HMK B;  3HK4 A;  3H3H A;  1BSE A;  3Q2P A;  4HM1 B;  1W01 A;  5AI1 A;  1SAR A;  1R4C A;  4K1U A;  1RNB A;  1M9G A;  1X1Y A;  9RNT A;  4CPK A;  1BNG A;  1BRK A;  2KF3 A;  2UUG C;  3F7S A;  2R41 A;  5G2G A;  4BTY A;  1EUI C;  3OW2 2;  1GD3 A;  2E2U A;  1OPY A;  3K0Z A;  5EQL A;  1A2K A;  3F40 A;  3KZT A;  5LC7 A;  1UUW B;  1W5Z A;  3WHO A;  1OHO A;  3E99 A;  4KT3 B;  1LQG C;  2QEX 3;  1OAC A;  4FR9 A;  1YJW 3;  3MHE A;  4HM3 B;  1KD1 4;  4BL3 A;  1Q40 A;  2L1S A;  1W6Y A;  2RNT A;  3EN1 B;  5IEN A;  2W9Q A;  2H0G A;  1N8R 4;  3DGL A;  1OHS A;  1RN1 A;  4Q53 A;  1KWI A;  1JZD A;  1MNL A;  3F8X A;  5JBS A;  3FF0 A;  4IIA A;  4EV2 A;  4MMX B;  3UB1 A;  3ER7 A;  2FGT A;  4O2H A;  5AEW B;  1N9J A;  1HZ1 A;  1I2E A;  4CJN A;  2WOH A;  1JBR A;  4I5Q A;  2BNG A;  3DY5 A;  1ZGX A;  1MGR A;  1US1 A;  1B2M A;  1S5A A;  1GY5 A;  1JBT A;  1ZO2 A;  1RGC A;  1BGS A;  2C11 A;  3WA3 A;  2D1W A;  4XB5 A;  1BRN L;  4J5K A;  2RCD A;  2I9W A;  2L4V A;  4MMY B;  4XBT A;  1Q7H A;  1Y4K A;  3SOY A;  2CH9 A;  2Z7A A;  1RGE A;  1B2X A;  3MYT A;  3LTB A;  5FGO A;  1E3V A;  2BIR A;  1RN7 A;  2MF7 A;  1IT7 A;  3VF1 A;  1CYV A;  4KZ1 A;  1VQQ A;  1IV9 A;  2HMN B;  1DE3 A;  1BNI A;  1V57 A;  1I70 A;  3EC9 A;  4HM5 B;  3AMO B;  1E97 A;  4NHF A;  1JN5 A;  3CCM 3;  1Q7Y 4;  3DGM A;  3MG1 A;  5CXO A;  1W2Z A;  3RGR A;  1YIT 3;  3G4S 3;  4FMB A;  5BXQ A;  4J8T A;  4HM6 B;  1IDP A;  1SIH A;  2XFT A;  2XR8 B;  3EQQ B;  4HBR A;  5FW5 A;  3CC2 3;  5IW9 A;  4OVM A;  1RGH A;  2QIY A;  1VQK 3;  1AQZ A;  4HM0 B;  1NJI 4;  1B2S A;  1BSC A;  1G96 A;  2UX0 A;  4EXR A;  3RGA A;  1PFP A;  1ROV A;  1W00 A;  2CWT A;  4FCZ A;  2CIU A;  3D4A A;  3WA2 X;  4JRF A;  3CD6 3;  1WNH A;  5IG0 A;  3JVC A;  4HYZ A;  2P09 A;  5D83 A;  1UGH I;  1A90 A;  3KCH A;  4AKY A;  4EV5 A;  1BRS A;  2Z76 A;  5AIF A;  3JUN A;  2BT3 A;  4GHO A;  5AIH A;  1NWW A;  3PXM A;  4KFF A;  4L8O A;  2H0I A;  5DRV A;  2BMR B;  1U5O A;  1TTO A;  5D81 A;  1LXE A;  1M90 4;  4HZ9 B;  5BIR A;  3FG4 A;  3L0R A;  2GXF A;  3OWY A;  1GMR A;  3BND A;  1W02 A;  1KSI A;  2CK3 H;  3WMD A;  1IK3 A;  2GBX B;  3G6E 3;  3CCJ 3;  3CCL 3;  4R9K A;  2P0X A;  1TFO A;  2E2T A;  3LML A;  3WDG B;  3MKI A;  2BMO B;  4MJD A;  2QGU A;  4N6N B;  3DMC A;  3GAX A;  1EA2 A;  1YVS A;  4AKZ A;  4BIR A;  5A0O B;  4J9A A;  1IQY A;  3QRD A;  1OGZ A;  3HOH A;  1RJO A;  1BUQ A;  1FA3 A;  1IVU A;  1B2U A;  4BTX A;  4MMZ B;  1G02 A;  1BOX A;  3D3L A;  1QJG A;  3HX8 A;  1ULI B;  3EN8 A;  2RFR A;  4XBY A;  2C10 A;  1IT8 A;  1TIJ A;  4LYL B;  4LSO A;  1GS3 A;  1VQ6 3;  1A67 A;  3GZR A;  1KC8 4;  1YJ9 3;  5EVH A;  3NQZ A;  3N54 B;  3DGY A;  3OV4 A;  1NO3 A;  1PY3 A;  1YVB I;  3ZFZ A;  5IG5 A;  5HOH A;  1A2P A;  1SQW A;  4K90 B;  2D42 A;  1ZX2 A;  2KCD A;  3HIG A;  3U97 A;  4WHA A;  3WOE B;  3NBB A;  4NPB A;  5ELJ A;  3DGN A;  1VQ8 3;  1R4Y A;  1YI2 3;  1S72 3;  5AYR B;  3PGB A;  3KE7 A;  3A76 A;  2B24 B;  3J7Y d;  2E2V A;  3V98 A;  4R80 A;  5RNT A;  2XSO B;  1N5H A;  4KVH A;  2Z77 A;  3AHW A;  2F86 B;  3GWR A;  2KF5 A;  1ROA A;  1JRQ A;  3B8L A;  1VQP 3;  2CKF B;  5GSP A;  3MWZ A;  1X1W A;  2OCT A;  4X2O A;  1K73 4;  3PYJ A;  2CFG A;  2CFD A;  1RKY A;  3N8B A;  1DMN A;  1GOV A;  2F5M A;  2W03 A;  1B20 A;  3VSY A;  4FMC A;  1BRI A;  4MEI A;  1FGM A;  3GZY B;  1Z1S A;  5ELU A;  1A2V A;  1W7C A;  3GZX B;  4BTW A;  5CLK A;  5BVB A;  3CU3 A;  3H51 A;  2P0M A;  1BIR A;  1BVI A;  1YGE A;  2OOV C;  3V99 A;  2J8X B;  1T2H A;  1GD4 A;  3KSE D;  3UL5 A;  4HVN A;  4OK0 A;  1MOL A;  1MWS A;  1OCV A;  2YFJ B;  3CME 3;  3FGY A;  2ZA4 A;  1PU4 A;  1Q82 4;  1OH0 A;  1RGG A;  3IPT A;  1QVG 2;  3OWU A;  4CCV A;  4IPB A;  2Y74 A;  1AV4 A;  1UDI I;  4RNZ A;  3LTA A;  1C7H A;  3KN4 A;  5IEO A;  1TP6 A;  3WR2 A;  1HKX A;  1UI8 A;  1QVF 2;  3PZW A;  1DVD A;  4LZI A;  5HGR A;  3AMO A;  3JUP A;  3UJM A;  1AR0 A;  4X2H A;  3SED A;  2XEP A;  1T3B A;  3NV0 B;  1WMP A;  4HM4 B;  1ULJ B;  4EYC A;  4QWT A;  5TGN A;  1D6U A;  1U8C B;  2XGL A;  3AGN A;  4BL2 A;  1UUV B;  3DXO A;  4CDL A;  1O7P B;  4H3U A;  3K63 A;  3Q90 A;  1I2G A;  3AGO A;  1KQS 2;  1FZU A;  2IA7 A;  2SBL A;  1IVW A;  4LEH A;  1W6C A;  4PEJ A;  3I56 3;  1VQ4 3;  1EG9 B;  1W6G A;  3I55 3;  1CYU A;  4TX4 A;  3LT9 A;  5STD A;  2WGQ A;  2ZDJ A;  3NM7 A;  2OOV A;  1K9M 4;  1SII A;  3HI7 A;  2OQE C;  2RSX A;  2K54 A;  3S27 A;  1YNV X;  1V58 A;  1OHP A;  2F99 A;  5EEO A;  2JQ5 A;  3SYU A;  2O3O A;  3UNL A;  1RMS A;  2KAA A;  3CXC 2;  1NNV A;  1C54 A;  2SAR A;  3MPH A;  3G16 A;  4XDW A;  1BNF A;  4STD A;  2LQV A;  5M19 A;  1RN4 A;  3EBY A;  1B21 A;  1BSB A;  1BAO A;  1RLS A;  4N6T A;  3FLJ A;  1JBS A;  1RGL A;  1IQX A;  1UUG B;  2CWU A;  1Q81 4;  5KP4 A;  4JF8 A;  4KFE A;  3ZG5 A;  2FNQ A;  3JUQ A;  1CEW I;  3ZG0 A;  1O7H B;  3FKA A;  2XF3 A;  1TRQ A;  1ASK A;  2QA4 3;  3S29 A;  3V92 A;  4ORL A;  1FUW A;  4AEQ A;  1I3F A;  4K61 A;  2OQE A;  2Z6B A;  4J5G A;  4HM2 B;  1BUJ A;  2HMJ B;  2ZHX B;  1FGO A;  1PYL A;  2F98 A;  2GBW B;  2BMQ B;  2RGQ A;  3NUV A;  1YHQ 3;  2CFK A;  3G8Z A;  1QMA A;  3EHC A;  5DRE A;  2CG0 A;  1NB5 I;  2WO0 A;  3JUM A;  3BIR A;  2CX1 A;  1N5P A;  1TU5 A;  1LOW A;  2CFW A;  3X3X A;  3FG3 A;  1DMM A;  3BU4 A;  4OUQ A;  2MC8 A;  1LNI A;  4R1K A;  1FGR A;  1TFK A;  1QAL A;  4DKI A;  1VQ7 3;  1I3I A;  1I0V A;  3S28 A;  1UCL A;  3B4O A;  2XH9 A;  1V74 A;  2V1L A;  7RNT A;  3NQY A;  1ISK A;  3LZA A;  3N9H A;  1BNJ A;  2CHC A;  1RHL A;  2F56 A;  3LH4 A;  1K8A 4;  2BU4 A;  4RNY A;  3UL6 A;  2IMJ A;  4XBX A;  1E3R A;  3T8U A;  2XFS A;  2GEX A;  2W04 A;  3QK9 A;  4R9L A;  1WMN A;  3NBR A;  3EB8 A;  1GYB A;  1M1K 4;  3KSP A;  3NX0 A;  3B7C A;  2UGI A;  1MWR A;  2W56 B;  4N6O B;  3MG3 A;  1NB3 I;  6RNT A;  1B3S A;  4N3V A;  4EW5 A;  1B27 A;  1JV2 B;  1SPU A;  4FMA A;  3LXU X;  1Q86 4;  3VGN A;  2GEY A;  2IYJ A;  2B1X B;  4HAA A;  1AVL A;  2R4I A;  2W2C A;  1OF5 A;  5CF1 A;  1HYF A;  3PCS A;  2AAD A;  1BRJ A;  2W9P A;  1STF I;  1YGW A; 
#chains in the Genus database with same CATH homology
 3DZL A;  3S5C A;  1STD A;  1N9E A;  2LYX A;  3CCQ 3;  4HJL B;  3DUK A;  3G71 3;  2STD A;  2GU1 A;  1VQN 3;  1M1X B;  1TUH A;  3BNC A;  2A15 A;  3CNX A;  3NV0 A;  4XDV A;  2ZL8 A;  3CCE 3;  1OGX A;  4HZB B;  3KII A;  4HM8 B;  5AIG A;  3K7C A;  2OTL 3;  3EF8 A;  3CCS 3;  1JB4 A;  2P05 A;  3EX9 A;  1O7G B;  1LVN A;  3STD A;  3EJV A;  3KKG A;  4WWU C;  1OF5 B;  3CPO A;  3LTD A;  2IUJ A;  4O02 B;  3NM2 A;  2ML6 A;  4LGQ A;  3RDE A;  1EQK A;  5JPU A;  3TDG A;  1IVX A;  3FSD A;  3X3Y A;  2CW9 A;  5AYS C;  1O7N B;  2O9U X;  3HZP A;  1JKG B;  3U1W A;  3WOF B;  1NDO B;  3FZW A;  3WOD G;  5CF2 A;  1WTH A;  3BNE A;  1LOX A;  4N6U A;  8CHO A;  3CCV 3;  4L7K A;  2Q07 A;  3F14 A;  3I0Y A;  6STD A;  1GY6 A;  2CG1 A;  3IJE B;  2YFL B;  3CNM A;  5AII A;  4RZM A;  2YFI B;  2P38 A;  3NBJ A;  2YX9 A;  2KXG A;  3M8C A;  3PCR A;  1W4N A;  3X40 A;  4ZM8 A;  1N8Q A;  4U13 A;  1VQ5 3;  3FG1 A;  1O7M B;  4WYK B;  1K28 A;  5LC6 A;  2XGN A;  4NRE A;  4WP5 A;  3CPW 2;  2W6J H;  3NHX A;  2XSH B;  4K1V A;  4FCM A;  1IVV A;  5IER A;  1IV7 A;  1VZZ A;  2JDI H;  3B4P A;  3D9R A;  2XRX B;  3SLU A;  3K5T A;  1F8N A;  2INX A;  1LNH A;  3X3Z A;  3T8N A;  5IG3 A;  1WMO A;  4N6M A;  5IEP A;  4O3V A;  2GU3 A;  3F8H A;  1QAF A;  1JNQ A;  2CC3 A;  2K0M A;  2KRT A;  1Q40 B;  4KFD A;  3SXX A;  5IG4 A;  4XM4 A;  1VQM 3;  2CFL A;  1DMQ A;  3G0K A;  3KFQ C;  5I97 A;  1FGQ A;  2HMM B;  1YIJ 3;  4N6L A;  3SVA A;  4H61 A;  1RRL A;  1SJW A;  3ROB A;  1FGT A;  3X42 A;  5KP3 A;  2W56 A;  3CMA 3;  4GL6 A;  3DM8 A;  3MG2 A;  1T5Y A;  2FXT A;  3CCU 3;  3CC4 3;  1O7W B;  5JPP A;  3SX1 A;  1WQL B;  3IMA B;  4LMI A;  4I4K A;  1RRH A;  3GZB A;  1L5G B;  3OX9 A;  2IUK A;  4N6V 0;  3LT8 A;  1NU3 A;  3PS8 A;  4WFO A;  1JN5 B;  2ML5 A;  3OWS A;  5KP1 A;  3ECF A;  1VQL 3;  3LYG A;  3FCS B;  5AEU B;  3MSO A;  3SOA A;  4G1M B;  4FCJ A;  4O8S A;  1VQO 3;  2BHM A;  2WGO A;  1GY7 A;  2WOF A;  1D6Y A;  3GRD A;  5D82 A;  3CC7 3;  1IU7 A;  3LTC A;  1OUN A;  2Y73 A;  4FMD A;  4R4K A;  3S67 A;  3BNB A;  1JB5 A;  3F7X A;  3FH1 A;  3JUO A;  2PNC A;  1DVC A;  1CQS A;  4HKV B;  1YJN 3;  2OTJ 3;  3BB9 A;  3T0U A;  5CK6 A;  3CCR 3;  1Q42 A;  3F9S A;  1JB2 A;  2OWP A;  2HMO B;  3BLZ A;  1JKG A;  1HU9 A;  3K9M C;  1DYU A;  3HII A;  3NXJ A;  1QAK A;  1EKM A;  2BO9 B;  3Q1C A;  4GB5 A;  1UI7 A;  2CWV A;  3FF2 A;  1AVK A;  4EC6 A;  1VQ9 3;  3OXA A;  1K41 A;  1J2B A;  1D6Z A;  2PZV A;  1W2B 2;  3LOY A;  3DGO A;  5IF6 A;  3X41 A;  2W0Q A;  1JJ2 2;  3ALA A;  1IQ8 A;  4HM7 B;  4L8P A;  2M7O A;  3O8Y A;  3EBT A;  4IT7 A;  4RBN A;  1UW1 A;  4WYK A;  4EBG A;  3EE1 A;  2HMK B;  3HK4 A;  3H3H A;  3Q2P A;  4HM1 B;  1W01 A;  5AI1 A;  1R4C A;  4K1U A;  1M9G A;  3F7S A;  4BTY A;  5G2G A;  3OW2 2;  1GD3 A;  2E2U A;  1OPY A;  3K0Z A;  5EQL A;  1A2K A;  3F40 A;  3KZT A;  5LC7 A;  1UUW B;  1W5Z A;  1OHO A;  3E99 A;  2QEX 3;  1OAC A;  4FR9 A;  1YJW 3;  3MHE A;  4HM3 B;  1KD1 4;  1Q40 A;  3EN1 B;  1W6Y A;  5IEN A;  2W9Q A;  1N8R 4;  3DGL A;  1OHS A;  4Q53 A;  1KWI A;  1MNL A;  3F8X A;  5JBS A;  3FF0 A;  4IIA A;  4EV2 A;  4MMX B;  3UB1 A;  3ER7 A;  2FGT A;  4O2H A;  5AEW B;  1N9J A;  2WOH A;  2BNG A;  3DY5 A;  1US1 A;  1S5A A;  1GY5 A;  1ZO2 A;  2C11 A;  3WA3 A;  2D1W A;  4XB5 A;  2RCD A;  2I9W A;  2L4V A;  4MMY B;  4XBT A;  1Y4K A;  3SOY A;  2CH9 A;  2Z7A A;  3MYT A;  3LTB A;  5FGO A;  1E3V A;  2MF7 A;  1RN7 A;  1IT7 A;  3VF1 A;  1CYV A;  4KZ1 A;  1IV9 A;  2HMN B;  4HM5 B;  3EC9 A;  4NHF A;  3CCM 3;  3AMO B;  1E97 A;  1Q7Y 4;  1JN5 A;  3DGM A;  3MG1 A;  5CXO A;  1W2Z A;  3RGR A;  1YIT 3;  3G4S 3;  4FMB A;  5BXQ A;  4J8T A;  4HM6 B;  1IDP A;  1SIH A;  2XFT A;  2XR8 B;  3EQQ B;  4HBR A;  5FW5 A;  3CC2 3;  5IW9 A;  4OVM A;  2QIY A;  1VQK 3;  4HM0 B;  1NJI 4;  1G96 A;  2UX0 A;  4EXR A;  3RGA A;  1PFP A;  1ROV A;  1W00 A;  2CWT A;  4FCZ A;  2CIU A;  3WA2 X;  4JRF A;  3CD6 3;  1WNH A;  5IG0 A;  3JVC A;  4HYZ A;  2P09 A;  5D83 A;  1A90 A;  4AKY A;  4EV5 A;  2Z76 A;  5AIF A;  3JUN A;  2BT3 A;  5AIH A;  1NWW A;  3PXM A;  4KFF A;  4L8O A;  5DRV A;  2BMR B;  1U5O A;  5D81 A;  1M90 4;  1LXE A;  4HZ9 B;  3FG4 A;  3L0R A;  2GXF A;  3OWY A;  3BND A;  1DVD A;  1W02 A;  1KSI A;  2CK3 H;  3WMD A;  1IK3 A;  2GBX B;  3G6E 3;  3CCJ 3;  3CCL 3;  4R9K A;  2P0X A;  1TFO A;  2E2T A;  3LML A;  3WDG B;  3MKI A;  2BMO B;  4MJD A;  2QGU A;  4N6N B;  3DMC A;  3GAX A;  1EA2 A;  4AKZ A;  5A0O B;  4J9A A;  1IQY A;  3QRD A;  1OGZ A;  1RJO A;  1BUQ A;  1FA3 A;  1IVU A;  4BTX A;  4MMZ B;  3D3L A;  1QJG A;  3HX8 A;  1ULI B;  3EN8 A;  2RFR A;  4XBY A;  2C10 A;  1IT8 A;  1TIJ A;  4LSO A;  1GS3 A;  1VQ6 3;  1A67 A;  3GZR A;  1KC8 4;  1YJ9 3;  5EVH A;  3NQZ A;  3N54 B;  3OV4 A;  1NO3 A;  1YVB I;  5IG5 A;  1SQW A;  4K90 B;  2D42 A;  1ZX2 A;  2KCD A;  3HIG A;  3U97 A;  4WHA A;  3WOE B;  3NBB A;  5ELJ A;  7STD A;  3DGN A;  1VQ8 3;  1YI2 3;  1S72 3;  5AYR B;  3PGB A;  3KE7 A;  3A76 A;  2B24 B;  3J7Y d;  2E2V A;  3V98 A;  4R80 A;  2XSO B;  1N5H A;  4KVH A;  2Z77 A;  2F86 B;  3GWR A;  3B8L A;  1ROA A;  1JRQ A;  1VQP 3;  2CKF B;  3MWZ A;  2OCT A;  4X2O A;  1K73 4;  3PYJ A;  2CFG A;  2CFD A;  1RKY A;  3N8B A;  1DMN A;  2W03 A;  3VSY A;  4FMC A;  4MEI A;  1FGM A;  3GZY B;  1Z1S A;  5ELU A;  1A2V A;  1W7C A;  3GZX B;  4BTW A;  5CLK A;  5BVB A;  3CU3 A;  3H51 A;  2P0M A;  2OOV C;  1YGE A;  3V99 A;  1GD4 A;  3KSE D;  3UL5 A;  4HVN A;  4OK0 A;  1MOL A;  1OCV A;  2YFJ B;  3CME 3;  3FGY A;  1PU4 A;  1Q82 4;  1OH0 A;  3IPT A;  1QVG 2;  3OWU A;  4CCV A;  4IPB A;  2Y74 A;  1AV4 A;  4RNZ A;  3LTA A;  1C7H A;  3KN4 A;  5IEO A;  1TP6 A;  1QVF 2;  1HKX A;  1UI8 A;  3PZW A;  4LZI A;  5HGR A;  3AMO A;  3JUP A;  3UJM A;  1AR0 A;  4X2H A;  3SED A;  2XEP A;  4HM4 B;  3NV0 B;  1WMP A;  1ULJ B;  4EYC A;  4QWT A;  5TGN A;  1D6U A;  1U8C B;  2XGL A;  1UUV B;  3DXO A;  4CDL A;  1O7P B;  4H3U A;  3K63 A;  3Q90 A;  1KQS 2;  2IA7 A;  2SBL A;  1IVW A;  4LEH A;  1W6C A;  4PEJ A;  3I56 3;  1VQ4 3;  1EG9 B;  1W6G A;  3I55 3;  1CYU A;  4TX4 A;  3LT9 A;  5STD A;  2WGQ A;  2ZDJ A;  3NM7 A;  2OOV A;  1K9M 4;  1SII A;  3HI7 A;  2OQE C;  2RSX A;  2K54 A;  3S27 A;  2F99 A;  1OHP A;  5EEO A;  2JQ5 A;  2O3O A;  3UNL A;  3CXC 2;  3MPH A;  3G16 A;  4XDW A;  4STD A;  2LQV A;  3EBY A;  4N6T A;  3FLJ A;  1IQX A;  1Q81 4;  2CWU A;  5KP4 A;  4JF8 A;  4KFE A;  2FNQ A;  3JUQ A;  1CEW I;  1O7H B;  3FKA A;  2XF3 A;  1ASK A;  2QA4 3;  3S29 A;  3V92 A;  4ORL A;  1FUW A;  4AEQ A;  4K61 A;  2OQE A;  2Z6B A;  4HM2 B;  2HMJ B;  1FGO A;  2F98 A;  2GBW B;  2BMQ B;  2RGQ A;  3NUV A;  1YHQ 3;  2CFK A;  3G8Z A;  1QMA A;  3EHC A;  5DRE A;  2CG0 A;  1NB5 I;  2WO0 A;  3JUM A;  1TU5 A;  1N5P A;  2CFW A;  3X3X A;  3FG3 A;  1DMM A;  2MC8 A;  4OUQ A;  4R1K A;  1FGR A;  1TFK A;  1QAL A;  1VQ7 3;  3S28 A;  3B4O A;  2XH9 A;  1V74 A;  2V1L A;  3NQY A;  1ISK A;  3LZA A;  3N9H A;  2CHC A;  3LH4 A;  1K8A 4;  4RNY A;  3UL6 A;  2IMJ A;  4XBX A;  1E3R A;  3T8U A;  2XFS A;  2GEX A;  2W04 A;  3QK9 A;  4R9L A;  1WMN A;  3NBR A;  3EB8 A;  1GYB A;  1M1K 4;  3KSP A;  3NX0 A;  3B7C A;  2W56 B;  4N6O B;  3MG3 A;  1NB3 I;  4N3V A;  1JV2 B;  1SPU A;  4FMA A;  3LXU X;  1Q86 4;  3VGN A;  2GEY A;  2B1X B;  1AVL A;  2R4I A;  2W2C A;  1OF5 A;  5CF1 A;  3PCS A;  2HML B;  2W9P A;  1STF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...