3LTCA

X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.0 a by multi-wavelength anomalous dispersion
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP BINDING PROTEIN-DX
molecule tags De novo protein
source organism Synthetic construct
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltcA00
2P09A 3LT9A 3LTBA 1UW1A 3LT8A 3DGMA 3LTCA 3DGLA 3DGOA 2P0XA 3DGNA 3LTAA 2P05A 3LTDA
chains in the Genus database with same CATH superfamily
5ELUA 1GOYA 3LH4A 1YGEA 4XM4A 4HM8B 1E97A 3AGNA 3WDGB 1BAOA 1D6YA 1BRJA 3DGMA 4AKZA 2CFWA 2HMKB 1BSDA 2ZL8A 1Q7HA 4LYLB 1KSIA 2MC8A 3D5IA 3WHOA 1B21A 3EN8A 1OUNA 4KT3B 1IV7A 3EB8A 4O3VA 3LXUX 5AYRB 3LYGA 4K90B 1KQS2 3F8XA 1W02A 2B1XB 2GU3A 1G96A 2KF3A 3KKGA 1DE3A 4LEHA 2YFIB 2F4YA 4K61A 5IERA 2HMJB 1FGMA 4RZMA 1FGTA 1IQXA 4N6TA 7STDA 3AHSA 1GMQA 3NQYA 4WYKA 4BIRA 1BNFA 3FF2A 1EA2A 1RGLA 1T5YA 1X1YA 3MYTA 3D3LA 3HX8A 3O8YA 3OWUA 1W2ZA 4IPBA 4L8PA 1M1K4 4AKYA 3BIRA 3IPTA 1RRLA 1VQQA 3JUNA 3PCRA 5AYSC 4CPKA 3CCE3 2OTL3 2CC3A 3DMCA 1RGKA 1IVUA 3J7Yd 2OOVA 4BTWA 3FH1A 1BSBA 4ILFA 5IG4A 1JV2B 4U13A 5KP1A 3OW22 6RNTA 1JNQA 3OV4A 5D83A 1BRSA 1O7NB 1G02A 2AADA 1UUVB 1YIJ3 3ALAA 2OWPA 3CCQ3 1B3SA 4KZ1A 4LZIA 5IF6A 1RN1A 2CFDA 2H0GA 2W6JH 3F7SA 1BOXA 3B8LA 1WNHA 2BMQB 2W56A 4JRFA 1VQ63 1LXEA 3FSDA 4IIAA 1GD3A 3LMLA 5AEUB 2D1WA 5BIRA 1BUQA 1MGWA 1FUTA 2LQVA 4LSOA 1VQO3 1GS3A 1Q814 3T8UA 1UCJA 3KIIA 3SX1A 1RN4A 1US1A 3JUQA 2H0HA 2KF4A 1N9EA 1RMSA 2L4VA 1WMPA 1BRHA 1LVNA 2C11A 2F98A 1I70A 1TFOA 1OCVA 1VQ53 1MGRA 5STDA 4RNYA 1B27A 4H3UA 4XB5A 3ZG5A 1QAFA 3A5EA 5KP4A 1Q40A 1BGSA 4I5QA 1GMRA 4O8SA 5AEWB 1UCIA 4EV5A 1RRHA 1N8QA 3K63A 3AMOB 3CCJ3 1IT8A 3CMA3 5A0OB 2SARA 1IYYA 3G8ZA 1AQZA 1VQ83 2HMLB 2L1SA 1TIJA 2H0IA 1VQM3 1FUSA 3G713 1O7HB 2CG1A 4EBGA 4HBRA 4HM3B 3HI7A 3SXXA 1W6GA 1PU4A 3DGYA 3NX0A 1BIRA 3UNLA 1NNVA 1E3VA 3NQZA 2R41A 4BU4A 1V58A 3DGLA 2XGLA 3BLZA 3DGNA 3GWRA 3NM2A 3NHXA 1W7CA 1IQ8A 3MG1A 1QVF2 3CC73 3RGAA 3OWSA 3WOFB 1K28A 1S723 2ZHXB 3EHCA 2IMJA 1OH0A 1GOUA 1OHPA 3BNEA 5M18A 3KSPA 1QAKA 4N6LA 1GMPA 1SIIA 2WOFA 5CXOA 5BXQA 1MWRA 4NREA 4XBTA 5AIGA 2OTJ3 4HM1B 3H51A 1YJN3 3B4OA 1Y4KA 3AMOA 3U97A 1BSEA 2CW9A 1RGAA 1LQGC 2C4BA 2WGOA 4HVNA 3ECFA 4KVHA 4MMXB 2W04A 2P09A 3I553 1TRQA 1C7HA 3FG4A 3BNCA 5CK6A 5FW5A 1YVSA 3RDEA 5BU4A 3CCL3 5JPPA 1WMOA 3B4PA 3NUVA 3TDGA 3LZAA 3WA2X 1W01A 4R4KA 3ROBA 3G16A 4O2HA 5EEOA 3VSYA 3NBRA 1PFPA 3LTCA 4HM7B 4MMYB 1FZUA 2GEXA 1UGHI 4EV2A 5LC7A 3EBYA 2CWTA 2ML6A 3Q1CA 3BNDA 9RNTA 2XFSA 2XRXB 1JN5B 1DMMA 4HM0B 4EC6A 3V92A 2F5MA 1BRGA 1YVBI 2YX9A 3FLJA 1RCLA 6STDA 3NV0B 4OVMA 3SLUA 3M8CA 2XSOB 3WODG 2QA43 1W4NA 1X1WA 3K9MC 4CDLA 2BU4A 2WGQA 4NPBA 3K5TA 2B24B 1AVLA 2BHMA 4RBNA 1BNEA 2UX0A 2XR8B 3SEDA 1RGGA 2KF6A 1NDOB 1EG9B 1D6UA 1T3BA 3DY5A 1B2ZA 2CK3H 4K1VA 4N6OB 3NM7A 4N6V0 1JB5A 3F40A 1K9M4 1IQYA 1QALA 2JDIH 1STFI 3A76A 3PS8A 5M19A 4Q53A 4BTXA 5IG5A 3F9SA 1L5GB 1UI8A 1RGCA 1HZ1A 1TUHA 1HYFA 1ZS7A 2CFLA 2WOHA 2XGNA 3G0KA 4QWTA 1BNRA 4BTYA 2D42A 1B2UA 3S5CA 3ZG0A 1SIHA 1NB5I 3D9RA 5AI1A 2BNGA 2RBIA 1JB2A 1RGEA 3GAXA 3K7CA 1LNIA 4GHOA 4GB5A 1UUGB 3HK4A 4O02B 1ASKA 1JKGA 2GSPA 3DGOA 3CNXA 3FF0A 3GZRA 3JUOA 1PY3A 2IY2A 3OXAA 4OK0A 1MWSA 3S28A 1RNBA 1FGRA 1GSPA 5EQLA 1YGWA 3DM8A 1LQMB 1X1XA 3CXC2 1TFKA 2CH9A 2RSXA 1F8NA 1SARA 3KCHA 4WWUC 1SJWA 5CF2A 1YHQ3 1KWIA 1LOWA 4CCVA 2QIYA 3NXJA 5CF1A 1YNVX 2KXGA 4DKIA 2ML5A 3DUKA 1MNLA 5G1LA 1VZZA 4L7KA 1GY6A 3X3YA 1A90A 1Q9EA 1O7GB 3Q3FA 1LRAA 3UJMA 2P0XA 3LTAA 1HKXA 3OWYA 5IG0A 2V1LA 1S5AA 5EVHA 5JBSA 3X3XA 3AGOA 2INXA 2Z77A 4ORLA 5HGRA 2OQEA 3EQQB 3S29A 2QGUA 1OHSA 1Q7Y4 1TU5A 1UUWB 2Z7AA 1W2B2 1GOVA 2K0MA 1W00A 1VQ43 1VQN3 3U1WA 2JQ5A 3IMAB 2PZVA 3S67A 4FCJA 1BNGA 1M904 3LT9A 4MEIA 1O7PB 4FMDA 2BMOB 4HKVB 2CIUA 1X1UA 2E2UA 2FGTA 1DMQA 4MJDA 1WMNA 1RKYA 2W9QA 5ELJA 2I9WA 4WHAA 3GZXB 3PGBA 1VQ93 3JVCA 2MF7A 3CCS3 1Z1SA 5BVBA 4R9KA 1UGIA 2W56B 1QMAA 1BNSA 1SQWA 2W0QA 5D82A 2E2VA 2ZA4A 3JUPA 1N8R4 1BUJA 1MWUA 1M1XB 1O7WB 1DYUA 2GBWB 3CCU3 1IVWA 1MWTA 2CKFB 4HJLB 3VGNA 3MSOA 3ZFZA 5IW9A 1YJ93 1AV4A 1LOYA 3WOEB 3GZBA 2CWUA 3GSPA 1RGHA 3QK9A 1KC84 3D79A 1A67A 3X3ZA 3LT8A 1BANA 2KAAA 4EXRA 2LYXA 2Y74A 3SVAA 1UI7A 4HM5B 3WMDA 4EYCA 1RN7A 2CHCA 1FA3A 3EN1B 2Z76A 3URPA 1I3FA 1DVDA 2OQEC 1I0VA 1VQ73 4HM2B 3CU3A 1FUWA 1W6YA 4K1UA 3NBJA 4IT7A 1ROVA 3HIGA 1RSNA 8CHOA 3KZTA 3EE1A 4RNTA 1N9JA 4XDWA 1RJOA 2W2CA 3FG3A 3CCV3 3EJVA 1N5HA 1RTUA 3QRDA 1JRQA 3RNTA 3FGYA 3FCSB 1EKMA 1GYBA 3AHWA 2HOHA 4CJNA 4FMBA 1OF5B 2XH9A 4G1MB 1NJI4 3KE7A 2CWVA 3T8NA 1OGZA 1UW1A 2OCTA 1WTHA 4R9LA 5CLKA 1CH0A 1R4CA 4STDA 1CYUA 2YFLB 5AIHA 1TRPA 2M7OA 1RCKA 2FNQA 2W9PA 3EBTA 1Q42A 1ISKA 2HMOB 3NBBA 4L8OA 1T2IA 5HOHA 2F99A 2A15A 1PYLA 1RDSA 3CCR3 1VQP3 1B2MA 4FMAA 5LC6A 1UDII 1W5ZA 2RNTA 3CC43 1JBRA 1U8CB 3KSED 1B20A 1QVG2 3F14A 1DVCA 1YJW3 1BNIA 4HZBB 2Y73A 3Q90A 2BO9B 2O3OA 3WR2A 1Q824 2IUJA 3CPW2 1IK3A 1C54A 1RHLA 5IEOA 1JJ22 3MWZA 3CNMA 4JF8A 2XF3A 2KCDA 2O9UX 4PEJA 4XDVA 1VQK3 1WQLB 1RGFA 1JZDA 4FCMA 3WA3A 1ROAA 4HZ9B 1AY7A 4HM6B 8RNTA 3LTBA 1LNHA 2GXFA 2UGIA 1ULJB 3L0RA 1UCLA 3MHEA 3V98A 1LOXA 3IJEB 3G4S3 2RFRA 4OUQA 1I2FA 3SYUA 4HAAA 1OPYA 3MKIA 1UCKA 1Q40B 3FG1A 2P0MA 1I8VA 2P05A 1TP6A 7RNTA 3B7CA 5G1KA 3S27A 1BU4A 3K0ZA 3UL6A 3X40A 4J5KA 4NHFA 5M1AA 3STDA 1OACA 2IYJA 4N3VA 4J9AA 3V99A 5JPUA 5IG3A 4HOHA 1GD4A 2CG0A 2J8XB 1FYSA 2W03A 4KFEA 3JUMA 1BRNL 1R4YA 1A2PA 2BMRB 1U5OA 3NV0A 1IV9A 1RLSA 1A2KA 3DH2A 1CEWI 5AIFA 1NWWA 4GL6A 1JBTA 2XFTA 1CYVA 1I2EA 1FGQA 2ZDJA 4ZM8A 3N54B 3BU4A 1IT7A 3FZWA 4WFOA 3H3HA 2F86B 2Q07A 3UL5A 4FMCA 1NB3I 2OOVC 3DXOA 3UB1A 1OF5A 2K54A 3PXMA 2CFGA 1T2HA 5IENA 4AEQA 5RNTA 1Q864 1BNJA 1I0XA 1IVXA 3RGRA 1BVIA 3GZYB 2UUGC 1TTOA 5IEPA 2XSHB 4LMIA 2IUKA 5KP3A 3F7XA 2K3DA 4I4KA 2GBXB 3HZPA 4X2HA 1W6CA 3I563 1IU7A 3F8HA 4FR9A 1JBSA 2HMNB 1HU9A 1KD14 1EEJA 1GY7A 1I2GA 1QJGA 1ZGXA 4N6MA 1GY5A 1IDPA 3BNBA 1ULIB 3MG2A 1M9GA 3VF1A 3DZLA 1YIT3 2Z6BA 2C10A 2KF5A 1K8A4 2QEX3 3CD63 2P38A 5I97A 1JN5A 1NU3A 2PNCA 3OX9A 4RNZA 1A2VA 1LOVA 1SPUA 1BSCA 2YFJB 3EF8A 1NO3A 2BIRA 3LOYA 1JKGB 3LTDA 4XBYA 1IVVA 3HIIA 1B2XA 4J8TA 3SOAA 2SBLA 3N8BA 3PCSA 3MPHA 1RNTA 1DETA 1N5PA 2RCDA 1I3IA 2GU1A 3E99A 4H61A 3N9HA 1JZOA 3KFQC 2F5WA 4TX4A 3PZWA 2IA7A 1B2SA 3BB9A 1CQSA 1D6ZA 3D5GA 4HYZA 4N6UA 2CX0A 4R80A 4KFFA 1STDA 1V74A 3PYJA 2R4IA 4R1KA 3HOHA 2RGQA 1EUIC 3KN4A 4WYKB 3T0UA 3EX9A 1BSAA 1ZO2A 6GSPA 3CME3 1VQL3 1DMNA 1G0TA 1E3RA 1AVKA 4N6NB 4KFDA 1AR0A 2AAEA 3CPOA 4J5GA 4WP5A 1TJDA 2WO0A 3FKAA 1EQKA 1J2BA 1BRIA 2BT3A 2KRTA 2E2TA 3EC9A 3X41A 1MOLA 2GEYA 2HMMB 3G6E3 3I0YA 3SOYA 4X2OA 4GSPA 1JB4A 1BRKA 1FGOA 4MMZB 1OGXA 5AIIA 1FW7A 1ZX2A 1O7MB 3X42A 3Q2PA 3MG3A 3D4AA 5FGOA 5TGNA 3GRDA 4LGQA 5D81A 4BL3A 5GSPA 3ER7A 1V57A 3CCM3 2XEPA 4EW5A 1K41A 4FCZA 5DREA 2FXTA 1K734 2CX1A 5DRVA 4XBXA 2F56A 7GSPA 1OHOA 4BL2A 2STDA 3CC23 1YI23 5G2GA 4HM4B 2CFKA
chains in the Genus database with same CATH topology
5ELUA 3LH4A 1YGEA 4XM4A 4HM8B 1E97A 3WDGB 1D6YA 3DGMA 4AKZA 2CFWA 2HMKB 2ZL8A 2MC8A 1KSIA 3EN8A 1OUNA 4O3VA 1IV7A 3EB8A 5AYRB 3LXUX 1KQS2 3LYGA 4K90B 3F8XA 1W02A 2B1XB 2GU3A 1G96A 3KKGA 4LEHA 2YFIB 4K61A 5IERA 2HMJB 1FGMA 4RZMA 1FGTA 1IQXA 7STDA 3NQYA 4WYKA 3FF2A 1EA2A 1T5YA 3MYTA 3O8YA 3D3LA 3HX8A 3OWUA 4IPBA 1W2ZA 1M1K4 4L8PA 4AKYA 3IPTA 1RRLA 3PCRA 3JUNA 5AYSC 3CCE3 2OTL3 2CC3A 3DMCA 1IVUA 3J7Yd 2OOVA 4BTWA 3FH1A 5IG4A 1JV2B 4U13A 5KP1A 3OW22 1JNQA 3OV4A 5D83A 1O7NB 1YIJ3 1UUVB 3ALAA 2OWPA 3CCQ3 4KZ1A 4LZIA 5IF6A 2CFDA 2W6JH 3F7SA 3B8LA 1WNHA 2BMQB 2W56A 4JRFA 1VQ63 1LXEA 3FSDA 4IIAA 1GD3A 3LMLA 5AEUB 2D1WA 1BUQA 4LSOA 2LQVA 1VQO3 1Q814 1GS3A 3T8UA 3KIIA 3SX1A 1US1A 3JUQA 1N9EA 2L4VA 1WMPA 1LVNA 2C11A 2F98A 1TFOA 1OCVA 1VQ53 5STDA 4RNYA 4H3UA 4XB5A 1QAFA 5KP4A 1Q40A 4O8SA 5AEWB 4EV5A 1RRHA 1N8QA 3K63A 3AMOB 3CCJ3 1IT8A 3CMA3 5A0OB 3G8ZA 1VQ83 2HMLB 1TIJA 1VQM3 3G713 1O7HB 2CG1A 4EBGA 4HBRA 4HM3B 3HI7A 3SXXA 1W6GA 1PU4A 3NX0A 3UNLA 1E3VA 3NQZA 3DGLA 2XGLA 3BLZA 3DGNA 3GWRA 3NM2A 3NHXA 1W7CA 1IQ8A 3MG1A 1QVF2 3CC73 3RGAA 3OWSA 3WOFB 1K28A 1S723 3EHCA 2IMJA 1OH0A 1OHPA 3BNEA 3KSPA 1QAKA 4N6LA 1SIIA 5CXOA 2WOFA 5BXQA 4NREA 4XBTA 5AIGA 2OTJ3 4HM1B 3H51A 1YJN3 3B4OA 1Y4KA 3AMOA 3U97A 2CW9A 4HVNA 2WGOA 4KVHA 3I553 3ECFA 4MMXB 2W04A 2P09A 1C7HA 3FG4A 3BNCA 5CK6A 5FW5A 3RDEA 3CCL3 5JPPA 1WMOA 3B4PA 3NUVA 3TDGA 3LZAA 3WA2X 1W01A 4R4KA 3ROBA 3G16A 4O2HA 5EEOA 3VSYA 3NBRA 1PFPA 3LTCA 4HM7B 4MMYB 2GEXA 4EV2A 5LC7A 3EBYA 2CWTA 2ML6A 3Q1CA 3BNDA 2XFSA 2XRXB 1JN5B 1DMMA 4HM0B 4EC6A 3V92A 1YVBI 2YX9A 3FLJA 6STDA 3NV0B 4OVMA 3SLUA 3M8CA 2XSOB 3WODG 2QA43 1W4NA 3K9MC 4CDLA 2WGQA 3K5TA 2B24B 1AVLA 2BHMA 4RBNA 2UX0A 2XR8B 3SEDA 1NDOB 1EG9B 1D6UA 3DY5A 2CK3H 4K1VA 4N6OB 3NM7A 4N6V0 1JB5A 3F40A 1K9M4 1IQYA 3A76A 1QALA 1STFI 2JDIH 3PS8A 4Q53A 4BTXA 5IG5A 3F9SA 1L5GB 1UI8A 2WOHA 2CFLA 1TUHA 2XGNA 3G0KA 4N6TA 4QWTA 4BTYA 2D42A 3S5CA 1SIHA 1NB5I 3D9RA 5AI1A 2BNGA 1JB2A 3GAXA 3K7CA 4GB5A 3HK4A 4O02B 1ASKA 1JKGA 3JUOA 3DGOA 3CNXA 3FF0A 3GZRA 3OXAA 4OK0A 3S28A 1FGRA 5EQLA 3DM8A 3CXC2 1TFKA 2CH9A 2RSXA 1F8NA 4WWUC 1SJWA 5CF2A 1YHQ3 1KWIA 4CCVA 2QIYA 3NXJA 5CF1A 2KXGA 2ML5A 3DUKA 1MNLA 1VZZA 4L7KA 1GY6A 3X3YA 1A90A 1O7GB 3UJMA 2P0XA 3LTAA 1HKXA 3OWYA 5IG0A 2V1LA 1S5AA 5EVHA 5JBSA 3X3XA 2INXA 2Z77A 4ORLA 5HGRA 2OQEA 3EQQB 3S29A 2QGUA 1OHSA 1Q7Y4 1TU5A 1UUWB 2Z7AA 1W2B2 2K0MA 1W00A 1VQ43 1VQN3 3U1WA 2JQ5A 3IMAB 2PZVA 3S67A 4FCJA 1M904 3LT9A 4MEIA 1O7PB 4FMDA 2BMOB 4HKVB 2CIUA 2E2UA 2FGTA 1DMQA 4MJDA 1WMNA 1RKYA 2W9QA 5ELJA 2I9WA 4WHAA 3GZXB 3PGBA 1VQ93 3JVCA 2MF7A 3CCS3 1Z1SA 5BVBA 4R9KA 2W56B 1QMAA 1SQWA 2W0QA 5D82A 2E2VA 3JUPA 1N8R4 1M1XB 1O7WB 1DYUA 2GBWB 3CCU3 1IVWA 3VGNA 2CKFB 4HJLB 3MSOA 5IW9A 1YJ93 1AV4A 3WOEB 3GZBA 2CWUA 3QK9A 1KC84 1A67A 3X3ZA 3LT8A 4EXRA 2LYXA 2Y74A 3SVAA 1UI7A 4HM5B 3WMDA 4EYCA 1RN7A 2CHCA 1FA3A 3EN1B 2Z76A 1DVDA 2OQEC 1VQ73 4HM2B 3CU3A 1FUWA 1W6YA 4K1UA 3NBJA 4IT7A 1ROVA 3HIGA 8CHOA 3KZTA 3EE1A 4XDWA 1N9JA 3CCV3 1RJOA 2W2CA 3FG3A 3EJVA 1N5HA 3QRDA 1JRQA 3FGYA 3FCSB 1EKMA 1GYBA 4FMBA 1OF5B 2XH9A 4G1MB 1NJI4 3KE7A 2CWVA 3T8NA 1OGZA 1UW1A 2OCTA 1WTHA 4R9LA 5CLKA 1R4CA 4STDA 1CYUA 2YFLB 5AIHA 2M7OA 2FNQA 2W9PA 3EBTA 1Q42A 1ISKA 2HMOB 3NBBA 4L8OA 2F99A 2A15A 3CCR3 1VQP3 4FMAA 5LC6A 1W5ZA 3CC43 1U8CB 3KSED 1QVG2 3F14A 1DVCA 1YJW3 4HZBB 2Y73A 3Q90A 2BO9B 2O3OA 1Q824 2IUJA 3CPW2 1IK3A 5IEOA 1JJ22 3MWZA 3CNMA 4JF8A 2XF3A 2KCDA 2O9UX 4PEJA 4XDVA 1VQK3 1WQLB 3WA3A 4FCMA 1ROAA 4HZ9B 4HM6B 3LTBA 1LNHA 2GXFA 3L0RA 1ULJB 3MHEA 3V98A 1LOXA 3IJEB 3G4S3 2RFRA 4OUQA 1OPYA 3MKIA 1Q40B 3FG1A 2P0MA 2P05A 1TP6A 3B7CA 3S27A 3K0ZA 3UL6A 3X40A 4NHFA 3STDA 1OACA 4N3VA 4J9AA 3V99A 5JPUA 5IG3A 1GD4A 2CG0A 4KFEA 2W03A 3JUMA 2BMRB 3NV0A 1U5OA 1IV9A 1A2KA 5AIFA 1CEWI 1NWWA 4GL6A 2XFTA 1CYVA 1FGQA 2ZDJA 4ZM8A 3N54B 1IT7A 3FZWA 4WFOA 3H3HA 2F86B 2Q07A 3UL5A 4FMCA 1NB3I 2OOVC 3DXOA 3UB1A 1OF5A 2K54A 3PXMA 2CFGA 5IENA 4AEQA 1Q864 3RGRA 1IVXA 3GZYB 5IEPA 2XSHB 4LMIA 2IUKA 5KP3A 3F7XA 4I4KA 2GBXB 3HZPA 4X2HA 1W6CA 3I563 1IU7A 3F8HA 4FR9A 2HMNB 1HU9A 1KD14 1GY7A 1QJGA 4N6MA 1GY5A 1IDPA 3BNBA 1ULIB 3MG2A 1M9GA 3VF1A 3DZLA 1YIT3 2Z6BA 2C10A 1K8A4 3CD63 2QEX3 2P38A 5I97A 1NU3A 1JN5A 2PNCA 3OX9A 4RNZA 1A2VA 1SPUA 2YFJB 3EF8A 1NO3A 3LOYA 1JKGB 3LTDA 4XBYA 1IVVA 3HIIA 4J8TA 3SOAA 2SBLA 3N8BA 3PCSA 3MPHA 1N5PA 3E99A 2RCDA 2GU1A 4H61A 3N9HA 3KFQC 4TX4A 3PZWA 2IA7A 3BB9A 1CQSA 1D6ZA 4HYZA 4N6UA 4R80A 4KFFA 1STDA 1V74A 3PYJA 2R4IA 4R1KA 2RGQA 3KN4A 4WYKB 3T0UA 3EX9A 3CME3 1ZO2A 1VQL3 1DMNA 1E3RA 1AVKA 4N6NB 4KFDA 1AR0A 3CPOA 4WP5A 2WO0A 3FKAA 1EQKA 1J2BA 2BT3A 2KRTA 2E2TA 3EC9A 3X41A 1MOLA 2GEYA 2HMMB 3G6E3 3I0YA 3SOYA 4X2OA 1JB4A 1FGOA 4MMZB 1OGXA 5AIIA 1ZX2A 1O7MB 3X42A 3Q2PA 3MG3A 5FGOA 5TGNA 3GRDA 4LGQA 5D81A 3CCM3 3ER7A 2XEPA 1K41A 4FCZA 5DREA 2FXTA 1K734 5DRVA 4XBXA 1OHOA 2STDA 3CC23 1YI23 5G2GA 4HM4B 2CFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P09 A;  3LT9 A;  3LTB A;  1UW1 A;  3LT8 A;  3DGM A;  3LTC A;  3DGL A;  3DGO A;  2P0X A;  3DGN A;  3LTA A;  2P05 A;  3LTD A; 
#chains in the Genus database with same CATH topology
 5ELU A;  1GOY A;  3LH4 A;  1YGE A;  4XM4 A;  4HM8 B;  1E97 A;  3AGN A;  3WDG B;  1BAO A;  1D6Y A;  1BRJ A;  3DGM A;  4AKZ A;  2CFW A;  2HMK B;  1BSD A;  2ZL8 A;  1Q7H A;  4LYL B;  1KSI A;  2MC8 A;  3D5I A;  3WHO A;  1B21 A;  3EN8 A;  1OUN A;  4KT3 B;  1IV7 A;  3EB8 A;  4O3V A;  3LXU X;  5AYR B;  3LYG A;  4K90 B;  1KQS 2;  3F8X A;  1W02 A;  2B1X B;  2GU3 A;  1G96 A;  2KF3 A;  3KKG A;  1DE3 A;  4LEH A;  2YFI B;  2F4Y A;  4K61 A;  5IER A;  2HMJ B;  1FGM A;  4RZM A;  1FGT A;  1IQX A;  4N6T A;  7STD A;  3AHS A;  1GMQ A;  3NQY A;  4WYK A;  4BIR A;  1BNF A;  3FF2 A;  1EA2 A;  1RGL A;  1T5Y A;  1X1Y A;  3MYT A;  3D3L A;  3HX8 A;  3O8Y A;  3OWU A;  1W2Z A;  4IPB A;  4L8P A;  1M1K 4;  4AKY A;  3BIR A;  3IPT A;  1RRL A;  1VQQ A;  3JUN A;  3PCR A;  5AYS C;  4CPK A;  3CCE 3;  2OTL 3;  2CC3 A;  3DMC A;  1RGK A;  1IVU A;  3J7Y d;  2OOV A;  4BTW A;  3FH1 A;  1BSB A;  4ILF A;  5IG4 A;  1JV2 B;  4U13 A;  5KP1 A;  3OW2 2;  6RNT A;  1JNQ A;  3OV4 A;  5D83 A;  1BRS A;  1O7N B;  1G02 A;  2AAD A;  1UUV B;  1YIJ 3;  3ALA A;  2OWP A;  3CCQ 3;  1B3S A;  4KZ1 A;  4LZI A;  5IF6 A;  1RN1 A;  2CFD A;  2H0G A;  2W6J H;  3F7S A;  1BOX A;  3B8L A;  1WNH A;  2BMQ B;  2W56 A;  4JRF A;  1VQ6 3;  1LXE A;  3FSD A;  4IIA A;  1GD3 A;  3LML A;  5AEU B;  2D1W A;  5BIR A;  1BUQ A;  1MGW A;  1FUT A;  2LQV A;  4LSO A;  1VQO 3;  1GS3 A;  1Q81 4;  3T8U A;  1UCJ A;  3KII A;  3SX1 A;  1RN4 A;  1US1 A;  3JUQ A;  2H0H A;  2KF4 A;  1N9E A;  1RMS A;  2L4V A;  1WMP A;  1BRH A;  1LVN A;  2C11 A;  2F98 A;  1I70 A;  1TFO A;  1OCV A;  1VQ5 3;  1MGR A;  5STD A;  4RNY A;  1B27 A;  4H3U A;  4XB5 A;  3ZG5 A;  1QAF A;  3A5E A;  5KP4 A;  1Q40 A;  1BGS A;  4I5Q A;  1GMR A;  4O8S A;  5AEW B;  1UCI A;  4EV5 A;  1RRH A;  1N8Q A;  3K63 A;  3AMO B;  3CCJ 3;  1IT8 A;  3CMA 3;  5A0O B;  2SAR A;  1IYY A;  3G8Z A;  1AQZ A;  1VQ8 3;  2HML B;  2L1S A;  1TIJ A;  2H0I A;  1VQM 3;  1FUS A;  3G71 3;  1O7H B;  2CG1 A;  4EBG A;  4HBR A;  4HM3 B;  3HI7 A;  3SXX A;  1W6G A;  1PU4 A;  3DGY A;  3NX0 A;  1BIR A;  3UNL A;  1NNV A;  1E3V A;  3NQZ A;  2R41 A;  4BU4 A;  1V58 A;  3DGL A;  2XGL A;  3BLZ A;  3DGN A;  3GWR A;  3NM2 A;  3NHX A;  1W7C A;  1IQ8 A;  3MG1 A;  1QVF 2;  3CC7 3;  3RGA A;  3OWS A;  3WOF B;  1K28 A;  1S72 3;  2ZHX B;  3EHC A;  2IMJ A;  1OH0 A;  1GOU A;  1OHP A;  3BNE A;  5M18 A;  3KSP A;  1QAK A;  4N6L A;  1GMP A;  1SII A;  2WOF A;  5CXO A;  5BXQ A;  1MWR A;  4NRE A;  4XBT A;  5AIG A;  2OTJ 3;  4HM1 B;  3H51 A;  1YJN 3;  3B4O A;  1Y4K A;  3AMO A;  3U97 A;  1BSE A;  2CW9 A;  1RGA A;  1LQG C;  2C4B A;  2WGO A;  4HVN A;  3ECF A;  4KVH A;  4MMX B;  2W04 A;  2P09 A;  3I55 3;  1TRQ A;  1C7H A;  3FG4 A;  3BNC A;  5CK6 A;  5FW5 A;  1YVS A;  3RDE A;  5BU4 A;  3CCL 3;  5JPP A;  1WMO A;  3B4P A;  3NUV A;  3TDG A;  3LZA A;  3WA2 X;  1W01 A;  4R4K A;  3ROB A;  3G16 A;  4O2H A;  5EEO A;  3VSY A;  3NBR A;  1PFP A;  3LTC A;  4HM7 B;  4MMY B;  1FZU A;  2GEX A;  1UGH I;  4EV2 A;  5LC7 A;  3EBY A;  2CWT A;  2ML6 A;  3Q1C A;  3BND A;  9RNT A;  2XFS A;  2XRX B;  1JN5 B;  1DMM A;  4HM0 B;  4EC6 A;  3V92 A;  2F5M A;  1BRG A;  1YVB I;  2YX9 A;  3FLJ A;  1RCL A;  6STD A;  3NV0 B;  4OVM A;  3SLU A;  3M8C A;  2XSO B;  3WOD G;  2QA4 3;  1W4N A;  1X1W A;  3K9M C;  4CDL A;  2BU4 A;  2WGQ A;  4NPB A;  3K5T A;  2B24 B;  1AVL A;  2BHM A;  4RBN A;  1BNE A;  2UX0 A;  2XR8 B;  3SED A;  1RGG A;  2KF6 A;  1NDO B;  1EG9 B;  1D6U A;  1T3B A;  3DY5 A;  1B2Z A;  2CK3 H;  4K1V A;  4N6O B;  3NM7 A;  4N6V 0;  1JB5 A;  3F40 A;  1K9M 4;  1IQY A;  1QAL A;  2JDI H;  1STF I;  3A76 A;  3PS8 A;  5M19 A;  4Q53 A;  4BTX A;  5IG5 A;  3F9S A;  1L5G B;  1UI8 A;  1RGC A;  1HZ1 A;  1TUH A;  1HYF A;  1ZS7 A;  2CFL A;  2WOH A;  2XGN A;  3G0K A;  4QWT A;  1BNR A;  4BTY A;  2D42 A;  1B2U A;  3S5C A;  3ZG0 A;  1SIH A;  1NB5 I;  3D9R A;  5AI1 A;  2BNG A;  2RBI A;  1JB2 A;  1RGE A;  3GAX A;  3K7C A;  1LNI A;  4GHO A;  4GB5 A;  1UUG B;  3HK4 A;  4O02 B;  1ASK A;  1JKG A;  2GSP A;  3DGO A;  3CNX A;  3FF0 A;  3GZR A;  3JUO A;  1PY3 A;  2IY2 A;  3OXA A;  4OK0 A;  1MWS A;  3S28 A;  1RNB A;  1FGR A;  1GSP A;  5EQL A;  1YGW A;  3DM8 A;  1LQM B;  1X1X A;  3CXC 2;  1TFK A;  2CH9 A;  2RSX A;  1F8N A;  1SAR A;  3KCH A;  4WWU C;  1SJW A;  5CF2 A;  1YHQ 3;  1KWI A;  1LOW A;  4CCV A;  2QIY A;  3NXJ A;  5CF1 A;  1YNV X;  2KXG A;  4DKI A;  2ML5 A;  3DUK A;  1MNL A;  5G1L A;  1VZZ A;  4L7K A;  1GY6 A;  3X3Y A;  1A90 A;  1Q9E A;  1O7G B;  3Q3F A;  1LRA A;  3UJM A;  2P0X A;  3LTA A;  1HKX A;  3OWY A;  5IG0 A;  2V1L A;  1S5A A;  5EVH A;  5JBS A;  3X3X A;  3AGO A;  2INX A;  2Z77 A;  4ORL A;  5HGR A;  2OQE A;  3EQQ B;  3S29 A;  2QGU A;  1OHS A;  1Q7Y 4;  1TU5 A;  1UUW B;  2Z7A A;  1W2B 2;  1GOV A;  2K0M A;  1W00 A;  1VQ4 3;  1VQN 3;  3U1W A;  2JQ5 A;  3IMA B;  2PZV A;  3S67 A;  4FCJ A;  1BNG A;  1M90 4;  3LT9 A;  4MEI A;  1O7P B;  4FMD A;  2BMO B;  4HKV B;  2CIU A;  1X1U A;  2E2U A;  2FGT A;  1DMQ A;  4MJD A;  1WMN A;  1RKY A;  2W9Q A;  5ELJ A;  2I9W A;  4WHA A;  3GZX B;  3PGB A;  1VQ9 3;  3JVC A;  2MF7 A;  3CCS 3;  1Z1S A;  5BVB A;  4R9K A;  1UGI A;  2W56 B;  1QMA A;  1BNS A;  1SQW A;  2W0Q A;  5D82 A;  2E2V A;  2ZA4 A;  3JUP A;  1N8R 4;  1BUJ A;  1MWU A;  1M1X B;  1O7W B;  1DYU A;  2GBW B;  3CCU 3;  1IVW A;  1MWT A;  2CKF B;  4HJL B;  3VGN A;  3MSO A;  3ZFZ A;  5IW9 A;  1YJ9 3;  1AV4 A;  1LOY A;  3WOE B;  3GZB A;  2CWU A;  3GSP A;  1RGH A;  3QK9 A;  1KC8 4;  3D79 A;  1A67 A;  3X3Z A;  3LT8 A;  1BAN A;  2KAA A;  4EXR A;  2LYX A;  2Y74 A;  3SVA A;  1UI7 A;  4HM5 B;  3WMD A;  4EYC A;  1RN7 A;  2CHC A;  1FA3 A;  3EN1 B;  2Z76 A;  3URP A;  1I3F A;  1DVD A;  2OQE C;  1I0V A;  1VQ7 3;  4HM2 B;  3CU3 A;  1FUW A;  1W6Y A;  4K1U A;  3NBJ A;  4IT7 A;  1ROV A;  3HIG A;  1RSN A;  8CHO A;  3KZT A;  3EE1 A;  4RNT A;  1N9J A;  4XDW A;  1RJO A;  2W2C A;  3FG3 A;  3CCV 3;  3EJV A;  1N5H A;  1RTU A;  3QRD A;  1JRQ A;  3RNT A;  3FGY A;  3FCS B;  1EKM A;  1GYB A;  3AHW A;  2HOH A;  4CJN A;  4FMB A;  1OF5 B;  2XH9 A;  4G1M B;  1NJI 4;  3KE7 A;  2CWV A;  3T8N A;  1OGZ A;  1UW1 A;  2OCT A;  1WTH A;  4R9L A;  5CLK A;  1CH0 A;  1R4C A;  4STD A;  1CYU A;  2YFL B;  5AIH A;  1TRP A;  2M7O A;  1RCK A;  2FNQ A;  2W9P A;  3EBT A;  1Q42 A;  1ISK A;  2HMO B;  3NBB A;  4L8O A;  1T2I A;  5HOH A;  2F99 A;  2A15 A;  1PYL A;  1RDS A;  3CCR 3;  1VQP 3;  1B2M A;  4FMA A;  5LC6 A;  1UDI I;  1W5Z A;  2RNT A;  3CC4 3;  1JBR A;  1U8C B;  3KSE D;  1B20 A;  1QVG 2;  3F14 A;  1DVC A;  1YJW 3;  1BNI A;  4HZB B;  2Y73 A;  3Q90 A;  2BO9 B;  2O3O A;  3WR2 A;  1Q82 4;  2IUJ A;  3CPW 2;  1IK3 A;  1C54 A;  1RHL A;  5IEO A;  1JJ2 2;  3MWZ A;  3CNM A;  4JF8 A;  2XF3 A;  2KCD A;  2O9U X;  4PEJ A;  4XDV A;  1VQK 3;  1WQL B;  1RGF A;  1JZD A;  4FCM A;  3WA3 A;  1ROA A;  4HZ9 B;  1AY7 A;  4HM6 B;  8RNT A;  3LTB A;  1LNH A;  2GXF A;  2UGI A;  1ULJ B;  3L0R A;  1UCL A;  3MHE A;  3V98 A;  1LOX A;  3IJE B;  3G4S 3;  2RFR A;  4OUQ A;  1I2F A;  3SYU A;  4HAA A;  1OPY A;  3MKI A;  1UCK A;  1Q40 B;  3FG1 A;  2P0M A;  1I8V A;  2P05 A;  1TP6 A;  7RNT A;  3B7C A;  5G1K A;  3S27 A;  1BU4 A;  3K0Z A;  3UL6 A;  3X40 A;  4J5K A;  4NHF A;  5M1A A;  3STD A;  1OAC A;  2IYJ A;  4N3V A;  4J9A A;  3V99 A;  5JPU A;  5IG3 A;  4HOH A;  1GD4 A;  2CG0 A;  2J8X B;  1FYS A;  2W03 A;  4KFE A;  3JUM A;  1BRN L;  1R4Y A;  1A2P A;  2BMR B;  1U5O A;  3NV0 A;  1IV9 A;  1RLS A;  1A2K A;  3DH2 A;  1CEW I;  5AIF A;  1NWW A;  4GL6 A;  1JBT A;  2XFT A;  1CYV A;  1I2E A;  1FGQ A;  2ZDJ A;  4ZM8 A;  3N54 B;  3BU4 A;  1IT7 A;  3FZW A;  4WFO A;  3H3H A;  2F86 B;  2Q07 A;  3UL5 A;  4FMC A;  1NB3 I;  2OOV C;  3DXO A;  3UB1 A;  1OF5 A;  2K54 A;  3PXM A;  2CFG A;  1T2H A;  5IEN A;  4AEQ A;  5RNT A;  1Q86 4;  1BNJ A;  1I0X A;  1IVX A;  3RGR A;  1BVI A;  3GZY B;  2UUG C;  1TTO A;  5IEP A;  2XSH B;  4LMI A;  2IUK A;  5KP3 A;  3F7X A;  2K3D A;  4I4K A;  2GBX B;  3HZP A;  4X2H A;  1W6C A;  3I56 3;  1IU7 A;  3F8H A;  4FR9 A;  1JBS A;  2HMN B;  1HU9 A;  1KD1 4;  1EEJ A;  1GY7 A;  1I2G A;  1QJG A;  1ZGX A;  4N6M A;  1GY5 A;  1IDP A;  3BNB A;  1ULI B;  3MG2 A;  1M9G A;  3VF1 A;  3DZL A;  1YIT 3;  2Z6B A;  2C10 A;  2KF5 A;  1K8A 4;  2QEX 3;  3CD6 3;  2P38 A;  5I97 A;  1JN5 A;  1NU3 A;  2PNC A;  3OX9 A;  4RNZ A;  1A2V A;  1LOV A;  1SPU A;  1BSC A;  2YFJ B;  3EF8 A;  1NO3 A;  2BIR A;  3LOY A;  1JKG B;  3LTD A;  4XBY A;  1IVV A;  3HII A;  1B2X A;  4J8T A;  3SOA A;  2SBL A;  3N8B A;  3PCS A;  3MPH A;  1RNT A;  1DET A;  1N5P A;  2RCD A;  1I3I A;  2GU1 A;  3E99 A;  4H61 A;  3N9H A;  1JZO A;  3KFQ C;  2F5W A;  4TX4 A;  3PZW A;  2IA7 A;  1B2S A;  3BB9 A;  1CQS A;  1D6Z A;  3D5G A;  4HYZ A;  4N6U A;  2CX0 A;  4R80 A;  4KFF A;  1STD A;  1V74 A;  3PYJ A;  2R4I A;  4R1K A;  3HOH A;  2RGQ A;  1EUI C;  3KN4 A;  4WYK B;  3T0U A;  3EX9 A;  1BSA A;  1ZO2 A;  6GSP A;  3CME 3;  1VQL 3;  1DMN A;  1G0T A;  1E3R A;  1AVK A;  4N6N B;  4KFD A;  1AR0 A;  2AAE A;  3CPO A;  4J5G A;  4WP5 A;  1TJD A;  2WO0 A;  3FKA A;  1EQK A;  1J2B A;  1BRI A;  2BT3 A;  2KRT A;  2E2T A;  3EC9 A;  3X41 A;  1MOL A;  2GEY A;  2HMM B;  3G6E 3;  3I0Y A;  3SOY A;  4X2O A;  4GSP A;  1JB4 A;  1BRK A;  1FGO A;  4MMZ B;  1OGX A;  5AII A;  1FW7 A;  1ZX2 A;  1O7M B;  3X42 A;  3Q2P A;  3MG3 A;  3D4A A;  5FGO A;  5TGN A;  3GRD A;  4LGQ A;  5D81 A;  4BL3 A;  5GSP A;  3ER7 A;  1V57 A;  3CCM 3;  2XEP A;  4EW5 A;  1K41 A;  4FCZ A;  5DRE A;  2FXT A;  1K73 4;  2CX1 A;  5DRV A;  4XBX A;  2F56 A;  7GSP A;  1OHO A;  4BL2 A;  2STD A;  3CC2 3;  1YI2 3;  5G2G A;  4HM4 B;  2CFK A; 
#chains in the Genus database with same CATH homology
 5ELU A;  3LH4 A;  1YGE A;  4XM4 A;  4HM8 B;  1E97 A;  3WDG B;  1D6Y A;  3DGM A;  4AKZ A;  2CFW A;  2HMK B;  2ZL8 A;  2MC8 A;  1KSI A;  3EN8 A;  1OUN A;  4O3V A;  1IV7 A;  3EB8 A;  5AYR B;  3LXU X;  1KQS 2;  3LYG A;  4K90 B;  3F8X A;  1W02 A;  2B1X B;  2GU3 A;  1G96 A;  3KKG A;  4LEH A;  2YFI B;  4K61 A;  5IER A;  2HMJ B;  1FGM A;  4RZM A;  1FGT A;  1IQX A;  7STD A;  3NQY A;  4WYK A;  3FF2 A;  1EA2 A;  1T5Y A;  3MYT A;  3O8Y A;  3D3L A;  3HX8 A;  3OWU A;  4IPB A;  1W2Z A;  1M1K 4;  4L8P A;  4AKY A;  3IPT A;  1RRL A;  3PCR A;  3JUN A;  5AYS C;  3CCE 3;  2OTL 3;  2CC3 A;  3DMC A;  1IVU A;  3J7Y d;  2OOV A;  4BTW A;  3FH1 A;  5IG4 A;  1JV2 B;  4U13 A;  5KP1 A;  3OW2 2;  1JNQ A;  3OV4 A;  5D83 A;  1O7N B;  1YIJ 3;  1UUV B;  3ALA A;  2OWP A;  3CCQ 3;  4KZ1 A;  4LZI A;  5IF6 A;  2CFD A;  2W6J H;  3F7S A;  3B8L A;  1WNH A;  2BMQ B;  2W56 A;  4JRF A;  1VQ6 3;  1LXE A;  3FSD A;  4IIA A;  1GD3 A;  3LML A;  5AEU B;  2D1W A;  1BUQ A;  4LSO A;  2LQV A;  1VQO 3;  1Q81 4;  1GS3 A;  3T8U A;  3KII A;  3SX1 A;  1US1 A;  3JUQ A;  1N9E A;  2L4V A;  1WMP A;  1LVN A;  2C11 A;  2F98 A;  1TFO A;  1OCV A;  1VQ5 3;  5STD A;  4RNY A;  4H3U A;  4XB5 A;  1QAF A;  5KP4 A;  1Q40 A;  4O8S A;  5AEW B;  4EV5 A;  1RRH A;  1N8Q A;  3K63 A;  3AMO B;  3CCJ 3;  1IT8 A;  3CMA 3;  5A0O B;  3G8Z A;  1VQ8 3;  2HML B;  1TIJ A;  1VQM 3;  3G71 3;  1O7H B;  2CG1 A;  4EBG A;  4HBR A;  4HM3 B;  3HI7 A;  3SXX A;  1W6G A;  1PU4 A;  3NX0 A;  3UNL A;  1E3V A;  3NQZ A;  3DGL A;  2XGL A;  3BLZ A;  3DGN A;  3GWR A;  3NM2 A;  3NHX A;  1W7C A;  1IQ8 A;  3MG1 A;  1QVF 2;  3CC7 3;  3RGA A;  3OWS A;  3WOF B;  1K28 A;  1S72 3;  3EHC A;  2IMJ A;  1OH0 A;  1OHP A;  3BNE A;  3KSP A;  1QAK A;  4N6L A;  1SII A;  5CXO A;  2WOF A;  5BXQ A;  4NRE A;  4XBT A;  5AIG A;  2OTJ 3;  4HM1 B;  3H51 A;  1YJN 3;  3B4O A;  1Y4K A;  3AMO A;  3U97 A;  2CW9 A;  4HVN A;  2WGO A;  4KVH A;  3I55 3;  3ECF A;  4MMX B;  2W04 A;  2P09 A;  1C7H A;  3FG4 A;  3BNC A;  5CK6 A;  5FW5 A;  3RDE A;  3CCL 3;  5JPP A;  1WMO A;  3B4P A;  3NUV A;  3TDG A;  3LZA A;  3WA2 X;  1W01 A;  4R4K A;  3ROB A;  3G16 A;  4O2H A;  5EEO A;  3VSY A;  3NBR A;  1PFP A;  3LTC A;  4HM7 B;  4MMY B;  2GEX A;  4EV2 A;  5LC7 A;  3EBY A;  2CWT A;  2ML6 A;  3Q1C A;  3BND A;  2XFS A;  2XRX B;  1JN5 B;  1DMM A;  4HM0 B;  4EC6 A;  3V92 A;  1YVB I;  2YX9 A;  3FLJ A;  6STD A;  3NV0 B;  4OVM A;  3SLU A;  3M8C A;  2XSO B;  3WOD G;  2QA4 3;  1W4N A;  3K9M C;  4CDL A;  2WGQ A;  3K5T A;  2B24 B;  1AVL A;  2BHM A;  4RBN A;  2UX0 A;  2XR8 B;  3SED A;  1NDO B;  1EG9 B;  1D6U A;  3DY5 A;  2CK3 H;  4K1V A;  4N6O B;  3NM7 A;  4N6V 0;  1JB5 A;  3F40 A;  1K9M 4;  1IQY A;  3A76 A;  1QAL A;  1STF I;  2JDI H;  3PS8 A;  4Q53 A;  4BTX A;  5IG5 A;  3F9S A;  1L5G B;  1UI8 A;  2WOH A;  2CFL A;  1TUH A;  2XGN A;  3G0K A;  4N6T A;  4QWT A;  4BTY A;  2D42 A;  3S5C A;  1SIH A;  1NB5 I;  3D9R A;  5AI1 A;  2BNG A;  1JB2 A;  3GAX A;  3K7C A;  4GB5 A;  3HK4 A;  4O02 B;  1ASK A;  1JKG A;  3JUO A;  3DGO A;  3CNX A;  3FF0 A;  3GZR A;  3OXA A;  4OK0 A;  3S28 A;  1FGR A;  5EQL A;  3DM8 A;  3CXC 2;  1TFK A;  2CH9 A;  2RSX A;  1F8N A;  4WWU C;  1SJW A;  5CF2 A;  1YHQ 3;  1KWI A;  4CCV A;  2QIY A;  3NXJ A;  5CF1 A;  2KXG A;  2ML5 A;  3DUK A;  1MNL A;  1VZZ A;  4L7K A;  1GY6 A;  3X3Y A;  1A90 A;  1O7G B;  3UJM A;  2P0X A;  3LTA A;  1HKX A;  3OWY A;  5IG0 A;  2V1L A;  1S5A A;  5EVH A;  5JBS A;  3X3X A;  2INX A;  2Z77 A;  4ORL A;  5HGR A;  2OQE A;  3EQQ B;  3S29 A;  2QGU A;  1OHS A;  1Q7Y 4;  1TU5 A;  1UUW B;  2Z7A A;  1W2B 2;  2K0M A;  1W00 A;  1VQ4 3;  1VQN 3;  3U1W A;  2JQ5 A;  3IMA B;  2PZV A;  3S67 A;  4FCJ A;  1M90 4;  3LT9 A;  4MEI A;  1O7P B;  4FMD A;  2BMO B;  4HKV B;  2CIU A;  2E2U A;  2FGT A;  1DMQ A;  4MJD A;  1WMN A;  1RKY A;  2W9Q A;  5ELJ A;  2I9W A;  4WHA A;  3GZX B;  3PGB A;  1VQ9 3;  3JVC A;  2MF7 A;  3CCS 3;  1Z1S A;  5BVB A;  4R9K A;  2W56 B;  1QMA A;  1SQW A;  2W0Q A;  5D82 A;  2E2V A;  3JUP A;  1N8R 4;  1M1X B;  1O7W B;  1DYU A;  2GBW B;  3CCU 3;  1IVW A;  3VGN A;  2CKF B;  4HJL B;  3MSO A;  5IW9 A;  1YJ9 3;  1AV4 A;  3WOE B;  3GZB A;  2CWU A;  3QK9 A;  1KC8 4;  1A67 A;  3X3Z A;  3LT8 A;  4EXR A;  2LYX A;  2Y74 A;  3SVA A;  1UI7 A;  4HM5 B;  3WMD A;  4EYC A;  1RN7 A;  2CHC A;  1FA3 A;  3EN1 B;  2Z76 A;  1DVD A;  2OQE C;  1VQ7 3;  4HM2 B;  3CU3 A;  1FUW A;  1W6Y A;  4K1U A;  3NBJ A;  4IT7 A;  1ROV A;  3HIG A;  8CHO A;  3KZT A;  3EE1 A;  4XDW A;  1N9J A;  3CCV 3;  1RJO A;  2W2C A;  3FG3 A;  3EJV A;  1N5H A;  3QRD A;  1JRQ A;  3FGY A;  3FCS B;  1EKM A;  1GYB A;  4FMB A;  1OF5 B;  2XH9 A;  4G1M B;  1NJI 4;  3KE7 A;  2CWV A;  3T8N A;  1OGZ A;  1UW1 A;  2OCT A;  1WTH A;  4R9L A;  5CLK A;  1R4C A;  4STD A;  1CYU A;  2YFL B;  5AIH A;  2M7O A;  2FNQ A;  2W9P A;  3EBT A;  1Q42 A;  1ISK A;  2HMO B;  3NBB A;  4L8O A;  2F99 A;  2A15 A;  3CCR 3;  1VQP 3;  4FMA A;  5LC6 A;  1W5Z A;  3CC4 3;  1U8C B;  3KSE D;  1QVG 2;  3F14 A;  1DVC A;  1YJW 3;  4HZB B;  2Y73 A;  3Q90 A;  2BO9 B;  2O3O A;  1Q82 4;  2IUJ A;  3CPW 2;  1IK3 A;  5IEO A;  1JJ2 2;  3MWZ A;  3CNM A;  4JF8 A;  2XF3 A;  2KCD A;  2O9U X;  4PEJ A;  4XDV A;  1VQK 3;  1WQL B;  3WA3 A;  4FCM A;  1ROA A;  4HZ9 B;  4HM6 B;  3LTB A;  1LNH A;  2GXF A;  3L0R A;  1ULJ B;  3MHE A;  3V98 A;  1LOX A;  3IJE B;  3G4S 3;  2RFR A;  4OUQ A;  1OPY A;  3MKI A;  1Q40 B;  3FG1 A;  2P0M A;  2P05 A;  1TP6 A;  3B7C A;  3S27 A;  3K0Z A;  3UL6 A;  3X40 A;  4NHF A;  3STD A;  1OAC A;  4N3V A;  4J9A A;  3V99 A;  5JPU A;  5IG3 A;  1GD4 A;  2CG0 A;  4KFE A;  2W03 A;  3JUM A;  2BMR B;  3NV0 A;  1U5O A;  1IV9 A;  1A2K A;  5AIF A;  1CEW I;  1NWW A;  4GL6 A;  2XFT A;  1CYV A;  1FGQ A;  2ZDJ A;  4ZM8 A;  3N54 B;  1IT7 A;  3FZW A;  4WFO A;  3H3H A;  2F86 B;  2Q07 A;  3UL5 A;  4FMC A;  1NB3 I;  2OOV C;  3DXO A;  3UB1 A;  1OF5 A;  2K54 A;  3PXM A;  2CFG A;  5IEN A;  4AEQ A;  1Q86 4;  3RGR A;  1IVX A;  3GZY B;  5IEP A;  2XSH B;  4LMI A;  2IUK A;  5KP3 A;  3F7X A;  4I4K A;  2GBX B;  3HZP A;  4X2H A;  1W6C A;  3I56 3;  1IU7 A;  3F8H A;  4FR9 A;  2HMN B;  1HU9 A;  1KD1 4;  1GY7 A;  1QJG A;  4N6M A;  1GY5 A;  1IDP A;  3BNB A;  1ULI B;  3MG2 A;  1M9G A;  3VF1 A;  3DZL A;  1YIT 3;  2Z6B A;  2C10 A;  1K8A 4;  3CD6 3;  2QEX 3;  2P38 A;  5I97 A;  1NU3 A;  1JN5 A;  2PNC A;  3OX9 A;  4RNZ A;  1A2V A;  1SPU A;  2YFJ B;  3EF8 A;  1NO3 A;  3LOY A;  1JKG B;  3LTD A;  4XBY A;  1IVV A;  3HII A;  4J8T A;  3SOA A;  2SBL A;  3N8B A;  3PCS A;  3MPH A;  1N5P A;  3E99 A;  2RCD A;  2GU1 A;  4H61 A;  3N9H A;  3KFQ C;  4TX4 A;  3PZW A;  2IA7 A;  3BB9 A;  1CQS A;  1D6Z A;  4HYZ A;  4N6U A;  4R80 A;  4KFF A;  1STD A;  1V74 A;  3PYJ A;  2R4I A;  4R1K A;  2RGQ A;  3KN4 A;  4WYK B;  3T0U A;  3EX9 A;  3CME 3;  1ZO2 A;  1VQL 3;  1DMN A;  1E3R A;  1AVK A;  4N6N B;  4KFD A;  1AR0 A;  3CPO A;  4WP5 A;  2WO0 A;  3FKA A;  1EQK A;  1J2B A;  2BT3 A;  2KRT A;  2E2T A;  3EC9 A;  3X41 A;  1MOL A;  2GEY A;  2HMM B;  3G6E 3;  3I0Y A;  3SOY A;  4X2O A;  1JB4 A;  1FGO A;  4MMZ B;  1OGX A;  5AII A;  1ZX2 A;  1O7M B;  3X42 A;  3Q2P A;  3MG3 A;  5FGO A;  5TGN A;  3GRD A;  4LGQ A;  5D81 A;  3CCM 3;  3ER7 A;  2XEP A;  1K41 A;  4FCZ A;  5DRE A;  2FXT A;  1K73 4;  5DRV A;  4XBX A;  1OHO A;  2STD A;  3CC2 3;  1YI2 3;  5G2G A;  4HM4 B;  2CFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...