3LTCA

X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.0 a by multi-wavelength anomalous dispersion
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords ATP BINDING PROTEIN-DX
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltcA00
3LTBA 2P05A 3DGMA 3LT9A 1UW1A 3DGLA 3LTAA 2P09A 3DGOA 3DGNA 3LT8A 3LTCA 2P0XA 3LTDA
chains in the Genus database with same CATH superfamily
1W6CA 4WYKB 3NUVA 1R4CA 1BIRA 1O7GB 2K3DA 5G2GA 3G713 3EBTA 4GHOA 2YFJB 3FG3A 2Z6BA 1RCKA 2W0QA 3GAXA 1N9EA 4HM7B 1ULIB 5AYSC 1RJOA 1BRJA 3F7XA 5IG0A 3PGBA 1WMNA 4EV5A 4GSPA 1ROAA 3LTCA 4EYCA 3B7CA 3X3XA 2BT3A 5DRVA 2WO0A 1Z1SA 2F86B 1B2ZA 5AEUB 4OVMA 1STFI 1RGGA 3UB1A 3A76A 1SARA 2K54A 3IJEB 1AY7A 3MKIA 1EQKA 2XF3A 2CWTA 2P38A 3KN4A 4K61A 4LZIA 1EEJA 1YI23 5BVBA 1QAKA 1BNFA 2RSXA 4CJNA 3DGMA 3N8BA 3S27A 3T0UA 4LEHA 4WWUC 1B2XA 2FXTA 3S28A 3ZFZA 3L0RA 3CCM3 2Y73A 2RFRA 3U97A 4N6V0 1VQQA 1R4YA 3UNLA 2RCDA 3F14A 3D5GA 1NWWA 1O7MB 2AADA 3PZWA 3F8XA 4FMBA 1OH0A 2OWPA 3T8UA 3GSPA 3I553 1DYUA 3CPW2 3PCRA 3WOEB 3HI7A 3H3HA 2YFIB 2XH9A 1VQK3 1A90A 1CYVA 5IEPA 1FA3A 4O3VA 1LQMB 1Q864 4FMCA 5DREA 8CHOA 5HOHA 3LT9A 2W03A 3FG4A 3DGLA 1NO3A 3OWSA 2BO9B 1YJ93 1K734 1ZGXA 4IPBA 1IK3A 2IUKA 1B2MA 2MC8A 1GOYA 1JB2A 1F8NA 5FGOA 1VQ93 3NM7A 1Y4KA 1G96A 1OPYA 4AKYA 4MJDA 1UI8A 3MG1A 4QWTA 1N8R4 2CFGA 1K9M4 2W04A 3X40A 1RHLA 1RMSA 2GBWB 3PS8A 1BNSA 4BIRA 2E2VA 1JV2B 2KXGA 3ALAA 4STDA 2W56A 1X1UA 1BNIA 3DUKA 3NV0A 4R80A 4FMDA 3QRDA 5AIFA 3GZXB 1N8QA 2W9QA 5M18A 2P0XA 3LTDA 2ZA4A 3GWRA 1IYYA 3DGYA 3BNDA 4Q53A 2HMKB 3FSDA 1RGLA 3JUQA 5GSPA 3VGNA 2OQEA 2MF7A 5FW5A 3CPOA 1O7NB 5LC6A 1RRLA 2XRXB 1BGSA 1X1XA 2XSHB 2F5WA 5LC7A 2IUJA 1I0XA 1W2ZA 1QAFA 3DGOA 4BU4A 1BUJA 1W7CA 1I8VA 1BRHA 1T2IA 2WGQA 3OXAA 2Q07A 3HOHA 1ISKA 3JUOA 1D6UA 3OWUA 4EBGA 1BNJA 2GEYA 3CCQ3 3CCV3 4ZM8A 3X42A 4EW5A 1EKMA 1OGXA 2INXA 1UW1A 2HMLB 2B1XB 5G1LA 1CEWI 1K8A4 1T3BA 2XR8B 4LYLB 2XSOB 4DKIA 1ZO2A 3EF8A 4HZBB 3MHEA 3WR2A 1FGMA 2JQ5A 4R1KA 1BSDA 2E2TA 2STDA 3UL5A 1OCVA 1IQYA 1Q814 1IV9A 5IEOA 3K0ZA 1JRQA 1VQ63 1WMOA 2UX0A 1NJI4 3SOYA 2F99A 3HK4A 3CCS3 1OF5A 5KP3A 1JN5B 3K63A 1UUVB 1LOWA 1RGAA 4HKVB 2PNCA 1RGKA 3KIIA 3MG2A 5HGRA 3BB9A 1LRAA 3CC23 5A0OB 2IY2A 3N9HA 1SPUA 3F7SA 1FGRA 1YVBI 2GU1A 1VZZA 3O8YA 3HIIA 4G1MB 1YIT3 4RNYA 5ELUA 2BNGA 1I2GA 3D3LA 1YJN3 4RBNA 3D4AA 4IT7A 1WMPA 4FMAA 4WHAA 5I97A 3G6E3 1OACA 2BMQB 2KF5A 4MMZB 1DMQA 2QGUA 1VQ43 1K41A 1E97A 1UCLA 1UI7A 3VSYA 3A5EA 3CMA3 3DXOA 1W2B2 4N6TA 4OK0A 1UDII 3KKGA 3MG3A 2J8XB 1G02A 2UGIA 3EB8A 4J9AA 3SX1A 5IW9A 3DZLA 1JBSA 3GZBA 5IERA 3EN1B 4J5KA 1W6YA 2CX0A 2OCTA 2XFSA 1V74A 4R9LA 4AKZA 3BLZA 1O7HB 4GL6A 2BMRB 5IG5A 1JKGB 1DMNA 1IVUA 3QK9A 4PEJA 3SXXA 2FNQA 1ULJB 1CH0A 1UUGB 1US1A 1YGEA 4MMYB 2CW9A 1N5HA 1I2FA 4XDVA 1VQL3 1BRIA 3LMLA 2Z76A 5JPPA 2W56B 3PCSA 3KCHA 4O8SA 5CLKA 1LXEA 5D81A 4MMXB 1Q7HA 4XBTA 2Z7AA 3V98A 1VQP3 4FCMA 1D6YA 1JZOA 3OV4A 1HU9A 2HMJB 2L1SA 5M1AA 5JPUA 2V1LA 3EE1A 1Q9EA 3CC73 3KSPA 1MWRA 4XBXA 1JJ22 1M1XB 4K90B 5G1KA 4EC6A 1IVWA 4EV2A 1LNHA 2F5MA 1OHSA 1QJGA 3G16A 4N6LA 1HZ1A 3NBRA 1J2BA 4KT3B 1SQWA 1B2SA 1IVXA 2KF6A 2KAAA 1I3FA 1Q40B 2O9UX 3CCR3 1OF5B 1YHQ3 3Q2PA 1B21A 2CWVA 1AV4A 2IMJA 4HAAA 2WGOA 5CF1A 1Q824 1WTHA 1B20A 2BU4A 1NNVA 4WYKA 1UCKA 1YIJ3 4HM5B 1C54A 4L8OA 4R4KA 1BRKA 2L4VA 1YNVX 1X1YA 5KP4A 4K1UA 5IF6A 1IU7A 5IG3A 3EC9A 2XGNA 2C10A 1CYUA 1PU4A 3FKAA 1MGWA 1NB3I 1W02A 1TRPA 2A15A 3BU4A 1IV7A 4RNZA 8RNTA 1ZS7A 1C7HA 2K0MA 3AHSA 2P0MA 1SJWA 3F9SA 1HYFA 1CQSA 5KP1A 1MGRA 3AHWA 1RNBA 2WOHA 5D82A 3ER7A 5CK6A 4N6OB 7STDA 3F40A 1ROVA 3EHCA 2D42A 1LOYA 3SOAA 2ML5A 1M904 4KFEA 1TFOA 4JF8A 2B24B 2XGLA 1GSPA 3GZYB 3URPA 3CCL3 1VQ83 4BL2A 1FW7A 2YX9A 3EX9A 1AVKA 1O7PB 2ZHXB 1GY6A 3ECFA 5AEWB 1IT8A 5RNTA 3ROBA 2IA7A 2W6JH 1RTUA 3LTBA 3LYGA 1JB5A 3JUPA 4LMIA 3PYJA 3I0YA 3UL6A 4X2HA 2PZVA 1BSEA 3SLUA 3SVAA 5M19A 1IDPA 2HMNB 3WHOA 2P05A 3D9RA 1RN1A 1RRHA 1STDA 2GSPA 3MYTA 3F8HA 1V58A 1WNHA 4O02B 1UGHI 5ELJA 3NV0B 1DVCA 4I4KA 1L5GB 3G4S3 5CXOA 3X3YA 1LOVA 4O2HA 4HZ9B 1RKYA 1OUNA 3BIRA 1RGCA 3B4PA 2ZL8A 1GYBA 1W01A 3OX9A 4BTYA 1BSAA 1KQS2 1FUWA 2QIYA 1YVSA 3AMOA 1QALA 4ILFA 3AMOB 1Q40A 4TX4A 3X3ZA 1SIHA 1LNIA 1TFKA 2CFLA 4HM2B 3GRDA 1BVIA 5AIGA 3CD63 3CNMA 2BHMA 2IYJA 4NPBA 1KSIA 4WP5A 3ZG0A 5IENA 3FZWA 3AGNA 1I2EA 1JN5A 4HOHA 3SYUA 1T2HA 1W5ZA 3GZRA 1RN7A 5IG4A 4LSOA 2ZDJA 3B4OA 3G0KA 1EA2A 2C11A 2F56A 4L7KA 4CDLA 1DVDA 1RCLA 2CWUA 4J8TA 2GXFA 1GMRA 4NHFA 3MSOA 3KZTA 3CCJ3 3FLJA 3NBBA 4EXRA 1K28A 1NDOB 1RGEA 1MOLA 3ZG5A 3MPHA 1I70A 4N3VA 1FYSA 2KRTA 1NB5I 1ZX2A 3BNEA 1V57A 4K1VA 1IVVA 1OHOA 3NQYA 1OGZA 2W2CA 1DE3A 1GD3A 1O7WB 2GBXB 3FF0A 3S29A 4BTWA 1YGWA 1G0TA 4XDWA 3D79A 2E2UA 4X2OA 4H61A 1TIJA 3I563 1VQN3 3WDGB 1Q7Y4 1T5YA 2CKFB 3Q90A 1GMPA 2H0IA 1JB4A 1GD4A 1KD14 4FCJA 3IMAB 1BRSA 1A67A 3EJVA 4J5GA 3HZPA 1D6ZA 3JUNA 3KE7A 1UCJA 1EG9B 4OUQA 1BRGA 1A2KA 3CNXA 1S5AA 2Z77A 3FH1A 1HKXA 3FG1A 7RNTA 3WA2X 1IQ8A 3EQQB 1DMMA 2RNTA 1GOVA 2P09A 2CK3H 1KWIA 3G8ZA 3JUMA 4HVNA 1FUSA 1IQXA 1GS3A 1RDSA 1FGQA 1RN4A 4HM1B 1BSBA 2M7OA 1JBTA 1VQM3 1GY7A 1TUHA 1BRNL 1PY3A 2XFTA 3K5TA 1JBRA 4HM4B 4HYZA 3U1WA 2JDIH 3TDGA 2CC3A 7GSPA 4LGQA 2RBIA 2CHCA 5AIIA 1A2VA 3WMDA 2HMOB 3K7CA 4FCZA 1UUWB 3KFQC 4N6UA 3FCSB 4HBRA 1B3SA 2F98A 1MNLA 2RGQA 2R4IA 1TP6A 9RNTA 3STDA 1PYLA 1M9GA 2D1WA 2WOFA 3WODG 2LYXA 2KF4A 3RGAA 3LT8A 4KFFA 2H0GA 4U13A 2CFDA 3WOFB 3NBJA 1GOUA 4N6NB 5BXQA 5EQLA 6STDA 1SIIA 2KCDA 1Q42A 1BAOA 3NM2A 1E3VA 1FZUA 1X1WA 2CIUA 4KZ1A 4BL3A 1QMAA 3DMCA 1N9JA 3BNBA 2C4BA 3AGOA 3CC43 4CPKA 4IIAA 3CXC2 3DH2A 1S723 2OTL3 5BU4A 3NHXA 3FF2A 1GMQA 3X41A 3RGRA 2OTJ3 1I3IA 1MWTA 3OW22 4BTXA 2CH9A 1LOXA 2CFKA 3DY5A 2SBLA 1VQO3 1RLSA 1TRQA 3HIGA 4XM4A 3CCE3 1FUTA 3DGNA 1ASKA 1I0VA 2OQEC 1OHPA 3K9MC 3D5IA 4FR9A 3Q3FA 1RGFA 3RNTA 4KFDA 2CFWA 4R9KA 5CF2A 1JKGA 4KVHA 5AYRB 2CX1A 2Y74A 1KC84 5JBSA 1BANA 1TJDA 3M8CA 4HM0B 2QA43 2FGTA 1BNRA 3JVCA 2ML6A 4HJLB 3SEDA 2QEX3 1FGTA 3E99A 4N6MA 2UUGC 4L8PA 1W4NA 1NU3A 1BNEA 1TTOA 1UCIA 3V99A 3VF1A 1FGOA 2R41A 1MWUA 1A2PA 1LQGC 1RNTA 2SARA 3H51A 3LOYA 3LXUX 5EEOA 4H3UA 1U8CB 4NREA 1N5PA 4I5QA 3J7Yd 3CME3 3CCU3 2XEPA 2YFLB 1YJW3 3MWZA 4AEQA 1AR0A 2BMOB 3FGYA 3IPTA 4CCVA 1QVF2 2HOHA 1BSCA 3B8LA 5AIHA 2KF3A 2O3OA 2OOVA 1VQ53 1JNQA 1RGHA 1DETA 1U5OA 1AQZA 3DM8A 4HM3B 4XBYA 2H0HA 4JRFA 2HMMB 3LH4A 2LQVA 1GY5A 3NQZA 3NXJA 4HM6B 4HM8B 1BNGA 1BU4A 4RZMA 2OOVC 1QVG2 2CG1A 3OWYA 3LTAA 3S5CA 3WA3A 3HX8A 1M1K4 1TU5A 4RNTA 3PXMA 5EVHA 1AVLA 2BIRA 3EBYA 2GEXA 4XB5A 2AAEA 3KSED 5STDA 4GB5A 1BOXA 5D83A 1IT7A 2F4YA 3UJMA 1MWSA 3T8NA 3V92A 1VQ73 6GSPA 3BNCA 3LZAA 4ORLA 5TGNA 1WQLB 3EN8A 1B2UA 3N54B 1UGIA 3RDEA 1W00A 3NX0A 2W9PA 1LVNA 4MEIA 1E3RA 1PFPA 1RSNA 3S67A 3Q1CA 3CU3A 4WFOA 5BIRA 6RNTA 1B27A 2CG0A 1EUIC 1BUQA 2GU3A 1W6GA 2I9WA 1JZDA 5AI1A
chains in the Genus database with same CATH topology
1W6CA 4WYKB 3NUVA 1R4CA 1O7GB 5G2GA 3G713 3EBTA 2YFJB 3FG3A 2Z6BA 2W0QA 3GAXA 1N9EA 4HM7B 1ULIB 5AYSC 1RJOA 3F7XA 5IG0A 3PGBA 1WMNA 4EV5A 1ROAA 3LTCA 4EYCA 3B7CA 3X3XA 2BT3A 5DRVA 2WO0A 1Z1SA 2F86B 5AEUB 4OVMA 1STFI 3UB1A 3A76A 2K54A 3IJEB 3MKIA 1EQKA 2XF3A 2CWTA 2P38A 3KN4A 4K61A 4LZIA 1YI23 5BVBA 1QAKA 2RSXA 3DGMA 3N8BA 3S27A 3T0UA 4LEHA 4WWUC 2FXTA 3S28A 3L0RA 3CCM3 2Y73A 2RFRA 3U97A 4N6V0 3UNLA 2RCDA 3F14A 3PZWA 1NWWA 1O7MB 4FMBA 3F8XA 1OH0A 2OWPA 3T8UA 3I553 3CPW2 1DYUA 3PCRA 3WOEB 3HI7A 3H3HA 2YFIB 2XH9A 1VQK3 1A90A 1CYVA 5IEPA 1FA3A 4O3VA 1Q864 4FMCA 5DREA 8CHOA 3LT9A 2W03A 3FG4A 3DGLA 1NO3A 3OWSA 2BO9B 1YJ93 1K734 4IPBA 1IK3A 2IUKA 2MC8A 1JB2A 1F8NA 5FGOA 1VQ93 3NM7A 1Y4KA 1G96A 1OPYA 4AKYA 4MJDA 1UI8A 3MG1A 4QWTA 1N8R4 2CFGA 1K9M4 2W04A 3X40A 3PS8A 2GBWB 2E2VA 3ALAA 1JV2B 2KXGA 4STDA 2W56A 3DUKA 3NV0A 4R80A 4FMDA 3QRDA 5AIFA 3GZXB 1N8QA 2W9QA 2P0XA 3LTDA 3GWRA 4Q53A 3BNDA 2HMKB 3FSDA 3JUQA 3VGNA 2OQEA 2MF7A 5FW5A 3CPOA 1O7NB 5LC6A 1RRLA 2XRXB 2XSHB 5LC7A 2IUJA 3DGOA 1QAFA 1W2ZA 1W7CA 2WGQA 3OXAA 2Q07A 1ISKA 3JUOA 1D6UA 3OWUA 4EBGA 3CCQ3 2GEYA 3CCV3 4ZM8A 3X42A 1EKMA 1OGXA 2INXA 1UW1A 2HMLB 2B1XB 1CEWI 1K8A4 2XR8B 2XSOB 1ZO2A 3EF8A 4HZBB 3MHEA 1FGMA 2JQ5A 4R1KA 2E2TA 2STDA 3UL5A 1OCVA 1IQYA 1Q814 1IV9A 5IEOA 3K0ZA 1JRQA 1VQ63 1WMOA 2UX0A 1NJI4 3SOYA 2F99A 3HK4A 3CCS3 1OF5A 5KP3A 1JN5B 3K63A 1UUVB 4HKVB 2PNCA 5HGRA 3KIIA 3MG2A 3BB9A 3CC23 5A0OB 3N9HA 1SPUA 3F7SA 1FGRA 1YVBI 2GU1A 1VZZA 3O8YA 3HIIA 4G1MB 1YIT3 4RNYA 5ELUA 2BNGA 3D3LA 1YJN3 4RBNA 4IT7A 1WMPA 4FMAA 4WHAA 5I97A 3G6E3 1OACA 2BMQB 1VQ43 4MMZB 1DMQA 2QGUA 1K41A 1E97A 1UI7A 3VSYA 3CMA3 3DXOA 1W2B2 4N6TA 4OK0A 3KKGA 3MG3A 3SX1A 3EB8A 4J9AA 5IW9A 3DZLA 3GZBA 5IERA 3EN1B 1W6YA 2XFSA 2OCTA 4AKZA 1V74A 4R9LA 3BLZA 1O7HB 4GL6A 2BMRB 5IG5A 1JKGB 1DMNA 1IVUA 3QK9A 4PEJA 3SXXA 2FNQA 1ULJB 4MMYB 1US1A 1YGEA 4XDVA 2CW9A 1N5HA 1VQL3 3LMLA 2Z76A 5JPPA 2W56B 3PCSA 4O8SA 5CLKA 1LXEA 5D81A 4MMXB 4XBTA 3V98A 2Z7AA 1VQP3 4FCMA 1D6YA 3OV4A 1HU9A 2HMJB 5JPUA 2V1LA 3EE1A 3CC73 3KSPA 4XBXA 1JJ22 1M1XB 4K90B 4EC6A 1IVWA 4EV2A 1LNHA 1OHSA 1QJGA 3G16A 4N6LA 1J2BA 3NBRA 1SQWA 1IVXA 1Q40B 2O9UX 3CCR3 1OF5B 1YHQ3 3Q2PA 2CWVA 1AV4A 2IMJA 2WGOA 5CF1A 1Q824 1WTHA 4WYKA 1YIJ3 4HM5B 4L8OA 4R4KA 2L4VA 5KP4A 4K1UA 5IF6A 1IU7A 5IG3A 3EC9A 2XGNA 2C10A 1CYUA 1PU4A 3FKAA 1NB3I 1W02A 2A15A 4RNZA 1IV7A 1C7HA 2K0MA 2P0MA 1SJWA 3F9SA 5KP1A 1CQSA 2WOHA 5D82A 3ER7A 5CK6A 4N6OB 7STDA 3F40A 1ROVA 3EHCA 2D42A 3SOAA 1M904 2ML5A 4KFEA 1TFOA 4JF8A 2B24B 2XGLA 3GZYB 3CCL3 1VQ83 2YX9A 3EX9A 1AVKA 1O7PB 3ECFA 1GY6A 5AEWB 1IT8A 3ROBA 2IA7A 2W6JH 3LTBA 3LYGA 1JB5A 3JUPA 4LMIA 3PYJA 3I0YA 3UL6A 4X2HA 2PZVA 3SVAA 3SLUA 1IDPA 2HMNB 2P05A 3D9RA 1RRHA 1STDA 3MYTA 3F8HA 1WNHA 4O02B 5ELJA 3NV0B 1DVCA 4I4KA 1L5GB 3G4S3 5CXOA 3X3YA 1RKYA 4O2HA 4HZ9B 1OUNA 3B4PA 2ZL8A 1GYBA 1W01A 3OX9A 4BTYA 1KQS2 1FUWA 2QIYA 3AMOA 1QALA 3AMOB 1Q40A 4TX4A 3X3ZA 1SIHA 1TFKA 2CFLA 4HM2B 3GRDA 5AIGA 3CD63 3CNMA 2BHMA 5IENA 1KSIA 4WP5A 3FZWA 1JN5A 1W5ZA 3GZRA 1RN7A 5IG4A 4LSOA 2ZDJA 3B4OA 3G0KA 1EA2A 2C11A 4L7KA 1DVDA 4CDLA 2CWUA 4J8TA 2GXFA 4NHFA 3MSOA 3KZTA 3CCJ3 3FLJA 3NBBA 4EXRA 1K28A 1NDOB 1MOLA 3MPHA 4N3VA 2KRTA 1NB5I 1ZX2A 3BNEA 4K1VA 1IVVA 1OHOA 3NQYA 1OGZA 2W2CA 1GD3A 1O7WB 2GBXB 3FF0A 3S29A 4BTWA 4XDWA 4X2OA 2E2UA 4H61A 1TIJA 3I563 1VQN3 3WDGB 1Q7Y4 1T5YA 2CKFB 3Q90A 1JB4A 1GD4A 1KD14 4FCJA 3IMAB 1A67A 3EJVA 3HZPA 1D6ZA 3JUNA 3KE7A 1EG9B 4OUQA 1A2KA 3CNXA 1S5AA 2Z77A 3FH1A 1HKXA 3FG1A 3WA2X 1IQ8A 3EQQB 1DMMA 2P09A 2CK3H 1KWIA 3G8ZA 3JUMA 4HVNA 1IQXA 1GS3A 1FGQA 4HM1B 2M7OA 1VQM3 1GY7A 1TUHA 2XFTA 3K5TA 4HM4B 4HYZA 3U1WA 2JDIH 3TDGA 2CC3A 4LGQA 2CHCA 5AIIA 1A2VA 3WMDA 2HMOB 3K7CA 4FCZA 1UUWB 3KFQC 4N6UA 3FCSB 4HBRA 2F98A 1MNLA 2RGQA 2R4IA 1TP6A 3STDA 2D1WA 1M9GA 2WOFA 3WODG 2LYXA 3RGAA 3LT8A 4KFFA 4U13A 2CFDA 3WOFB 3NBJA 4N6NB 5BXQA 5EQLA 6STDA 1SIIA 2KCDA 1Q42A 3NM2A 1E3VA 2CIUA 4KZ1A 1QMAA 3DMCA 1N9JA 3BNBA 3CC43 4IIAA 3CXC2 1S723 2OTL3 3NHXA 3FF2A 3X41A 3RGRA 2OTJ3 3OW22 4BTXA 2CH9A 1LOXA 2CFKA 3DY5A 2SBLA 1VQO3 3HIGA 3CCE3 4XM4A 3DGNA 1ASKA 2OQEC 1OHPA 3K9MC 4FR9A 4KFDA 2CFWA 4R9KA 5CF2A 1JKGA 4KVHA 5AYRB 1KC84 2Y74A 5JBSA 3M8CA 4HM0B 2QA43 2FGTA 3JVCA 2ML6A 4HJLB 3SEDA 2QEX3 1FGTA 3E99A 4N6MA 4L8PA 1W4NA 1NU3A 3V99A 3VF1A 1FGOA 3LOYA 3H51A 3LXUX 5EEOA 4H3UA 1U8CB 4NREA 1N5PA 3J7Yd 3CME3 3CCU3 2XEPA 2YFLB 1YJW3 3MWZA 4AEQA 1AR0A 2BMOB 3FGYA 3IPTA 4CCVA 1QVF2 3B8LA 5AIHA 2O3OA 2OOVA 1VQ53 1JNQA 1U5OA 3DM8A 4HM3B 4XBYA 4JRFA 2HMMB 3LH4A 2LQVA 1GY5A 3NQZA 3NXJA 4HM6B 4HM8B 4RZMA 2OOVC 1QVG2 2CG1A 3OWYA 3LTAA 3S5CA 3WA3A 3HX8A 1M1K4 1TU5A 3PXMA 5EVHA 1AVLA 3EBYA 2GEXA 4XB5A 3KSED 5STDA 4GB5A 5D83A 1IT7A 3UJMA 1VQ73 3T8NA 3V92A 3BNCA 3LZAA 4ORLA 5TGNA 1WQLB 3EN8A 3N54B 3RDEA 1W00A 3NX0A 2W9PA 1LVNA 4MEIA 1E3RA 1PFPA 3S67A 3Q1CA 3CU3A 4WFOA 1BUQA 2CG0A 2GU3A 1W6GA 2I9WA 5AI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTB A;  2P05 A;  3DGM A;  3LT9 A;  1UW1 A;  3DGL A;  3LTA A;  2P09 A;  3DGO A;  3DGN A;  3LT8 A;  3LTC A;  2P0X A;  3LTD A; 
#chains in the Genus database with same CATH topology
 1W6C A;  4WYK B;  3NUV A;  1R4C A;  1BIR A;  1O7G B;  2K3D A;  5G2G A;  3G71 3;  3EBT A;  4GHO A;  2YFJ B;  3FG3 A;  2Z6B A;  1RCK A;  2W0Q A;  3GAX A;  1N9E A;  4HM7 B;  1ULI B;  5AYS C;  1RJO A;  1BRJ A;  3F7X A;  5IG0 A;  3PGB A;  1WMN A;  4EV5 A;  4GSP A;  1ROA A;  3LTC A;  4EYC A;  3B7C A;  3X3X A;  2BT3 A;  5DRV A;  2WO0 A;  1Z1S A;  2F86 B;  1B2Z A;  5AEU B;  4OVM A;  1STF I;  1RGG A;  3UB1 A;  3A76 A;  1SAR A;  2K54 A;  3IJE B;  1AY7 A;  3MKI A;  1EQK A;  2XF3 A;  2CWT A;  2P38 A;  3KN4 A;  4K61 A;  4LZI A;  1EEJ A;  1YI2 3;  5BVB A;  1QAK A;  1BNF A;  2RSX A;  4CJN A;  3DGM A;  3N8B A;  3S27 A;  3T0U A;  4LEH A;  4WWU C;  1B2X A;  2FXT A;  3S28 A;  3ZFZ A;  3L0R A;  3CCM 3;  2Y73 A;  2RFR A;  3U97 A;  4N6V 0;  1VQQ A;  1R4Y A;  3UNL A;  2RCD A;  3F14 A;  3D5G A;  1NWW A;  1O7M B;  2AAD A;  3PZW A;  3F8X A;  4FMB A;  1OH0 A;  2OWP A;  3T8U A;  3GSP A;  3I55 3;  1DYU A;  3CPW 2;  3PCR A;  3WOE B;  3HI7 A;  3H3H A;  2YFI B;  2XH9 A;  1VQK 3;  1A90 A;  1CYV A;  5IEP A;  1FA3 A;  4O3V A;  1LQM B;  1Q86 4;  4FMC A;  5DRE A;  8CHO A;  5HOH A;  3LT9 A;  2W03 A;  3FG4 A;  3DGL A;  1NO3 A;  3OWS A;  2BO9 B;  1YJ9 3;  1K73 4;  1ZGX A;  4IPB A;  1IK3 A;  2IUK A;  1B2M A;  2MC8 A;  1GOY A;  1JB2 A;  1F8N A;  5FGO A;  1VQ9 3;  3NM7 A;  1Y4K A;  1G96 A;  1OPY A;  4AKY A;  4MJD A;  1UI8 A;  3MG1 A;  4QWT A;  1N8R 4;  2CFG A;  1K9M 4;  2W04 A;  3X40 A;  1RHL A;  1RMS A;  2GBW B;  3PS8 A;  1BNS A;  4BIR A;  2E2V A;  1JV2 B;  2KXG A;  3ALA A;  4STD A;  2W56 A;  1X1U A;  1BNI A;  3DUK A;  3NV0 A;  4R80 A;  4FMD A;  3QRD A;  5AIF A;  3GZX B;  1N8Q A;  2W9Q A;  5M18 A;  2P0X A;  3LTD A;  2ZA4 A;  3GWR A;  1IYY A;  3DGY A;  3BND A;  4Q53 A;  2HMK B;  3FSD A;  1RGL A;  3JUQ A;  5GSP A;  3VGN A;  2OQE A;  2MF7 A;  5FW5 A;  3CPO A;  1O7N B;  5LC6 A;  1RRL A;  2XRX B;  1BGS A;  1X1X A;  2XSH B;  2F5W A;  5LC7 A;  2IUJ A;  1I0X A;  1W2Z A;  1QAF A;  3DGO A;  4BU4 A;  1BUJ A;  1W7C A;  1I8V A;  1BRH A;  1T2I A;  2WGQ A;  3OXA A;  2Q07 A;  3HOH A;  1ISK A;  3JUO A;  1D6U A;  3OWU A;  4EBG A;  1BNJ A;  2GEY A;  3CCQ 3;  3CCV 3;  4ZM8 A;  3X42 A;  4EW5 A;  1EKM A;  1OGX A;  2INX A;  1UW1 A;  2HML B;  2B1X B;  5G1L A;  1CEW I;  1K8A 4;  1T3B A;  2XR8 B;  4LYL B;  2XSO B;  4DKI A;  1ZO2 A;  3EF8 A;  4HZB B;  3MHE A;  3WR2 A;  1FGM A;  2JQ5 A;  4R1K A;  1BSD A;  2E2T A;  2STD A;  3UL5 A;  1OCV A;  1IQY A;  1Q81 4;  1IV9 A;  5IEO A;  3K0Z A;  1JRQ A;  1VQ6 3;  1WMO A;  2UX0 A;  1NJI 4;  3SOY A;  2F99 A;  3HK4 A;  3CCS 3;  1OF5 A;  5KP3 A;  1JN5 B;  3K63 A;  1UUV B;  1LOW A;  1RGA A;  4HKV B;  2PNC A;  1RGK A;  3KII A;  3MG2 A;  5HGR A;  3BB9 A;  1LRA A;  3CC2 3;  5A0O B;  2IY2 A;  3N9H A;  1SPU A;  3F7S A;  1FGR A;  1YVB I;  2GU1 A;  1VZZ A;  3O8Y A;  3HII A;  4G1M B;  1YIT 3;  4RNY A;  5ELU A;  2BNG A;  1I2G A;  3D3L A;  1YJN 3;  4RBN A;  3D4A A;  4IT7 A;  1WMP A;  4FMA A;  4WHA A;  5I97 A;  3G6E 3;  1OAC A;  2BMQ B;  2KF5 A;  4MMZ B;  1DMQ A;  2QGU A;  1VQ4 3;  1K41 A;  1E97 A;  1UCL A;  1UI7 A;  3VSY A;  3A5E A;  3CMA 3;  3DXO A;  1W2B 2;  4N6T A;  4OK0 A;  1UDI I;  3KKG A;  3MG3 A;  2J8X B;  1G02 A;  2UGI A;  3EB8 A;  4J9A A;  3SX1 A;  5IW9 A;  3DZL A;  1JBS A;  3GZB A;  5IER A;  3EN1 B;  4J5K A;  1W6Y A;  2CX0 A;  2OCT A;  2XFS A;  1V74 A;  4R9L A;  4AKZ A;  3BLZ A;  1O7H B;  4GL6 A;  2BMR B;  5IG5 A;  1JKG B;  1DMN A;  1IVU A;  3QK9 A;  4PEJ A;  3SXX A;  2FNQ A;  1ULJ B;  1CH0 A;  1UUG B;  1US1 A;  1YGE A;  4MMY B;  2CW9 A;  1N5H A;  1I2F A;  4XDV A;  1VQL 3;  1BRI A;  3LML A;  2Z76 A;  5JPP A;  2W56 B;  3PCS A;  3KCH A;  4O8S A;  5CLK A;  1LXE A;  5D81 A;  4MMX B;  1Q7H A;  4XBT A;  2Z7A A;  3V98 A;  1VQP 3;  4FCM A;  1D6Y A;  1JZO A;  3OV4 A;  1HU9 A;  2HMJ B;  2L1S A;  5M1A A;  5JPU A;  2V1L A;  3EE1 A;  1Q9E A;  3CC7 3;  3KSP A;  1MWR A;  4XBX A;  1JJ2 2;  1M1X B;  4K90 B;  5G1K A;  4EC6 A;  1IVW A;  4EV2 A;  1LNH A;  2F5M A;  1OHS A;  1QJG A;  3G16 A;  4N6L A;  1HZ1 A;  3NBR A;  1J2B A;  4KT3 B;  1SQW A;  1B2S A;  1IVX A;  2KF6 A;  2KAA A;  1I3F A;  1Q40 B;  2O9U X;  3CCR 3;  1OF5 B;  1YHQ 3;  3Q2P A;  1B21 A;  2CWV A;  1AV4 A;  2IMJ A;  4HAA A;  2WGO A;  5CF1 A;  1Q82 4;  1WTH A;  1B20 A;  2BU4 A;  1NNV A;  4WYK A;  1UCK A;  1YIJ 3;  4HM5 B;  1C54 A;  4L8O A;  4R4K A;  1BRK A;  2L4V A;  1YNV X;  1X1Y A;  5KP4 A;  4K1U A;  5IF6 A;  1IU7 A;  5IG3 A;  3EC9 A;  2XGN A;  2C10 A;  1CYU A;  1PU4 A;  3FKA A;  1MGW A;  1NB3 I;  1W02 A;  1TRP A;  2A15 A;  3BU4 A;  1IV7 A;  4RNZ A;  8RNT A;  1ZS7 A;  1C7H A;  2K0M A;  3AHS A;  2P0M A;  1SJW A;  3F9S A;  1HYF A;  1CQS A;  5KP1 A;  1MGR A;  3AHW A;  1RNB A;  2WOH A;  5D82 A;  3ER7 A;  5CK6 A;  4N6O B;  7STD A;  3F40 A;  1ROV A;  3EHC A;  2D42 A;  1LOY A;  3SOA A;  2ML5 A;  1M90 4;  4KFE A;  1TFO A;  4JF8 A;  2B24 B;  2XGL A;  1GSP A;  3GZY B;  3URP A;  3CCL 3;  1VQ8 3;  4BL2 A;  1FW7 A;  2YX9 A;  3EX9 A;  1AVK A;  1O7P B;  2ZHX B;  1GY6 A;  3ECF A;  5AEW B;  1IT8 A;  5RNT A;  3ROB A;  2IA7 A;  2W6J H;  1RTU A;  3LTB A;  3LYG A;  1JB5 A;  3JUP A;  4LMI A;  3PYJ A;  3I0Y A;  3UL6 A;  4X2H A;  2PZV A;  1BSE A;  3SLU A;  3SVA A;  5M19 A;  1IDP A;  2HMN B;  3WHO A;  2P05 A;  3D9R A;  1RN1 A;  1RRH A;  1STD A;  2GSP A;  3MYT A;  3F8H A;  1V58 A;  1WNH A;  4O02 B;  1UGH I;  5ELJ A;  3NV0 B;  1DVC A;  4I4K A;  1L5G B;  3G4S 3;  5CXO A;  3X3Y A;  1LOV A;  4O2H A;  4HZ9 B;  1RKY A;  1OUN A;  3BIR A;  1RGC A;  3B4P A;  2ZL8 A;  1GYB A;  1W01 A;  3OX9 A;  4BTY A;  1BSA A;  1KQS 2;  1FUW A;  2QIY A;  1YVS A;  3AMO A;  1QAL A;  4ILF A;  3AMO B;  1Q40 A;  4TX4 A;  3X3Z A;  1SIH A;  1LNI A;  1TFK A;  2CFL A;  4HM2 B;  3GRD A;  1BVI A;  5AIG A;  3CD6 3;  3CNM A;  2BHM A;  2IYJ A;  4NPB A;  1KSI A;  4WP5 A;  3ZG0 A;  5IEN A;  3FZW A;  3AGN A;  1I2E A;  1JN5 A;  4HOH A;  3SYU A;  1T2H A;  1W5Z A;  3GZR A;  1RN7 A;  5IG4 A;  4LSO A;  2ZDJ A;  3B4O A;  3G0K A;  1EA2 A;  2C11 A;  2F56 A;  4L7K A;  4CDL A;  1DVD A;  1RCL A;  2CWU A;  4J8T A;  2GXF A;  1GMR A;  4NHF A;  3MSO A;  3KZT A;  3CCJ 3;  3FLJ A;  3NBB A;  4EXR A;  1K28 A;  1NDO B;  1RGE A;  1MOL A;  3ZG5 A;  3MPH A;  1I70 A;  4N3V A;  1FYS A;  2KRT A;  1NB5 I;  1ZX2 A;  3BNE A;  1V57 A;  4K1V A;  1IVV A;  1OHO A;  3NQY A;  1OGZ A;  2W2C A;  1DE3 A;  1GD3 A;  1O7W B;  2GBX B;  3FF0 A;  3S29 A;  4BTW A;  1YGW A;  1G0T A;  4XDW A;  3D79 A;  2E2U A;  4X2O A;  4H61 A;  1TIJ A;  3I56 3;  1VQN 3;  3WDG B;  1Q7Y 4;  1T5Y A;  2CKF B;  3Q90 A;  1GMP A;  2H0I A;  1JB4 A;  1GD4 A;  1KD1 4;  4FCJ A;  3IMA B;  1BRS A;  1A67 A;  3EJV A;  4J5G A;  3HZP A;  1D6Z A;  3JUN A;  3KE7 A;  1UCJ A;  1EG9 B;  4OUQ A;  1BRG A;  1A2K A;  3CNX A;  1S5A A;  2Z77 A;  3FH1 A;  1HKX A;  3FG1 A;  7RNT A;  3WA2 X;  1IQ8 A;  3EQQ B;  1DMM A;  2RNT A;  1GOV A;  2P09 A;  2CK3 H;  1KWI A;  3G8Z A;  3JUM A;  4HVN A;  1FUS A;  1IQX A;  1GS3 A;  1RDS A;  1FGQ A;  1RN4 A;  4HM1 B;  1BSB A;  2M7O A;  1JBT A;  1VQM 3;  1GY7 A;  1TUH A;  1BRN L;  1PY3 A;  2XFT A;  3K5T A;  1JBR A;  4HM4 B;  4HYZ A;  3U1W A;  2JDI H;  3TDG A;  2CC3 A;  7GSP A;  4LGQ A;  2RBI A;  2CHC A;  5AII A;  1A2V A;  3WMD A;  2HMO B;  3K7C A;  4FCZ A;  1UUW B;  3KFQ C;  4N6U A;  3FCS B;  4HBR A;  1B3S A;  2F98 A;  1MNL A;  2RGQ A;  2R4I A;  1TP6 A;  9RNT A;  3STD A;  1PYL A;  1M9G A;  2D1W A;  2WOF A;  3WOD G;  2LYX A;  2KF4 A;  3RGA A;  3LT8 A;  4KFF A;  2H0G A;  4U13 A;  2CFD A;  3WOF B;  3NBJ A;  1GOU A;  4N6N B;  5BXQ A;  5EQL A;  6STD A;  1SII A;  2KCD A;  1Q42 A;  1BAO A;  3NM2 A;  1E3V A;  1FZU A;  1X1W A;  2CIU A;  4KZ1 A;  4BL3 A;  1QMA A;  3DMC A;  1N9J A;  3BNB A;  2C4B A;  3AGO A;  3CC4 3;  4CPK A;  4IIA A;  3CXC 2;  3DH2 A;  1S72 3;  2OTL 3;  5BU4 A;  3NHX A;  3FF2 A;  1GMQ A;  3X41 A;  3RGR A;  2OTJ 3;  1I3I A;  1MWT A;  3OW2 2;  4BTX A;  2CH9 A;  1LOX A;  2CFK A;  3DY5 A;  2SBL A;  1VQO 3;  1RLS A;  1TRQ A;  3HIG A;  4XM4 A;  3CCE 3;  1FUT A;  3DGN A;  1ASK A;  1I0V A;  2OQE C;  1OHP A;  3K9M C;  3D5I A;  4FR9 A;  3Q3F A;  1RGF A;  3RNT A;  4KFD A;  2CFW A;  4R9K A;  5CF2 A;  1JKG A;  4KVH A;  5AYR B;  2CX1 A;  2Y74 A;  1KC8 4;  5JBS A;  1BAN A;  1TJD A;  3M8C A;  4HM0 B;  2QA4 3;  2FGT A;  1BNR A;  3JVC A;  2ML6 A;  4HJL B;  3SED A;  2QEX 3;  1FGT A;  3E99 A;  4N6M A;  2UUG C;  4L8P A;  1W4N A;  1NU3 A;  1BNE A;  1TTO A;  1UCI A;  3V99 A;  3VF1 A;  1FGO A;  2R41 A;  1MWU A;  1A2P A;  1LQG C;  1RNT A;  2SAR A;  3H51 A;  3LOY A;  3LXU X;  5EEO A;  4H3U A;  1U8C B;  4NRE A;  1N5P A;  4I5Q A;  3J7Y d;  3CME 3;  3CCU 3;  2XEP A;  2YFL B;  1YJW 3;  3MWZ A;  4AEQ A;  1AR0 A;  2BMO B;  3FGY A;  3IPT A;  4CCV A;  1QVF 2;  2HOH A;  1BSC A;  3B8L A;  5AIH A;  2KF3 A;  2O3O A;  2OOV A;  1VQ5 3;  1JNQ A;  1RGH A;  1DET A;  1U5O A;  1AQZ A;  3DM8 A;  4HM3 B;  4XBY A;  2H0H A;  4JRF A;  2HMM B;  3LH4 A;  2LQV A;  1GY5 A;  3NQZ A;  3NXJ A;  4HM6 B;  4HM8 B;  1BNG A;  1BU4 A;  4RZM A;  2OOV C;  1QVG 2;  2CG1 A;  3OWY A;  3LTA A;  3S5C A;  3WA3 A;  3HX8 A;  1M1K 4;  1TU5 A;  4RNT A;  3PXM A;  5EVH A;  1AVL A;  2BIR A;  3EBY A;  2GEX A;  4XB5 A;  2AAE A;  3KSE D;  5STD A;  4GB5 A;  1BOX A;  5D83 A;  1IT7 A;  2F4Y A;  3UJM A;  1MWS A;  3T8N A;  3V92 A;  1VQ7 3;  6GSP A;  3BNC A;  3LZA A;  4ORL A;  5TGN A;  1WQL B;  3EN8 A;  1B2U A;  3N54 B;  1UGI A;  3RDE A;  1W00 A;  3NX0 A;  2W9P A;  1LVN A;  4MEI A;  1E3R A;  1PFP A;  1RSN A;  3S67 A;  3Q1C A;  3CU3 A;  4WFO A;  5BIR A;  6RNT A;  1B27 A;  2CG0 A;  1EUI C;  1BUQ A;  2GU3 A;  1W6G A;  2I9W A;  1JZD A;  5AI1 A; 
#chains in the Genus database with same CATH homology
 1W6C A;  4WYK B;  3NUV A;  1R4C A;  1O7G B;  5G2G A;  3G71 3;  3EBT A;  2YFJ B;  3FG3 A;  2Z6B A;  2W0Q A;  3GAX A;  1N9E A;  4HM7 B;  1ULI B;  5AYS C;  1RJO A;  3F7X A;  5IG0 A;  3PGB A;  1WMN A;  4EV5 A;  1ROA A;  3LTC A;  4EYC A;  3B7C A;  3X3X A;  2BT3 A;  5DRV A;  2WO0 A;  1Z1S A;  2F86 B;  5AEU B;  4OVM A;  1STF I;  3UB1 A;  3A76 A;  2K54 A;  3IJE B;  3MKI A;  1EQK A;  2XF3 A;  2CWT A;  2P38 A;  3KN4 A;  4K61 A;  4LZI A;  1YI2 3;  5BVB A;  1QAK A;  2RSX A;  3DGM A;  3N8B A;  3S27 A;  3T0U A;  4LEH A;  4WWU C;  2FXT A;  3S28 A;  3L0R A;  3CCM 3;  2Y73 A;  2RFR A;  3U97 A;  4N6V 0;  3UNL A;  2RCD A;  3F14 A;  3PZW A;  1NWW A;  1O7M B;  4FMB A;  3F8X A;  1OH0 A;  2OWP A;  3T8U A;  3I55 3;  3CPW 2;  1DYU A;  3PCR A;  3WOE B;  3HI7 A;  3H3H A;  2YFI B;  2XH9 A;  1VQK 3;  1A90 A;  1CYV A;  5IEP A;  1FA3 A;  4O3V A;  1Q86 4;  4FMC A;  5DRE A;  8CHO A;  3LT9 A;  2W03 A;  3FG4 A;  3DGL A;  1NO3 A;  3OWS A;  2BO9 B;  1YJ9 3;  1K73 4;  4IPB A;  1IK3 A;  2IUK A;  2MC8 A;  1JB2 A;  1F8N A;  5FGO A;  1VQ9 3;  3NM7 A;  1Y4K A;  1G96 A;  1OPY A;  4AKY A;  4MJD A;  1UI8 A;  3MG1 A;  4QWT A;  1N8R 4;  2CFG A;  1K9M 4;  2W04 A;  3X40 A;  3PS8 A;  2GBW B;  2E2V A;  3ALA A;  1JV2 B;  2KXG A;  4STD A;  2W56 A;  3DUK A;  3NV0 A;  4R80 A;  4FMD A;  3QRD A;  5AIF A;  3GZX B;  1N8Q A;  2W9Q A;  2P0X A;  3LTD A;  3GWR A;  4Q53 A;  3BND A;  2HMK B;  3FSD A;  3JUQ A;  3VGN A;  2OQE A;  2MF7 A;  5FW5 A;  3CPO A;  1O7N B;  5LC6 A;  1RRL A;  2XRX B;  2XSH B;  5LC7 A;  2IUJ A;  3DGO A;  1QAF A;  1W2Z A;  1W7C A;  2WGQ A;  3OXA A;  2Q07 A;  1ISK A;  3JUO A;  1D6U A;  3OWU A;  4EBG A;  3CCQ 3;  2GEY A;  3CCV 3;  4ZM8 A;  3X42 A;  1EKM A;  1OGX A;  2INX A;  1UW1 A;  2HML B;  2B1X B;  1CEW I;  1K8A 4;  2XR8 B;  2XSO B;  1ZO2 A;  3EF8 A;  4HZB B;  3MHE A;  1FGM A;  2JQ5 A;  4R1K A;  2E2T A;  2STD A;  3UL5 A;  1OCV A;  1IQY A;  1Q81 4;  1IV9 A;  5IEO A;  3K0Z A;  1JRQ A;  1VQ6 3;  1WMO A;  2UX0 A;  1NJI 4;  3SOY A;  2F99 A;  3HK4 A;  3CCS 3;  1OF5 A;  5KP3 A;  1JN5 B;  3K63 A;  1UUV B;  4HKV B;  2PNC A;  5HGR A;  3KII A;  3MG2 A;  3BB9 A;  3CC2 3;  5A0O B;  3N9H A;  1SPU A;  3F7S A;  1FGR A;  1YVB I;  2GU1 A;  1VZZ A;  3O8Y A;  3HII A;  4G1M B;  1YIT 3;  4RNY A;  5ELU A;  2BNG A;  3D3L A;  1YJN 3;  4RBN A;  4IT7 A;  1WMP A;  4FMA A;  4WHA A;  5I97 A;  3G6E 3;  1OAC A;  2BMQ B;  1VQ4 3;  4MMZ B;  1DMQ A;  2QGU A;  1K41 A;  1E97 A;  1UI7 A;  3VSY A;  3CMA 3;  3DXO A;  1W2B 2;  4N6T A;  4OK0 A;  3KKG A;  3MG3 A;  3SX1 A;  3EB8 A;  4J9A A;  5IW9 A;  3DZL A;  3GZB A;  5IER A;  3EN1 B;  1W6Y A;  2XFS A;  2OCT A;  4AKZ A;  1V74 A;  4R9L A;  3BLZ A;  1O7H B;  4GL6 A;  2BMR B;  5IG5 A;  1JKG B;  1DMN A;  1IVU A;  3QK9 A;  4PEJ A;  3SXX A;  2FNQ A;  1ULJ B;  4MMY B;  1US1 A;  1YGE A;  4XDV A;  2CW9 A;  1N5H A;  1VQL 3;  3LML A;  2Z76 A;  5JPP A;  2W56 B;  3PCS A;  4O8S A;  5CLK A;  1LXE A;  5D81 A;  4MMX B;  4XBT A;  3V98 A;  2Z7A A;  1VQP 3;  4FCM A;  1D6Y A;  3OV4 A;  1HU9 A;  2HMJ B;  5JPU A;  2V1L A;  3EE1 A;  3CC7 3;  3KSP A;  4XBX A;  1JJ2 2;  1M1X B;  4K90 B;  4EC6 A;  1IVW A;  4EV2 A;  1LNH A;  1OHS A;  1QJG A;  3G16 A;  4N6L A;  1J2B A;  3NBR A;  1SQW A;  1IVX A;  1Q40 B;  2O9U X;  3CCR 3;  1OF5 B;  1YHQ 3;  3Q2P A;  2CWV A;  1AV4 A;  2IMJ A;  2WGO A;  5CF1 A;  1Q82 4;  1WTH A;  4WYK A;  1YIJ 3;  4HM5 B;  4L8O A;  4R4K A;  2L4V A;  5KP4 A;  4K1U A;  5IF6 A;  1IU7 A;  5IG3 A;  3EC9 A;  2XGN A;  2C10 A;  1CYU A;  1PU4 A;  3FKA A;  1NB3 I;  1W02 A;  2A15 A;  4RNZ A;  1IV7 A;  1C7H A;  2K0M A;  2P0M A;  1SJW A;  3F9S A;  5KP1 A;  1CQS A;  2WOH A;  5D82 A;  3ER7 A;  5CK6 A;  4N6O B;  7STD A;  3F40 A;  1ROV A;  3EHC A;  2D42 A;  3SOA A;  1M90 4;  2ML5 A;  4KFE A;  1TFO A;  4JF8 A;  2B24 B;  2XGL A;  3GZY B;  3CCL 3;  1VQ8 3;  2YX9 A;  3EX9 A;  1AVK A;  1O7P B;  3ECF A;  1GY6 A;  5AEW B;  1IT8 A;  3ROB A;  2IA7 A;  2W6J H;  3LTB A;  3LYG A;  1JB5 A;  3JUP A;  4LMI A;  3PYJ A;  3I0Y A;  3UL6 A;  4X2H A;  2PZV A;  3SVA A;  3SLU A;  1IDP A;  2HMN B;  2P05 A;  3D9R A;  1RRH A;  1STD A;  3MYT A;  3F8H A;  1WNH A;  4O02 B;  5ELJ A;  3NV0 B;  1DVC A;  4I4K A;  1L5G B;  3G4S 3;  5CXO A;  3X3Y A;  1RKY A;  4O2H A;  4HZ9 B;  1OUN A;  3B4P A;  2ZL8 A;  1GYB A;  1W01 A;  3OX9 A;  4BTY A;  1KQS 2;  1FUW A;  2QIY A;  3AMO A;  1QAL A;  3AMO B;  1Q40 A;  4TX4 A;  3X3Z A;  1SIH A;  1TFK A;  2CFL A;  4HM2 B;  3GRD A;  5AIG A;  3CD6 3;  3CNM A;  2BHM A;  5IEN A;  1KSI A;  4WP5 A;  3FZW A;  1JN5 A;  1W5Z A;  3GZR A;  1RN7 A;  5IG4 A;  4LSO A;  2ZDJ A;  3B4O A;  3G0K A;  1EA2 A;  2C11 A;  4L7K A;  1DVD A;  4CDL A;  2CWU A;  4J8T A;  2GXF A;  4NHF A;  3MSO A;  3KZT A;  3CCJ 3;  3FLJ A;  3NBB A;  4EXR A;  1K28 A;  1NDO B;  1MOL A;  3MPH A;  4N3V A;  2KRT A;  1NB5 I;  1ZX2 A;  3BNE A;  4K1V A;  1IVV A;  1OHO A;  3NQY A;  1OGZ A;  2W2C A;  1GD3 A;  1O7W B;  2GBX B;  3FF0 A;  3S29 A;  4BTW A;  4XDW A;  4X2O A;  2E2U A;  4H61 A;  1TIJ A;  3I56 3;  1VQN 3;  3WDG B;  1Q7Y 4;  1T5Y A;  2CKF B;  3Q90 A;  1JB4 A;  1GD4 A;  1KD1 4;  4FCJ A;  3IMA B;  1A67 A;  3EJV A;  3HZP A;  1D6Z A;  3JUN A;  3KE7 A;  1EG9 B;  4OUQ A;  1A2K A;  3CNX A;  1S5A A;  2Z77 A;  3FH1 A;  1HKX A;  3FG1 A;  3WA2 X;  1IQ8 A;  3EQQ B;  1DMM A;  2P09 A;  2CK3 H;  1KWI A;  3G8Z A;  3JUM A;  4HVN A;  1IQX A;  1GS3 A;  1FGQ A;  4HM1 B;  2M7O A;  1VQM 3;  1GY7 A;  1TUH A;  2XFT A;  3K5T A;  4HM4 B;  4HYZ A;  3U1W A;  2JDI H;  3TDG A;  2CC3 A;  4LGQ A;  2CHC A;  5AII A;  1A2V A;  3WMD A;  2HMO B;  3K7C A;  4FCZ A;  1UUW B;  3KFQ C;  4N6U A;  3FCS B;  4HBR A;  2F98 A;  1MNL A;  2RGQ A;  2R4I A;  1TP6 A;  3STD A;  2D1W A;  1M9G A;  2WOF A;  3WOD G;  2LYX A;  3RGA A;  3LT8 A;  4KFF A;  4U13 A;  2CFD A;  3WOF B;  3NBJ A;  4N6N B;  5BXQ A;  5EQL A;  6STD A;  1SII A;  2KCD A;  1Q42 A;  3NM2 A;  1E3V A;  2CIU A;  4KZ1 A;  1QMA A;  3DMC A;  1N9J A;  3BNB A;  3CC4 3;  4IIA A;  3CXC 2;  1S72 3;  2OTL 3;  3NHX A;  3FF2 A;  3X41 A;  3RGR A;  2OTJ 3;  3OW2 2;  4BTX A;  2CH9 A;  1LOX A;  2CFK A;  3DY5 A;  2SBL A;  1VQO 3;  3HIG A;  3CCE 3;  4XM4 A;  3DGN A;  1ASK A;  2OQE C;  1OHP A;  3K9M C;  4FR9 A;  4KFD A;  2CFW A;  4R9K A;  5CF2 A;  1JKG A;  4KVH A;  5AYR B;  1KC8 4;  2Y74 A;  5JBS A;  3M8C A;  4HM0 B;  2QA4 3;  2FGT A;  3JVC A;  2ML6 A;  4HJL B;  3SED A;  2QEX 3;  1FGT A;  3E99 A;  4N6M A;  4L8P A;  1W4N A;  1NU3 A;  3V99 A;  3VF1 A;  1FGO A;  3LOY A;  3H51 A;  3LXU X;  5EEO A;  4H3U A;  1U8C B;  4NRE A;  1N5P A;  3J7Y d;  3CME 3;  3CCU 3;  2XEP A;  2YFL B;  1YJW 3;  3MWZ A;  4AEQ A;  1AR0 A;  2BMO B;  3FGY A;  3IPT A;  4CCV A;  1QVF 2;  3B8L A;  5AIH A;  2O3O A;  2OOV A;  1VQ5 3;  1JNQ A;  1U5O A;  3DM8 A;  4HM3 B;  4XBY A;  4JRF A;  2HMM B;  3LH4 A;  2LQV A;  1GY5 A;  3NQZ A;  3NXJ A;  4HM6 B;  4HM8 B;  4RZM A;  2OOV C;  1QVG 2;  2CG1 A;  3OWY A;  3LTA A;  3S5C A;  3WA3 A;  3HX8 A;  1M1K 4;  1TU5 A;  3PXM A;  5EVH A;  1AVL A;  3EBY A;  2GEX A;  4XB5 A;  3KSE D;  5STD A;  4GB5 A;  5D83 A;  1IT7 A;  3UJM A;  1VQ7 3;  3T8N A;  3V92 A;  3BNC A;  3LZA A;  4ORL A;  5TGN A;  1WQL B;  3EN8 A;  3N54 B;  3RDE A;  1W00 A;  3NX0 A;  2W9P A;  1LVN A;  4MEI A;  1E3R A;  1PFP A;  3S67 A;  3Q1C A;  3CU3 A;  4WFO A;  1BUQ A;  2CG0 A;  2GU3 A;  1W6G A;  2I9W A;  5AI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...