3LTCA

X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.0 a by multi-wavelength anomalous dispersion
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords ATP BINDING PROTEIN-DX
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltcA00
1UW1A 3LTCA 2P09A 3DGNA 3LTBA 3DGMA 3LTDA 3DGLA 3DGOA 3LT9A 3LTAA 2P0XA 3LT8A 2P05A
chains in the Genus database with same CATH superfamily
3VF1A 1BSCA 2IMJA 1VQP3 2Z7AA 5EEOA 1Q814 1M904 2SBLA 3CC43 3SX1A 1MWUA 3CU3A 5AIGA 3PCSA 3I553 1W02A 4HZBB 5KP3A 1I3FA 1DVDA 1G96A 2A15A 1RGLA 3ZFZA 3GSPA 5ELUA 5IENA 4AEQA 4RNYA 3EF8A 5EVHA 8RNTA 1I0XA 4K90B 1WNHA 1A2KA 1QMAA 3FKAA 1T5YA 1DVCA 2RFRA 3DGYA 3DM8A 2XF3A 1WTHA 1A67A 4HBRA 5BU4A 1X1YA 3PS8A 4H3UA 4J5KA 1B2XA 3CC73 4L8OA 3NV0B 2YFJB 3NM2A 4WYKB 4XBXA 3EJVA 1EUIC 3RGRA 1DMQA 3FG3A 4O3VA 2B24B 4N6MA 2ML5A 1UCIA 3EB8A 1SIHA 1GS3A 2KAAA 3T8UA 4BTXA 1IQ8A 3M8CA 3CCM3 3MKIA 2XRXB 3F7SA 4R80A 1QALA 4HM7B 3X3YA 1BUJA 2CK3H 1W7CA 3MSOA 7RNTA 1BNIA 3LYGA 5FGOA 4J5GA 1JB4A 2GEXA 3B4PA 1IVVA 2CFLA 4BIRA 1QJGA 2IA7A 5D83A 1S5AA 1JKGA 4N6OB 4O8SA 1LQMB 1N5PA 2R41A 1SARA 4FCZA 3CC23 1VQ93 1TRPA 1JBRA 1T3BA 4HAAA 4FCMA 1UGIA 2BHMA 3D4AA 3FF0A 1KC84 9RNTA 4R9LA 1UCLA 3U97A 2Y73A 2CFDA 2ZHXB 2PNCA 4N6UA 1RCKA 5HGRA 1O7PB 3F7XA 2OTL3 3H3HA 1YJ93 3EQQB 3F9SA 1BU4A 3KCHA 2W9PA 2K3DA 4KFEA 1BRHA 4N6TA 5DRVA 1W2B2 3VSYA 3K5TA 4EV2A 1B21A 3EX9A 1MGWA 4GHOA 2PZVA 3BNDA 1BNFA 2I9WA 2GU1A 1LOWA 3AMOA 3URPA 2JQ5A 4FCJA 3NHXA 4XB5A 3KZTA 1ULIB 2CFWA 1BVIA 2FNQA 1JB2A 3WODG 3CCU3 3X3XA 4FMDA 1TTOA 2E2UA 2CFKA 4CDLA 2HMMB 3DGNA 1AR0A 4FMBA 1Q864 3S67A 3GWRA 1O7WB 1I2GA 1AVKA 5LC6A 1HKXA 1YIT3 3F40A 1U8CB 1YNVX 3NBBA 3N8BA 1DYUA 1CH0A 4G1MB 1JJ22 1VQ43 1OUNA 3HIIA 5G2GA 4XDWA 2J8XB 1TFOA 3UL6A 1MNLA 1N8R4 2M7OA 2FGTA 3OX9A 3KN4A 4KVHA 4HM4B 1I2FA 3K7CA 4I5QA 3X3ZA 2HMNB 4GL6A 1ROAA 4HKVB 3OW22 3HX8A 5IG4A 3MYTA 1Q40B 2P0XA 2H0HA 1JZOA 1E3VA 3JUMA 1SIIA 1YHQ3 1FGOA 1JBSA 3CMA3 1LRAA 1RDSA 3EBYA 5D81A 3BLZA 3ROBA 1NB3I 2FXTA 2RBIA 1CEWI 1TP6A 4GSPA 1KSIA 1OCVA 2LYXA 1UI8A 5EQLA 3LMLA 2CHCA 4HM6B 3LT9A 1RMSA 3DXOA 2OQEA 1OF5B 3MWZA 3LTAA 3MG1A 3F14A 1UW1A 4OVMA 2RSXA 2ZA4A 1D6UA 2WO0A 2XFTA 1FGMA 1RRLA 2KF4A 3Q2PA 4J8TA 3CCL3 2CWVA 4AKZA 3D5IA 5KP4A 1FGRA 1FUTA 5GSPA 5G1LA 5AYSC 5M19A 2GBWB 1B2ZA 4NPBA 6STDA 1A2PA 1JB5A 2SARA 4MMXB 1E3RA 2E2VA 3CCV3 2WGQA 1T2HA 5I97A 3E99A 1Y4KA 4OK0A 1EA2A 5BIRA 4FMAA 1I8VA 3V99A 1L5GB 2MC8A 1YIJ3 3BNBA 1VQN3 3D79A 1EKMA 2CG0A 1LNHA 1TJDA 3B7CA 2STDA 2F56A 3JUNA 4MMYB 2Z77A 3NBJA 2KCDA 1Q7HA 2WGOA 3H51A 3GRDA 5D82A 1KQS2 1F8NA 1QAFA 2XSOB 1IU7A 1BRSA 1Z1SA 3CNMA 1IQXA 4NHFA 4NREA 5G1KA 2HMKB 4X2HA 5IERA 2CC3A 4HM5B 3CCJ3 4JF8A 2R4IA 1M9GA 4XBYA 4R4KA 1TRQA 1NJI4 2P05A 5AIIA 1B20A 1IDPA 3S5CA 1AVLA 5AIFA 3WMDA 4CJNA 1FGTA 5KP1A 4GB5A 4KFFA 4Q53A 1AY7A 3FG4A 4EC6A 3IPTA 5BXQA 1N8QA 2OOVC 3HK4A 1X1WA 1VQ73 4N6V0 1TFKA 1UUVB 4HVNA 3NBRA 4EXRA 4O02B 3CPW2 3KSPA 1N5HA 3PYJA 1O7NB 3KSED 2IUJA 2OWPA 3MPHA 2CW9A 1UI7A 1LOVA 2BMOB 2IY2A 2W2CA 3ZG5A 1K9M4 2W0QA 3HIGA 4LMIA 3EHCA 3GZRA 1VQK3 4N6NB 1ROVA 2GXFA 5TGNA 1OHPA 1TIJA 2BT3A 1V58A 2O9UX 3D3LA 5IG5A 2UGIA 3NQYA 3SLUA 4BU4A 1BIRA 3OWUA 2YX9A 1HZ1A 2CX0A 1NO3A 4HM2B 1JNQA 3F8XA 3SOAA 1BGSA 3D5GA 4L7KA 4EW5A 4EV5A 1BANA 1IT8A 4MMZB 3CXC2 5HOHA 4K61A 1GMQA 1RGAA 1GMPA 2F99A 3Q3FA 3G6E3 3EC9A 4BTYA 1VQO3 4HM3B 3MHEA 1RCLA 2W04A 2YFLB 1JZDA 1JN5A 1AV4A 1I0VA 2F86B 1DETA 1ZO2A 4QWTA 4XDVA 2CKFB 3UNLA 3I563 1ULJB 1GMRA 1RRHA 4BL3A 4EYCA 1FA3A 5IW9A 5STDA 1EQKA 1QVF2 3GZBA 1KD14 2OTJ3 4RNTA 3DUKA 1R4CA 4KZ1A 5AEWB 5IG3A 1BNJA 1RGFA 3DH2A 3O8YA 1ZX2A 3EN1B 3BB9A 1ZS7A 3OV4A 5JBSA 3BU4A 3PGBA 5BVBA 1YVSA 2Z76A 3JUPA 2P09A 4EBGA 2XGNA 1CYVA 3CNXA 4STDA 3FG1A 3MG3A 4LGQA 2Q07A 3LT8A 4IIAA 1GOUA 1E97A 2OCTA 3S29A 1U5OA 3WOFB 1WQLB 3KKGA 3RNTA 3CCQ3 1I70A 7STDA 1VQL3 4RZMA 3AHSA 1PY3A 1BSBA 3LOYA 2K54A 3JUOA 1GD3A 1WMOA 3FCSB 1IVXA 4LEHA 1MGRA 1FYSA 2F4YA 4BL2A 1Q824 4J9AA 4MEIA 2CIUA 2GEYA 2C10A 3NM7A 1LQGC 3FH1A 5CF2A 1VQ83 1DMNA 1W2ZA 5CLKA 3BNEA 2CFGA 2BMRB 2W56B 3I0YA 4IPBA 2QGUA 1W6YA 1A90A 2BU4A 2F5WA 4XBTA 1JRQA 3JVCA 1OHSA 2BO9B 3LH4A 1IT7A 1W6GA 3K9MC 1BAOA 5IG0A 3UB1A 1O7HB 1YJN3 2D42A 4JRFA 3NQZA 6GSPA 1IYYA 3SVAA 2UUGC 2XH9A 2W03A 3A5EA 1KWIA 2WOHA 3T0UA 1C54A 3GAXA 1UUGB 3Q1CA 1VQ53 1RGKA 3FGYA 2KRTA 1NU3A 3N54B 1V57A 3WA2X 3LZAA 3X41A 1GD4A 2C11A 1RGCA 1G0TA 2LQVA 1HYFA 1RN1A 1M1K4 3DGLA 3X40A 1NDOB 1MOLA 3EN8A 3UL5A 2XR8B 2W6JH 3CPOA 4H61A 3D9RA 4XM4A 1RKYA 1OGZA 4AKYA 3LTDA 1GOVA 4HZ9B 2RCDA 1A2VA 4IT7A 4ILFA 5IEOA 1IK3A 1GY6A 1IVUA 3B8LA 1BSEA 2W56A 4HM8B 3J7Yd 1VQM3 1BRNL 1B2UA 1RJOA 1X1UA 2HMOB 4K1VA 5AEUB 4LYLB 1ISKA 4PEJA 3AGNA 2H0GA 1MWSA 3LTCA 1B27A 4WFOA 3TDGA 3X42A 1GY7A 1UGHI 2YFIB 1ZGXA 2KF3A 5A0OB 1BRJA 3RGAA 1BOXA 1OGXA 1R4YA 2B1XB 2XGLA 2F98A 2HMLB 4HM0B 4N6LA 1PU4A 1X1XA 3SEDA 3G4S3 3AGOA 3SYUA 2XSHB 3G8ZA 2HMJB 3U1WA 1LXEA 3EE1A 5DREA 2O3OA 1TU5A 4N3VA 1W4NA 1RGEA 2JDIH 3HZPA 3LXUX 4LZIA 1W00A 2INXA 2ML6A 1JBTA 4OUQA 1IVWA 4TX4A 3ALAA 1N9EA 2V1LA 1NB5I 1CYUA 2K0MA 1WMNA 2CH9A 4X2OA 4ZM8A 3FZWA 1TUHA 1V74A 2L4VA 1WMPA 1I3IA 1FGQA 1JKGB 2F5MA 2QIYA 3AHWA 3IMAB 1PYLA 3N9HA 1MWRA 3V98A 5CXOA 1SJWA 1Q9EA 3G16A 3FF2A 1BNGA 3AMOB 4BTWA 2BIRA 1M1XB 4I4KA 1Q42A 3CD63 1GSPA 1MWTA 3GZYB 3FSDA 2W9QA 3QRDA 4L8PA 1BRKA 1J2BA 1IV7A 1YI23 2BNGA 5IEPA 1D6ZA 1US1A 4HOHA 3HOHA 3ER7A 3NUVA 3WDGB 2Y74A 4HYZA 4WHAA 1YVBI 3CCS3 1OF5A 1PFPA 3S27A 3NXJA 1S723 1Q7Y4 1K41A 5IF6A 2BMQB 3FLJA 3UJMA 1LNIA 3ZG0A 1FUWA 3KFQC 7GSPA 1VQ63 1AQZA 2AAEA 3B4OA 3JUQA 1RGHA 4KFDA 1EG9B 4MJDA 1NNVA 2D1WA 6RNTA 5AI1A 1UDII 1YGEA 4WYKA 3IJEB 2E2TA 1DMMA 3K0ZA 4U13A 5CK6A 2OOVA 1JN5B 4FMCA 1VZZA 2MF7A 3BIRA 1YJW3 2HOHA 1LOYA 2P38A 5JPPA 3F8HA 1BNRA 2OQEC 3RDEA 4CPKA 3DZLA 3WA3A 1STFI 3K63A 2RNTA 1RN7A 1K28A 1K734 2Z6BA 1OHOA 3NX0A 3MG2A 1BRGA 3DMCA 1RNTA 3STDA 3A76A 4HM1B 4RBNA 1LVNA 1Q40A 5CF1A 3QK9A 2QEX3 3SXXA 1IQYA 4CCVA 1IV9A 1GOYA 1JV2B 2UX0A 1RTUA 1STDA 3WHOA 5M18A 1FW7A 1OACA 1NWWA 3OWYA 3DY5A 4O2HA 3BNCA 3V92A 3G0KA 2KF5A 1RGGA 3CCE3 3DGOA 1SQWA 2XFSA 3T8NA 3PZWA 2GU3A 5M1AA 2CWUA 2IUKA 5ELJA 2QA43 3HI7A 4R1KA 3LTBA 1G02A 1I2EA 2C4BA 3WOEB 1B2SA 2AADA 2ZDJA 1W5ZA 4R9KA 3L0RA 1DE3A 1W6CA 4KT3B 4WP5A 3SOYA 1OPYA 1VQQA 2L1SA 4RNZA 2IYJA 3GZXB 1QAKA 2CG1A 2CX1A 1BNEA 3WR2A 3ECFA 1BNSA 2P0MA 1UCJA 4FR9A 3KIIA 1D6YA 3EBTA 3PXMA 3OWSA 4HJLB 3DGMA 3VGNA 1C7HA 3KE7A 1O7GB 1BRIA 2XEPA 5LC7A 4K1UA 1YGWA 5RNTA 4WWUC 5AIHA 5JPUA 1BSDA 1UCKA 1QVG2 1K8A4 1RLSA 1LOXA 5FW5A 2H0IA 1RNBA 1UUWB 4ORLA 1BSAA 1RHLA 2WOFA 1T2IA 1N9JA 1GYBA 3OXAA 3S28A 1ASKA 1FZUA 2GSPA 1W01A 1HU9A 4LSOA 1RN4A 1FUSA 1O7MB 4DKIA 2RGQA 1CQSA 1GY5A 3G713 1B3SA 3CCR3 2CWTA 1OH0A 2GBXB 1EEJA 3NV0A 8CHOA 1RSNA 3CME3 1SPUA 2ZL8A 1BUQA 3PCRA 2KF6A 3Q90A 5AYRB 2KXGA 1B2MA
chains in the Genus database with same CATH topology
3VF1A 1VQP3 2IMJA 2Z7AA 5EEOA 1Q814 1M904 2SBLA 3CC43 3SX1A 5AIGA 3CU3A 3PCSA 3I553 1W02A 4HZBB 5KP3A 1DVDA 1G96A 2A15A 5ELUA 5IENA 4AEQA 4RNYA 3EF8A 5EVHA 4K90B 1WNHA 1A2KA 1QMAA 3FKAA 1T5YA 1DVCA 2RFRA 3DM8A 2XF3A 1WTHA 1A67A 4HBRA 3PS8A 4H3UA 3CC73 4L8OA 3NV0B 2YFJB 3NM2A 4WYKB 4XBXA 3RGRA 1DMQA 3FG3A 4O3VA 2B24B 4N6MA 2ML5A 3EB8A 1SIHA 1GS3A 3T8UA 4BTXA 1IQ8A 3M8CA 3CCM3 3MKIA 2XRXB 3F7SA 4R80A 1QALA 4HM7B 3X3YA 2CK3H 1W7CA 3MSOA 3LYGA 5FGOA 1JB4A 2GEXA 3B4PA 1IVVA 2CFLA 1QJGA 2IA7A 5D83A 1S5AA 1JKGA 4N6OB 4O8SA 1N5PA 4FCZA 3CC23 1VQ93 4FCMA 2BHMA 3FF0A 1KC84 4R9LA 3U97A 2Y73A 2CFDA 2PNCA 4N6UA 5HGRA 1O7PB 3F7XA 2OTL3 3H3HA 1YJ93 3EQQB 3F9SA 4KFEA 2W9PA 1W2B2 4N6TA 5DRVA 3VSYA 3K5TA 4EV2A 3EX9A 2PZVA 3BNDA 2I9WA 2GU1A 3AMOA 2JQ5A 4FCJA 3NHXA 4XB5A 3KZTA 1ULIB 2CFWA 2FNQA 3CCU3 1JB2A 3WODG 3X3XA 4FMDA 2CFKA 2E2UA 4CDLA 2HMMB 3DGNA 1AR0A 4FMBA 1Q864 3S67A 3GWRA 1O7WB 1AVKA 5LC6A 1HKXA 1YIT3 3F40A 1U8CB 3NBBA 3N8BA 1DYUA 4G1MB 1JJ22 1VQ43 1OUNA 3HIIA 5G2GA 4XDWA 1TFOA 3UL6A 1MNLA 1N8R4 2M7OA 2FGTA 3OX9A 3KN4A 4KVHA 4HM4B 3X3ZA 3K7CA 2HMNB 4GL6A 1ROAA 4HKVB 3OW22 3HX8A 5IG4A 3MYTA 1Q40B 2P0XA 1E3VA 3JUMA 1SIIA 1YHQ3 1FGOA 3CMA3 3EBYA 5D81A 3BLZA 3ROBA 1NB3I 2FXTA 1CEWI 1TP6A 1KSIA 1OCVA 2LYXA 1UI8A 5EQLA 3LMLA 2CHCA 4HM6B 3LT9A 3DXOA 2OQEA 1OF5B 3MWZA 3LTAA 3MG1A 3F14A 1UW1A 4OVMA 2RSXA 1D6UA 2WO0A 2XFTA 1FGMA 1RRLA 3Q2PA 4J8TA 3CCL3 2CWVA 4AKZA 5KP4A 1FGRA 5AYSC 2GBWB 6STDA 1JB5A 4MMXB 1E3RA 2E2VA 3CCV3 2WGQA 5I97A 3E99A 1Y4KA 4OK0A 1EA2A 4FMAA 3V99A 1L5GB 2MC8A 1YIJ3 3BNBA 1VQN3 1EKMA 2CG0A 1LNHA 3B7CA 2STDA 3JUNA 4MMYB 2Z77A 3NBJA 2KCDA 2WGOA 3H51A 3GRDA 5D82A 1KQS2 1F8NA 1QAFA 2XSOB 1IU7A 1Z1SA 3CNMA 4NHFA 1IQXA 4NREA 2HMKB 4X2HA 5IERA 2CC3A 4HM5B 3CCJ3 4JF8A 2R4IA 1M9GA 4XBYA 4R4KA 1NJI4 2P05A 5AIIA 1IDPA 3S5CA 1AVLA 5AIFA 3WMDA 1FGTA 5KP1A 4GB5A 4KFFA 4Q53A 3FG4A 4EC6A 3IPTA 5BXQA 1N8QA 2OOVC 3HK4A 1VQ73 4N6V0 1TFKA 1UUVB 4HVNA 3NBRA 4EXRA 4O02B 3CPW2 3KSPA 1N5HA 3PYJA 1O7NB 3KSED 2IUJA 2OWPA 3MPHA 2CW9A 1UI7A 2BMOB 2W2CA 1K9M4 2W0QA 3HIGA 4LMIA 3EHCA 3GZRA 1VQK3 4N6NB 1ROVA 2GXFA 5TGNA 1OHPA 1TIJA 2BT3A 2O9UX 3D3LA 5IG5A 3NQYA 3SLUA 3OWUA 2YX9A 1NO3A 4HM2B 1JNQA 3F8XA 3SOAA 4L7KA 4EV5A 1IT8A 4MMZB 3CXC2 4K61A 2F99A 3G6E3 3EC9A 4BTYA 1VQO3 4HM3B 3MHEA 2W04A 2YFLB 1JN5A 1AV4A 2F86B 4XDVA 3UNLA 1ZO2A 4QWTA 3I563 2CKFB 1ULJB 1RRHA 4EYCA 1FA3A 5IW9A 5STDA 1EQKA 1QVF2 3GZBA 1KD14 2OTJ3 3DUKA 1R4CA 4KZ1A 5AEWB 5IG3A 3O8YA 1ZX2A 3EN1B 3BB9A 3OV4A 5JBSA 3PGBA 5BVBA 2Z76A 3JUPA 2P09A 4EBGA 2XGNA 1CYVA 3CNXA 4STDA 3FG1A 3MG3A 4LGQA 2Q07A 3LT8A 4IIAA 1E97A 2OCTA 3S29A 1U5OA 3WOFB 1WQLB 3KKGA 3CCQ3 7STDA 1VQL3 4RZMA 3LOYA 2K54A 3JUOA 1GD3A 1WMOA 3FCSB 1IVXA 4LEHA 1Q824 4J9AA 4MEIA 2CIUA 2GEYA 2C10A 3NM7A 3FH1A 5CF2A 1VQ83 1DMNA 1W2ZA 5CLKA 3BNEA 2CFGA 2BMRB 2W56B 3I0YA 4IPBA 2QGUA 1W6YA 1A90A 4XBTA 1JRQA 3JVCA 1OHSA 2BO9B 3LH4A 1IT7A 1W6GA 2KXGA 3K9MC 5IG0A 3UB1A 1O7HB 1YJN3 2D42A 4JRFA 3NQZA 3SVAA 2XH9A 2W03A 1KWIA 2WOHA 3T0UA 3GAXA 3Q1CA 1VQ53 3FGYA 2KRTA 1NU3A 3N54B 3WA2X 3LZAA 3X41A 1GD4A 2C11A 2LQVA 1M1K4 3DGLA 3X40A 1NDOB 1MOLA 3EN8A 3UL5A 2XR8B 2W6JH 3CPOA 4H61A 3D9RA 4XM4A 1RKYA 1OGZA 4AKYA 3LTDA 4HZ9B 2RCDA 1A2VA 4IT7A 5IEOA 1IK3A 1GY6A 1IVUA 3B8LA 2W56A 4HM8B 3J7Yd 1VQM3 1RJOA 2HMOB 4K1VA 5AEUB 1ISKA 4PEJA 3TDGA 3LTCA 4WFOA 3X42A 1GY7A 2YFIB 5A0OB 3RGAA 2B1XB 1OGXA 2XGLA 2F98A 2HMLB 4HM0B 4N6LA 1PU4A 3SEDA 3G4S3 2XSHB 3G8ZA 2HMJB 3U1WA 1LXEA 3EE1A 5DREA 2O3OA 1TU5A 4N3VA 1W4NA 2JDIH 3HZPA 3LXUX 4LZIA 1W00A 2INXA 2ML6A 4OUQA 1IVWA 4TX4A 3ALAA 1N9EA 2V1LA 1NB5I 1CYUA 2K0MA 1WMNA 2CH9A 4X2OA 4ZM8A 3FZWA 1TUHA 1V74A 2L4VA 1WMPA 1FGQA 1JKGB 2QIYA 3IMAB 3N9HA 3V98A 5CXOA 1SJWA 3G16A 3FF2A 3AMOB 4BTWA 4I4KA 1M1XB 1Q42A 3CD63 3GZYB 3FSDA 2W9QA 3QRDA 4L8PA 1J2BA 1IV7A 1YI23 2BNGA 5IEPA 1D6ZA 1US1A 3ER7A 3NUVA 3WDGB 2Y74A 4HYZA 4WHAA 1YVBI 3CCS3 1OF5A 1PFPA 3S27A 3NXJA 1S723 1Q7Y4 1K41A 5IF6A 2BMQB 3FLJA 3UJMA 1FUWA 3KFQC 1VQ63 3B4OA 3JUQA 4KFDA 1EG9B 4MJDA 2D1WA 5AI1A 1YGEA 4WYKA 3IJEB 2E2TA 1DMMA 3K0ZA 4U13A 5CK6A 2OOVA 1JN5B 4FMCA 1VZZA 2MF7A 1YJW3 2P38A 5JPPA 3F8HA 2OQEC 3RDEA 3DZLA 3WA3A 1STFI 3K63A 1RN7A 1K28A 1K734 2Z6BA 1OHOA 3NX0A 3MG2A 3DMCA 3STDA 3A76A 4HM1B 4RBNA 1LVNA 1Q40A 5CF1A 3QK9A 2QEX3 3SXXA 1IQYA 4CCVA 1IV9A 2UX0A 1JV2B 1STDA 1OACA 1NWWA 3OWYA 3DY5A 4O2HA 3BNCA 3V92A 3G0KA 3CCE3 3DGOA 1SQWA 2XFSA 3T8NA 3PZWA 2GU3A 2CWUA 2IUKA 5ELJA 2QA43 3HI7A 4R1KA 3LTBA 3WOEB 2ZDJA 1W5ZA 4R9KA 3L0RA 1W6CA 4WP5A 3SOYA 1OPYA 4RNZA 3GZXB 1QAKA 2CG1A 3ECFA 2P0MA 4FR9A 3KIIA 1D6YA 3EBTA 3PXMA 3OWSA 4HJLB 3DGMA 3VGNA 1C7HA 3KE7A 1O7GB 2XEPA 5LC7A 4K1UA 4WWUC 5AIHA 5JPUA 1QVG2 1K8A4 1LOXA 5FW5A 1UUWB 4ORLA 2WOFA 1N9JA 1GYBA 3OXAA 3S28A 1ASKA 1HU9A 1W01A 4LSOA 3G713 1O7MB 2RGQA 1CQSA 1GY5A 3CCR3 2CWTA 1OH0A 2GBXB 3NV0A 8CHOA 3CME3 1SPUA 2ZL8A 1BUQA 3PCRA 3Q90A 5AYRB 3EJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW1 A;  3LTC A;  2P09 A;  3DGN A;  3LTB A;  3DGM A;  3LTD A;  3DGL A;  3DGO A;  3LT9 A;  3LTA A;  2P0X A;  3LT8 A;  2P05 A; 
#chains in the Genus database with same CATH topology
 3VF1 A;  1BSC A;  2IMJ A;  1VQP 3;  2Z7A A;  5EEO A;  1Q81 4;  1M90 4;  2SBL A;  3CC4 3;  3SX1 A;  1MWU A;  3CU3 A;  5AIG A;  3PCS A;  3I55 3;  1W02 A;  4HZB B;  5KP3 A;  1I3F A;  1DVD A;  1G96 A;  2A15 A;  1RGL A;  3ZFZ A;  3GSP A;  5ELU A;  5IEN A;  4AEQ A;  4RNY A;  3EF8 A;  5EVH A;  8RNT A;  1I0X A;  4K90 B;  1WNH A;  1A2K A;  1QMA A;  3FKA A;  1T5Y A;  1DVC A;  2RFR A;  3DGY A;  3DM8 A;  2XF3 A;  1WTH A;  1A67 A;  4HBR A;  5BU4 A;  1X1Y A;  3PS8 A;  4H3U A;  4J5K A;  1B2X A;  3CC7 3;  4L8O A;  3NV0 B;  2YFJ B;  3NM2 A;  4WYK B;  4XBX A;  3EJV A;  1EUI C;  3RGR A;  1DMQ A;  3FG3 A;  4O3V A;  2B24 B;  4N6M A;  2ML5 A;  1UCI A;  3EB8 A;  1SIH A;  1GS3 A;  2KAA A;  3T8U A;  4BTX A;  1IQ8 A;  3M8C A;  3CCM 3;  3MKI A;  2XRX B;  3F7S A;  4R80 A;  1QAL A;  4HM7 B;  3X3Y A;  1BUJ A;  2CK3 H;  1W7C A;  3MSO A;  7RNT A;  1BNI A;  3LYG A;  5FGO A;  4J5G A;  1JB4 A;  2GEX A;  3B4P A;  1IVV A;  2CFL A;  4BIR A;  1QJG A;  2IA7 A;  5D83 A;  1S5A A;  1JKG A;  4N6O B;  4O8S A;  1LQM B;  1N5P A;  2R41 A;  1SAR A;  4FCZ A;  3CC2 3;  1VQ9 3;  1TRP A;  1JBR A;  1T3B A;  4HAA A;  4FCM A;  1UGI A;  2BHM A;  3D4A A;  3FF0 A;  1KC8 4;  9RNT A;  4R9L A;  1UCL A;  3U97 A;  2Y73 A;  2CFD A;  2ZHX B;  2PNC A;  4N6U A;  1RCK A;  5HGR A;  1O7P B;  3F7X A;  2OTL 3;  3H3H A;  1YJ9 3;  3EQQ B;  3F9S A;  1BU4 A;  3KCH A;  2W9P A;  2K3D A;  4KFE A;  1BRH A;  4N6T A;  5DRV A;  1W2B 2;  3VSY A;  3K5T A;  4EV2 A;  1B21 A;  3EX9 A;  1MGW A;  4GHO A;  2PZV A;  3BND A;  1BNF A;  2I9W A;  2GU1 A;  1LOW A;  3AMO A;  3URP A;  2JQ5 A;  4FCJ A;  3NHX A;  4XB5 A;  3KZT A;  1ULI B;  2CFW A;  1BVI A;  2FNQ A;  1JB2 A;  3WOD G;  3CCU 3;  3X3X A;  4FMD A;  1TTO A;  2E2U A;  2CFK A;  4CDL A;  2HMM B;  3DGN A;  1AR0 A;  4FMB A;  1Q86 4;  3S67 A;  3GWR A;  1O7W B;  1I2G A;  1AVK A;  5LC6 A;  1HKX A;  1YIT 3;  3F40 A;  1U8C B;  1YNV X;  3NBB A;  3N8B A;  1DYU A;  1CH0 A;  4G1M B;  1JJ2 2;  1VQ4 3;  1OUN A;  3HII A;  5G2G A;  4XDW A;  2J8X B;  1TFO A;  3UL6 A;  1MNL A;  1N8R 4;  2M7O A;  2FGT A;  3OX9 A;  3KN4 A;  4KVH A;  4HM4 B;  1I2F A;  3K7C A;  4I5Q A;  3X3Z A;  2HMN B;  4GL6 A;  1ROA A;  4HKV B;  3OW2 2;  3HX8 A;  5IG4 A;  3MYT A;  1Q40 B;  2P0X A;  2H0H A;  1JZO A;  1E3V A;  3JUM A;  1SII A;  1YHQ 3;  1FGO A;  1JBS A;  3CMA 3;  1LRA A;  1RDS A;  3EBY A;  5D81 A;  3BLZ A;  3ROB A;  1NB3 I;  2FXT A;  2RBI A;  1CEW I;  1TP6 A;  4GSP A;  1KSI A;  1OCV A;  2LYX A;  1UI8 A;  5EQL A;  3LML A;  2CHC A;  4HM6 B;  3LT9 A;  1RMS A;  3DXO A;  2OQE A;  1OF5 B;  3MWZ A;  3LTA A;  3MG1 A;  3F14 A;  1UW1 A;  4OVM A;  2RSX A;  2ZA4 A;  1D6U A;  2WO0 A;  2XFT A;  1FGM A;  1RRL A;  2KF4 A;  3Q2P A;  4J8T A;  3CCL 3;  2CWV A;  4AKZ A;  3D5I A;  5KP4 A;  1FGR A;  1FUT A;  5GSP A;  5G1L A;  5AYS C;  5M19 A;  2GBW B;  1B2Z A;  4NPB A;  6STD A;  1A2P A;  1JB5 A;  2SAR A;  4MMX B;  1E3R A;  2E2V A;  3CCV 3;  2WGQ A;  1T2H A;  5I97 A;  3E99 A;  1Y4K A;  4OK0 A;  1EA2 A;  5BIR A;  4FMA A;  1I8V A;  3V99 A;  1L5G B;  2MC8 A;  1YIJ 3;  3BNB A;  1VQN 3;  3D79 A;  1EKM A;  2CG0 A;  1LNH A;  1TJD A;  3B7C A;  2STD A;  2F56 A;  3JUN A;  4MMY B;  2Z77 A;  3NBJ A;  2KCD A;  1Q7H A;  2WGO A;  3H51 A;  3GRD A;  5D82 A;  1KQS 2;  1F8N A;  1QAF A;  2XSO B;  1IU7 A;  1BRS A;  1Z1S A;  3CNM A;  1IQX A;  4NHF A;  4NRE A;  5G1K A;  2HMK B;  4X2H A;  5IER A;  2CC3 A;  4HM5 B;  3CCJ 3;  4JF8 A;  2R4I A;  1M9G A;  4XBY A;  4R4K A;  1TRQ A;  1NJI 4;  2P05 A;  5AII A;  1B20 A;  1IDP A;  3S5C A;  1AVL A;  5AIF A;  3WMD A;  4CJN A;  1FGT A;  5KP1 A;  4GB5 A;  4KFF A;  4Q53 A;  1AY7 A;  3FG4 A;  4EC6 A;  3IPT A;  5BXQ A;  1N8Q A;  2OOV C;  3HK4 A;  1X1W A;  1VQ7 3;  4N6V 0;  1TFK A;  1UUV B;  4HVN A;  3NBR A;  4EXR A;  4O02 B;  3CPW 2;  3KSP A;  1N5H A;  3PYJ A;  1O7N B;  3KSE D;  2IUJ A;  2OWP A;  3MPH A;  2CW9 A;  1UI7 A;  1LOV A;  2BMO B;  2IY2 A;  2W2C A;  3ZG5 A;  1K9M 4;  2W0Q A;  3HIG A;  4LMI A;  3EHC A;  3GZR A;  1VQK 3;  4N6N B;  1ROV A;  2GXF A;  5TGN A;  1OHP A;  1TIJ A;  2BT3 A;  1V58 A;  2O9U X;  3D3L A;  5IG5 A;  2UGI A;  3NQY A;  3SLU A;  4BU4 A;  1BIR A;  3OWU A;  2YX9 A;  1HZ1 A;  2CX0 A;  1NO3 A;  4HM2 B;  1JNQ A;  3F8X A;  3SOA A;  1BGS A;  3D5G A;  4L7K A;  4EW5 A;  4EV5 A;  1BAN A;  1IT8 A;  4MMZ B;  3CXC 2;  5HOH A;  4K61 A;  1GMQ A;  1RGA A;  1GMP A;  2F99 A;  3Q3F A;  3G6E 3;  3EC9 A;  4BTY A;  1VQO 3;  4HM3 B;  3MHE A;  1RCL A;  2W04 A;  2YFL B;  1JZD A;  1JN5 A;  1AV4 A;  1I0V A;  2F86 B;  1DET A;  1ZO2 A;  4QWT A;  4XDV A;  2CKF B;  3UNL A;  3I56 3;  1ULJ B;  1GMR A;  1RRH A;  4BL3 A;  4EYC A;  1FA3 A;  5IW9 A;  5STD A;  1EQK A;  1QVF 2;  3GZB A;  1KD1 4;  2OTJ 3;  4RNT A;  3DUK A;  1R4C A;  4KZ1 A;  5AEW B;  5IG3 A;  1BNJ A;  1RGF A;  3DH2 A;  3O8Y A;  1ZX2 A;  3EN1 B;  3BB9 A;  1ZS7 A;  3OV4 A;  5JBS A;  3BU4 A;  3PGB A;  5BVB A;  1YVS A;  2Z76 A;  3JUP A;  2P09 A;  4EBG A;  2XGN A;  1CYV A;  3CNX A;  4STD A;  3FG1 A;  3MG3 A;  4LGQ A;  2Q07 A;  3LT8 A;  4IIA A;  1GOU A;  1E97 A;  2OCT A;  3S29 A;  1U5O A;  3WOF B;  1WQL B;  3KKG A;  3RNT A;  3CCQ 3;  1I70 A;  7STD A;  1VQL 3;  4RZM A;  3AHS A;  1PY3 A;  1BSB A;  3LOY A;  2K54 A;  3JUO A;  1GD3 A;  1WMO A;  3FCS B;  1IVX A;  4LEH A;  1MGR A;  1FYS A;  2F4Y A;  4BL2 A;  1Q82 4;  4J9A A;  4MEI A;  2CIU A;  2GEY A;  2C10 A;  3NM7 A;  1LQG C;  3FH1 A;  5CF2 A;  1VQ8 3;  1DMN A;  1W2Z A;  5CLK A;  3BNE A;  2CFG A;  2BMR B;  2W56 B;  3I0Y A;  4IPB A;  2QGU A;  1W6Y A;  1A90 A;  2BU4 A;  2F5W A;  4XBT A;  1JRQ A;  3JVC A;  1OHS A;  2BO9 B;  3LH4 A;  1IT7 A;  1W6G A;  3K9M C;  1BAO A;  5IG0 A;  3UB1 A;  1O7H B;  1YJN 3;  2D42 A;  4JRF A;  3NQZ A;  6GSP A;  1IYY A;  3SVA A;  2UUG C;  2XH9 A;  2W03 A;  3A5E A;  1KWI A;  2WOH A;  3T0U A;  1C54 A;  3GAX A;  1UUG B;  3Q1C A;  1VQ5 3;  1RGK A;  3FGY A;  2KRT A;  1NU3 A;  3N54 B;  1V57 A;  3WA2 X;  3LZA A;  3X41 A;  1GD4 A;  2C11 A;  1RGC A;  1G0T A;  2LQV A;  1HYF A;  1RN1 A;  1M1K 4;  3DGL A;  3X40 A;  1NDO B;  1MOL A;  3EN8 A;  3UL5 A;  2XR8 B;  2W6J H;  3CPO A;  4H61 A;  3D9R A;  4XM4 A;  1RKY A;  1OGZ A;  4AKY A;  3LTD A;  1GOV A;  4HZ9 B;  2RCD A;  1A2V A;  4IT7 A;  4ILF A;  5IEO A;  1IK3 A;  1GY6 A;  1IVU A;  3B8L A;  1BSE A;  2W56 A;  4HM8 B;  3J7Y d;  1VQM 3;  1BRN L;  1B2U A;  1RJO A;  1X1U A;  2HMO B;  4K1V A;  5AEU B;  4LYL B;  1ISK A;  4PEJ A;  3AGN A;  2H0G A;  1MWS A;  3LTC A;  1B27 A;  4WFO A;  3TDG A;  3X42 A;  1GY7 A;  1UGH I;  2YFI B;  1ZGX A;  2KF3 A;  5A0O B;  1BRJ A;  3RGA A;  1BOX A;  1OGX A;  1R4Y A;  2B1X B;  2XGL A;  2F98 A;  2HML B;  4HM0 B;  4N6L A;  1PU4 A;  1X1X A;  3SED A;  3G4S 3;  3AGO A;  3SYU A;  2XSH B;  3G8Z A;  2HMJ B;  3U1W A;  1LXE A;  3EE1 A;  5DRE A;  2O3O A;  1TU5 A;  4N3V A;  1W4N A;  1RGE A;  2JDI H;  3HZP A;  3LXU X;  4LZI A;  1W00 A;  2INX A;  2ML6 A;  1JBT A;  4OUQ A;  1IVW A;  4TX4 A;  3ALA A;  1N9E A;  2V1L A;  1NB5 I;  1CYU A;  2K0M A;  1WMN A;  2CH9 A;  4X2O A;  4ZM8 A;  3FZW A;  1TUH A;  1V74 A;  2L4V A;  1WMP A;  1I3I A;  1FGQ A;  1JKG B;  2F5M A;  2QIY A;  3AHW A;  3IMA B;  1PYL A;  3N9H A;  1MWR A;  3V98 A;  5CXO A;  1SJW A;  1Q9E A;  3G16 A;  3FF2 A;  1BNG A;  3AMO B;  4BTW A;  2BIR A;  1M1X B;  4I4K A;  1Q42 A;  3CD6 3;  1GSP A;  1MWT A;  3GZY B;  3FSD A;  2W9Q A;  3QRD A;  4L8P A;  1BRK A;  1J2B A;  1IV7 A;  1YI2 3;  2BNG A;  5IEP A;  1D6Z A;  1US1 A;  4HOH A;  3HOH A;  3ER7 A;  3NUV A;  3WDG B;  2Y74 A;  4HYZ A;  4WHA A;  1YVB I;  3CCS 3;  1OF5 A;  1PFP A;  3S27 A;  3NXJ A;  1S72 3;  1Q7Y 4;  1K41 A;  5IF6 A;  2BMQ B;  3FLJ A;  3UJM A;  1LNI A;  3ZG0 A;  1FUW A;  3KFQ C;  7GSP A;  1VQ6 3;  1AQZ A;  2AAE A;  3B4O A;  3JUQ A;  1RGH A;  4KFD A;  1EG9 B;  4MJD A;  1NNV A;  2D1W A;  6RNT A;  5AI1 A;  1UDI I;  1YGE A;  4WYK A;  3IJE B;  2E2T A;  1DMM A;  3K0Z A;  4U13 A;  5CK6 A;  2OOV A;  1JN5 B;  4FMC A;  1VZZ A;  2MF7 A;  3BIR A;  1YJW 3;  2HOH A;  1LOY A;  2P38 A;  5JPP A;  3F8H A;  1BNR A;  2OQE C;  3RDE A;  4CPK A;  3DZL A;  3WA3 A;  1STF I;  3K63 A;  2RNT A;  1RN7 A;  1K28 A;  1K73 4;  2Z6B A;  1OHO A;  3NX0 A;  3MG2 A;  1BRG A;  3DMC A;  1RNT A;  3STD A;  3A76 A;  4HM1 B;  4RBN A;  1LVN A;  1Q40 A;  5CF1 A;  3QK9 A;  2QEX 3;  3SXX A;  1IQY A;  4CCV A;  1IV9 A;  1GOY A;  1JV2 B;  2UX0 A;  1RTU A;  1STD A;  3WHO A;  5M18 A;  1FW7 A;  1OAC A;  1NWW A;  3OWY A;  3DY5 A;  4O2H A;  3BNC A;  3V92 A;  3G0K A;  2KF5 A;  1RGG A;  3CCE 3;  3DGO A;  1SQW A;  2XFS A;  3T8N A;  3PZW A;  2GU3 A;  5M1A A;  2CWU A;  2IUK A;  5ELJ A;  2QA4 3;  3HI7 A;  4R1K A;  3LTB A;  1G02 A;  1I2E A;  2C4B A;  3WOE B;  1B2S A;  2AAD A;  2ZDJ A;  1W5Z A;  4R9K A;  3L0R A;  1DE3 A;  1W6C A;  4KT3 B;  4WP5 A;  3SOY A;  1OPY A;  1VQQ A;  2L1S A;  4RNZ A;  2IYJ A;  3GZX B;  1QAK A;  2CG1 A;  2CX1 A;  1BNE A;  3WR2 A;  3ECF A;  1BNS A;  2P0M A;  1UCJ A;  4FR9 A;  3KII A;  1D6Y A;  3EBT A;  3PXM A;  3OWS A;  4HJL B;  3DGM A;  3VGN A;  1C7H A;  3KE7 A;  1O7G B;  1BRI A;  2XEP A;  5LC7 A;  4K1U A;  1YGW A;  5RNT A;  4WWU C;  5AIH A;  5JPU A;  1BSD A;  1UCK A;  1QVG 2;  1K8A 4;  1RLS A;  1LOX A;  5FW5 A;  2H0I A;  1RNB A;  1UUW B;  4ORL A;  1BSA A;  1RHL A;  2WOF A;  1T2I A;  1N9J A;  1GYB A;  3OXA A;  3S28 A;  1ASK A;  1FZU A;  2GSP A;  1W01 A;  1HU9 A;  4LSO A;  1RN4 A;  1FUS A;  1O7M B;  4DKI A;  2RGQ A;  1CQS A;  1GY5 A;  3G71 3;  1B3S A;  3CCR 3;  2CWT A;  1OH0 A;  2GBX B;  1EEJ A;  3NV0 A;  8CHO A;  1RSN A;  3CME 3;  1SPU A;  2ZL8 A;  1BUQ A;  3PCR A;  2KF6 A;  3Q90 A;  5AYR B;  2KXG A;  1B2M A; 
#chains in the Genus database with same CATH homology
 3VF1 A;  1VQP 3;  2IMJ A;  2Z7A A;  5EEO A;  1Q81 4;  1M90 4;  2SBL A;  3CC4 3;  3SX1 A;  5AIG A;  3CU3 A;  3PCS A;  3I55 3;  1W02 A;  4HZB B;  5KP3 A;  1DVD A;  1G96 A;  2A15 A;  5ELU A;  5IEN A;  4AEQ A;  4RNY A;  3EF8 A;  5EVH A;  4K90 B;  1WNH A;  1A2K A;  1QMA A;  3FKA A;  1T5Y A;  1DVC A;  2RFR A;  3DM8 A;  2XF3 A;  1WTH A;  1A67 A;  4HBR A;  3PS8 A;  4H3U A;  3CC7 3;  4L8O A;  3NV0 B;  2YFJ B;  3NM2 A;  4WYK B;  4XBX A;  3RGR A;  1DMQ A;  3FG3 A;  4O3V A;  2B24 B;  4N6M A;  2ML5 A;  3EB8 A;  1SIH A;  1GS3 A;  3T8U A;  4BTX A;  1IQ8 A;  3M8C A;  3CCM 3;  3MKI A;  2XRX B;  3F7S A;  4R80 A;  1QAL A;  4HM7 B;  3X3Y A;  2CK3 H;  1W7C A;  3MSO A;  3LYG A;  5FGO A;  1JB4 A;  2GEX A;  3B4P A;  1IVV A;  2CFL A;  1QJG A;  2IA7 A;  5D83 A;  1S5A A;  1JKG A;  4N6O B;  4O8S A;  1N5P A;  4FCZ A;  3CC2 3;  1VQ9 3;  4FCM A;  2BHM A;  3FF0 A;  1KC8 4;  4R9L A;  3U97 A;  2Y73 A;  2CFD A;  2PNC A;  4N6U A;  5HGR A;  1O7P B;  3F7X A;  2OTL 3;  3H3H A;  1YJ9 3;  3EQQ B;  3F9S A;  4KFE A;  2W9P A;  1W2B 2;  4N6T A;  5DRV A;  3VSY A;  3K5T A;  4EV2 A;  3EX9 A;  2PZV A;  3BND A;  2I9W A;  2GU1 A;  3AMO A;  2JQ5 A;  4FCJ A;  3NHX A;  4XB5 A;  3KZT A;  1ULI B;  2CFW A;  2FNQ A;  3CCU 3;  1JB2 A;  3WOD G;  3X3X A;  4FMD A;  2CFK A;  2E2U A;  4CDL A;  2HMM B;  3DGN A;  1AR0 A;  4FMB A;  1Q86 4;  3S67 A;  3GWR A;  1O7W B;  1AVK A;  5LC6 A;  1HKX A;  1YIT 3;  3F40 A;  1U8C B;  3NBB A;  3N8B A;  1DYU A;  4G1M B;  1JJ2 2;  1VQ4 3;  1OUN A;  3HII A;  5G2G A;  4XDW A;  1TFO A;  3UL6 A;  1MNL A;  1N8R 4;  2M7O A;  2FGT A;  3OX9 A;  3KN4 A;  4KVH A;  4HM4 B;  3X3Z A;  3K7C A;  2HMN B;  4GL6 A;  1ROA A;  4HKV B;  3OW2 2;  3HX8 A;  5IG4 A;  3MYT A;  1Q40 B;  2P0X A;  1E3V A;  3JUM A;  1SII A;  1YHQ 3;  1FGO A;  3CMA 3;  3EBY A;  5D81 A;  3BLZ A;  3ROB A;  1NB3 I;  2FXT A;  1CEW I;  1TP6 A;  1KSI A;  1OCV A;  2LYX A;  1UI8 A;  5EQL A;  3LML A;  2CHC A;  4HM6 B;  3LT9 A;  3DXO A;  2OQE A;  1OF5 B;  3MWZ A;  3LTA A;  3MG1 A;  3F14 A;  1UW1 A;  4OVM A;  2RSX A;  1D6U A;  2WO0 A;  2XFT A;  1FGM A;  1RRL A;  3Q2P A;  4J8T A;  3CCL 3;  2CWV A;  4AKZ A;  5KP4 A;  1FGR A;  5AYS C;  2GBW B;  6STD A;  1JB5 A;  4MMX B;  1E3R A;  2E2V A;  3CCV 3;  2WGQ A;  5I97 A;  3E99 A;  1Y4K A;  4OK0 A;  1EA2 A;  4FMA A;  3V99 A;  1L5G B;  2MC8 A;  1YIJ 3;  3BNB A;  1VQN 3;  1EKM A;  2CG0 A;  1LNH A;  3B7C A;  2STD A;  3JUN A;  4MMY B;  2Z77 A;  3NBJ A;  2KCD A;  2WGO A;  3H51 A;  3GRD A;  5D82 A;  1KQS 2;  1F8N A;  1QAF A;  2XSO B;  1IU7 A;  1Z1S A;  3CNM A;  4NHF A;  1IQX A;  4NRE A;  2HMK B;  4X2H A;  5IER A;  2CC3 A;  4HM5 B;  3CCJ 3;  4JF8 A;  2R4I A;  1M9G A;  4XBY A;  4R4K A;  1NJI 4;  2P05 A;  5AII A;  1IDP A;  3S5C A;  1AVL A;  5AIF A;  3WMD A;  1FGT A;  5KP1 A;  4GB5 A;  4KFF A;  4Q53 A;  3FG4 A;  4EC6 A;  3IPT A;  5BXQ A;  1N8Q A;  2OOV C;  3HK4 A;  1VQ7 3;  4N6V 0;  1TFK A;  1UUV B;  4HVN A;  3NBR A;  4EXR A;  4O02 B;  3CPW 2;  3KSP A;  1N5H A;  3PYJ A;  1O7N B;  3KSE D;  2IUJ A;  2OWP A;  3MPH A;  2CW9 A;  1UI7 A;  2BMO B;  2W2C A;  1K9M 4;  2W0Q A;  3HIG A;  4LMI A;  3EHC A;  3GZR A;  1VQK 3;  4N6N B;  1ROV A;  2GXF A;  5TGN A;  1OHP A;  1TIJ A;  2BT3 A;  2O9U X;  3D3L A;  5IG5 A;  3NQY A;  3SLU A;  3OWU A;  2YX9 A;  1NO3 A;  4HM2 B;  1JNQ A;  3F8X A;  3SOA A;  4L7K A;  4EV5 A;  1IT8 A;  4MMZ B;  3CXC 2;  4K61 A;  2F99 A;  3G6E 3;  3EC9 A;  4BTY A;  1VQO 3;  4HM3 B;  3MHE A;  2W04 A;  2YFL B;  1JN5 A;  1AV4 A;  2F86 B;  4XDV A;  3UNL A;  1ZO2 A;  4QWT A;  3I56 3;  2CKF B;  1ULJ B;  1RRH A;  4EYC A;  1FA3 A;  5IW9 A;  5STD A;  1EQK A;  1QVF 2;  3GZB A;  1KD1 4;  2OTJ 3;  3DUK A;  1R4C A;  4KZ1 A;  5AEW B;  5IG3 A;  3O8Y A;  1ZX2 A;  3EN1 B;  3BB9 A;  3OV4 A;  5JBS A;  3PGB A;  5BVB A;  2Z76 A;  3JUP A;  2P09 A;  4EBG A;  2XGN A;  1CYV A;  3CNX A;  4STD A;  3FG1 A;  3MG3 A;  4LGQ A;  2Q07 A;  3LT8 A;  4IIA A;  1E97 A;  2OCT A;  3S29 A;  1U5O A;  3WOF B;  1WQL B;  3KKG A;  3CCQ 3;  7STD A;  1VQL 3;  4RZM A;  3LOY A;  2K54 A;  3JUO A;  1GD3 A;  1WMO A;  3FCS B;  1IVX A;  4LEH A;  1Q82 4;  4J9A A;  4MEI A;  2CIU A;  2GEY A;  2C10 A;  3NM7 A;  3FH1 A;  5CF2 A;  1VQ8 3;  1DMN A;  1W2Z A;  5CLK A;  3BNE A;  2CFG A;  2BMR B;  2W56 B;  3I0Y A;  4IPB A;  2QGU A;  1W6Y A;  1A90 A;  4XBT A;  1JRQ A;  3JVC A;  1OHS A;  2BO9 B;  3LH4 A;  1IT7 A;  1W6G A;  2KXG A;  3K9M C;  5IG0 A;  3UB1 A;  1O7H B;  1YJN 3;  2D42 A;  4JRF A;  3NQZ A;  3SVA A;  2XH9 A;  2W03 A;  1KWI A;  2WOH A;  3T0U A;  3GAX A;  3Q1C A;  1VQ5 3;  3FGY A;  2KRT A;  1NU3 A;  3N54 B;  3WA2 X;  3LZA A;  3X41 A;  1GD4 A;  2C11 A;  2LQV A;  1M1K 4;  3DGL A;  3X40 A;  1NDO B;  1MOL A;  3EN8 A;  3UL5 A;  2XR8 B;  2W6J H;  3CPO A;  4H61 A;  3D9R A;  4XM4 A;  1RKY A;  1OGZ A;  4AKY A;  3LTD A;  4HZ9 B;  2RCD A;  1A2V A;  4IT7 A;  5IEO A;  1IK3 A;  1GY6 A;  1IVU A;  3B8L A;  2W56 A;  4HM8 B;  3J7Y d;  1VQM 3;  1RJO A;  2HMO B;  4K1V A;  5AEU B;  1ISK A;  4PEJ A;  3TDG A;  3LTC A;  4WFO A;  3X42 A;  1GY7 A;  2YFI B;  5A0O B;  3RGA A;  2B1X B;  1OGX A;  2XGL A;  2F98 A;  2HML B;  4HM0 B;  4N6L A;  1PU4 A;  3SED A;  3G4S 3;  2XSH B;  3G8Z A;  2HMJ B;  3U1W A;  1LXE A;  3EE1 A;  5DRE A;  2O3O A;  1TU5 A;  4N3V A;  1W4N A;  2JDI H;  3HZP A;  3LXU X;  4LZI A;  1W00 A;  2INX A;  2ML6 A;  4OUQ A;  1IVW A;  4TX4 A;  3ALA A;  1N9E A;  2V1L A;  1NB5 I;  1CYU A;  2K0M A;  1WMN A;  2CH9 A;  4X2O A;  4ZM8 A;  3FZW A;  1TUH A;  1V74 A;  2L4V A;  1WMP A;  1FGQ A;  1JKG B;  2QIY A;  3IMA B;  3N9H A;  3V98 A;  5CXO A;  1SJW A;  3G16 A;  3FF2 A;  3AMO B;  4BTW A;  4I4K A;  1M1X B;  1Q42 A;  3CD6 3;  3GZY B;  3FSD A;  2W9Q A;  3QRD A;  4L8P A;  1J2B A;  1IV7 A;  1YI2 3;  2BNG A;  5IEP A;  1D6Z A;  1US1 A;  3ER7 A;  3NUV A;  3WDG B;  2Y74 A;  4HYZ A;  4WHA A;  1YVB I;  3CCS 3;  1OF5 A;  1PFP A;  3S27 A;  3NXJ A;  1S72 3;  1Q7Y 4;  1K41 A;  5IF6 A;  2BMQ B;  3FLJ A;  3UJM A;  1FUW A;  3KFQ C;  1VQ6 3;  3B4O A;  3JUQ A;  4KFD A;  1EG9 B;  4MJD A;  2D1W A;  5AI1 A;  1YGE A;  4WYK A;  3IJE B;  2E2T A;  1DMM A;  3K0Z A;  4U13 A;  5CK6 A;  2OOV A;  1JN5 B;  4FMC A;  1VZZ A;  2MF7 A;  1YJW 3;  2P38 A;  5JPP A;  3F8H A;  2OQE C;  3RDE A;  3DZL A;  3WA3 A;  1STF I;  3K63 A;  1RN7 A;  1K28 A;  1K73 4;  2Z6B A;  1OHO A;  3NX0 A;  3MG2 A;  3DMC A;  3STD A;  3A76 A;  4HM1 B;  4RBN A;  1LVN A;  1Q40 A;  5CF1 A;  3QK9 A;  2QEX 3;  3SXX A;  1IQY A;  4CCV A;  1IV9 A;  2UX0 A;  1JV2 B;  1STD A;  1OAC A;  1NWW A;  3OWY A;  3DY5 A;  4O2H A;  3BNC A;  3V92 A;  3G0K A;  3CCE 3;  3DGO A;  1SQW A;  2XFS A;  3T8N A;  3PZW A;  2GU3 A;  2CWU A;  2IUK A;  5ELJ A;  2QA4 3;  3HI7 A;  4R1K A;  3LTB A;  3WOE B;  2ZDJ A;  1W5Z A;  4R9K A;  3L0R A;  1W6C A;  4WP5 A;  3SOY A;  1OPY A;  4RNZ A;  3GZX B;  1QAK A;  2CG1 A;  3ECF A;  2P0M A;  4FR9 A;  3KII A;  1D6Y A;  3EBT A;  3PXM A;  3OWS A;  4HJL B;  3DGM A;  3VGN A;  1C7H A;  3KE7 A;  1O7G B;  2XEP A;  5LC7 A;  4K1U A;  4WWU C;  5AIH A;  5JPU A;  1QVG 2;  1K8A 4;  1LOX A;  5FW5 A;  1UUW B;  4ORL A;  2WOF A;  1N9J A;  1GYB A;  3OXA A;  3S28 A;  1ASK A;  1HU9 A;  1W01 A;  4LSO A;  3G71 3;  1O7M B;  2RGQ A;  1CQS A;  1GY5 A;  3CCR 3;  2CWT A;  1OH0 A;  2GBX B;  3NV0 A;  8CHO A;  3CME 3;  1SPU A;  2ZL8 A;  1BUQ A;  3PCR A;  3Q90 A;  5AYR B;  3EJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...