1M1K4

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1m1k400
3CCQ3 1YHQ3 2OTJ3 1Q7Y4 2QA43 1VQ83 1VQ73 3CC73 1YI23 1S723 3CCR3 1VQL3 1QVG2 3I563 1VQN3 3CCS3 1Q814 3CXC2 1YIJ3 1JJ22 2OTL3 3OW22 1K8A4 3I553 1VQK3 1VQM3 1M904 1W2B2 1VQP3 3CCE3 3CCL3 3CMA3 2QEX3 1KQS2 3G713 3CME3 3CC43 1N8R4 1YJW3 1NJI4 1M1K4 3CCU3 1K9M4 1VQ53 1VQ43 3G4S3 1VQO3 1YJ93 3CCM3 1Q864 1KD14 1Q824 1KC84 3CC23 1YJN3 3CCJ3 1YIT3 1K734 1VQ93 1QVF2 3CD63 3CCV3 3G6E3 3CPW2 1VQ63
chains in the Genus database with same CATH superfamily
1NDOB 2W03A 3EE1A 4J9AA 3IMAB 3D3LA 2JQ5A 2CFWA 3ER7A 4OUQA 4WHAA 4O02B 3E99A 3S29A 1LVNA 1YI23 1ISKA 1IVUA 1D6ZA 4HVNA 4EBGA 1DMMA 4BL3A 1T2IA 1TFOA 3FG1A 5AEUB 1E97A 1NWWA 1WMNA 1WTHA 2Z76A 3BIRA 3NBRA 5ELJA 1Q9EA 2KRTA 3PXMA 4STDA 3T0UA 2I9WA 2XFTA 3OXAA 3BB9A 4RNTA 1TRPA 2MF7A 4BU4A 1IQYA 3NM2A 7RNTA 3U1WA 3VGNA 1IV9A 3LTCA 3HX8A 1RGCA 4BTWA 5G2GA 1WQLB 2ML5A 4IPBA 1RJOA 4ORLA 1RGFA 1YNVX 1ZX2A 2GSPA 1Q7Y4 3KSED 3F7SA 1UCJA 1EEJA 7GSPA 1JBTA 5D81A 3ZG5A 1AVLA 4X2HA 1JRQA 3PZWA 2CWUA 1JJ22 4N6UA 1K28A 4WWUC 1LXEA 2WGOA 1I70A 1WMPA 2OOVA 1UCLA 1W02A 5AYRB 4NHFA 3CMA3 2O3OA 2Z77A 1GD3A 1OPYA 2INXA 2ZHXB 1DVCA 2CK3H 3S5CA 1I8VA 3X3YA 1BOXA 1LRAA 1Q864 2BMRB 1QVF2 5KP3A 1TUHA 3EB8A 1B2SA 1BRGA 1WNHA 3CNMA 3FG4A 1MWSA 2STDA 2D1WA 4LGQA 3FH1A 1RLSA 2H0HA 1AR0A 2W9PA 3CC73 3B7CA 3D4AA 1OGXA 1QAFA 2HOHA 3NBBA 1JB4A 3I563 3WMDA 3CXC2 5CK6A 1E3VA 2KF6A 1RRLA 1RGKA 2RFRA 3I553 2IUKA 1ZO2A 4KZ1A 3CCE3 1BNRA 2ZA4A 2Y73A 1A2VA 1G02A 2YFLB 1TU5A 1B2MA 1JV2B 3KCHA 2W6JH 4XB5A 3NX0A 1N8QA 3BNEA 1BSBA 1N9JA 1BRSA 2BMOB 3JUPA 1IVXA 1OGZA 3G8ZA 4H61A 4JRFA 4RNYA 1O7MB 4N6TA 1GYBA 1YHQ3 1DE3A 4HM3B 1V74A 2F56A 4GSPA 2K54A 2P05A 1S723 3D5IA 1JBRA 3DUKA 3EX9A 1E3RA 1UUWB 5AIHA 1T2HA 4G1MB 1BIRA 1OHSA 1ROAA 3SX1A 2W04A 5IERA 2CX1A 3Q2PA 1GOYA 3DGYA 2BO9B 3TDGA 1MOLA 1UI7A 2IA7A 2H0GA 5AYSC 3Q90A 1HKXA 1N5PA 3CME3 2W9QA 1SIHA 5HOHA 1IT8A 5IG0A 3X40A 3VF1A 2LQVA 1ULJB 3HIIA 5AIFA 3PCSA 2HMMB 1Q7HA 1TP6A 2Q07A 3GSPA 1QJGA 3EQQB 4HM8B 1SARA 1GY6A 2GU3A 2P0MA 3NQYA 2BIRA 4X2OA 4R9KA 1BNGA 1RSNA 4HKVB 3GRDA 3SEDA 1VQL3 1RGLA 2PZVA 3HOHA 1QVG2 2R4IA 1Q814 4ILFA 2A15A 3DGOA 4N6OB 2OTL3 3QK9A 4N6LA 4KFEA 1PY3A 1Y4KA 4J5GA 3SOYA 4PEJA 3BNDA 4HM4B 4HYZA 1IV7A 5BVBA 5HGRA 3O8YA 2MC8A 1VQ43 3G4S3 3JUNA 1FGRA 1VZZA 3LMLA 3JVCA 4MJDA 4OVMA 1VQ93 4AEQA 4OK0A 2XR8B 3MKIA 2QIYA 4FMBA 1M1XB 4L8OA 1BSCA 3OWUA 3G16A 2B1XB 4LYLB 5ELUA 3DZLA 1B20A 3HIGA 3N54B 2CC3A 3KIIA 1R4YA 1OHPA 2XGLA 1W7CA 2XEPA 1EKMA 2PNCA 3MHEA 5IW9A 1LOYA 1V57A 2W56B 1O7NB 3B8LA 4FCZA 3T8UA 1X1YA 1AY7A 2OOVC 3DH2A 3S27A 3ZG0A 3CCL3 1L5GB 5EVHA 3UNLA 2J8XB 4XM4A 1C7HA 5IEOA 4EYCA 2QEX3 1SJWA 1US1A 1YGEA 2UGIA 4J8TA 1I3IA 3V98A 3LT9A 3CCU3 2H0IA 1FUWA 1TJDA 2GEYA 2W56A 3F7XA 3RGAA 1KD14 3SXXA 3OV4A 2CHCA 2GBWB 2GXFA 3EN8A 3Q1CA 1B2XA 3BLZA 1QALA 1MGWA 3MWZA 4R1KA 2Z7AA 3PGBA 4AKYA 1B3SA 3I0YA 1ASKA 2RCDA 3OWSA 2BU4A 1BNFA 1LQMB 1VQ73 3MG1A 3AMOB 1RCLA 4MMZB 1IVVA 1RTUA 1W01A 3DGNA 4HM0B 1UDII 1JZDA 4BIRA 1RGGA 5CF1A 1VQN3 4LZIA 2WGQA 1BSDA 3IJEB 2QGUA 3J7Yd 4Q53A 2FXTA 2CIUA 4HM6B 1GOUA 3GZBA 1YGWA 1W2B2 5I97A 5GSPA 3WA2X 3X42A 4FMCA 1TFKA 3AMOA 4XDVA 1EUIC 2O9UX 4K1UA 2OQEA 1B2ZA 5KP1A 1BUJA 1RGEA 3K9MC 4FR9A 1O7HB 1UUGB 2XRXB 1UUVB 2KAAA 1FUTA 5A0OB 1DYUA 2YX9A 4MMXB 3EBYA 1ZGXA 4R80A 3WOFB 1RKYA 3CCV3 1RGHA 4EC6A 1NB5I 1X1XA 1EG9B 3FF0A 3FKAA 2CKFB 3JUQA 4U13A 1GSPA 1DMNA 4DKIA 3D9RA 4NPBA 4IT7A 1T3BA 3UL6A 2CW9A 5CF2A 2P38A 4O8SA 1GY7A 1AV4A 1RN4A 1OUNA 3WA3A 3UJMA 1YIJ3 3F8HA 4HZBB 8CHOA 5BXQA 1HZ1A 1BRJA 1JKGB 4FMAA 4HOHA 4EV2A 1LOWA 1CYUA 3BU4A 4EW5A 1ULIB 3LXUX 1JB2A 2E2VA 3S67A 4R4KA 1BAOA 1B2UA 5FGOA 1I2EA 3G0KA 2BHMA 1MWUA 1LNIA 1Q40B 2IYJA 1JKGA 1QMAA 4N6MA 3SVAA 1CEWI 1Q42A 1K734 1OF5B 3CCJ3 3DY5A 3K5TA 1YVBI 2L4VA 2V1LA 1STDA 3WODG 1FW7A 5G1LA 1JN5B 4FCJA 2XH9A 3KE7A 3PCRA 1BU4A 1GS3A 1KSIA 3EBTA 1UW1A 3NXJA 4XDWA 1BVIA 2QA43 4EV5A 5IF6A 1CH0A 1GMPA 1N5HA 1I0VA 1O7WB 1OF5A 2ZL8A 4QWTA 1STFI 3HZPA 1RN1A 3K7CA 3CCS3 1JN5A 4WYKB 3SLUA 1M904 3MG2A 4K61A 2D42A 2M7OA 4XBTA 4K1VA 1KQS2 3AGOA 4MMYB 3KSPA 4H3UA 1A2KA 3CCM3 4WYKA 1GY5A 4FCMA 1FYSA 3ZFZA 1KC84 5EQLA 1BRNL 3DM8A 2YFIB 3NHXA 2XF3A 4KFFA 1UGHI 2IY2A 5IEPA 1IQXA 3RNTA 5CLKA 1OHOA 3LT8A 3U97A 2KXGA 4AKZA 1OACA 2HMJB 3ALAA 5AEWB 1I0XA 3KZTA 4N6NB 3URPA 4CPKA 3D79A 1N9EA 2HMOB 1AVKA 2HMLB 2P0XA 3X3ZA 2OWPA 3DGLA 4JF8A 1VQP3 4RZMA 3FSDA 2Z6BA 1TIJA 3CC43 2C10A 4NREA 3PS8A 1BNEA 1RN7A 1RNBA 2LYXA 6STDA 2CH9A 1NB3I 4I5QA 1T5YA 3M8CA 1Q824 2CG0A 4RNZA 5IG3A 2CWVA 1YIT3 4KVHA 2GBXB 3EJVA 3NQZA 1JNQA 1UCKA 3CPW2 2BMQB 2UX0A 5G1KA 5TGNA 4KT3B 1LNHA 1JZOA 1BANA 2BT3A 1BSEA 1D6UA 5EEOA 3K0ZA 2CFGA 4LEHA 3F9SA 1W00A 1RRHA 1B21A 4TX4A 5M18A 8RNTA 1AQZA 1V58A 4HAAA 3V99A 2B24B 2K0MA 1KWIA 1W5ZA 3LTBA 1IVWA 4WP5A 2F5WA 2OQEC 3LZAA 3D5GA 3AGNA 1W6YA 1VQ53 1NU3A 3B4OA 1MWTA 1RDSA 2F99A 3NUVA 2FGTA 1BRKA 4GHOA 4IIAA 4HJLB 4HM1B 5BIRA 2IMJA 1JB5A 2CX0A 3S28A 2KCDA 3B4PA 3UB1A 3CCQ3 1BGSA 3LYGA 1RMSA 2AAEA 1IK3A 4I4KA 1LOVA 2R41A 1GMQA 5DRVA 3V92A 3CCR3 1O7GB 1FGOA 2W2CA 3N9HA 5AI1A 2Y74A 3A76A 3JUMA 1MNLA 4L8PA 4GL6A 6GSPA 2ML6A 4EXRA 2RBIA 1W6GA 3KKGA 2XFSA 5KP4A 1PU4A 3F8XA 5IG5A 2F4YA 3MPHA 1WMOA 2UUGC 1TRQA 3K63A 3EF8A 3EHCA 5RNTA 1GMRA 3CPOA 1HYFA 3HK4A 3FGYA 1VQO3 1YJ93 3H51A 1IT7A 3LOYA 1GD4A 1ROVA 4BL2A 3FZWA 2WOHA 5LC7A 2F5MA 3STDA 1PYLA 1C54A 3KN4A 1OCVA 3CU3A 5LC6A 3HI7A 1IDPA 3MG3A 4HM5B 4LSOA 2KF5A 1U5OA 2XSOB 5IG4A 1Z1SA 4BTYA 3GZRA 3GZXB 3FF2A 4XBXA 1I3FA 1W6CA 3ECFA 1LOXA 1O7PB 3MSOA 1W4NA 4XBYA 1BRHA 3L0RA 3OWYA 4HM2B 2CFDA 4KFDA 5CXOA 3OW22 1HU9A 1VQM3 5JPPA 5D82A 1K41A 4CJNA 4L7KA 1DETA 5D83A 2P09A 3MYTA 3UL5A 2XSHB 2IUJA 4HZ9B 1M1K4 1CQSA 5JBSA 1K9M4 1OH0A 4J5KA 3CNXA 1BNJA 2FNQA 1FUSA 3CC23 1YJN3 1G0TA 3FLJA 3FG3A 3KFQC 3JUOA 1RGAA 3IPTA 5IENA 1UCIA 1D6YA 2W0QA 3PYJA 1GOVA 1BNSA 4ZM8A 1Q40A 1M9GA 1MGRA 1G96A 1QAKA 3DGMA 4N3VA 1FGQA 1F8NA 4CCVA 1K8A4 1BUQA 3WR2A 3LTDA 3F40A 4HBRA 3OX9A 1NO3A 1FGTA 3G713 1FGMA 9RNTA 3DMCA 1LQGC 2KF4A 3EN1B 5FW5A 1S5AA 1EQKA 1X1UA 3GAXA 3RDEA 2HMNB 1UI8A 4BTXA 1ZS7A 3WHOA 4GB5A 1A67A 1IU7A 1NJI4 1J2BA 1I2FA 3RGRA 1VQ63 1A90A 2GEXA 2F86B 2E2UA 2OTJ3 3F14A 1VQQA 3NBJA 1FA3A 1RHLA 2KF3A 3WDGB 3ROBA 4R9LA 2OCTA 2BNGA 1IQ8A 2RNTA 3H3HA 2RGQA 4LMIA 4HM7B 4MEIA 3DXOA 3X41A 1RNTA 2GU1A 1BRIA 1VQK3 3BNBA 1IYYA 1JBSA 1PFPA 1NNVA 2WOFA 3EC9A 5DREA 1UGIA 2CWTA 5BU4A 5M19A 4WFOA 1N8R4 1MWRA 2HMKB 1DMQA 4O3VA 1CYVA 7STDA 4FMDA 3GWRA 2E2TA 3GZYB 3NV0B 3SYUA 1U8CB 1SIIA 3X3XA 3G6E3 1B27A 1A2PA 3A5EA 5AIGA 2SARA 1TTOA 2YFJB 3AHWA 2CFLA 1VQ83 1SQWA 2F98A 3NV0A 5AIIA 2RSXA 2SBLA 2K3DA 2XGNA 1RCKA 1FZUA 2ZDJA 4RBNA 6RNTA 1DVDA 1EA2A 1R4CA 1YVSA 3Q3FA 1BSAA 2JDIH 2CG1A 2WO0A 4O2HA 5M1AA 1I2GA 1SPUA 2C4BA 3NM7A 3QRDA 3LH4A 3VSYA 1X1WA 4K90B 1YJW3 2CFKA 1BNIA 2C11A 2L1SA 3FCSB 5JPUA 1W2ZA 3N8BA 5STDA 4CDLA 3CD63 2AADA 3SOAA 3AHSA 3T8NA 4N6V0 3BNCA 3WOEB 3LTAA
chains in the Genus database with same CATH topology
1NDOB 2W03A 3EE1A 4J9AA 3IMAB 3D3LA 2JQ5A 2CFWA 3ER7A 4OUQA 4WHAA 4O02B 3E99A 3S29A 1LVNA 1YI23 1ISKA 1IVUA 1D6ZA 4HVNA 4EBGA 1DMMA 1TFOA 3FG1A 5AEUB 1E97A 1NWWA 1WMNA 1WTHA 2Z76A 5ELJA 3NBRA 4STDA 2KRTA 3PXMA 3T0UA 2I9WA 2XFTA 3OXAA 3BB9A 2MF7A 1IQYA 3NM2A 3U1WA 3VGNA 1IV9A 3LTCA 3HX8A 4BTWA 5G2GA 1WQLB 2ML5A 4IPBA 1RJOA 4ORLA 1ZX2A 1Q7Y4 3KSED 3F7SA 5D81A 1AVLA 4X2HA 1JRQA 3PZWA 2CWUA 1JJ22 4N6UA 1K28A 4WWUC 1LXEA 2WGOA 1WMPA 2OOVA 1W02A 5AYRB 4NHFA 3CMA3 2O3OA 2Z77A 1GD3A 1OPYA 2INXA 1DVCA 2CK3H 3S5CA 3X3YA 1Q864 2BMRB 1QVF2 5KP3A 1TUHA 3EB8A 1WNHA 3CNMA 3FG4A 2STDA 2D1WA 4LGQA 3FH1A 1AR0A 2W9PA 3CC73 3B7CA 1OGXA 1QAFA 3NBBA 3I563 1JB4A 3WMDA 3CXC2 5CK6A 1E3VA 1RRLA 2RFRA 3I553 2IUKA 1ZO2A 4KZ1A 3CCE3 2Y73A 1A2VA 2YFLB 1TU5A 1JV2B 2W6JH 4XB5A 3NX0A 1N8QA 3BNEA 1N9JA 2BMOB 3JUPA 1IVXA 1OGZA 3G8ZA 4H61A 4JRFA 4RNYA 1O7MB 4N6TA 1GYBA 1YHQ3 4HM3B 1V74A 2K54A 2P05A 1S723 3DUKA 3EX9A 1E3RA 1UUWB 5AIHA 4G1MB 1OHSA 1ROAA 3SX1A 2W04A 5IERA 3Q2PA 2BO9B 3TDGA 1MOLA 1UI7A 2IA7A 5AYSC 3Q90A 1HKXA 1N5PA 3CME3 2W9QA 1SIHA 1IT8A 5IG0A 3X40A 3VF1A 2LQVA 1ULJB 3HIIA 5AIFA 3PCSA 2HMMB 1TP6A 2Q07A 4HM8B 1QJGA 3EQQB 2GU3A 1GY6A 2P0MA 3NQYA 4X2OA 4R9KA 4HKVB 3GRDA 3SEDA 1VQL3 1QVG2 2PZVA 2R4IA 1Q814 2A15A 3DGOA 4N6OB 2OTL3 3QK9A 4N6LA 4KFEA 1Y4KA 3SOYA 4PEJA 3BNDA 4HM4B 4HYZA 1IV7A 5BVBA 5HGRA 3O8YA 2MC8A 1VQ43 3G4S3 3JUNA 1FGRA 1VZZA 3LMLA 3JVCA 4MJDA 4OVMA 1VQ93 4AEQA 4OK0A 2XR8B 3MKIA 2QIYA 4FMBA 1M1XB 4L8OA 3OWUA 3G16A 2B1XB 5ELUA 3DZLA 3HIGA 3N54B 2CC3A 3KIIA 1OHPA 2XGLA 1W7CA 2XEPA 1EKMA 2PNCA 3MHEA 5IW9A 3B8LA 2W56B 5JPPA 1O7NB 4FCZA 3T8UA 2OOVC 3S27A 3CCL3 1L5GB 5EVHA 3UNLA 4XM4A 5IEOA 1C7HA 4EYCA 2QEX3 1SJWA 1US1A 1YGEA 4J8TA 3V98A 3LT9A 3CCU3 1FUWA 2W56A 2GEYA 3F7XA 3RGAA 1KD14 3SXXA 3OV4A 2CHCA 2GBWB 2GXFA 3EN8A 3Q1CA 3BLZA 1QALA 3MWZA 4R1KA 2Z7AA 3PGBA 4AKYA 3I0YA 1ASKA 2RCDA 3OWSA 1VQ73 3MG1A 3AMOB 4MMZB 1IVVA 1W01A 3DGNA 4HM0B 1VQN3 5CF1A 4LZIA 2WGQA 3IJEB 2QGUA 3J7Yd 4Q53A 2FXTA 2CIUA 4HM6B 3GZBA 1W2B2 5I97A 3WA2X 3X42A 4FMCA 1TFKA 3AMOA 4XDVA 2O9UX 4K1UA 5KP1A 2OQEA 3K9MC 4FR9A 1O7HB 2XRXB 1UUVB 5A0OB 1DYUA 2YX9A 4MMXB 3EBYA 4R80A 3WOFB 1RKYA 3CCV3 4EC6A 1NB5I 1EG9B 3FF0A 3FKAA 2CKFB 3JUQA 4U13A 1DMNA 3D9RA 4IT7A 3UL6A 2CW9A 5CF2A 2P38A 4O8SA 1GY7A 1AV4A 1OUNA 3WA3A 3UJMA 1YIJ3 3F8HA 4HZBB 8CHOA 5BXQA 1JKGB 4FMAA 4EV2A 1CYUA 1ULIB 3LXUX 1JB2A 2E2VA 3S67A 4R4KA 5FGOA 3G0KA 2BHMA 1Q40B 3SVAA 4N6MA 1JKGA 1QMAA 1CEWI 1Q42A 1K734 1OF5B 3CCJ3 3DY5A 3K5TA 2L4VA 2V1LA 1YVBI 1STDA 3WODG 1JN5B 4FCJA 2XH9A 3KE7A 3PCRA 1GS3A 1KSIA 3NXJA 3EBTA 1UW1A 4XDWA 2QA43 4EV5A 5IF6A 1N5HA 1O7WB 4QWTA 1OF5A 2ZL8A 5CXOA 1STFI 3HZPA 3K7CA 3CCS3 1JN5A 4WYKB 3SLUA 1M904 3MG2A 4K61A 2D42A 2M7OA 4XBTA 4K1VA 1KQS2 4MMYB 3KSPA 4H3UA 1A2KA 3CCM3 4WYKA 1GY5A 4FCMA 1KC84 5EQLA 3DM8A 2YFIB 3NHXA 2XF3A 4KFFA 5IEPA 1IQXA 5CLKA 1OHOA 3LT8A 3U97A 2KXGA 4AKZA 1OACA 2HMJB 3ALAA 5AEWB 3KZTA 4N6NB 1N9EA 2HMOB 1AVKA 2HMLB 2P0XA 3X3ZA 2OWPA 3DGLA 4JF8A 1VQP3 4RZMA 3FSDA 2Z6BA 1TIJA 3CC43 2C10A 4NREA 3PS8A 1RN7A 2LYXA 6STDA 2CH9A 1NB3I 1T5YA 3M8CA 1Q824 2CG0A 4RNZA 5IG3A 2CWVA 1YIT3 4KVHA 2GBXB 3EJVA 3NQZA 1JNQA 3CPW2 2BMQB 2UX0A 5TGNA 1LNHA 2BT3A 1D6UA 5EEOA 3K0ZA 2CFGA 4LEHA 3F9SA 1W00A 1RRHA 4TX4A 3V99A 2B24B 2K0MA 1KWIA 1W5ZA 3LTBA 1IVWA 4WP5A 2OQEC 3LZAA 1W6YA 1VQ53 1NU3A 3B4OA 3NUVA 2F99A 2FGTA 4IIAA 4HJLB 4HM1B 2IMJA 1JB5A 3S28A 2KCDA 3B4PA 3UB1A 3CCQ3 3LYGA 1IK3A 4I4KA 3CCR3 5DRVA 3V92A 1O7GB 1FGOA 2W2CA 3N9HA 5AI1A 2Y74A 3A76A 3JUMA 1MNLA 4L8PA 4GL6A 2ML6A 4EXRA 3KKGA 1W6GA 5KP4A 2XFSA 1PU4A 3F8XA 5IG5A 3MPHA 1WMOA 3K63A 3EF8A 3EHCA 3CPOA 3HK4A 3FGYA 1VQO3 1YJ93 3H51A 1IT7A 3LOYA 1GD4A 1ROVA 3FZWA 2WOHA 5LC7A 3STDA 3KN4A 1OCVA 3CU3A 5LC6A 3HI7A 1IDPA 3MG3A 4HM5B 4LSOA 1U5OA 2XSOB 5IG4A 1Z1SA 4BTYA 3GZRA 3GZXB 3FF2A 4XBXA 1W6CA 3ECFA 1LOXA 1O7PB 3MSOA 1W4NA 4XBYA 3L0RA 3OWYA 4HM2B 2CFDA 4KFDA 3OW22 1HU9A 1VQM3 5D82A 1K41A 4L7KA 5D83A 2P09A 3MYTA 3UL5A 2XSHB 2IUJA 4HZ9B 1M1K4 1CQSA 5JBSA 1K9M4 1OH0A 3CNXA 2FNQA 3CC23 1YJN3 3FLJA 3FG3A 3KFQC 3JUOA 3IPTA 5IENA 1D6YA 2W0QA 3PYJA 4ZM8A 1Q40A 1M9GA 1G96A 1QAKA 3DGMA 4N3VA 1FGQA 1F8NA 4CCVA 1K8A4 1BUQA 3LTDA 3F40A 4HBRA 3OX9A 1NO3A 1FGTA 3G713 1FGMA 3DMCA 3EN1B 5FW5A 1S5AA 1EQKA 3GAXA 3RDEA 2HMNB 1UI8A 4BTXA 4GB5A 1A67A 1IU7A 1NJI4 1J2BA 3RGRA 1VQ63 1A90A 2GEXA 2F86B 2E2UA 2OTJ3 3F14A 3NBJA 1FA3A 3WDGB 3ROBA 4R9LA 2OCTA 2BNGA 1IQ8A 3H3HA 4LMIA 2RGQA 4MEIA 4HM7B 3DXOA 3X41A 2GU1A 1VQK3 3BNBA 1PFPA 2WOFA 3EC9A 5DREA 2CWTA 4WFOA 1N8R4 2HMKB 1DMQA 4O3VA 1CYVA 7STDA 4FMDA 3GWRA 2E2TA 3GZYB 3NV0B 1U8CB 1SIIA 3X3XA 3G6E3 5AIGA 2YFJB 2CFLA 1VQ83 1SQWA 2F98A 3NV0A 5AIIA 2RSXA 2SBLA 2XGNA 2ZDJA 4RBNA 1DVDA 1EA2A 1R4CA 2JDIH 2CG1A 2WO0A 4O2HA 1YJW3 1SPUA 3NM7A 3QRDA 3LH4A 3VSYA 4K90B 2CFKA 2C11A 3FCSB 5JPUA 1W2ZA 3N8BA 5STDA 4CDLA 3CD63 3SOAA 3T8NA 4N6V0 3BNCA 3WOEB 3LTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ 3;  1YHQ 3;  2OTJ 3;  1Q7Y 4;  2QA4 3;  1VQ8 3;  1VQ7 3;  3CC7 3;  1YI2 3;  1S72 3;  3CCR 3;  1VQL 3;  1QVG 2;  3I56 3;  1VQN 3;  3CCS 3;  1Q81 4;  3CXC 2;  1YIJ 3;  1JJ2 2;  2OTL 3;  3OW2 2;  1K8A 4;  3I55 3;  1VQK 3;  1VQM 3;  1M90 4;  1W2B 2;  1VQP 3;  3CCE 3;  3CCL 3;  3CMA 3;  2QEX 3;  1KQS 2;  3G71 3;  3CME 3;  3CC4 3;  1N8R 4;  1YJW 3;  1NJI 4;  1M1K 4;  3CCU 3;  1K9M 4;  1VQ5 3;  1VQ4 3;  3G4S 3;  1VQO 3;  1YJ9 3;  3CCM 3;  1Q86 4;  1KD1 4;  1Q82 4;  1KC8 4;  3CC2 3;  1YJN 3;  3CCJ 3;  1YIT 3;  1K73 4;  1VQ9 3;  1QVF 2;  3CD6 3;  3CCV 3;  3G6E 3;  3CPW 2;  1VQ6 3; 
#chains in the Genus database with same CATH topology
 1NDO B;  2W03 A;  3EE1 A;  4J9A A;  3IMA B;  3D3L A;  2JQ5 A;  2CFW A;  3ER7 A;  4OUQ A;  4WHA A;  4O02 B;  3E99 A;  3S29 A;  1LVN A;  1YI2 3;  1ISK A;  1IVU A;  1D6Z A;  4HVN A;  4EBG A;  1DMM A;  4BL3 A;  1T2I A;  1TFO A;  3FG1 A;  5AEU B;  1E97 A;  1NWW A;  1WMN A;  1WTH A;  2Z76 A;  3BIR A;  3NBR A;  5ELJ A;  1Q9E A;  2KRT A;  3PXM A;  4STD A;  3T0U A;  2I9W A;  2XFT A;  3OXA A;  3BB9 A;  4RNT A;  1TRP A;  2MF7 A;  4BU4 A;  1IQY A;  3NM2 A;  7RNT A;  3U1W A;  3VGN A;  1IV9 A;  3LTC A;  3HX8 A;  1RGC A;  4BTW A;  5G2G A;  1WQL B;  2ML5 A;  4IPB A;  1RJO A;  4ORL A;  1RGF A;  1YNV X;  1ZX2 A;  2GSP A;  1Q7Y 4;  3KSE D;  3F7S A;  1UCJ A;  1EEJ A;  7GSP A;  1JBT A;  5D81 A;  3ZG5 A;  1AVL A;  4X2H A;  1JRQ A;  3PZW A;  2CWU A;  1JJ2 2;  4N6U A;  1K28 A;  4WWU C;  1LXE A;  2WGO A;  1I70 A;  1WMP A;  2OOV A;  1UCL A;  1W02 A;  5AYR B;  4NHF A;  3CMA 3;  2O3O A;  2Z77 A;  1GD3 A;  1OPY A;  2INX A;  2ZHX B;  1DVC A;  2CK3 H;  3S5C A;  1I8V A;  3X3Y A;  1BOX A;  1LRA A;  1Q86 4;  2BMR B;  1QVF 2;  5KP3 A;  1TUH A;  3EB8 A;  1B2S A;  1BRG A;  1WNH A;  3CNM A;  3FG4 A;  1MWS A;  2STD A;  2D1W A;  4LGQ A;  3FH1 A;  1RLS A;  2H0H A;  1AR0 A;  2W9P A;  3CC7 3;  3B7C A;  3D4A A;  1OGX A;  1QAF A;  2HOH A;  3NBB A;  1JB4 A;  3I56 3;  3WMD A;  3CXC 2;  5CK6 A;  1E3V A;  2KF6 A;  1RRL A;  1RGK A;  2RFR A;  3I55 3;  2IUK A;  1ZO2 A;  4KZ1 A;  3CCE 3;  1BNR A;  2ZA4 A;  2Y73 A;  1A2V A;  1G02 A;  2YFL B;  1TU5 A;  1B2M A;  1JV2 B;  3KCH A;  2W6J H;  4XB5 A;  3NX0 A;  1N8Q A;  3BNE A;  1BSB A;  1N9J A;  1BRS A;  2BMO B;  3JUP A;  1IVX A;  1OGZ A;  3G8Z A;  4H61 A;  4JRF A;  4RNY A;  1O7M B;  4N6T A;  1GYB A;  1YHQ 3;  1DE3 A;  4HM3 B;  1V74 A;  2F56 A;  4GSP A;  2K54 A;  2P05 A;  1S72 3;  3D5I A;  1JBR A;  3DUK A;  3EX9 A;  1E3R A;  1UUW B;  5AIH A;  1T2H A;  4G1M B;  1BIR A;  1OHS A;  1ROA A;  3SX1 A;  2W04 A;  5IER A;  2CX1 A;  3Q2P A;  1GOY A;  3DGY A;  2BO9 B;  3TDG A;  1MOL A;  1UI7 A;  2IA7 A;  2H0G A;  5AYS C;  3Q90 A;  1HKX A;  1N5P A;  3CME 3;  2W9Q A;  1SIH A;  5HOH A;  1IT8 A;  5IG0 A;  3X40 A;  3VF1 A;  2LQV A;  1ULJ B;  3HII A;  5AIF A;  3PCS A;  2HMM B;  1Q7H A;  1TP6 A;  2Q07 A;  3GSP A;  1QJG A;  3EQQ B;  4HM8 B;  1SAR A;  1GY6 A;  2GU3 A;  2P0M A;  3NQY A;  2BIR A;  4X2O A;  4R9K A;  1BNG A;  1RSN A;  4HKV B;  3GRD A;  3SED A;  1VQL 3;  1RGL A;  2PZV A;  3HOH A;  1QVG 2;  2R4I A;  1Q81 4;  4ILF A;  2A15 A;  3DGO A;  4N6O B;  2OTL 3;  3QK9 A;  4N6L A;  4KFE A;  1PY3 A;  1Y4K A;  4J5G A;  3SOY A;  4PEJ A;  3BND A;  4HM4 B;  4HYZ A;  1IV7 A;  5BVB A;  5HGR A;  3O8Y A;  2MC8 A;  1VQ4 3;  3G4S 3;  3JUN A;  1FGR A;  1VZZ A;  3LML A;  3JVC A;  4MJD A;  4OVM A;  1VQ9 3;  4AEQ A;  4OK0 A;  2XR8 B;  3MKI A;  2QIY A;  4FMB A;  1M1X B;  4L8O A;  1BSC A;  3OWU A;  3G16 A;  2B1X B;  4LYL B;  5ELU A;  3DZL A;  1B20 A;  3HIG A;  3N54 B;  2CC3 A;  3KII A;  1R4Y A;  1OHP A;  2XGL A;  1W7C A;  2XEP A;  1EKM A;  2PNC A;  3MHE A;  5IW9 A;  1LOY A;  1V57 A;  2W56 B;  1O7N B;  3B8L A;  4FCZ A;  3T8U A;  1X1Y A;  1AY7 A;  2OOV C;  3DH2 A;  3S27 A;  3ZG0 A;  3CCL 3;  1L5G B;  5EVH A;  3UNL A;  2J8X B;  4XM4 A;  1C7H A;  5IEO A;  4EYC A;  2QEX 3;  1SJW A;  1US1 A;  1YGE A;  2UGI A;  4J8T A;  1I3I A;  3V98 A;  3LT9 A;  3CCU 3;  2H0I A;  1FUW A;  1TJD A;  2GEY A;  2W56 A;  3F7X A;  3RGA A;  1KD1 4;  3SXX A;  3OV4 A;  2CHC A;  2GBW B;  2GXF A;  3EN8 A;  3Q1C A;  1B2X A;  3BLZ A;  1QAL A;  1MGW A;  3MWZ A;  4R1K A;  2Z7A A;  3PGB A;  4AKY A;  1B3S A;  3I0Y A;  1ASK A;  2RCD A;  3OWS A;  2BU4 A;  1BNF A;  1LQM B;  1VQ7 3;  3MG1 A;  3AMO B;  1RCL A;  4MMZ B;  1IVV A;  1RTU A;  1W01 A;  3DGN A;  4HM0 B;  1UDI I;  1JZD A;  4BIR A;  1RGG A;  5CF1 A;  1VQN 3;  4LZI A;  2WGQ A;  1BSD A;  3IJE B;  2QGU A;  3J7Y d;  4Q53 A;  2FXT A;  2CIU A;  4HM6 B;  1GOU A;  3GZB A;  1YGW A;  1W2B 2;  5I97 A;  5GSP A;  3WA2 X;  3X42 A;  4FMC A;  1TFK A;  3AMO A;  4XDV A;  1EUI C;  2O9U X;  4K1U A;  2OQE A;  1B2Z A;  5KP1 A;  1BUJ A;  1RGE A;  3K9M C;  4FR9 A;  1O7H B;  1UUG B;  2XRX B;  1UUV B;  2KAA A;  1FUT A;  5A0O B;  1DYU A;  2YX9 A;  4MMX B;  3EBY A;  1ZGX A;  4R80 A;  3WOF B;  1RKY A;  3CCV 3;  1RGH A;  4EC6 A;  1NB5 I;  1X1X A;  1EG9 B;  3FF0 A;  3FKA A;  2CKF B;  3JUQ A;  4U13 A;  1GSP A;  1DMN A;  4DKI A;  3D9R A;  4NPB A;  4IT7 A;  1T3B A;  3UL6 A;  2CW9 A;  5CF2 A;  2P38 A;  4O8S A;  1GY7 A;  1AV4 A;  1RN4 A;  1OUN A;  3WA3 A;  3UJM A;  1YIJ 3;  3F8H A;  4HZB B;  8CHO A;  5BXQ A;  1HZ1 A;  1BRJ A;  1JKG B;  4FMA A;  4HOH A;  4EV2 A;  1LOW A;  1CYU A;  3BU4 A;  4EW5 A;  1ULI B;  3LXU X;  1JB2 A;  2E2V A;  3S67 A;  4R4K A;  1BAO A;  1B2U A;  5FGO A;  1I2E A;  3G0K A;  2BHM A;  1MWU A;  1LNI A;  1Q40 B;  2IYJ A;  1JKG A;  1QMA A;  4N6M A;  3SVA A;  1CEW I;  1Q42 A;  1K73 4;  1OF5 B;  3CCJ 3;  3DY5 A;  3K5T A;  1YVB I;  2L4V A;  2V1L A;  1STD A;  3WOD G;  1FW7 A;  5G1L A;  1JN5 B;  4FCJ A;  2XH9 A;  3KE7 A;  3PCR A;  1BU4 A;  1GS3 A;  1KSI A;  3EBT A;  1UW1 A;  3NXJ A;  4XDW A;  1BVI A;  2QA4 3;  4EV5 A;  5IF6 A;  1CH0 A;  1GMP A;  1N5H A;  1I0V A;  1O7W B;  1OF5 A;  2ZL8 A;  4QWT A;  1STF I;  3HZP A;  1RN1 A;  3K7C A;  3CCS 3;  1JN5 A;  4WYK B;  3SLU A;  1M90 4;  3MG2 A;  4K61 A;  2D42 A;  2M7O A;  4XBT A;  4K1V A;  1KQS 2;  3AGO A;  4MMY B;  3KSP A;  4H3U A;  1A2K A;  3CCM 3;  4WYK A;  1GY5 A;  4FCM A;  1FYS A;  3ZFZ A;  1KC8 4;  5EQL A;  1BRN L;  3DM8 A;  2YFI B;  3NHX A;  2XF3 A;  4KFF A;  1UGH I;  2IY2 A;  5IEP A;  1IQX A;  3RNT A;  5CLK A;  1OHO A;  3LT8 A;  3U97 A;  2KXG A;  4AKZ A;  1OAC A;  2HMJ B;  3ALA A;  5AEW B;  1I0X A;  3KZT A;  4N6N B;  3URP A;  4CPK A;  3D79 A;  1N9E A;  2HMO B;  1AVK A;  2HML B;  2P0X A;  3X3Z A;  2OWP A;  3DGL A;  4JF8 A;  1VQP 3;  4RZM A;  3FSD A;  2Z6B A;  1TIJ A;  3CC4 3;  2C10 A;  4NRE A;  3PS8 A;  1BNE A;  1RN7 A;  1RNB A;  2LYX A;  6STD A;  2CH9 A;  1NB3 I;  4I5Q A;  1T5Y A;  3M8C A;  1Q82 4;  2CG0 A;  4RNZ A;  5IG3 A;  2CWV A;  1YIT 3;  4KVH A;  2GBX B;  3EJV A;  3NQZ A;  1JNQ A;  1UCK A;  3CPW 2;  2BMQ B;  2UX0 A;  5G1K A;  5TGN A;  4KT3 B;  1LNH A;  1JZO A;  1BAN A;  2BT3 A;  1BSE A;  1D6U A;  5EEO A;  3K0Z A;  2CFG A;  4LEH A;  3F9S A;  1W00 A;  1RRH A;  1B21 A;  4TX4 A;  5M18 A;  8RNT A;  1AQZ A;  1V58 A;  4HAA A;  3V99 A;  2B24 B;  2K0M A;  1KWI A;  1W5Z A;  3LTB A;  1IVW A;  4WP5 A;  2F5W A;  2OQE C;  3LZA A;  3D5G A;  3AGN A;  1W6Y A;  1VQ5 3;  1NU3 A;  3B4O A;  1MWT A;  1RDS A;  2F99 A;  3NUV A;  2FGT A;  1BRK A;  4GHO A;  4IIA A;  4HJL B;  4HM1 B;  5BIR A;  2IMJ A;  1JB5 A;  2CX0 A;  3S28 A;  2KCD A;  3B4P A;  3UB1 A;  3CCQ 3;  1BGS A;  3LYG A;  1RMS A;  2AAE A;  1IK3 A;  4I4K A;  1LOV A;  2R41 A;  1GMQ A;  5DRV A;  3V92 A;  3CCR 3;  1O7G B;  1FGO A;  2W2C A;  3N9H A;  5AI1 A;  2Y74 A;  3A76 A;  3JUM A;  1MNL A;  4L8P A;  4GL6 A;  6GSP A;  2ML6 A;  4EXR A;  2RBI A;  1W6G A;  3KKG A;  2XFS A;  5KP4 A;  1PU4 A;  3F8X A;  5IG5 A;  2F4Y A;  3MPH A;  1WMO A;  2UUG C;  1TRQ A;  3K63 A;  3EF8 A;  3EHC A;  5RNT A;  1GMR A;  3CPO A;  1HYF A;  3HK4 A;  3FGY A;  1VQO 3;  1YJ9 3;  3H51 A;  1IT7 A;  3LOY A;  1GD4 A;  1ROV A;  4BL2 A;  3FZW A;  2WOH A;  5LC7 A;  2F5M A;  3STD A;  1PYL A;  1C54 A;  3KN4 A;  1OCV A;  3CU3 A;  5LC6 A;  3HI7 A;  1IDP A;  3MG3 A;  4HM5 B;  4LSO A;  2KF5 A;  1U5O A;  2XSO B;  5IG4 A;  1Z1S A;  4BTY A;  3GZR A;  3GZX B;  3FF2 A;  4XBX A;  1I3F A;  1W6C A;  3ECF A;  1LOX A;  1O7P B;  3MSO A;  1W4N A;  4XBY A;  1BRH A;  3L0R A;  3OWY A;  4HM2 B;  2CFD A;  4KFD A;  5CXO A;  3OW2 2;  1HU9 A;  1VQM 3;  5JPP A;  5D82 A;  1K41 A;  4CJN A;  4L7K A;  1DET A;  5D83 A;  2P09 A;  3MYT A;  3UL5 A;  2XSH B;  2IUJ A;  4HZ9 B;  1M1K 4;  1CQS A;  5JBS A;  1K9M 4;  1OH0 A;  4J5K A;  3CNX A;  1BNJ A;  2FNQ A;  1FUS A;  3CC2 3;  1YJN 3;  1G0T A;  3FLJ A;  3FG3 A;  3KFQ C;  3JUO A;  1RGA A;  3IPT A;  5IEN A;  1UCI A;  1D6Y A;  2W0Q A;  3PYJ A;  1GOV A;  1BNS A;  4ZM8 A;  1Q40 A;  1M9G A;  1MGR A;  1G96 A;  1QAK A;  3DGM A;  4N3V A;  1FGQ A;  1F8N A;  4CCV A;  1K8A 4;  1BUQ A;  3WR2 A;  3LTD A;  3F40 A;  4HBR A;  3OX9 A;  1NO3 A;  1FGT A;  3G71 3;  1FGM A;  9RNT A;  3DMC A;  1LQG C;  2KF4 A;  3EN1 B;  5FW5 A;  1S5A A;  1EQK A;  1X1U A;  3GAX A;  3RDE A;  2HMN B;  1UI8 A;  4BTX A;  1ZS7 A;  3WHO A;  4GB5 A;  1A67 A;  1IU7 A;  1NJI 4;  1J2B A;  1I2F A;  3RGR A;  1VQ6 3;  1A90 A;  2GEX A;  2F86 B;  2E2U A;  2OTJ 3;  3F14 A;  1VQQ A;  3NBJ A;  1FA3 A;  1RHL A;  2KF3 A;  3WDG B;  3ROB A;  4R9L A;  2OCT A;  2BNG A;  1IQ8 A;  2RNT A;  3H3H A;  2RGQ A;  4LMI A;  4HM7 B;  4MEI A;  3DXO A;  3X41 A;  1RNT A;  2GU1 A;  1BRI A;  1VQK 3;  3BNB A;  1IYY A;  1JBS A;  1PFP A;  1NNV A;  2WOF A;  3EC9 A;  5DRE A;  1UGI A;  2CWT A;  5BU4 A;  5M19 A;  4WFO A;  1N8R 4;  1MWR A;  2HMK B;  1DMQ A;  4O3V A;  1CYV A;  7STD A;  4FMD A;  3GWR A;  2E2T A;  3GZY B;  3NV0 B;  3SYU A;  1U8C B;  1SII A;  3X3X A;  3G6E 3;  1B27 A;  1A2P A;  3A5E A;  5AIG A;  2SAR A;  1TTO A;  2YFJ B;  3AHW A;  2CFL A;  1VQ8 3;  1SQW A;  2F98 A;  3NV0 A;  5AII A;  2RSX A;  2SBL A;  2K3D A;  2XGN A;  1RCK A;  1FZU A;  2ZDJ A;  4RBN A;  6RNT A;  1DVD A;  1EA2 A;  1R4C A;  1YVS A;  3Q3F A;  1BSA A;  2JDI H;  2CG1 A;  2WO0 A;  4O2H A;  5M1A A;  1I2G A;  1SPU A;  2C4B A;  3NM7 A;  3QRD A;  3LH4 A;  3VSY A;  1X1W A;  4K90 B;  1YJW 3;  2CFK A;  1BNI A;  2C11 A;  2L1S A;  3FCS B;  5JPU A;  1W2Z A;  3N8B A;  5STD A;  4CDL A;  3CD6 3;  2AAD A;  3SOA A;  3AHS A;  3T8N A;  4N6V 0;  3BNC A;  3WOE B;  3LTA A; 
#chains in the Genus database with same CATH homology
 1NDO B;  2W03 A;  3EE1 A;  4J9A A;  3IMA B;  3D3L A;  2JQ5 A;  2CFW A;  3ER7 A;  4OUQ A;  4WHA A;  4O02 B;  3E99 A;  3S29 A;  1LVN A;  1YI2 3;  1ISK A;  1IVU A;  1D6Z A;  4HVN A;  4EBG A;  1DMM A;  1TFO A;  3FG1 A;  5AEU B;  1E97 A;  1NWW A;  1WMN A;  1WTH A;  2Z76 A;  5ELJ A;  3NBR A;  4STD A;  2KRT A;  3PXM A;  3T0U A;  2I9W A;  2XFT A;  3OXA A;  3BB9 A;  2MF7 A;  1IQY A;  3NM2 A;  3U1W A;  3VGN A;  1IV9 A;  3LTC A;  3HX8 A;  4BTW A;  5G2G A;  1WQL B;  2ML5 A;  4IPB A;  1RJO A;  4ORL A;  1ZX2 A;  1Q7Y 4;  3KSE D;  3F7S A;  5D81 A;  1AVL A;  4X2H A;  1JRQ A;  3PZW A;  2CWU A;  1JJ2 2;  4N6U A;  1K28 A;  4WWU C;  1LXE A;  2WGO A;  1WMP A;  2OOV A;  1W02 A;  5AYR B;  4NHF A;  3CMA 3;  2O3O A;  2Z77 A;  1GD3 A;  1OPY A;  2INX A;  1DVC A;  2CK3 H;  3S5C A;  3X3Y A;  1Q86 4;  2BMR B;  1QVF 2;  5KP3 A;  1TUH A;  3EB8 A;  1WNH A;  3CNM A;  3FG4 A;  2STD A;  2D1W A;  4LGQ A;  3FH1 A;  1AR0 A;  2W9P A;  3CC7 3;  3B7C A;  1OGX A;  1QAF A;  3NBB A;  3I56 3;  1JB4 A;  3WMD A;  3CXC 2;  5CK6 A;  1E3V A;  1RRL A;  2RFR A;  3I55 3;  2IUK A;  1ZO2 A;  4KZ1 A;  3CCE 3;  2Y73 A;  1A2V A;  2YFL B;  1TU5 A;  1JV2 B;  2W6J H;  4XB5 A;  3NX0 A;  1N8Q A;  3BNE A;  1N9J A;  2BMO B;  3JUP A;  1IVX A;  1OGZ A;  3G8Z A;  4H61 A;  4JRF A;  4RNY A;  1O7M B;  4N6T A;  1GYB A;  1YHQ 3;  4HM3 B;  1V74 A;  2K54 A;  2P05 A;  1S72 3;  3DUK A;  3EX9 A;  1E3R A;  1UUW B;  5AIH A;  4G1M B;  1OHS A;  1ROA A;  3SX1 A;  2W04 A;  5IER A;  3Q2P A;  2BO9 B;  3TDG A;  1MOL A;  1UI7 A;  2IA7 A;  5AYS C;  3Q90 A;  1HKX A;  1N5P A;  3CME 3;  2W9Q A;  1SIH A;  1IT8 A;  5IG0 A;  3X40 A;  3VF1 A;  2LQV A;  1ULJ B;  3HII A;  5AIF A;  3PCS A;  2HMM B;  1TP6 A;  2Q07 A;  4HM8 B;  1QJG A;  3EQQ B;  2GU3 A;  1GY6 A;  2P0M A;  3NQY A;  4X2O A;  4R9K A;  4HKV B;  3GRD A;  3SED A;  1VQL 3;  1QVG 2;  2PZV A;  2R4I A;  1Q81 4;  2A15 A;  3DGO A;  4N6O B;  2OTL 3;  3QK9 A;  4N6L A;  4KFE A;  1Y4K A;  3SOY A;  4PEJ A;  3BND A;  4HM4 B;  4HYZ A;  1IV7 A;  5BVB A;  5HGR A;  3O8Y A;  2MC8 A;  1VQ4 3;  3G4S 3;  3JUN A;  1FGR A;  1VZZ A;  3LML A;  3JVC A;  4MJD A;  4OVM A;  1VQ9 3;  4AEQ A;  4OK0 A;  2XR8 B;  3MKI A;  2QIY A;  4FMB A;  1M1X B;  4L8O A;  3OWU A;  3G16 A;  2B1X B;  5ELU A;  3DZL A;  3HIG A;  3N54 B;  2CC3 A;  3KII A;  1OHP A;  2XGL A;  1W7C A;  2XEP A;  1EKM A;  2PNC A;  3MHE A;  5IW9 A;  3B8L A;  2W56 B;  5JPP A;  1O7N B;  4FCZ A;  3T8U A;  2OOV C;  3S27 A;  3CCL 3;  1L5G B;  5EVH A;  3UNL A;  4XM4 A;  5IEO A;  1C7H A;  4EYC A;  2QEX 3;  1SJW A;  1US1 A;  1YGE A;  4J8T A;  3V98 A;  3LT9 A;  3CCU 3;  1FUW A;  2W56 A;  2GEY A;  3F7X A;  3RGA A;  1KD1 4;  3SXX A;  3OV4 A;  2CHC A;  2GBW B;  2GXF A;  3EN8 A;  3Q1C A;  3BLZ A;  1QAL A;  3MWZ A;  4R1K A;  2Z7A A;  3PGB A;  4AKY A;  3I0Y A;  1ASK A;  2RCD A;  3OWS A;  1VQ7 3;  3MG1 A;  3AMO B;  4MMZ B;  1IVV A;  1W01 A;  3DGN A;  4HM0 B;  1VQN 3;  5CF1 A;  4LZI A;  2WGQ A;  3IJE B;  2QGU A;  3J7Y d;  4Q53 A;  2FXT A;  2CIU A;  4HM6 B;  3GZB A;  1W2B 2;  5I97 A;  3WA2 X;  3X42 A;  4FMC A;  1TFK A;  3AMO A;  4XDV A;  2O9U X;  4K1U A;  5KP1 A;  2OQE A;  3K9M C;  4FR9 A;  1O7H B;  2XRX B;  1UUV B;  5A0O B;  1DYU A;  2YX9 A;  4MMX B;  3EBY A;  4R80 A;  3WOF B;  1RKY A;  3CCV 3;  4EC6 A;  1NB5 I;  1EG9 B;  3FF0 A;  3FKA A;  2CKF B;  3JUQ A;  4U13 A;  1DMN A;  3D9R A;  4IT7 A;  3UL6 A;  2CW9 A;  5CF2 A;  2P38 A;  4O8S A;  1GY7 A;  1AV4 A;  1OUN A;  3WA3 A;  3UJM A;  1YIJ 3;  3F8H A;  4HZB B;  8CHO A;  5BXQ A;  1JKG B;  4FMA A;  4EV2 A;  1CYU A;  1ULI B;  3LXU X;  1JB2 A;  2E2V A;  3S67 A;  4R4K A;  5FGO A;  3G0K A;  2BHM A;  1Q40 B;  3SVA A;  4N6M A;  1JKG A;  1QMA A;  1CEW I;  1Q42 A;  1K73 4;  1OF5 B;  3CCJ 3;  3DY5 A;  3K5T A;  2L4V A;  2V1L A;  1YVB I;  1STD A;  3WOD G;  1JN5 B;  4FCJ A;  2XH9 A;  3KE7 A;  3PCR A;  1GS3 A;  1KSI A;  3NXJ A;  3EBT A;  1UW1 A;  4XDW A;  2QA4 3;  4EV5 A;  5IF6 A;  1N5H A;  1O7W B;  4QWT A;  1OF5 A;  2ZL8 A;  5CXO A;  1STF I;  3HZP A;  3K7C A;  3CCS 3;  1JN5 A;  4WYK B;  3SLU A;  1M90 4;  3MG2 A;  4K61 A;  2D42 A;  2M7O A;  4XBT A;  4K1V A;  1KQS 2;  4MMY B;  3KSP A;  4H3U A;  1A2K A;  3CCM 3;  4WYK A;  1GY5 A;  4FCM A;  1KC8 4;  5EQL A;  3DM8 A;  2YFI B;  3NHX A;  2XF3 A;  4KFF A;  5IEP A;  1IQX A;  5CLK A;  1OHO A;  3LT8 A;  3U97 A;  2KXG A;  4AKZ A;  1OAC A;  2HMJ B;  3ALA A;  5AEW B;  3KZT A;  4N6N B;  1N9E A;  2HMO B;  1AVK A;  2HML B;  2P0X A;  3X3Z A;  2OWP A;  3DGL A;  4JF8 A;  1VQP 3;  4RZM A;  3FSD A;  2Z6B A;  1TIJ A;  3CC4 3;  2C10 A;  4NRE A;  3PS8 A;  1RN7 A;  2LYX A;  6STD A;  2CH9 A;  1NB3 I;  1T5Y A;  3M8C A;  1Q82 4;  2CG0 A;  4RNZ A;  5IG3 A;  2CWV A;  1YIT 3;  4KVH A;  2GBX B;  3EJV A;  3NQZ A;  1JNQ A;  3CPW 2;  2BMQ B;  2UX0 A;  5TGN A;  1LNH A;  2BT3 A;  1D6U A;  5EEO A;  3K0Z A;  2CFG A;  4LEH A;  3F9S A;  1W00 A;  1RRH A;  4TX4 A;  3V99 A;  2B24 B;  2K0M A;  1KWI A;  1W5Z A;  3LTB A;  1IVW A;  4WP5 A;  2OQE C;  3LZA A;  1W6Y A;  1VQ5 3;  1NU3 A;  3B4O A;  3NUV A;  2F99 A;  2FGT A;  4IIA A;  4HJL B;  4HM1 B;  2IMJ A;  1JB5 A;  3S28 A;  2KCD A;  3B4P A;  3UB1 A;  3CCQ 3;  3LYG A;  1IK3 A;  4I4K A;  3CCR 3;  5DRV A;  3V92 A;  1O7G B;  1FGO A;  2W2C A;  3N9H A;  5AI1 A;  2Y74 A;  3A76 A;  3JUM A;  1MNL A;  4L8P A;  4GL6 A;  2ML6 A;  4EXR A;  3KKG A;  1W6G A;  5KP4 A;  2XFS A;  1PU4 A;  3F8X A;  5IG5 A;  3MPH A;  1WMO A;  3K63 A;  3EF8 A;  3EHC A;  3CPO A;  3HK4 A;  3FGY A;  1VQO 3;  1YJ9 3;  3H51 A;  1IT7 A;  3LOY A;  1GD4 A;  1ROV A;  3FZW A;  2WOH A;  5LC7 A;  3STD A;  3KN4 A;  1OCV A;  3CU3 A;  5LC6 A;  3HI7 A;  1IDP A;  3MG3 A;  4HM5 B;  4LSO A;  1U5O A;  2XSO B;  5IG4 A;  1Z1S A;  4BTY A;  3GZR A;  3GZX B;  3FF2 A;  4XBX A;  1W6C A;  3ECF A;  1LOX A;  1O7P B;  3MSO A;  1W4N A;  4XBY A;  3L0R A;  3OWY A;  4HM2 B;  2CFD A;  4KFD A;  3OW2 2;  1HU9 A;  1VQM 3;  5D82 A;  1K41 A;  4L7K A;  5D83 A;  2P09 A;  3MYT A;  3UL5 A;  2XSH B;  2IUJ A;  4HZ9 B;  1M1K 4;  1CQS A;  5JBS A;  1K9M 4;  1OH0 A;  3CNX A;  2FNQ A;  3CC2 3;  1YJN 3;  3FLJ A;  3FG3 A;  3KFQ C;  3JUO A;  3IPT A;  5IEN A;  1D6Y A;  2W0Q A;  3PYJ A;  4ZM8 A;  1Q40 A;  1M9G A;  1G96 A;  1QAK A;  3DGM A;  4N3V A;  1FGQ A;  1F8N A;  4CCV A;  1K8A 4;  1BUQ A;  3LTD A;  3F40 A;  4HBR A;  3OX9 A;  1NO3 A;  1FGT A;  3G71 3;  1FGM A;  3DMC A;  3EN1 B;  5FW5 A;  1S5A A;  1EQK A;  3GAX A;  3RDE A;  2HMN B;  1UI8 A;  4BTX A;  4GB5 A;  1A67 A;  1IU7 A;  1NJI 4;  1J2B A;  3RGR A;  1VQ6 3;  1A90 A;  2GEX A;  2F86 B;  2E2U A;  2OTJ 3;  3F14 A;  3NBJ A;  1FA3 A;  3WDG B;  3ROB A;  4R9L A;  2OCT A;  2BNG A;  1IQ8 A;  3H3H A;  4LMI A;  2RGQ A;  4MEI A;  4HM7 B;  3DXO A;  3X41 A;  2GU1 A;  1VQK 3;  3BNB A;  1PFP A;  2WOF A;  3EC9 A;  5DRE A;  2CWT A;  4WFO A;  1N8R 4;  2HMK B;  1DMQ A;  4O3V A;  1CYV A;  7STD A;  4FMD A;  3GWR A;  2E2T A;  3GZY B;  3NV0 B;  1U8C B;  1SII A;  3X3X A;  3G6E 3;  5AIG A;  2YFJ B;  2CFL A;  1VQ8 3;  1SQW A;  2F98 A;  3NV0 A;  5AII A;  2RSX A;  2SBL A;  2XGN A;  2ZDJ A;  4RBN A;  1DVD A;  1EA2 A;  1R4C A;  2JDI H;  2CG1 A;  2WO0 A;  4O2H A;  1YJW 3;  1SPU A;  3NM7 A;  3QRD A;  3LH4 A;  3VSY A;  4K90 B;  2CFK A;  2C11 A;  3FCS B;  5JPU A;  1W2Z A;  3N8B A;  5STD A;  4CDL A;  3CD6 3;  3SOA A;  3T8N A;  4N6V 0;  3BNC A;  3WOE B;  3LTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...