1M1K4

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1m1k400
3CCE3 1KQS2 3OW22 1NJI4 1VQK3 1YIJ3 1S723 1K734 2OTL3 1QVF2 2QA43 3CC23 3CC43 3CCM3 1YJN3 1VQ63 3I553 1VQ83 2QEX3 1W2B2 3CXC2 3G6E3 1JJ22 3CMA3 3CCS3 1VQ73 3CC73 1VQL3 3CCL3 1Q814 1YI23 1QVG2 2OTJ3 1M1K4 3CCQ3 1VQM3 1YJ93 3I563 1VQ43 1N8R4 1VQN3 3CCV3 3G4S3 1YIT3 1YJW3 1VQ93 1VQ53 1K9M4 1Q864 3CME3 1Q824 3CCU3 1K8A4 1YHQ3 1KC84 3CCJ3 1KD14 3G713 3CCR3 1M904 1VQP3 1Q7Y4 1VQO3 3CPW2 3CD63
chains in the Genus database with same CATH superfamily
1W00A 3NM7A 1DMQA 2MC8A 1JN5A 5AEUB 4J9AA 5BU4A 4KVHA 1SQWA 3AMOB 5BVBA 2ML6A 1BOXA 2XF3A 3QRDA 3JUQA 1TRQA 1RLSA 1V57A 2UGIA 3X42A 2R41A 4HM3B 3JUNA 1VQQA 5IG0A 3BIRA 2PNCA 3CXC2 3K0ZA 3NBRA 3HI7A 1Y4KA 3AMOA 3PYJA 1ROAA 4U13A 3FF2A 1RGEA 2ZL8A 1RCLA 1WMPA 2F86B 1TJDA 3G4S3 3CCV3 3MHEA 1W4NA 4WP5A 1BUJA 4J8TA 5CXOA 5CK6A 4R9LA 1BIRA 1T3BA 2QIYA 3V99A 1ZX2A 1QAFA 3EF8A 1W7CA 3KIIA 3FSDA 3H51A 1RNBA 1HZ1A 3BLZA 4N6V0 4RZMA 2CWUA 3K5TA 4LSOA 4FCZA 4K1VA 1BNSA 1LNHA 1US1A 1FUWA 1BNEA 1RRLA 3CMA3 3M8CA 3CCS3 3OXAA 2HOHA 2C10A 4MEIA 3UL5A 1GOVA 2YFIB 3UJMA 1RGHA 2P09A 4HM7B 1Q7HA 4BL3A 2P05A 3I563 4HYZA 5IG3A 1B2XA 1FGQA 3X3YA 2XRXB 3F8XA 5M19A 3CME3 2JDIH 3CCJ3 1DMNA 2W56B 2CG1A 2KXGA 1JV2B 4K61A 1JBRA 3BNDA 3FLJA 1KQS2 1JZOA 1W6GA 2RFRA 2H0GA 3AHSA 3DGNA 1VQK3 1VZZA 4HM2B 1TUHA 4FCJA 1LQMB 3VF1A 5EEOA 1JB5A 2KF4A 4XM4A 1JB2A 1C7HA 4QWTA 1FA3A 2RCDA 3A76A 3NV0B 1O7WB 3B4PA 3F14A 1B3SA 1Q40B 2IUKA 4EC6A 5IERA 1QJGA 3MG3A 2W56A 3ZG0A 4I5QA 4I4KA 1M9GA 4J5GA 1WMOA 1LXEA 1BVIA 2C4BA 1KWIA 1RHLA 2GEYA 1DVDA 3L0RA 1CYVA 1NU3A 3EC9A 1VQ43 1MWTA 3NV0A 1W6YA 1Q40A 3LT8A 2YX9A 3OWYA 2WO0A 4JF8A 5ELJA 1KD14 3MG2A 1B2SA 2LYXA 2Z77A 1UCIA 1ULJB 2E2UA 1E3VA 1IVUA 1I0VA 4WHAA 3B4OA 3E99A 1FYSA 4HM8B 3AGNA 5CF2A 1BRHA 4G1MB 1MGWA 1N8QA 1YJN3 2R4IA 5RNTA 5AI1A 3LOYA 1FUTA 2CK3H 3ER7A 4BL2A 2IY2A 1D6ZA 1JBTA 4GSPA 1LQGC 3T8NA 4RNTA 1BRIA 3Q3FA 1Q42A 2KF6A 4N6MA 3LZAA 4CJNA 3F8HA 3LTCA 1K41A 1ULIB 1UW1A 2Y73A 1BRNL 1WMNA 1JKGB 4HJLB 1LOWA 3MWZA 2F99A 1RGKA 2OQEA 3EHCA 7STDA 3FG3A 3PCRA 4HM5B 1FGOA 4MMYB 1M904 5JPPA 1OCVA 4EV5A 3U1WA 1T2IA 1BSAA 1RGCA 2IYJA 2XFTA 2BU4A 2YFJB 2W04A 3DM8A 1ZS7A 1JKGA 2J8XB 5KP1A 1KSIA 1UGIA 2BMRB 3CC23 4Q53A 1Z1SA 3CC43 4FMCA 3EN8A 4RBNA 1E3RA 1IT8A 1A2PA 1K28A 2XH9A 4JRFA 4WWUC 1W6CA 3TDGA 3EBTA 2OOVA 3V98A 3Q1CA 2WOFA 4MJDA 1GYBA 3WMDA 3VSYA 5KP4A 2WOHA 1RCKA 5D83A 4O02B 3DXOA 1TTOA 3NUVA 4R1KA 2INXA 2B24B 2CFKA 2W9QA 2IA7A 3RDEA 1LRAA 3GAXA 2Y74A 3K7CA 1NDOB 1A2KA 3F7XA 3RGAA 2UX0A 2IMJA 1RN4A 2I9WA 1FUSA 1MNLA 3EB8A 3G8ZA 1I8VA 1RJOA 3DMCA 5JBSA 1OACA 3BNBA 1M1XB 3WODG 3SXXA 1QVF2 3NBBA 2HMNB 3SVAA 5I97A 1OH0A 2CFWA 1GY6A 4KFEA 2HMMB 1VQL3 1BNFA 2W6JH 4LYLB 2F56A 3LMLA 2O3OA 3KSPA 1EA2A 1HU9A 1VQM3 5DREA 1ASKA 1IU7A 5FGOA 1N8R4 3HIIA 2QGUA 3WA3A 5IEPA 3KKGA 3PXMA 1GMRA 1Q824 1VQ53 1O7GB 1AY7A 1EUIC 1GY7A 3DUKA 3UB1A 2AADA 4X2HA 1V74A 1YIJ3 1S723 1TFOA 3HK4A 1BNRA 1LOXA 6GSPA 1RDSA 1EKMA 1UUGB 1X1UA 1X1WA 2LQVA 3KE7A 3MG1A 1NO3A 4KZ1A 5AIIA 3T8UA 5IW9A 2CHCA 1I3IA 3LXUX 1VQ83 1JZDA 2L1SA 3VGNA 1A90A 3CPOA 1W2B2 1BSBA 1OHOA 1I0XA 4L8PA 4CPKA 1B21A 1TIJA 2BO9B 1PFPA 2AAEA 3RNTA 1QALA 4EW5A 1TRPA 3CCQ3 3KSED 1JBSA 1N5PA 5AIGA 3X41A 3PZWA 2RGQA 2UUGC 3K9MC 4LZIA 2M7OA 1PY3A 1B2ZA 1IV9A 4RNYA 4HZBB 5STDA 5G1LA 1PU4A 2GBXB 1IDPA 1NB5I 3HOHA 3AGOA 3S67A 3MYTA 2CX0A 4ILFA 3B7CA 2QEX3 3FGYA 2ZHXB 1BSEA 5EQLA 4HM1B 1OGXA 4K1UA 1GOUA 2F5WA 2OCTA 4MMXB 3WOEB 1JJ22 1ZGXA 3S27A 1QMAA 3SOAA 5ELUA 1A67A 3CNXA 3LYGA 3F40A 4HAAA 1UDII 1DVCA 3KN4A 8RNTA 2RBIA 1X1YA 1D6YA 1U8CB 4RNZA 2ZA4A 3JUOA 1LOYA 1VQ93 2K3DA 3NQZA 2HMLB 4BTWA 3NXJA 1W02A 3EQQB 5D81A 1SIIA 1YGEA 3QK9A 1VQP3 1VQO3 1BU4A 1YVSA 3DGMA 3FCSB 3SOYA 1NWWA 1G96A 3ALAA 3FF0A 3G0KA 3MSOA 1RMSA 2Z76A 1BRSA 1WTHA 1S5AA 1B2MA 1GD3A 3S29A 3NM2A 4BTXA 3D3LA 2FNQA 1CYUA 5JPUA 3PGBA 1MWSA 3GZBA 1W5ZA 3GZYB 4WYKB 5AYRB 2BMOB 2WGQA 1B20A 5GSPA 2HMKB 2CWVA 2K0MA 4N6OB 3CCL3 1YNVX 2CW9A 1YI23 1QVG2 4OUQA 3IJEB 2BIRA 1I70A 3CU3A 2E2VA 1I3FA 1STDA 3DGLA 2O9UX 1RN7A 4BU4A 1I2FA 4WYKA 1Q864 4AEQA 4R4KA 2FXTA 2GU1A 4XBYA 4EBGA 1F8NA 1AR0A 3DH2A 1AVKA 1O7NB 2XGNA 4OVMA 3LH4A 1IQXA 2CIUA 4HZ9B 2CFLA 3F9SA 4KT3B 5CLKA 1LOVA 2CWTA 1TP6A 2W0QA 5M1AA 7RNTA 3BNEA 3I553 1OPYA 2HMOB 3JUMA 1FGMA 3IMAB 2Z6BA 1V58A 2GXFA 1IQYA 4AKZA 1FZUA 5IF6A 4K90B 1M1K4 2F98A 1E97A 3D79A 4H61A 3OX9A 1N9EA 1YIT3 1MOLA 4AKYA 4TX4A 4FR9A 2BMQB 3GZRA 1YHQ3 1OHSA 3N9HA 3MKIA 1Q9EA 4IPBA 3CPW2 1ZO2A 1OUNA 1BNIA 1PYLA 2MF7A 3WOFB 3HIGA 3FG1A 2GEXA 4IIAA 4EYCA 2QA43 4KFFA 2GSPA 2XSHB 1RGGA 3GWRA 1VQ63 4WFOA 1IT7A 3BB9A 1UCKA 2F4YA 3DGOA 5AEWB 1RKYA 3MPHA 2GBWB 5KP3A 1SARA 3CNMA 1UCLA 2KAAA 3D5IA 1UI8A 3DY5A 1DMMA 2OTJ3 3PS8A 4O8SA 2V1LA 2BT3A 3FG4A 2RSXA 4XBTA 1YVBI 2KRTA 1RNTA 1IVWA 3S5CA 4N6TA 4OK0A 3I0YA 1IK3A 1BNJA 1R4YA 1K9M4 4O2HA 1UGHI 3T0UA 2CFGA 3CCR3 3UL6A 4KFDA 5G1KA 4GL6A 3ROBA 1CH0A 5DRVA 3CCE3 3V92A 3LTAA 3U97A 1NJI4 1RGFA 1MGRA 1D6UA 2STDA 1I2GA 1MWUA 1X1XA 1EG9B 1CQSA 1BGSA 2KF3A 3Q90A 3DGYA 3PCSA 1W2ZA 4L7KA 1GSPA 1NB3I 1FGRA 3AHWA 4EXRA 1IQ8A 1JRQA 2P0XA 2ZDJA 4EV2A 3F7SA 3NQYA 4CDLA 2RNTA 1FGTA 1GMQA 1MWRA 1SJWA 1IVXA 2P38A 5HOHA 2GU3A 2H0HA 3LTBA 4XDVA 5IG5A 1SIHA 2JQ5A 6STDA 4HM4B 1QAKA 4XB5A 4BIRA 1UUWB 1T2HA 3H3HA 1STFI 1RTUA 3OV4A 3S28A 3HZPA 4HOHA 6RNTA 1GS3A 5M18A 3LTDA 3WDGB 2B1XB 4ZM8A 1HKXA 4GHOA 3G713 1A2VA 3RGRA 2CC3A 3URPA 4HBRA 1AV4A 1FW7A 4HKVB 2W9PA 3JUPA 2OTL3 3FKAA 3IPTA 2XEPA 2H0IA 1OGZA 3GZXB 2SARA 1GD4A 2CG0A 2K54A 1YGWA 1O7PB 4DKIA 1RGAA 3G16A 3G6E3 1LVNA 1SPUA 4STDA 2CFDA 1LNIA 2WGOA 3CC73 1Q814 2A15A 1C54A 4FCMA 1JB4A 3GRDA 4H3UA 5IENA 3KCHA 2D42A 3EX9A 1BSDA 1RSNA 4NPBA 5AIFA 1NNVA 3B8LA 5HGRA 5IEOA 1VQN3 3OWSA 5AIHA 3N8BA 3LT9A 1OHPA 1DE3A 1AVLA 2D1WA 2XGLA 1KC84 1UUVB 3EE1A 4O3VA 1Q7Y4 2IUJA 1TFKA 5CF1A 1OF5B 1I2EA 3JVCA 3D4AA 4HM0B 3CCM3 3WR2A 3D9RA 3ZFZA 2W03A 1HYFA 7GSPA 4LMIA 5TGNA 2SBLA 5LC6A 1BSCA 1BNGA 1OF5A 4FMAA 3NX0A 4L8OA 3A5EA 5BXQA 3N54B 4HVNA 3SX1A 4XBXA 1YJ93 4X2OA 4FMDA 1ISKA 1O7MB 4N6NB 2F5MA 1WQLB 2XSOB 4MMZB 5G2GA 1K8A4 1BANA 1ROVA 3K63A 3KFQC 5IG4A 4CCVA 1TU5A 3OWUA 3CD63 3ZG5A 4R9KA 1BUQA 1K734 3EBYA 3X3XA 4XDWA 4FMBA 3GSPA 3WHOA 3J7Yd 1G02A 1UCJA 2E2TA 1BRGA 1R4CA 2Q07A 1RRHA 1BAOA 3BNCA 2YFLB 3STDA 2FGTA 4N6LA 2PZVA 3EJVA 3BU4A 2XFSA 4LEHA 1N9JA 1VQ73 2KF5A 4GB5A 8CHOA 1RN1A 2OQEC 1JNQA 1IYYA 3HX8A 2L4VA 4IT7A 1U5OA 2OWPA 1DETA 5BIRA 1CEWI 3SEDA 1YJW3 2HMJB 3KZTA 1L5GB 3SLUA 3NHXA 2W2CA 3O8YA 2BHMA 3ECFA 1GY5A 3CCU3 3D5GA 1EQKA 3UNLA 4NHFA 2Z7AA 1WNHA 3OW22 5AYSC 3EN1B 4BTYA 9RNTA 1UI7A 1J2BA 4NREA 3X3ZA 4PEJA 5D82A 5FW5A 1RGLA 4ORLA 2ML5A 4J5KA 1BRJA 1N5HA 1W01A 2P0MA 3DZLA 1T5YA 3FZWA 5LC7A 1B27A 3Q2PA 1BRKA 1IV7A 2OOVC 3X40A 1AQZA 1EEJA 1B2UA 1GMPA 5A0OB 2BNGA 2CX1A 1O7HB 3FH1A 3WA2X 2CKFB 1JN5B 4HM6B 4R80A 2XR8B 4N3VA 1IVVA 2KCDA 1G0TA 2CH9A 1GOYA 3NBJA 3SYUA 4N6UA 2C11A 5EVHA 1DYUA 4LGQA
chains in the Genus database with same CATH topology
1W00A 3NM7A 1DMQA 2MC8A 1JN5A 5AEUB 4J9AA 5BVBA 4KVHA 1SQWA 3AMOB 2ML6A 2XF3A 3QRDA 3JUQA 3X42A 4HM3B 3JUNA 5IG0A 2PNCA 3CXC2 3K0ZA 3NBRA 3HI7A 1Y4KA 3AMOA 3PYJA 1ROAA 4U13A 3FF2A 2ZL8A 1WMPA 2F86B 3CCV3 3G4S3 3MHEA 1W4NA 4WP5A 4J8TA 5CXOA 5CK6A 4R9LA 2QIYA 3V99A 1ZX2A 1QAFA 3EF8A 1W7CA 3KIIA 3FSDA 3H51A 3BLZA 4N6V0 4RZMA 2CWUA 3K5TA 4LSOA 4FCZA 4K1VA 1US1A 1LNHA 1FUWA 1RRLA 3CMA3 3M8CA 3CCS3 3OXAA 2C10A 4MEIA 3UL5A 2YFIB 3UJMA 2P09A 4HM7B 2P05A 3I563 4HYZA 5IG3A 1FGQA 3X3YA 2XRXB 3F8XA 3CME3 2JDIH 3CCJ3 1DMNA 2W56B 2CG1A 2KXGA 1JV2B 4K61A 3BNDA 3FLJA 1KQS2 1W6GA 2RFRA 3DGNA 1VQK3 1VZZA 4HM2B 1TUHA 4FCJA 3VF1A 5EEOA 1JB5A 4XM4A 1JB2A 1C7HA 4QWTA 1FA3A 2RCDA 3A76A 3NV0B 1O7WB 3B4PA 3F14A 1Q40B 2IUKA 4EC6A 5IERA 1QJGA 3MG3A 2W56A 4I4KA 1M9GA 1WMOA 1LXEA 1KWIA 2GEYA 1DVDA 3L0RA 1CYVA 1NU3A 3EC9A 1VQ43 3NV0A 1W6YA 1Q40A 3LT8A 2YX9A 3OWYA 2WO0A 4JF8A 5ELJA 1KD14 3MG2A 2LYXA 2Z77A 1ULJB 2E2UA 1E3VA 1IVUA 4WHAA 3B4OA 3E99A 4HM8B 5CF2A 4G1MB 1YJN3 1N8QA 2R4IA 5AI1A 3LOYA 3ER7A 2CK3H 1D6ZA 3T8NA 1Q42A 4N6MA 3LZAA 3F8HA 3LTCA 1K41A 1ULIB 1UW1A 2Y73A 1WMNA 1JKGB 4HJLB 3MWZA 2F99A 2OQEA 3EHCA 7STDA 3FG3A 3PCRA 4HM5B 1FGOA 4MMYB 1M904 5JPPA 1OCVA 4EV5A 3U1WA 2YFJB 2XFTA 2W04A 3DM8A 1JKGA 5KP1A 1KSIA 2BMRB 3CC23 4Q53A 1Z1SA 3CC43 4FMCA 3EN8A 4RBNA 1E3RA 1IT8A 1K28A 2XH9A 4JRFA 4WWUC 1W6CA 3TDGA 3EBTA 2OOVA 3V98A 3Q1CA 2WOFA 4MJDA 1GYBA 3WMDA 3VSYA 5KP4A 2WOHA 5D83A 4O02B 3DXOA 3NUVA 4R1KA 2INXA 2B24B 2CFKA 2W9QA 2IA7A 3RDEA 3GAXA 2Y74A 3K7CA 1NDOB 1A2KA 3F7XA 3RGAA 2UX0A 2IMJA 2I9WA 1MNLA 3EB8A 3G8ZA 1RJOA 3DMCA 5JBSA 1OACA 3BNBA 1M1XB 3WODG 3SXXA 1QVF2 3NBBA 2HMNB 3SVAA 5I97A 1OH0A 2CFWA 1GY6A 4KFEA 2HMMB 1VQL3 2W6JH 3LMLA 2O3OA 3KSPA 1EA2A 1HU9A 1VQM3 5DREA 1IU7A 1ASKA 5FGOA 1N8R4 3HIIA 2QGUA 3WA3A 5IEPA 3KKGA 3PXMA 1VQ53 1Q824 1O7GB 1GY7A 3DUKA 3UB1A 4X2HA 1V74A 1YIJ3 1S723 1TFOA 3HK4A 1LOXA 3KE7A 1EKMA 2LQVA 4KZ1A 3MG1A 3T8UA 1NO3A 5AIIA 5IW9A 2CHCA 3LXUX 1VQ83 3VGNA 1A90A 3CPOA 1W2B2 1OHOA 4L8PA 1TIJA 2BO9B 1PFPA 1QALA 3CCQ3 3KSED 1N5PA 5AIGA 3X41A 3PZWA 2RGQA 3K9MC 4LZIA 2M7OA 1IV9A 4RNYA 4HZBB 5STDA 1PU4A 2GBXB 1IDPA 1NB5I 3S67A 3MYTA 3B7CA 2QEX3 3FGYA 5EQLA 4HM1B 1OGXA 4K1UA 2OCTA 4MMXB 3WOEB 1JJ22 3S27A 1QMAA 3SOAA 5ELUA 1A67A 3CNXA 3LYGA 3F40A 1DVCA 3KN4A 1D6YA 1U8CB 4RNZA 3JUOA 1VQ93 3NQZA 2HMLB 4BTWA 3NXJA 1W02A 3EQQB 5D81A 1SIIA 1YGEA 3QK9A 1VQP3 1VQO3 3DGMA 3FCSB 3SOYA 1NWWA 1G96A 3ALAA 3FF0A 3G0KA 3MSOA 2Z76A 1WTHA 1S5AA 1GD3A 3S29A 3NM2A 4BTXA 3D3LA 2FNQA 1CYUA 5JPUA 3PGBA 3GZBA 1W5ZA 3GZYB 4WYKB 5AYRB 2BMOB 2WGQA 2HMKB 2CWVA 2K0MA 4N6OB 3CCL3 1YI23 2CW9A 1QVG2 4OUQA 3IJEB 3CU3A 2E2VA 1STDA 3DGLA 2O9UX 1RN7A 4WYKA 1Q864 4AEQA 4R4KA 2FXTA 2GU1A 4XBYA 4EBGA 1F8NA 1AR0A 1AVKA 1O7NB 2XGNA 4OVMA 3LH4A 1IQXA 2CIUA 4HZ9B 2CFLA 3F9SA 5CLKA 2CWTA 1TP6A 2W0QA 3BNEA 3I553 1OPYA 2HMOB 3JUMA 1FGMA 3IMAB 2Z6BA 2GXFA 1IQYA 4AKZA 5IF6A 4K90B 1M1K4 2F98A 1E97A 4H61A 3OX9A 1N9EA 1YIT3 1MOLA 4AKYA 4TX4A 4FR9A 2BMQB 3GZRA 1YHQ3 1OHSA 3N9HA 3MKIA 3CPW2 4IPBA 1ZO2A 1OUNA 2MF7A 3WOFB 3HIGA 3FG1A 2GEXA 4IIAA 4EYCA 2QA43 4KFFA 2XSHB 3GWRA 1VQ63 4WFOA 1IT7A 3BB9A 3DGOA 5AEWB 1RKYA 3MPHA 2GBWB 5KP3A 3CNMA 1UI8A 3DY5A 1DMMA 2OTJ3 3PS8A 4O8SA 2V1LA 2BT3A 3FG4A 2RSXA 4XBTA 1YVBI 2KRTA 1IK3A 1IVWA 3S5CA 4N6TA 4OK0A 3I0YA 1K9M4 4O2HA 3T0UA 2CFGA 3CCR3 3UL6A 4KFDA 4GL6A 3ROBA 5DRVA 3CCE3 3V92A 3LTAA 3U97A 1NJI4 1D6UA 2STDA 1EG9B 1CQSA 3Q90A 4L7KA 3PCSA 1W2ZA 1NB3I 1FGRA 4EXRA 1IQ8A 1JRQA 2P0XA 2ZDJA 4EV2A 3F7SA 3NQYA 4CDLA 1FGTA 1SJWA 5IG5A 1IVXA 2P38A 2GU3A 3LTBA 4XDVA 1SIHA 2JQ5A 6STDA 4HM4B 1QAKA 4XB5A 1UUWB 3H3HA 1STFI 3S28A 3OV4A 3HZPA 1GS3A 3LTDA 3WDGB 2B1XB 4ZM8A 1HKXA 3G713 1A2VA 3RGRA 2CC3A 4HBRA 1AV4A 4HKVB 2W9PA 3JUPA 2OTL3 3FKAA 3IPTA 2XEPA 1OGZA 3GZXB 1GD4A 2CG0A 2K54A 1O7PB 3G16A 3G6E3 1LVNA 1SPUA 4STDA 2CFDA 2WGOA 3CC73 1Q814 2A15A 4FCMA 1JB4A 3GRDA 4H3UA 5IENA 2D42A 3EX9A 5AIFA 3B8LA 5HGRA 5IEOA 1VQN3 3OWSA 5AIHA 3N8BA 3LT9A 1OHPA 1AVLA 2D1WA 2XGLA 1KC84 1UUVB 3EE1A 4O3VA 1Q7Y4 2IUJA 1TFKA 5CF1A 1OF5B 3JVCA 4HM0B 3CCM3 3D9RA 2W03A 4LMIA 5TGNA 2SBLA 5LC6A 1OF5A 4FMAA 3NX0A 4L8OA 5BXQA 3N54B 4HVNA 3SX1A 4XBXA 1YJ93 4X2OA 4FMDA 1ISKA 1O7MB 4N6NB 1WQLB 2XSOB 4MMZB 5G2GA 1K8A4 1ROVA 1TU5A 3K63A 3KFQC 5IG4A 4CCVA 3OWUA 3CD63 4R9KA 1BUQA 1K734 3EBYA 3X3XA 4XDWA 4FMBA 3J7Yd 2E2TA 1R4CA 2Q07A 1RRHA 3BNCA 2YFLB 3STDA 2FGTA 4N6LA 2PZVA 3EJVA 2XFSA 4LEHA 1N9JA 1VQ73 4GB5A 8CHOA 2OQEC 1JNQA 3HX8A 2L4VA 4IT7A 1U5OA 2OWPA 1CEWI 3SEDA 1YJW3 2HMJB 3KZTA 1L5GB 3SLUA 3NHXA 2W2CA 3O8YA 2BHMA 3ECFA 1GY5A 3CCU3 1EQKA 3UNLA 4NHFA 2Z7AA 1WNHA 3OW22 5AYSC 3EN1B 4BTYA 1J2BA 1UI7A 4NREA 3X3ZA 4PEJA 5D82A 5FW5A 4ORLA 2ML5A 1N5HA 1W01A 2P0MA 3DZLA 1T5YA 3FZWA 5LC7A 3Q2PA 1IV7A 2OOVC 3X40A 5A0OB 2BNGA 3WA2X 1O7HB 3FH1A 2CKFB 1JN5B 4HM6B 4R80A 2XR8B 4N3VA 1IVVA 2KCDA 2CH9A 3NBJA 4N6UA 2C11A 5EVHA 1DYUA 4LGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE 3;  1KQS 2;  3OW2 2;  1NJI 4;  1VQK 3;  1YIJ 3;  1S72 3;  1K73 4;  2OTL 3;  1QVF 2;  2QA4 3;  3CC2 3;  3CC4 3;  3CCM 3;  1YJN 3;  1VQ6 3;  3I55 3;  1VQ8 3;  2QEX 3;  1W2B 2;  3CXC 2;  3G6E 3;  1JJ2 2;  3CMA 3;  3CCS 3;  1VQ7 3;  3CC7 3;  1VQL 3;  3CCL 3;  1Q81 4;  1YI2 3;  1QVG 2;  2OTJ 3;  1M1K 4;  3CCQ 3;  1VQM 3;  1YJ9 3;  3I56 3;  1VQ4 3;  1N8R 4;  1VQN 3;  3CCV 3;  3G4S 3;  1YIT 3;  1YJW 3;  1VQ9 3;  1VQ5 3;  1K9M 4;  1Q86 4;  3CME 3;  1Q82 4;  3CCU 3;  1K8A 4;  1YHQ 3;  1KC8 4;  3CCJ 3;  1KD1 4;  3G71 3;  3CCR 3;  1M90 4;  1VQP 3;  1Q7Y 4;  1VQO 3;  3CPW 2;  3CD6 3; 
#chains in the Genus database with same CATH topology
 1W00 A;  3NM7 A;  1DMQ A;  2MC8 A;  1JN5 A;  5AEU B;  4J9A A;  5BU4 A;  4KVH A;  1SQW A;  3AMO B;  5BVB A;  2ML6 A;  1BOX A;  2XF3 A;  3QRD A;  3JUQ A;  1TRQ A;  1RLS A;  1V57 A;  2UGI A;  3X42 A;  2R41 A;  4HM3 B;  3JUN A;  1VQQ A;  5IG0 A;  3BIR A;  2PNC A;  3CXC 2;  3K0Z A;  3NBR A;  3HI7 A;  1Y4K A;  3AMO A;  3PYJ A;  1ROA A;  4U13 A;  3FF2 A;  1RGE A;  2ZL8 A;  1RCL A;  1WMP A;  2F86 B;  1TJD A;  3G4S 3;  3CCV 3;  3MHE A;  1W4N A;  4WP5 A;  1BUJ A;  4J8T A;  5CXO A;  5CK6 A;  4R9L A;  1BIR A;  1T3B A;  2QIY A;  3V99 A;  1ZX2 A;  1QAF A;  3EF8 A;  1W7C A;  3KII A;  3FSD A;  3H51 A;  1RNB A;  1HZ1 A;  3BLZ A;  4N6V 0;  4RZM A;  2CWU A;  3K5T A;  4LSO A;  4FCZ A;  4K1V A;  1BNS A;  1LNH A;  1US1 A;  1FUW A;  1BNE A;  1RRL A;  3CMA 3;  3M8C A;  3CCS 3;  3OXA A;  2HOH A;  2C10 A;  4MEI A;  3UL5 A;  1GOV A;  2YFI B;  3UJM A;  1RGH A;  2P09 A;  4HM7 B;  1Q7H A;  4BL3 A;  2P05 A;  3I56 3;  4HYZ A;  5IG3 A;  1B2X A;  1FGQ A;  3X3Y A;  2XRX B;  3F8X A;  5M19 A;  3CME 3;  2JDI H;  3CCJ 3;  1DMN A;  2W56 B;  2CG1 A;  2KXG A;  1JV2 B;  4K61 A;  1JBR A;  3BND A;  3FLJ A;  1KQS 2;  1JZO A;  1W6G A;  2RFR A;  2H0G A;  3AHS A;  3DGN A;  1VQK 3;  1VZZ A;  4HM2 B;  1TUH A;  4FCJ A;  1LQM B;  3VF1 A;  5EEO A;  1JB5 A;  2KF4 A;  4XM4 A;  1JB2 A;  1C7H A;  4QWT A;  1FA3 A;  2RCD A;  3A76 A;  3NV0 B;  1O7W B;  3B4P A;  3F14 A;  1B3S A;  1Q40 B;  2IUK A;  4EC6 A;  5IER A;  1QJG A;  3MG3 A;  2W56 A;  3ZG0 A;  4I5Q A;  4I4K A;  1M9G A;  4J5G A;  1WMO A;  1LXE A;  1BVI A;  2C4B A;  1KWI A;  1RHL A;  2GEY A;  1DVD A;  3L0R A;  1CYV A;  1NU3 A;  3EC9 A;  1VQ4 3;  1MWT A;  3NV0 A;  1W6Y A;  1Q40 A;  3LT8 A;  2YX9 A;  3OWY A;  2WO0 A;  4JF8 A;  5ELJ A;  1KD1 4;  3MG2 A;  1B2S A;  2LYX A;  2Z77 A;  1UCI A;  1ULJ B;  2E2U A;  1E3V A;  1IVU A;  1I0V A;  4WHA A;  3B4O A;  3E99 A;  1FYS A;  4HM8 B;  3AGN A;  5CF2 A;  1BRH A;  4G1M B;  1MGW A;  1N8Q A;  1YJN 3;  2R4I A;  5RNT A;  5AI1 A;  3LOY A;  1FUT A;  2CK3 H;  3ER7 A;  4BL2 A;  2IY2 A;  1D6Z A;  1JBT A;  4GSP A;  1LQG C;  3T8N A;  4RNT A;  1BRI A;  3Q3F A;  1Q42 A;  2KF6 A;  4N6M A;  3LZA A;  4CJN A;  3F8H A;  3LTC A;  1K41 A;  1ULI B;  1UW1 A;  2Y73 A;  1BRN L;  1WMN A;  1JKG B;  4HJL B;  1LOW A;  3MWZ A;  2F99 A;  1RGK A;  2OQE A;  3EHC A;  7STD A;  3FG3 A;  3PCR A;  4HM5 B;  1FGO A;  4MMY B;  1M90 4;  5JPP A;  1OCV A;  4EV5 A;  3U1W A;  1T2I A;  1BSA A;  1RGC A;  2IYJ A;  2XFT A;  2BU4 A;  2YFJ B;  2W04 A;  3DM8 A;  1ZS7 A;  1JKG A;  2J8X B;  5KP1 A;  1KSI A;  1UGI A;  2BMR B;  3CC2 3;  4Q53 A;  1Z1S A;  3CC4 3;  4FMC A;  3EN8 A;  4RBN A;  1E3R A;  1IT8 A;  1A2P A;  1K28 A;  2XH9 A;  4JRF A;  4WWU C;  1W6C A;  3TDG A;  3EBT A;  2OOV A;  3V98 A;  3Q1C A;  2WOF A;  4MJD A;  1GYB A;  3WMD A;  3VSY A;  5KP4 A;  2WOH A;  1RCK A;  5D83 A;  4O02 B;  3DXO A;  1TTO A;  3NUV A;  4R1K A;  2INX A;  2B24 B;  2CFK A;  2W9Q A;  2IA7 A;  3RDE A;  1LRA A;  3GAX A;  2Y74 A;  3K7C A;  1NDO B;  1A2K A;  3F7X A;  3RGA A;  2UX0 A;  2IMJ A;  1RN4 A;  2I9W A;  1FUS A;  1MNL A;  3EB8 A;  3G8Z A;  1I8V A;  1RJO A;  3DMC A;  5JBS A;  1OAC A;  3BNB A;  1M1X B;  3WOD G;  3SXX A;  1QVF 2;  3NBB A;  2HMN B;  3SVA A;  5I97 A;  1OH0 A;  2CFW A;  1GY6 A;  4KFE A;  2HMM B;  1VQL 3;  1BNF A;  2W6J H;  4LYL B;  2F56 A;  3LML A;  2O3O A;  3KSP A;  1EA2 A;  1HU9 A;  1VQM 3;  5DRE A;  1ASK A;  1IU7 A;  5FGO A;  1N8R 4;  3HII A;  2QGU A;  3WA3 A;  5IEP A;  3KKG A;  3PXM A;  1GMR A;  1Q82 4;  1VQ5 3;  1O7G B;  1AY7 A;  1EUI C;  1GY7 A;  3DUK A;  3UB1 A;  2AAD A;  4X2H A;  1V74 A;  1YIJ 3;  1S72 3;  1TFO A;  3HK4 A;  1BNR A;  1LOX A;  6GSP A;  1RDS A;  1EKM A;  1UUG B;  1X1U A;  1X1W A;  2LQV A;  3KE7 A;  3MG1 A;  1NO3 A;  4KZ1 A;  5AII A;  3T8U A;  5IW9 A;  2CHC A;  1I3I A;  3LXU X;  1VQ8 3;  1JZD A;  2L1S A;  3VGN A;  1A90 A;  3CPO A;  1W2B 2;  1BSB A;  1OHO A;  1I0X A;  4L8P A;  4CPK A;  1B21 A;  1TIJ A;  2BO9 B;  1PFP A;  2AAE A;  3RNT A;  1QAL A;  4EW5 A;  1TRP A;  3CCQ 3;  3KSE D;  1JBS A;  1N5P A;  5AIG A;  3X41 A;  3PZW A;  2RGQ A;  2UUG C;  3K9M C;  4LZI A;  2M7O A;  1PY3 A;  1B2Z A;  1IV9 A;  4RNY A;  4HZB B;  5STD A;  5G1L A;  1PU4 A;  2GBX B;  1IDP A;  1NB5 I;  3HOH A;  3AGO A;  3S67 A;  3MYT A;  2CX0 A;  4ILF A;  3B7C A;  2QEX 3;  3FGY A;  2ZHX B;  1BSE A;  5EQL A;  4HM1 B;  1OGX A;  4K1U A;  1GOU A;  2F5W A;  2OCT A;  4MMX B;  3WOE B;  1JJ2 2;  1ZGX A;  3S27 A;  1QMA A;  3SOA A;  5ELU A;  1A67 A;  3CNX A;  3LYG A;  3F40 A;  4HAA A;  1UDI I;  1DVC A;  3KN4 A;  8RNT A;  2RBI A;  1X1Y A;  1D6Y A;  1U8C B;  4RNZ A;  2ZA4 A;  3JUO A;  1LOY A;  1VQ9 3;  2K3D A;  3NQZ A;  2HML B;  4BTW A;  3NXJ A;  1W02 A;  3EQQ B;  5D81 A;  1SII A;  1YGE A;  3QK9 A;  1VQP 3;  1VQO 3;  1BU4 A;  1YVS A;  3DGM A;  3FCS B;  3SOY A;  1NWW A;  1G96 A;  3ALA A;  3FF0 A;  3G0K A;  3MSO A;  1RMS A;  2Z76 A;  1BRS A;  1WTH A;  1S5A A;  1B2M A;  1GD3 A;  3S29 A;  3NM2 A;  4BTX A;  3D3L A;  2FNQ A;  1CYU A;  5JPU A;  3PGB A;  1MWS A;  3GZB A;  1W5Z A;  3GZY B;  4WYK B;  5AYR B;  2BMO B;  2WGQ A;  1B20 A;  5GSP A;  2HMK B;  2CWV A;  2K0M A;  4N6O B;  3CCL 3;  1YNV X;  2CW9 A;  1YI2 3;  1QVG 2;  4OUQ A;  3IJE B;  2BIR A;  1I70 A;  3CU3 A;  2E2V A;  1I3F A;  1STD A;  3DGL A;  2O9U X;  1RN7 A;  4BU4 A;  1I2F A;  4WYK A;  1Q86 4;  4AEQ A;  4R4K A;  2FXT A;  2GU1 A;  4XBY A;  4EBG A;  1F8N A;  1AR0 A;  3DH2 A;  1AVK A;  1O7N B;  2XGN A;  4OVM A;  3LH4 A;  1IQX A;  2CIU A;  4HZ9 B;  2CFL A;  3F9S A;  4KT3 B;  5CLK A;  1LOV A;  2CWT A;  1TP6 A;  2W0Q A;  5M1A A;  7RNT A;  3BNE A;  3I55 3;  1OPY A;  2HMO B;  3JUM A;  1FGM A;  3IMA B;  2Z6B A;  1V58 A;  2GXF A;  1IQY A;  4AKZ A;  1FZU A;  5IF6 A;  4K90 B;  1M1K 4;  2F98 A;  1E97 A;  3D79 A;  4H61 A;  3OX9 A;  1N9E A;  1YIT 3;  1MOL A;  4AKY A;  4TX4 A;  4FR9 A;  2BMQ B;  3GZR A;  1YHQ 3;  1OHS A;  3N9H A;  3MKI A;  1Q9E A;  4IPB A;  3CPW 2;  1ZO2 A;  1OUN A;  1BNI A;  1PYL A;  2MF7 A;  3WOF B;  3HIG A;  3FG1 A;  2GEX A;  4IIA A;  4EYC A;  2QA4 3;  4KFF A;  2GSP A;  2XSH B;  1RGG A;  3GWR A;  1VQ6 3;  4WFO A;  1IT7 A;  3BB9 A;  1UCK A;  2F4Y A;  3DGO A;  5AEW B;  1RKY A;  3MPH A;  2GBW B;  5KP3 A;  1SAR A;  3CNM A;  1UCL A;  2KAA A;  3D5I A;  1UI8 A;  3DY5 A;  1DMM A;  2OTJ 3;  3PS8 A;  4O8S A;  2V1L A;  2BT3 A;  3FG4 A;  2RSX A;  4XBT A;  1YVB I;  2KRT A;  1RNT A;  1IVW A;  3S5C A;  4N6T A;  4OK0 A;  3I0Y A;  1IK3 A;  1BNJ A;  1R4Y A;  1K9M 4;  4O2H A;  1UGH I;  3T0U A;  2CFG A;  3CCR 3;  3UL6 A;  4KFD A;  5G1K A;  4GL6 A;  3ROB A;  1CH0 A;  5DRV A;  3CCE 3;  3V92 A;  3LTA A;  3U97 A;  1NJI 4;  1RGF A;  1MGR A;  1D6U A;  2STD A;  1I2G A;  1MWU A;  1X1X A;  1EG9 B;  1CQS A;  1BGS A;  2KF3 A;  3Q90 A;  3DGY A;  3PCS A;  1W2Z A;  4L7K A;  1GSP A;  1NB3 I;  1FGR A;  3AHW A;  4EXR A;  1IQ8 A;  1JRQ A;  2P0X A;  2ZDJ A;  4EV2 A;  3F7S A;  3NQY A;  4CDL A;  2RNT A;  1FGT A;  1GMQ A;  1MWR A;  1SJW A;  1IVX A;  2P38 A;  5HOH A;  2GU3 A;  2H0H A;  3LTB A;  4XDV A;  5IG5 A;  1SIH A;  2JQ5 A;  6STD A;  4HM4 B;  1QAK A;  4XB5 A;  4BIR A;  1UUW B;  1T2H A;  3H3H A;  1STF I;  1RTU A;  3OV4 A;  3S28 A;  3HZP A;  4HOH A;  6RNT A;  1GS3 A;  5M18 A;  3LTD A;  3WDG B;  2B1X B;  4ZM8 A;  1HKX A;  4GHO A;  3G71 3;  1A2V A;  3RGR A;  2CC3 A;  3URP A;  4HBR A;  1AV4 A;  1FW7 A;  4HKV B;  2W9P A;  3JUP A;  2OTL 3;  3FKA A;  3IPT A;  2XEP A;  2H0I A;  1OGZ A;  3GZX B;  2SAR A;  1GD4 A;  2CG0 A;  2K54 A;  1YGW A;  1O7P B;  4DKI A;  1RGA A;  3G16 A;  3G6E 3;  1LVN A;  1SPU A;  4STD A;  2CFD A;  1LNI A;  2WGO A;  3CC7 3;  1Q81 4;  2A15 A;  1C54 A;  4FCM A;  1JB4 A;  3GRD A;  4H3U A;  5IEN A;  3KCH A;  2D42 A;  3EX9 A;  1BSD A;  1RSN A;  4NPB A;  5AIF A;  1NNV A;  3B8L A;  5HGR A;  5IEO A;  1VQN 3;  3OWS A;  5AIH A;  3N8B A;  3LT9 A;  1OHP A;  1DE3 A;  1AVL A;  2D1W A;  2XGL A;  1KC8 4;  1UUV B;  3EE1 A;  4O3V A;  1Q7Y 4;  2IUJ A;  1TFK A;  5CF1 A;  1OF5 B;  1I2E A;  3JVC A;  3D4A A;  4HM0 B;  3CCM 3;  3WR2 A;  3D9R A;  3ZFZ A;  2W03 A;  1HYF A;  7GSP A;  4LMI A;  5TGN A;  2SBL A;  5LC6 A;  1BSC A;  1BNG A;  1OF5 A;  4FMA A;  3NX0 A;  4L8O A;  3A5E A;  5BXQ A;  3N54 B;  4HVN A;  3SX1 A;  4XBX A;  1YJ9 3;  4X2O A;  4FMD A;  1ISK A;  1O7M B;  4N6N B;  2F5M A;  1WQL B;  2XSO B;  4MMZ B;  5G2G A;  1K8A 4;  1BAN A;  1ROV A;  3K63 A;  3KFQ C;  5IG4 A;  4CCV A;  1TU5 A;  3OWU A;  3CD6 3;  3ZG5 A;  4R9K A;  1BUQ A;  1K73 4;  3EBY A;  3X3X A;  4XDW A;  4FMB A;  3GSP A;  3WHO A;  3J7Y d;  1G02 A;  1UCJ A;  2E2T A;  1BRG A;  1R4C A;  2Q07 A;  1RRH A;  1BAO A;  3BNC A;  2YFL B;  3STD A;  2FGT A;  4N6L A;  2PZV A;  3EJV A;  3BU4 A;  2XFS A;  4LEH A;  1N9J A;  1VQ7 3;  2KF5 A;  4GB5 A;  8CHO A;  1RN1 A;  2OQE C;  1JNQ A;  1IYY A;  3HX8 A;  2L4V A;  4IT7 A;  1U5O A;  2OWP A;  1DET A;  5BIR A;  1CEW I;  3SED A;  1YJW 3;  2HMJ B;  3KZT A;  1L5G B;  3SLU A;  3NHX A;  2W2C A;  3O8Y A;  2BHM A;  3ECF A;  1GY5 A;  3CCU 3;  3D5G A;  1EQK A;  3UNL A;  4NHF A;  2Z7A A;  1WNH A;  3OW2 2;  5AYS C;  3EN1 B;  4BTY A;  9RNT A;  1UI7 A;  1J2B A;  4NRE A;  3X3Z A;  4PEJ A;  5D82 A;  5FW5 A;  1RGL A;  4ORL A;  2ML5 A;  4J5K A;  1BRJ A;  1N5H A;  1W01 A;  2P0M A;  3DZL A;  1T5Y A;  3FZW A;  5LC7 A;  1B27 A;  3Q2P A;  1BRK A;  1IV7 A;  2OOV C;  3X40 A;  1AQZ A;  1EEJ A;  1B2U A;  1GMP A;  5A0O B;  2BNG A;  2CX1 A;  1O7H B;  3FH1 A;  3WA2 X;  2CKF B;  1JN5 B;  4HM6 B;  4R80 A;  2XR8 B;  4N3V A;  1IVV A;  2KCD A;  1G0T A;  2CH9 A;  1GOY A;  3NBJ A;  3SYU A;  4N6U A;  2C11 A;  5EVH A;  1DYU A;  4LGQ A; 
#chains in the Genus database with same CATH homology
 1W00 A;  3NM7 A;  1DMQ A;  2MC8 A;  1JN5 A;  5AEU B;  4J9A A;  5BVB A;  4KVH A;  1SQW A;  3AMO B;  2ML6 A;  2XF3 A;  3QRD A;  3JUQ A;  3X42 A;  4HM3 B;  3JUN A;  5IG0 A;  2PNC A;  3CXC 2;  3K0Z A;  3NBR A;  3HI7 A;  1Y4K A;  3AMO A;  3PYJ A;  1ROA A;  4U13 A;  3FF2 A;  2ZL8 A;  1WMP A;  2F86 B;  3CCV 3;  3G4S 3;  3MHE A;  1W4N A;  4WP5 A;  4J8T A;  5CXO A;  5CK6 A;  4R9L A;  2QIY A;  3V99 A;  1ZX2 A;  1QAF A;  3EF8 A;  1W7C A;  3KII A;  3FSD A;  3H51 A;  3BLZ A;  4N6V 0;  4RZM A;  2CWU A;  3K5T A;  4LSO A;  4FCZ A;  4K1V A;  1US1 A;  1LNH A;  1FUW A;  1RRL A;  3CMA 3;  3M8C A;  3CCS 3;  3OXA A;  2C10 A;  4MEI A;  3UL5 A;  2YFI B;  3UJM A;  2P09 A;  4HM7 B;  2P05 A;  3I56 3;  4HYZ A;  5IG3 A;  1FGQ A;  3X3Y A;  2XRX B;  3F8X A;  3CME 3;  2JDI H;  3CCJ 3;  1DMN A;  2W56 B;  2CG1 A;  2KXG A;  1JV2 B;  4K61 A;  3BND A;  3FLJ A;  1KQS 2;  1W6G A;  2RFR A;  3DGN A;  1VQK 3;  1VZZ A;  4HM2 B;  1TUH A;  4FCJ A;  3VF1 A;  5EEO A;  1JB5 A;  4XM4 A;  1JB2 A;  1C7H A;  4QWT A;  1FA3 A;  2RCD A;  3A76 A;  3NV0 B;  1O7W B;  3B4P A;  3F14 A;  1Q40 B;  2IUK A;  4EC6 A;  5IER A;  1QJG A;  3MG3 A;  2W56 A;  4I4K A;  1M9G A;  1WMO A;  1LXE A;  1KWI A;  2GEY A;  1DVD A;  3L0R A;  1CYV A;  1NU3 A;  3EC9 A;  1VQ4 3;  3NV0 A;  1W6Y A;  1Q40 A;  3LT8 A;  2YX9 A;  3OWY A;  2WO0 A;  4JF8 A;  5ELJ A;  1KD1 4;  3MG2 A;  2LYX A;  2Z77 A;  1ULJ B;  2E2U A;  1E3V A;  1IVU A;  4WHA A;  3B4O A;  3E99 A;  4HM8 B;  5CF2 A;  4G1M B;  1YJN 3;  1N8Q A;  2R4I A;  5AI1 A;  3LOY A;  3ER7 A;  2CK3 H;  1D6Z A;  3T8N A;  1Q42 A;  4N6M A;  3LZA A;  3F8H A;  3LTC A;  1K41 A;  1ULI B;  1UW1 A;  2Y73 A;  1WMN A;  1JKG B;  4HJL B;  3MWZ A;  2F99 A;  2OQE A;  3EHC A;  7STD A;  3FG3 A;  3PCR A;  4HM5 B;  1FGO A;  4MMY B;  1M90 4;  5JPP A;  1OCV A;  4EV5 A;  3U1W A;  2YFJ B;  2XFT A;  2W04 A;  3DM8 A;  1JKG A;  5KP1 A;  1KSI A;  2BMR B;  3CC2 3;  4Q53 A;  1Z1S A;  3CC4 3;  4FMC A;  3EN8 A;  4RBN A;  1E3R A;  1IT8 A;  1K28 A;  2XH9 A;  4JRF A;  4WWU C;  1W6C A;  3TDG A;  3EBT A;  2OOV A;  3V98 A;  3Q1C A;  2WOF A;  4MJD A;  1GYB A;  3WMD A;  3VSY A;  5KP4 A;  2WOH A;  5D83 A;  4O02 B;  3DXO A;  3NUV A;  4R1K A;  2INX A;  2B24 B;  2CFK A;  2W9Q A;  2IA7 A;  3RDE A;  3GAX A;  2Y74 A;  3K7C A;  1NDO B;  1A2K A;  3F7X A;  3RGA A;  2UX0 A;  2IMJ A;  2I9W A;  1MNL A;  3EB8 A;  3G8Z A;  1RJO A;  3DMC A;  5JBS A;  1OAC A;  3BNB A;  1M1X B;  3WOD G;  3SXX A;  1QVF 2;  3NBB A;  2HMN B;  3SVA A;  5I97 A;  1OH0 A;  2CFW A;  1GY6 A;  4KFE A;  2HMM B;  1VQL 3;  2W6J H;  3LML A;  2O3O A;  3KSP A;  1EA2 A;  1HU9 A;  1VQM 3;  5DRE A;  1IU7 A;  1ASK A;  5FGO A;  1N8R 4;  3HII A;  2QGU A;  3WA3 A;  5IEP A;  3KKG A;  3PXM A;  1VQ5 3;  1Q82 4;  1O7G B;  1GY7 A;  3DUK A;  3UB1 A;  4X2H A;  1V74 A;  1YIJ 3;  1S72 3;  1TFO A;  3HK4 A;  1LOX A;  3KE7 A;  1EKM A;  2LQV A;  4KZ1 A;  3MG1 A;  3T8U A;  1NO3 A;  5AII A;  5IW9 A;  2CHC A;  3LXU X;  1VQ8 3;  3VGN A;  1A90 A;  3CPO A;  1W2B 2;  1OHO A;  4L8P A;  1TIJ A;  2BO9 B;  1PFP A;  1QAL A;  3CCQ 3;  3KSE D;  1N5P A;  5AIG A;  3X41 A;  3PZW A;  2RGQ A;  3K9M C;  4LZI A;  2M7O A;  1IV9 A;  4RNY A;  4HZB B;  5STD A;  1PU4 A;  2GBX B;  1IDP A;  1NB5 I;  3S67 A;  3MYT A;  3B7C A;  2QEX 3;  3FGY A;  5EQL A;  4HM1 B;  1OGX A;  4K1U A;  2OCT A;  4MMX B;  3WOE B;  1JJ2 2;  3S27 A;  1QMA A;  3SOA A;  5ELU A;  1A67 A;  3CNX A;  3LYG A;  3F40 A;  1DVC A;  3KN4 A;  1D6Y A;  1U8C B;  4RNZ A;  3JUO A;  1VQ9 3;  3NQZ A;  2HML B;  4BTW A;  3NXJ A;  1W02 A;  3EQQ B;  5D81 A;  1SII A;  1YGE A;  3QK9 A;  1VQP 3;  1VQO 3;  3DGM A;  3FCS B;  3SOY A;  1NWW A;  1G96 A;  3ALA A;  3FF0 A;  3G0K A;  3MSO A;  2Z76 A;  1WTH A;  1S5A A;  1GD3 A;  3S29 A;  3NM2 A;  4BTX A;  3D3L A;  2FNQ A;  1CYU A;  5JPU A;  3PGB A;  3GZB A;  1W5Z A;  3GZY B;  4WYK B;  5AYR B;  2BMO B;  2WGQ A;  2HMK B;  2CWV A;  2K0M A;  4N6O B;  3CCL 3;  1YI2 3;  2CW9 A;  1QVG 2;  4OUQ A;  3IJE B;  3CU3 A;  2E2V A;  1STD A;  3DGL A;  2O9U X;  1RN7 A;  4WYK A;  1Q86 4;  4AEQ A;  4R4K A;  2FXT A;  2GU1 A;  4XBY A;  4EBG A;  1F8N A;  1AR0 A;  1AVK A;  1O7N B;  2XGN A;  4OVM A;  3LH4 A;  1IQX A;  2CIU A;  4HZ9 B;  2CFL A;  3F9S A;  5CLK A;  2CWT A;  1TP6 A;  2W0Q A;  3BNE A;  3I55 3;  1OPY A;  2HMO B;  3JUM A;  1FGM A;  3IMA B;  2Z6B A;  2GXF A;  1IQY A;  4AKZ A;  5IF6 A;  4K90 B;  1M1K 4;  2F98 A;  1E97 A;  4H61 A;  3OX9 A;  1N9E A;  1YIT 3;  1MOL A;  4AKY A;  4TX4 A;  4FR9 A;  2BMQ B;  3GZR A;  1YHQ 3;  1OHS A;  3N9H A;  3MKI A;  3CPW 2;  4IPB A;  1ZO2 A;  1OUN A;  2MF7 A;  3WOF B;  3HIG A;  3FG1 A;  2GEX A;  4IIA A;  4EYC A;  2QA4 3;  4KFF A;  2XSH B;  3GWR A;  1VQ6 3;  4WFO A;  1IT7 A;  3BB9 A;  3DGO A;  5AEW B;  1RKY A;  3MPH A;  2GBW B;  5KP3 A;  3CNM A;  1UI8 A;  3DY5 A;  1DMM A;  2OTJ 3;  3PS8 A;  4O8S A;  2V1L A;  2BT3 A;  3FG4 A;  2RSX A;  4XBT A;  1YVB I;  2KRT A;  1IK3 A;  1IVW A;  3S5C A;  4N6T A;  4OK0 A;  3I0Y A;  1K9M 4;  4O2H A;  3T0U A;  2CFG A;  3CCR 3;  3UL6 A;  4KFD A;  4GL6 A;  3ROB A;  5DRV A;  3CCE 3;  3V92 A;  3LTA A;  3U97 A;  1NJI 4;  1D6U A;  2STD A;  1EG9 B;  1CQS A;  3Q90 A;  4L7K A;  3PCS A;  1W2Z A;  1NB3 I;  1FGR A;  4EXR A;  1IQ8 A;  1JRQ A;  2P0X A;  2ZDJ A;  4EV2 A;  3F7S A;  3NQY A;  4CDL A;  1FGT A;  1SJW A;  5IG5 A;  1IVX A;  2P38 A;  2GU3 A;  3LTB A;  4XDV A;  1SIH A;  2JQ5 A;  6STD A;  4HM4 B;  1QAK A;  4XB5 A;  1UUW B;  3H3H A;  1STF I;  3S28 A;  3OV4 A;  3HZP A;  1GS3 A;  3LTD A;  3WDG B;  2B1X B;  4ZM8 A;  1HKX A;  3G71 3;  1A2V A;  3RGR A;  2CC3 A;  4HBR A;  1AV4 A;  4HKV B;  2W9P A;  3JUP A;  2OTL 3;  3FKA A;  3IPT A;  2XEP A;  1OGZ A;  3GZX B;  1GD4 A;  2CG0 A;  2K54 A;  1O7P B;  3G16 A;  3G6E 3;  1LVN A;  1SPU A;  4STD A;  2CFD A;  2WGO A;  3CC7 3;  1Q81 4;  2A15 A;  4FCM A;  1JB4 A;  3GRD A;  4H3U A;  5IEN A;  2D42 A;  3EX9 A;  5AIF A;  3B8L A;  5HGR A;  5IEO A;  1VQN 3;  3OWS A;  5AIH A;  3N8B A;  3LT9 A;  1OHP A;  1AVL A;  2D1W A;  2XGL A;  1KC8 4;  1UUV B;  3EE1 A;  4O3V A;  1Q7Y 4;  2IUJ A;  1TFK A;  5CF1 A;  1OF5 B;  3JVC A;  4HM0 B;  3CCM 3;  3D9R A;  2W03 A;  4LMI A;  5TGN A;  2SBL A;  5LC6 A;  1OF5 A;  4FMA A;  3NX0 A;  4L8O A;  5BXQ A;  3N54 B;  4HVN A;  3SX1 A;  4XBX A;  1YJ9 3;  4X2O A;  4FMD A;  1ISK A;  1O7M B;  4N6N B;  1WQL B;  2XSO B;  4MMZ B;  5G2G A;  1K8A 4;  1ROV A;  1TU5 A;  3K63 A;  3KFQ C;  5IG4 A;  4CCV A;  3OWU A;  3CD6 3;  4R9K A;  1BUQ A;  1K73 4;  3EBY A;  3X3X A;  4XDW A;  4FMB A;  3J7Y d;  2E2T A;  1R4C A;  2Q07 A;  1RRH A;  3BNC A;  2YFL B;  3STD A;  2FGT A;  4N6L A;  2PZV A;  3EJV A;  2XFS A;  4LEH A;  1N9J A;  1VQ7 3;  4GB5 A;  8CHO A;  2OQE C;  1JNQ A;  3HX8 A;  2L4V A;  4IT7 A;  1U5O A;  2OWP A;  1CEW I;  3SED A;  1YJW 3;  2HMJ B;  3KZT A;  1L5G B;  3SLU A;  3NHX A;  2W2C A;  3O8Y A;  2BHM A;  3ECF A;  1GY5 A;  3CCU 3;  1EQK A;  3UNL A;  4NHF A;  2Z7A A;  1WNH A;  3OW2 2;  5AYS C;  3EN1 B;  4BTY A;  1J2B A;  1UI7 A;  4NRE A;  3X3Z A;  4PEJ A;  5D82 A;  5FW5 A;  4ORL A;  2ML5 A;  1N5H A;  1W01 A;  2P0M A;  3DZL A;  1T5Y A;  3FZW A;  5LC7 A;  3Q2P A;  1IV7 A;  2OOV C;  3X40 A;  5A0O B;  2BNG A;  3WA2 X;  1O7H B;  3FH1 A;  2CKF B;  1JN5 B;  4HM6 B;  4R80 A;  2XR8 B;  4N3V A;  1IVV A;  2KCD A;  2CH9 A;  3NBJ A;  4N6U A;  2C11 A;  5EVH A;  1DYU A;  4LGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...