1M1K4

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1m1k400
3I563 1M1K4 1NJI4 1KQS2 1VQ43 3CCM3 3CD63 1VQ53 3CME3 1K734 3G713 1K8A4 3CCU3 1YIJ3 1YJW3 1JJ22 1YHQ3 3CCQ3 3CC43 1Q864 1VQ73 1YJN3 2QEX3 1Q814 1Q824 1VQL3 2QA43 1KD14 1VQ93 3CCE3 1VQN3 1K9M4 3CXC2 3CC23 3CMA3 1KC84 2OTL3 3CCL3 1N8R4 1M904 1VQM3 3OW22 1YJ93 1QVG2 1W2B2 1VQ83 3CCJ3 1VQO3 1VQ63 3G6E3 1YIT3 3CC73 3G4S3 1QVF2 3I553 1S723 3CPW2 3CCR3 1VQK3 1Q7Y4 1YI23 1VQP3 3CCV3 3CCS3 2OTJ3
chains in the Genus database with same CATH superfamily
1AVKA 3I0YA 1STDA 3EBTA 4EYCA 1E3VA 2A15A 3HOHA 5DREA 1JBSA 1SQWA 2E2VA 1WMOA 3DXOA 2KRTA 1QAFA 4O3VA 2CX1A 3MG3A 2KAAA 2RNTA 3IMAB 1FGOA 1T2IA 1A90A 5JPPA 4O02B 3X3YA 1W7CA 3F8HA 2K0MA 1MWTA 2AAEA 1FA3A 3LYGA 4MJDA 3OW22 1QVG2 1IQXA 1Q40B 1A2VA 2CFGA 1JZDA 3WDGB 2YFIB 4LMIA 3GAXA 3WOEB 2STDA 1BUQA 4MMXB 1BSEA 5ELJA 1NDOB 1IDPA 2CFDA 3G16A 3CCV3 3D5IA 1E3RA 3OV4A 3VGNA 3Q2PA 1KQS2 4HM5B 1SARA 4EBGA 3CME3 1K734 3F40A 3PCSA 1YVSA 4PEJA 4K1VA 2B24B 3OWSA 1K28A 1IVUA 1RJOA 1UI7A 4KT3B 3EC9A 5IG0A 4FCZA 3NXJA 1X1UA 2YFJB 1ZGXA 1K9M4 2E2UA 2C11A 2HMKB 5KP4A 2H0IA 5AIGA 3J7Yd 1BRHA 3FSDA 2W9QA 2BT3A 3CU3A 1VQM3 1RSNA 5IG4A 1IK3A 2M7OA 2W03A 1STFI 4HKVB 2CH9A 4MMZB 1QVF2 2KF3A 3NM2A 1GD4A 3PS8A 4XDVA 1UUWB 3HX8A 2KF5A 5FGOA 3MPHA 1YI23 1Q7Y4 1W01A 1QMAA 1EUIC 2GXFA 1KWIA 2BO9B 4BL3A 3QK9A 3JVCA 3GRDA 3OXAA 1IT7A 5IEPA 3NBJA 1ASKA 2CWTA 4BU4A 1N8QA 2P09A 1YGWA 1FUTA 3JUMA 3S28A 3V99A 1JJ22 1GMQA 1NNVA 3SVAA 2CX0A 2IY2A 3AHWA 2INXA 1B21A 1NWWA 3DGMA 3DGYA 3FG1A 1BSDA 1RGCA 4X2OA 5FW5A 1TU5A 1OH0A 3CC23 3VSYA 2XSHB 2OQEC 2QIYA 1YJ93 1FZUA 2WOFA 3ZG5A 2Y73A 1G0TA 2D1WA 1YVBI 2F99A 3CNXA 1TFOA 4R4KA 1IU7A 5LC6A 3CCR3 3EBYA 8CHOA 1BSCA 4DKIA 1SJWA 1WMNA 5BU4A 1PU4A 2IA7A 4AKZA 2W04A 7GSPA 4R9KA 3X41A 1B20A 1E97A 1Q7HA 1B2ZA 2GSPA 3AHSA 4N6UA 4HZBB 1U8CB 4HM2B 2XGNA 3WA2X 3NQZA 1L5GB 1VQN3 1LNHA 1HKXA 2FNQA 1CYVA 3RGAA 2OWPA 3SX1A 1FGQA 1MNLA 1A2KA 1A67A 3WR2A 4NPBA 3FZWA 5EEOA 1W4NA 2BMQB 1B2XA 3A5EA 1OGXA 2KF4A 2LQVA 1OF5B 4XDWA 5D81A 5STDA 3S5CA 1GMRA 3IPTA 3E99A 1W02A 3DGLA 3NM7A 5IEOA 3CMA3 3EF8A 3NUVA 3CD63 1O7GB 1I0XA 1N5HA 2F5MA 2V1LA 1RN4A 1IQ8A 3DMCA 4FR9A 1RGHA 4LGQA 4WYKB 3UJMA 2CKFB 1MWSA 3DY5A 3JUPA 1VQ73 1BNFA 1LQGC 1RGKA 2E2TA 4MEIA 2PNCA 2CG1A 3BIRA 5AYSC 2ML5A 2W2CA 3B7CA 2GEYA 3HI7A 4KFFA 2L1SA 2GU3A 4IPBA 1QAKA 4N6NB 4WHAA 1NB5I 1VQ63 1UUVB 2MF7A 3AGNA 3MSOA 1G02A 4ORLA 1T3BA 4EV5A 1BNRA 3SOYA 1IQYA 1GOVA 2GBWB 1RN7A 2WGOA 2JDIH 3NX0A 1IT8A 4FCMA 2RGQA 2MC8A 1MOLA 1ZS7A 1BOXA 3NV0A 3CCU3 5IW9A 4LZIA 1ROVA 1OACA 4BTXA 1N9EA 1ULJB 1Q9EA 1BIRA 1RHLA 1Y4KA 2QEX3 3EN1B 3NQYA 1ULIB 3H51A 3U1WA 4BTYA 8RNTA 3ALAA 7STDA 3CXC2 1KSIA 2Q07A 3WMDA 1W6CA 1JKGB 2RFRA 1EEJA 1M1XB 2UUGC 4N6MA 3F7SA 1JKGA 1O7MB 3NBRA 4BL2A 1DMMA 1VZZA 3MHEA 4EW5A 3KE7A 2R41A 2IUJA 1BRNL 1D6UA 3CCS3 6GSPA 3OWYA 3CCM3 1RRLA 3A76A 4BIRA 2LYXA 3EJVA 3PGBA 1IV7A 1YGEA 2CC3A 5D82A 5GSPA 3T8UA 1GD3A 2XFSA 3NBBA 4R1KA 2P0XA 1JNQA 3N9HA 3PCRA 5G1LA 1I70A 1SIHA 1TTOA 1BNIA 1GYBA 2HMLB 5AEUB 3JUOA 1GY7A 3BU4A 1W5ZA 4BTWA 2K54A 2UX0A 5M19A 3STDA 1CQSA 2FXTA 3DGOA 2CIUA 2XGLA 1TRPA 1D6ZA 1C54A 1BVIA 2F56A 1O7HB 1R4YA 1BAOA 1NO3A 3KCHA 1RCLA 1GOYA 2F4YA 1S5AA 1QJGA 2H0HA 2BNGA 2O9UX 3KN4A 4HM0B 2GBXB 1BNGA 1IV9A 1ZX2A 2YFLB 4WWUC 4L7KA 3EX9A 1I2FA 5CLKA 4ILFA 1MWUA 2CFKA 2KXGA 2SBLA 3CNMA 3LH4A 3L0RA 3MYTA 1BNEA 3D79A 3LTAA 1FGMA 1Q42A 5AIIA 3BNCA 5AIFA 4R9LA 3VF1A 4OUQA 3URPA 1US1A 1WQLB 2BHMA 3ECFA 3LZAA 3PXMA 4XBXA 5BIRA 1Q864 1Q824 1VQ93 2F98A 1EKMA 3K5TA 1Z1SA 4H3UA 1OHOA 3WOFB 1FGTA 1BRKA 3KZTA 4K90B 1V58A 2P05A 3CCL3 3TDGA 1KC84 3KKGA 4RNZA 5CK6A 6RNTA 3V98A 1AQZA 5HOHA 2R4IA 3FGYA 3I553 1OHPA 3FF2A 3GWRA 1AY7A 3GZXB 3BNBA 1D6YA 1JRQA 1RNTA 2BMRB 1X1WA 3F7XA 1M1K4 4R80A 3H3HA 3ZG0A 1TJDA 3X40A 2AADA 1UCJA 1RNBA 5EVHA 3F8XA 1CYUA 2BIRA 3MG1A 4X2HA 6STDA 2H0GA 3KFQC 4GSPA 5JPUA 3EE1A 1UCKA 3K7CA 5AEWB 2XF3A 4HZ9B 1RRHA 4KFEA 1UCLA 2CWVA 5A0OB 4NREA 3F9SA 2HMMB 3UNLA 2Z77A 1BSBA 2KF6A 3B4OA 5AIHA 1T2HA 1W2ZA 4AEQA 2KCDA 3CPW2 1JB4A 3GZYB 1BGSA 1R4CA 3D9RA 4Q53A 3EHCA 1O7NB 4L8OA 4NHFA 4N6V0 4JRFA 4GHOA 4HM4B 2IUKA 5BXQA 1N5PA 1IYYA 3ER7A 5KP3A 3MWZA 1YIJ3 3BB9A 3D5GA 4XB5A 4I4KA 2XRXB 2F86B 5DRVA 3CCE3 2L4VA 2OOVA 1DMQA 3FLJA 3LTBA 4IT7A 1B2UA 4FMDA 1PFPA 3G6E3 4IIAA 1OUNA 3SLUA 1MGRA 1PY3A 5CF1A 3FG3A 1EA2A 1LRAA 1NU3A 1RGGA 1EG9B 4L8PA 4HM8B 4HOHA 5KP1A 3I563 2BMOB 2ZHXB 9RNTA 2B1XB 1FUWA 1A2PA 3NV0B 1UCIA 3MKIA 4HM3B 1BUJA 2CWUA 3G713 1TIJA 3PZWA 1RDSA 1G96A 5M18A 4QWTA 1BANA 1UGIA 1X1XA 1SIIA 3D4AA 5IF6A 3CCQ3 1KD14 3ZFZA 1W6YA 1W6GA 5IG5A 4FMCA 4OK0A 4HM7B 1I8VA 1DE3A 3UL6A 1O7PB 3OWUA 2W0QA 4OVMA 1JV2B 3UB1A 2C10A 2WO0A 2HMOB 1AR0A 1JZOA 1YIT3 3LXUX 4RNYA 1DVCA 1FYSA 3N54B 1UI8A 2P38A 3FF0A 1LOVA 1CH0A 2XR8B 2Z7AA 4WFOA 5I97A 1TP6A 2RBIA 4I5QA 3CPOA 1VQ43 2HOHA 3AMOA 3EQQB 4AKYA 1J2BA 1K8A4 1BRJA 3K9MC 1I3IA 1LOYA 2XFTA 3O8YA 1BNJA 1OCVA 1PYLA 2CFWA 2ML6A 4HYZA 2CK3H 1HZ1A 4LEHA 4N3VA 4N6OB 1OPYA 2C4BA 3S67A 1FW7A 1BNSA 1LXEA 3BNEA 3HIIA 3HIGA 3WODG 3KSED 1FUSA 1K41A 3LT8A 4CDLA 1B3SA 4RBNA 3SYUA 1W2B2 1M904 1VQ83 2W9PA 3MG2A 1VQO3 3AGOA 5CXOA 1QALA 1Q40A 5AI1A 3S29A 1C7HA 4XM4A 3IJEB 1ROAA 2GEXA 5AYRB 1S723 1B2MA 1AV4A 3G8ZA 3DM8A 1JN5B 1NJI4 2I9WA 4N6LA 1ZO2A 4XBYA 1VQP3 2OTJ3 3FG4A 1HYFA 2ZA4A 7RNTA 2IYJA 1V57A 1JN5A 1IVWA 2GU1A 4LYLB 2CHCA 2Z6BA 4J8TA 3K0ZA 1FGRA 3LOYA 4EV2A 1YHQ3 2PZVA 1JB5A 3LT9A 5IENA 1I2EA 1MWRA 1I2GA 1YJN3 1U5OA 1RGFA 5D83A 1Q814 1VQL3 1CEWI 1RGLA 3T0UA 2IMJA 1TFKA 2WOHA 4U13A 1DETA 4HAAA 4CPKA 1DVDA 4RZMA 2RCDA 2UGIA 3F14A 1JBTA 3RGRA 1NB3I 4N6TA 3LTDA 2Y74A 1RN1A 1X1YA 1RLSA 3CC73 2CG0A 5JBSA 5EQLA 5IERA 3JUQA 4FMBA 4LSOA 3T8NA 3K63A 1RMSA 4O2HA 5CF2A 1OHSA 2ZL8A 3WHOA 4G1MB 3GZRA 4HJLB 3CC43 1W00A 3EB8A 1OGZA 3PYJA 1UW1A 1VQQA 1F8NA 1WMPA 3FKAA 3Q3FA 5TGNA 4CJNA 1LNIA 2F5WA 4HBRA 4HVNA 1TUHA 1DMNA 3X3XA 2CFLA 3GSPA 3SEDA 1UDII 2O3OA 3M8CA 4O8SA 2OTL3 1GY5A 2FGTA 2K3DA 4HM6B 2OQEA 2YX9A 3OX9A 3EN8A 1M9GA 4EXRA 3UL5A 1WNHA 4JF8A 1O7WB 3G4S3 5G2GA 3X42A 5HGRA 1VQK3 2D42A 3WA3A 1AVLA 5BVBA 5RNTA 1TRQA 4FMAA 3GZBA 4FCJA 2XEPA 3ROBA 1VQ53 1BSAA 5LC7A 3V92A 4EC6A 5M1AA 1RGEA 3Q1CA 3KIIA 1YNVX 1RKYA 1IVVA 3BNDA 2XSOB 2OOVC 2QGUA 1GS3A 1HU9A 3DZLA 1BRIA 2P0MA 3G0KA 3SXXA 3QRDA 1JBRA 1I0VA 3N8BA 2J8XB 1N9JA 4TX4A 2XH9A 2Z76A 3DUKA 1ISKA 2SARA 1V74A 2OCTA 1B2SA 1GMPA 1WTHA 3B8LA 3DGNA 3DH2A 3JUNA 3LTCA 4H61A 4GB5A 4K1UA 3FH1A 1MGWA 1LVNA 2HMNB 1LOWA 1OF5A 2ZDJA 3HZPA 1T5YA 1LQMB 2WGQA 1UGHI 3B4PA 4ZM8A 1RGAA 5G1KA 3RDEA 3FCSB 4CCVA 1EQKA 1UUGB 5ELUA 4KZ1A 4KVHA 3HK4A 1GSPA 1BRGA 1DYUA 2RSXA 1GY6A 3S27A 2CW9A 3SOAA 1YJW3 4WYKA 4J5KA 1LOXA 4K61A 2W56B 4XBTA 3RNTA 2JQ5A 3D3LA 2QA43 3X3ZA 3LMLA 3BLZA 1B27A 1BRSA 2W56A 4J9AA 4GL6A 1RTUA 3KSPA 1N8R4 1JB2A 1RCKA 1SPUA 5IG3A 3CCJ3 4STDA 4HM1B 4KFDA 1IVXA 1GOUA 2W6JH 4RNTA 3NHXA 1I3FA 2HMJB 4J5GA 4MMYB 3Q90A 4WP5A 3U97A 3AMOB 1BU4A 2BU4A
chains in the Genus database with same CATH topology
1AVKA 3I0YA 1STDA 3EBTA 4EYCA 1E3VA 2A15A 5DREA 1SQWA 2E2VA 1WMOA 3DXOA 2KRTA 1QAFA 4O3VA 3MG3A 3IMAB 1FGOA 1A90A 5JPPA 4O02B 3X3YA 1W7CA 3F8HA 2K0MA 1FA3A 3LYGA 4MJDA 3OW22 1QVG2 1IQXA 1Q40B 1A2VA 2CFGA 3WDGB 2YFIB 4LMIA 3GAXA 3WOEB 2STDA 1BUQA 4MMXB 5ELJA 1NDOB 1IDPA 2CFDA 3G16A 3CCV3 1E3RA 3OV4A 3VGNA 3Q2PA 1KQS2 4HM5B 4EBGA 3CME3 1K734 3F40A 3PCSA 4PEJA 4K1VA 2B24B 3OWSA 1K28A 1IVUA 1RJOA 1UI7A 3EC9A 5IG0A 4FCZA 3NXJA 2YFJB 1K9M4 2E2UA 2C11A 2HMKB 5KP4A 3J7Yd 5AIGA 3FSDA 2W9QA 2BT3A 3CU3A 1VQM3 5IG4A 1IK3A 2M7OA 2W03A 1STFI 4HKVB 2CH9A 4MMZB 1QVF2 3NM2A 1GD4A 3PS8A 4XDVA 1UUWB 3HX8A 5FGOA 1YI23 3MPHA 1Q7Y4 1W01A 1QMAA 2GXFA 1KWIA 2BO9B 3QK9A 3JVCA 3GRDA 3OXAA 1IT7A 5IEPA 3NBJA 1ASKA 2CWTA 1N8QA 2P09A 3V99A 3JUMA 3S28A 1JJ22 3SVAA 3DGMA 2INXA 4X2OA 1NWWA 1TU5A 3FG1A 5FW5A 3CC23 1OH0A 3VSYA 2XSHB 2OQEC 2QIYA 1YJ93 2WOFA 2Y73A 2D1WA 1YVBI 2F99A 3CNXA 1TFOA 4R4KA 1IU7A 5LC6A 3CCR3 3EBYA 8CHOA 1PU4A 1SJWA 1WMNA 2IA7A 4AKZA 2W04A 4R9KA 3X41A 1E97A 4N6UA 4HZBB 1U8CB 4HM2B 2XGNA 3WA2X 3NQZA 1L5GB 1VQN3 1LNHA 1HKXA 2FNQA 1CYVA 3RGAA 2OWPA 3SX1A 1FGQA 1MNLA 1A2KA 1A67A 3FZWA 5EEOA 1W4NA 2BMQB 1OGXA 2LQVA 1OF5B 4XDWA 5D81A 5STDA 3S5CA 3IPTA 3E99A 1W02A 3DGLA 3NM7A 5IEOA 3CMA3 3EF8A 3NUVA 3CD63 1O7GB 1N5HA 2V1LA 4FR9A 1IQ8A 3DMCA 4LGQA 4WYKB 3UJMA 2CKFB 3DY5A 3JUPA 1VQ73 2E2TA 4MEIA 2PNCA 2CG1A 5AYSC 2ML5A 2W2CA 3B7CA 2GEYA 3HI7A 4KFFA 2GU3A 4IPBA 1QAKA 4N6NB 4WHAA 1NB5I 1VQ63 1UUVB 2MF7A 3MSOA 4ORLA 4EV5A 3SOYA 1IQYA 2GBWB 1RN7A 2WGOA 2JDIH 3NX0A 1IT8A 4FCMA 2RGQA 2MC8A 1MOLA 3NV0A 3CCU3 5IW9A 4LZIA 1ROVA 1OACA 4BTXA 1N9EA 1ULJB 1Y4KA 2QEX3 3EN1B 3NQYA 1ULIB 3H51A 3U1WA 4BTYA 3ALAA 7STDA 3CXC2 1KSIA 2Q07A 3WMDA 1W6CA 1JKGB 2RFRA 1M1XB 4N6MA 3F7SA 1JKGA 1O7MB 3NBRA 1DMMA 1VZZA 3MHEA 3KE7A 2IUJA 1D6UA 3CCS3 3OWYA 3CCM3 1RRLA 3A76A 2LYXA 3EJVA 3PGBA 1IV7A 1YGEA 2CC3A 5D82A 3T8UA 1GD3A 2XFSA 3NBBA 4R1KA 2P0XA 1JNQA 3N9HA 3PCRA 1SIHA 1GYBA 2HMLB 5AEUB 3JUOA 1GY7A 1W5ZA 4BTWA 2K54A 2UX0A 3STDA 1CQSA 2FXTA 3DGOA 2CIUA 2XGLA 1D6ZA 1O7HB 1NO3A 1S5AA 1QJGA 2O9UX 2BNGA 3KN4A 4HM0B 2GBXB 1IV9A 1ZX2A 2YFLB 4WWUC 4L7KA 3EX9A 5CLKA 2CFKA 2KXGA 2SBLA 3CNMA 3LH4A 3L0RA 3MYTA 3LTAA 1FGMA 1Q42A 5AIIA 3BNCA 5AIFA 4R9LA 3VF1A 4OUQA 3CCQ3 1US1A 1WQLB 2BHMA 3ECFA 3LZAA 3PXMA 4XBXA 1Q864 2F98A 1EKMA 3K5TA 1Z1SA 4H3UA 1OHOA 3WOFB 1FGTA 1KC84 3KZTA 4K90B 2P05A 3CCL3 3TDGA 3KKGA 4RNZA 5CK6A 3V98A 2R4IA 3FGYA 3I553 1OHPA 3FF2A 3GWRA 3GZXB 3BNBA 1D6YA 1JRQA 2BMRB 3F7XA 1M1K4 4R80A 3H3HA 3X40A 5EVHA 3F8XA 1CYUA 3MG1A 4X2HA 6STDA 3KFQC 5JPUA 3EE1A 5AEWB 3K7CA 2XF3A 4HZ9B 1RRHA 4KFEA 2CWVA 5A0OB 4NREA 3F9SA 2HMMB 3UNLA 2Z77A 3B4OA 5AIHA 1W2ZA 4AEQA 2KCDA 3CPW2 1JB4A 3GZYB 1R4CA 3D9RA 4Q53A 3EHCA 1O7NB 4L8OA 4NHFA 4N6V0 4JRFA 5BXQA 4HM4B 2IUKA 1N5PA 3ER7A 5KP3A 3MWZA 1YIJ3 3BB9A 4XB5A 4I4KA 2XRXB 2F86B 5DRVA 3CCE3 2L4VA 2OOVA 1DMQA 3FLJA 3LTBA 4IT7A 4FMDA 1PFPA 3G6E3 4IIAA 1OUNA 3SLUA 5CF1A 3FG3A 1EA2A 1NU3A 1EG9B 4L8PA 4HM8B 5KP1A 3I563 2BMOB 2B1XB 1FUWA 3NV0B 3MKIA 4HM3B 2CWUA 3G713 1TIJA 3PZWA 1G96A 4QWTA 5IF6A 1SIIA 1KD14 1W6YA 1W6GA 5IG5A 4FMCA 4OK0A 4HM7B 3UL6A 1O7PB 3OWUA 2W0QA 4OVMA 1JV2B 3UB1A 2C10A 2WO0A 2HMOB 1AR0A 1YIT3 3LXUX 4RNYA 1DVCA 3N54B 1UI8A 2P38A 3FF0A 4WFOA 2XR8B 2Z7AA 5I97A 1TP6A 3CPOA 1VQ43 3AMOA 3EQQB 4AKYA 1J2BA 1K8A4 3K9MC 2XFTA 3O8YA 1OCVA 2CFWA 2ML6A 4HYZA 4LEHA 2CK3H 4N3VA 4N6OB 3S67A 1OPYA 1LXEA 3BNEA 3HIIA 3HIGA 3WODG 3KSED 3LT8A 1K41A 4CDLA 1M904 4RBNA 1W2B2 1VQ83 2W9PA 3MG2A 1VQO3 5CXOA 1QALA 1Q40A 3S29A 1C7HA 4XM4A 3IJEB 1ROAA 2GEXA 5AYRB 1S723 1AV4A 3G8ZA 3DM8A 1JN5B 1NJI4 2I9WA 4N6LA 1ZO2A 4XBYA 1VQP3 2OTJ3 3FG4A 1JN5A 1IVWA 2GU1A 2CHCA 2Z6BA 4J8TA 3K0ZA 1FGRA 3LOYA 4EV2A 1YHQ3 2PZVA 1JB5A 3LT9A 5IENA 1YJN3 1Q814 1U5OA 5D83A 1VQL3 1CEWI 3T0UA 2IMJA 1TFKA 2WOHA 4U13A 1DVDA 4RZMA 2RCDA 3F14A 3RGRA 1NB3I 4N6TA 3LTDA 2Y74A 3CC73 2CG0A 5JBSA 5EQLA 5IERA 3JUQA 4FMBA 4LSOA 3T8NA 3K63A 4O2HA 5CF2A 1OHSA 2ZL8A 4G1MB 3GZRA 4HJLB 3CC43 1W00A 3EB8A 1OGZA 3PYJA 1UW1A 1Q824 1F8NA 1WMPA 3FKAA 1VQ93 5TGNA 4HBRA 4HVNA 1TUHA 1DMNA 3X3XA 2CFLA 3SEDA 3M8CA 2O3OA 4O8SA 2OTL3 1GY5A 2FGTA 2OQEA 4HM6B 2YX9A 3OX9A 3EN8A 1M9GA 4EXRA 3UL5A 1WNHA 4JF8A 1O7WB 3G4S3 5G2GA 3X42A 5HGRA 1VQK3 2D42A 3WA3A 1AVLA 5BVBA 4FMAA 3GZBA 4FCJA 2XEPA 3ROBA 1VQ53 5LC7A 3V92A 4EC6A 3Q1CA 1RKYA 3KIIA 1IVVA 3BNDA 2XSOB 2OOVC 2QGUA 1GS3A 1HU9A 3DZLA 2P0MA 3G0KA 3SXXA 3QRDA 3N8BA 1N9JA 4TX4A 2XH9A 2Z76A 3DUKA 1ISKA 1V74A 2OCTA 3B8LA 3JUNA 1WTHA 3DGNA 3LTCA 4H61A 5AI1A 4K1UA 4GB5A 3FH1A 1LVNA 2HMNB 1OF5A 2ZDJA 3HZPA 1T5YA 2WGQA 3B4PA 4ZM8A 3RDEA 4CCVA 3FCSB 1EQKA 5ELUA 4KZ1A 4KVHA 3HK4A 1DYUA 2RSXA 1GY6A 3S27A 2CW9A 3SOAA 1YJW3 4WYKA 1LOXA 4K61A 2W56B 4XBTA 2QA43 2JQ5A 3D3LA 3X3ZA 3LMLA 3BLZA 2W56A 4J9AA 4GL6A 3KSPA 1N8R4 1JB2A 1SPUA 5IG3A 3CCJ3 4STDA 4HM1B 4KFDA 1IVXA 2W6JH 3NHXA 2HMJB 4MMYB 4WP5A 3U97A 3Q90A 3AMOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 3;  1M1K 4;  1NJI 4;  1KQS 2;  1VQ4 3;  3CCM 3;  3CD6 3;  1VQ5 3;  3CME 3;  1K73 4;  3G71 3;  1K8A 4;  3CCU 3;  1YIJ 3;  1YJW 3;  1JJ2 2;  1YHQ 3;  3CCQ 3;  3CC4 3;  1Q86 4;  1VQ7 3;  1YJN 3;  2QEX 3;  1Q81 4;  1Q82 4;  1VQL 3;  2QA4 3;  1KD1 4;  1VQ9 3;  3CCE 3;  1VQN 3;  1K9M 4;  3CXC 2;  3CC2 3;  3CMA 3;  1KC8 4;  2OTL 3;  3CCL 3;  1N8R 4;  1M90 4;  1VQM 3;  3OW2 2;  1YJ9 3;  1QVG 2;  1W2B 2;  1VQ8 3;  3CCJ 3;  1VQO 3;  1VQ6 3;  3G6E 3;  1YIT 3;  3CC7 3;  3G4S 3;  1QVF 2;  3I55 3;  1S72 3;  3CPW 2;  3CCR 3;  1VQK 3;  1Q7Y 4;  1YI2 3;  1VQP 3;  3CCV 3;  3CCS 3;  2OTJ 3; 
#chains in the Genus database with same CATH topology
 1AVK A;  3I0Y A;  1STD A;  3EBT A;  4EYC A;  1E3V A;  2A15 A;  3HOH A;  5DRE A;  1JBS A;  1SQW A;  2E2V A;  1WMO A;  3DXO A;  2KRT A;  1QAF A;  4O3V A;  2CX1 A;  3MG3 A;  2KAA A;  2RNT A;  3IMA B;  1FGO A;  1T2I A;  1A90 A;  5JPP A;  4O02 B;  3X3Y A;  1W7C A;  3F8H A;  2K0M A;  1MWT A;  2AAE A;  1FA3 A;  3LYG A;  4MJD A;  3OW2 2;  1QVG 2;  1IQX A;  1Q40 B;  1A2V A;  2CFG A;  1JZD A;  3WDG B;  2YFI B;  4LMI A;  3GAX A;  3WOE B;  2STD A;  1BUQ A;  4MMX B;  1BSE A;  5ELJ A;  1NDO B;  1IDP A;  2CFD A;  3G16 A;  3CCV 3;  3D5I A;  1E3R A;  3OV4 A;  3VGN A;  3Q2P A;  1KQS 2;  4HM5 B;  1SAR A;  4EBG A;  3CME 3;  1K73 4;  3F40 A;  3PCS A;  1YVS A;  4PEJ A;  4K1V A;  2B24 B;  3OWS A;  1K28 A;  1IVU A;  1RJO A;  1UI7 A;  4KT3 B;  3EC9 A;  5IG0 A;  4FCZ A;  3NXJ A;  1X1U A;  2YFJ B;  1ZGX A;  1K9M 4;  2E2U A;  2C11 A;  2HMK B;  5KP4 A;  2H0I A;  5AIG A;  3J7Y d;  1BRH A;  3FSD A;  2W9Q A;  2BT3 A;  3CU3 A;  1VQM 3;  1RSN A;  5IG4 A;  1IK3 A;  2M7O A;  2W03 A;  1STF I;  4HKV B;  2CH9 A;  4MMZ B;  1QVF 2;  2KF3 A;  3NM2 A;  1GD4 A;  3PS8 A;  4XDV A;  1UUW B;  3HX8 A;  2KF5 A;  5FGO A;  3MPH A;  1YI2 3;  1Q7Y 4;  1W01 A;  1QMA A;  1EUI C;  2GXF A;  1KWI A;  2BO9 B;  4BL3 A;  3QK9 A;  3JVC A;  3GRD A;  3OXA A;  1IT7 A;  5IEP A;  3NBJ A;  1ASK A;  2CWT A;  4BU4 A;  1N8Q A;  2P09 A;  1YGW A;  1FUT A;  3JUM A;  3S28 A;  3V99 A;  1JJ2 2;  1GMQ A;  1NNV A;  3SVA A;  2CX0 A;  2IY2 A;  3AHW A;  2INX A;  1B21 A;  1NWW A;  3DGM A;  3DGY A;  3FG1 A;  1BSD A;  1RGC A;  4X2O A;  5FW5 A;  1TU5 A;  1OH0 A;  3CC2 3;  3VSY A;  2XSH B;  2OQE C;  2QIY A;  1YJ9 3;  1FZU A;  2WOF A;  3ZG5 A;  2Y73 A;  1G0T A;  2D1W A;  1YVB I;  2F99 A;  3CNX A;  1TFO A;  4R4K A;  1IU7 A;  5LC6 A;  3CCR 3;  3EBY A;  8CHO A;  1BSC A;  4DKI A;  1SJW A;  1WMN A;  5BU4 A;  1PU4 A;  2IA7 A;  4AKZ A;  2W04 A;  7GSP A;  4R9K A;  3X41 A;  1B20 A;  1E97 A;  1Q7H A;  1B2Z A;  2GSP A;  3AHS A;  4N6U A;  4HZB B;  1U8C B;  4HM2 B;  2XGN A;  3WA2 X;  3NQZ A;  1L5G B;  1VQN 3;  1LNH A;  1HKX A;  2FNQ A;  1CYV A;  3RGA A;  2OWP A;  3SX1 A;  1FGQ A;  1MNL A;  1A2K A;  1A67 A;  3WR2 A;  4NPB A;  3FZW A;  5EEO A;  1W4N A;  2BMQ B;  1B2X A;  3A5E A;  1OGX A;  2KF4 A;  2LQV A;  1OF5 B;  4XDW A;  5D81 A;  5STD A;  3S5C A;  1GMR A;  3IPT A;  3E99 A;  1W02 A;  3DGL A;  3NM7 A;  5IEO A;  3CMA 3;  3EF8 A;  3NUV A;  3CD6 3;  1O7G B;  1I0X A;  1N5H A;  2F5M A;  2V1L A;  1RN4 A;  1IQ8 A;  3DMC A;  4FR9 A;  1RGH A;  4LGQ A;  4WYK B;  3UJM A;  2CKF B;  1MWS A;  3DY5 A;  3JUP A;  1VQ7 3;  1BNF A;  1LQG C;  1RGK A;  2E2T A;  4MEI A;  2PNC A;  2CG1 A;  3BIR A;  5AYS C;  2ML5 A;  2W2C A;  3B7C A;  2GEY A;  3HI7 A;  4KFF A;  2L1S A;  2GU3 A;  4IPB A;  1QAK A;  4N6N B;  4WHA A;  1NB5 I;  1VQ6 3;  1UUV B;  2MF7 A;  3AGN A;  3MSO A;  1G02 A;  4ORL A;  1T3B A;  4EV5 A;  1BNR A;  3SOY A;  1IQY A;  1GOV A;  2GBW B;  1RN7 A;  2WGO A;  2JDI H;  3NX0 A;  1IT8 A;  4FCM A;  2RGQ A;  2MC8 A;  1MOL A;  1ZS7 A;  1BOX A;  3NV0 A;  3CCU 3;  5IW9 A;  4LZI A;  1ROV A;  1OAC A;  4BTX A;  1N9E A;  1ULJ B;  1Q9E A;  1BIR A;  1RHL A;  1Y4K A;  2QEX 3;  3EN1 B;  3NQY A;  1ULI B;  3H51 A;  3U1W A;  4BTY A;  8RNT A;  3ALA A;  7STD A;  3CXC 2;  1KSI A;  2Q07 A;  3WMD A;  1W6C A;  1JKG B;  2RFR A;  1EEJ A;  1M1X B;  2UUG C;  4N6M A;  3F7S A;  1JKG A;  1O7M B;  3NBR A;  4BL2 A;  1DMM A;  1VZZ A;  3MHE A;  4EW5 A;  3KE7 A;  2R41 A;  2IUJ A;  1BRN L;  1D6U A;  3CCS 3;  6GSP A;  3OWY A;  3CCM 3;  1RRL A;  3A76 A;  4BIR A;  2LYX A;  3EJV A;  3PGB A;  1IV7 A;  1YGE A;  2CC3 A;  5D82 A;  5GSP A;  3T8U A;  1GD3 A;  2XFS A;  3NBB A;  4R1K A;  2P0X A;  1JNQ A;  3N9H A;  3PCR A;  5G1L A;  1I70 A;  1SIH A;  1TTO A;  1BNI A;  1GYB A;  2HML B;  5AEU B;  3JUO A;  1GY7 A;  3BU4 A;  1W5Z A;  4BTW A;  2K54 A;  2UX0 A;  5M19 A;  3STD A;  1CQS A;  2FXT A;  3DGO A;  2CIU A;  2XGL A;  1TRP A;  1D6Z A;  1C54 A;  1BVI A;  2F56 A;  1O7H B;  1R4Y A;  1BAO A;  1NO3 A;  3KCH A;  1RCL A;  1GOY A;  2F4Y A;  1S5A A;  1QJG A;  2H0H A;  2BNG A;  2O9U X;  3KN4 A;  4HM0 B;  2GBX B;  1BNG A;  1IV9 A;  1ZX2 A;  2YFL B;  4WWU C;  4L7K A;  3EX9 A;  1I2F A;  5CLK A;  4ILF A;  1MWU A;  2CFK A;  2KXG A;  2SBL A;  3CNM A;  3LH4 A;  3L0R A;  3MYT A;  1BNE A;  3D79 A;  3LTA A;  1FGM A;  1Q42 A;  5AII A;  3BNC A;  5AIF A;  4R9L A;  3VF1 A;  4OUQ A;  3URP A;  1US1 A;  1WQL B;  2BHM A;  3ECF A;  3LZA A;  3PXM A;  4XBX A;  5BIR A;  1Q86 4;  1Q82 4;  1VQ9 3;  2F98 A;  1EKM A;  3K5T A;  1Z1S A;  4H3U A;  1OHO A;  3WOF B;  1FGT A;  1BRK A;  3KZT A;  4K90 B;  1V58 A;  2P05 A;  3CCL 3;  3TDG A;  1KC8 4;  3KKG A;  4RNZ A;  5CK6 A;  6RNT A;  3V98 A;  1AQZ A;  5HOH A;  2R4I A;  3FGY A;  3I55 3;  1OHP A;  3FF2 A;  3GWR A;  1AY7 A;  3GZX B;  3BNB A;  1D6Y A;  1JRQ A;  1RNT A;  2BMR B;  1X1W A;  3F7X A;  1M1K 4;  4R80 A;  3H3H A;  3ZG0 A;  1TJD A;  3X40 A;  2AAD A;  1UCJ A;  1RNB A;  5EVH A;  3F8X A;  1CYU A;  2BIR A;  3MG1 A;  4X2H A;  6STD A;  2H0G A;  3KFQ C;  4GSP A;  5JPU A;  3EE1 A;  1UCK A;  3K7C A;  5AEW B;  2XF3 A;  4HZ9 B;  1RRH A;  4KFE A;  1UCL A;  2CWV A;  5A0O B;  4NRE A;  3F9S A;  2HMM B;  3UNL A;  2Z77 A;  1BSB A;  2KF6 A;  3B4O A;  5AIH A;  1T2H A;  1W2Z A;  4AEQ A;  2KCD A;  3CPW 2;  1JB4 A;  3GZY B;  1BGS A;  1R4C A;  3D9R A;  4Q53 A;  3EHC A;  1O7N B;  4L8O A;  4NHF A;  4N6V 0;  4JRF A;  4GHO A;  4HM4 B;  2IUK A;  5BXQ A;  1N5P A;  1IYY A;  3ER7 A;  5KP3 A;  3MWZ A;  1YIJ 3;  3BB9 A;  3D5G A;  4XB5 A;  4I4K A;  2XRX B;  2F86 B;  5DRV A;  3CCE 3;  2L4V A;  2OOV A;  1DMQ A;  3FLJ A;  3LTB A;  4IT7 A;  1B2U A;  4FMD A;  1PFP A;  3G6E 3;  4IIA A;  1OUN A;  3SLU A;  1MGR A;  1PY3 A;  5CF1 A;  3FG3 A;  1EA2 A;  1LRA A;  1NU3 A;  1RGG A;  1EG9 B;  4L8P A;  4HM8 B;  4HOH A;  5KP1 A;  3I56 3;  2BMO B;  2ZHX B;  9RNT A;  2B1X B;  1FUW A;  1A2P A;  3NV0 B;  1UCI A;  3MKI A;  4HM3 B;  1BUJ A;  2CWU A;  3G71 3;  1TIJ A;  3PZW A;  1RDS A;  1G96 A;  5M18 A;  4QWT A;  1BAN A;  1UGI A;  1X1X A;  1SII A;  3D4A A;  5IF6 A;  3CCQ 3;  1KD1 4;  3ZFZ A;  1W6Y A;  1W6G A;  5IG5 A;  4FMC A;  4OK0 A;  4HM7 B;  1I8V A;  1DE3 A;  3UL6 A;  1O7P B;  3OWU A;  2W0Q A;  4OVM A;  1JV2 B;  3UB1 A;  2C10 A;  2WO0 A;  2HMO B;  1AR0 A;  1JZO A;  1YIT 3;  3LXU X;  4RNY A;  1DVC A;  1FYS A;  3N54 B;  1UI8 A;  2P38 A;  3FF0 A;  1LOV A;  1CH0 A;  2XR8 B;  2Z7A A;  4WFO A;  5I97 A;  1TP6 A;  2RBI A;  4I5Q A;  3CPO A;  1VQ4 3;  2HOH A;  3AMO A;  3EQQ B;  4AKY A;  1J2B A;  1K8A 4;  1BRJ A;  3K9M C;  1I3I A;  1LOY A;  2XFT A;  3O8Y A;  1BNJ A;  1OCV A;  1PYL A;  2CFW A;  2ML6 A;  4HYZ A;  2CK3 H;  1HZ1 A;  4LEH A;  4N3V A;  4N6O B;  1OPY A;  2C4B A;  3S67 A;  1FW7 A;  1BNS A;  1LXE A;  3BNE A;  3HII A;  3HIG A;  3WOD G;  3KSE D;  1FUS A;  1K41 A;  3LT8 A;  4CDL A;  1B3S A;  4RBN A;  3SYU A;  1W2B 2;  1M90 4;  1VQ8 3;  2W9P A;  3MG2 A;  1VQO 3;  3AGO A;  5CXO A;  1QAL A;  1Q40 A;  5AI1 A;  3S29 A;  1C7H A;  4XM4 A;  3IJE B;  1ROA A;  2GEX A;  5AYR B;  1S72 3;  1B2M A;  1AV4 A;  3G8Z A;  3DM8 A;  1JN5 B;  1NJI 4;  2I9W A;  4N6L A;  1ZO2 A;  4XBY A;  1VQP 3;  2OTJ 3;  3FG4 A;  1HYF A;  2ZA4 A;  7RNT A;  2IYJ A;  1V57 A;  1JN5 A;  1IVW A;  2GU1 A;  4LYL B;  2CHC A;  2Z6B A;  4J8T A;  3K0Z A;  1FGR A;  3LOY A;  4EV2 A;  1YHQ 3;  2PZV A;  1JB5 A;  3LT9 A;  5IEN A;  1I2E A;  1MWR A;  1I2G A;  1YJN 3;  1U5O A;  1RGF A;  5D83 A;  1Q81 4;  1VQL 3;  1CEW I;  1RGL A;  3T0U A;  2IMJ A;  1TFK A;  2WOH A;  4U13 A;  1DET A;  4HAA A;  4CPK A;  1DVD A;  4RZM A;  2RCD A;  2UGI A;  3F14 A;  1JBT A;  3RGR A;  1NB3 I;  4N6T A;  3LTD A;  2Y74 A;  1RN1 A;  1X1Y A;  1RLS A;  3CC7 3;  2CG0 A;  5JBS A;  5EQL A;  5IER A;  3JUQ A;  4FMB A;  4LSO A;  3T8N A;  3K63 A;  1RMS A;  4O2H A;  5CF2 A;  1OHS A;  2ZL8 A;  3WHO A;  4G1M B;  3GZR A;  4HJL B;  3CC4 3;  1W00 A;  3EB8 A;  1OGZ A;  3PYJ A;  1UW1 A;  1VQQ A;  1F8N A;  1WMP A;  3FKA A;  3Q3F A;  5TGN A;  4CJN A;  1LNI A;  2F5W A;  4HBR A;  4HVN A;  1TUH A;  1DMN A;  3X3X A;  2CFL A;  3GSP A;  3SED A;  1UDI I;  2O3O A;  3M8C A;  4O8S A;  2OTL 3;  1GY5 A;  2FGT A;  2K3D A;  4HM6 B;  2OQE A;  2YX9 A;  3OX9 A;  3EN8 A;  1M9G A;  4EXR A;  3UL5 A;  1WNH A;  4JF8 A;  1O7W B;  3G4S 3;  5G2G A;  3X42 A;  5HGR A;  1VQK 3;  2D42 A;  3WA3 A;  1AVL A;  5BVB A;  5RNT A;  1TRQ A;  4FMA A;  3GZB A;  4FCJ A;  2XEP A;  3ROB A;  1VQ5 3;  1BSA A;  5LC7 A;  3V92 A;  4EC6 A;  5M1A A;  1RGE A;  3Q1C A;  3KII A;  1YNV X;  1RKY A;  1IVV A;  3BND A;  2XSO B;  2OOV C;  2QGU A;  1GS3 A;  1HU9 A;  3DZL A;  1BRI A;  2P0M A;  3G0K A;  3SXX A;  3QRD A;  1JBR A;  1I0V A;  3N8B A;  2J8X B;  1N9J A;  4TX4 A;  2XH9 A;  2Z76 A;  3DUK A;  1ISK A;  2SAR A;  1V74 A;  2OCT A;  1B2S A;  1GMP A;  1WTH A;  3B8L A;  3DGN A;  3DH2 A;  3JUN A;  3LTC A;  4H61 A;  4GB5 A;  4K1U A;  3FH1 A;  1MGW A;  1LVN A;  2HMN B;  1LOW A;  1OF5 A;  2ZDJ A;  3HZP A;  1T5Y A;  1LQM B;  2WGQ A;  1UGH I;  3B4P A;  4ZM8 A;  1RGA A;  5G1K A;  3RDE A;  3FCS B;  4CCV A;  1EQK A;  1UUG B;  5ELU A;  4KZ1 A;  4KVH A;  3HK4 A;  1GSP A;  1BRG A;  1DYU A;  2RSX A;  1GY6 A;  3S27 A;  2CW9 A;  3SOA A;  1YJW 3;  4WYK A;  4J5K A;  1LOX A;  4K61 A;  2W56 B;  4XBT A;  3RNT A;  2JQ5 A;  3D3L A;  2QA4 3;  3X3Z A;  3LML A;  3BLZ A;  1B27 A;  1BRS A;  2W56 A;  4J9A A;  4GL6 A;  1RTU A;  3KSP A;  1N8R 4;  1JB2 A;  1RCK A;  1SPU A;  5IG3 A;  3CCJ 3;  4STD A;  4HM1 B;  4KFD A;  1IVX A;  1GOU A;  2W6J H;  4RNT A;  3NHX A;  1I3F A;  2HMJ B;  4J5G A;  4MMY B;  3Q90 A;  4WP5 A;  3U97 A;  3AMO B;  1BU4 A;  2BU4 A; 
#chains in the Genus database with same CATH homology
 1AVK A;  3I0Y A;  1STD A;  3EBT A;  4EYC A;  1E3V A;  2A15 A;  5DRE A;  1SQW A;  2E2V A;  1WMO A;  3DXO A;  2KRT A;  1QAF A;  4O3V A;  3MG3 A;  3IMA B;  1FGO A;  1A90 A;  5JPP A;  4O02 B;  3X3Y A;  1W7C A;  3F8H A;  2K0M A;  1FA3 A;  3LYG A;  4MJD A;  3OW2 2;  1QVG 2;  1IQX A;  1Q40 B;  1A2V A;  2CFG A;  3WDG B;  2YFI B;  4LMI A;  3GAX A;  3WOE B;  2STD A;  1BUQ A;  4MMX B;  5ELJ A;  1NDO B;  1IDP A;  2CFD A;  3G16 A;  3CCV 3;  1E3R A;  3OV4 A;  3VGN A;  3Q2P A;  1KQS 2;  4HM5 B;  4EBG A;  3CME 3;  1K73 4;  3F40 A;  3PCS A;  4PEJ A;  4K1V A;  2B24 B;  3OWS A;  1K28 A;  1IVU A;  1RJO A;  1UI7 A;  3EC9 A;  5IG0 A;  4FCZ A;  3NXJ A;  2YFJ B;  1K9M 4;  2E2U A;  2C11 A;  2HMK B;  5KP4 A;  3J7Y d;  5AIG A;  3FSD A;  2W9Q A;  2BT3 A;  3CU3 A;  1VQM 3;  5IG4 A;  1IK3 A;  2M7O A;  2W03 A;  1STF I;  4HKV B;  2CH9 A;  4MMZ B;  1QVF 2;  3NM2 A;  1GD4 A;  3PS8 A;  4XDV A;  1UUW B;  3HX8 A;  5FGO A;  1YI2 3;  3MPH A;  1Q7Y 4;  1W01 A;  1QMA A;  2GXF A;  1KWI A;  2BO9 B;  3QK9 A;  3JVC A;  3GRD A;  3OXA A;  1IT7 A;  5IEP A;  3NBJ A;  1ASK A;  2CWT A;  1N8Q A;  2P09 A;  3V99 A;  3JUM A;  3S28 A;  1JJ2 2;  3SVA A;  3DGM A;  2INX A;  4X2O A;  1NWW A;  1TU5 A;  3FG1 A;  5FW5 A;  3CC2 3;  1OH0 A;  3VSY A;  2XSH B;  2OQE C;  2QIY A;  1YJ9 3;  2WOF A;  2Y73 A;  2D1W A;  1YVB I;  2F99 A;  3CNX A;  1TFO A;  4R4K A;  1IU7 A;  5LC6 A;  3CCR 3;  3EBY A;  8CHO A;  1PU4 A;  1SJW A;  1WMN A;  2IA7 A;  4AKZ A;  2W04 A;  4R9K A;  3X41 A;  1E97 A;  4N6U A;  4HZB B;  1U8C B;  4HM2 B;  2XGN A;  3WA2 X;  3NQZ A;  1L5G B;  1VQN 3;  1LNH A;  1HKX A;  2FNQ A;  1CYV A;  3RGA A;  2OWP A;  3SX1 A;  1FGQ A;  1MNL A;  1A2K A;  1A67 A;  3FZW A;  5EEO A;  1W4N A;  2BMQ B;  1OGX A;  2LQV A;  1OF5 B;  4XDW A;  5D81 A;  5STD A;  3S5C A;  3IPT A;  3E99 A;  1W02 A;  3DGL A;  3NM7 A;  5IEO A;  3CMA 3;  3EF8 A;  3NUV A;  3CD6 3;  1O7G B;  1N5H A;  2V1L A;  4FR9 A;  1IQ8 A;  3DMC A;  4LGQ A;  4WYK B;  3UJM A;  2CKF B;  3DY5 A;  3JUP A;  1VQ7 3;  2E2T A;  4MEI A;  2PNC A;  2CG1 A;  5AYS C;  2ML5 A;  2W2C A;  3B7C A;  2GEY A;  3HI7 A;  4KFF A;  2GU3 A;  4IPB A;  1QAK A;  4N6N B;  4WHA A;  1NB5 I;  1VQ6 3;  1UUV B;  2MF7 A;  3MSO A;  4ORL A;  4EV5 A;  3SOY A;  1IQY A;  2GBW B;  1RN7 A;  2WGO A;  2JDI H;  3NX0 A;  1IT8 A;  4FCM A;  2RGQ A;  2MC8 A;  1MOL A;  3NV0 A;  3CCU 3;  5IW9 A;  4LZI A;  1ROV A;  1OAC A;  4BTX A;  1N9E A;  1ULJ B;  1Y4K A;  2QEX 3;  3EN1 B;  3NQY A;  1ULI B;  3H51 A;  3U1W A;  4BTY A;  3ALA A;  7STD A;  3CXC 2;  1KSI A;  2Q07 A;  3WMD A;  1W6C A;  1JKG B;  2RFR A;  1M1X B;  4N6M A;  3F7S A;  1JKG A;  1O7M B;  3NBR A;  1DMM A;  1VZZ A;  3MHE A;  3KE7 A;  2IUJ A;  1D6U A;  3CCS 3;  3OWY A;  3CCM 3;  1RRL A;  3A76 A;  2LYX A;  3EJV A;  3PGB A;  1IV7 A;  1YGE A;  2CC3 A;  5D82 A;  3T8U A;  1GD3 A;  2XFS A;  3NBB A;  4R1K A;  2P0X A;  1JNQ A;  3N9H A;  3PCR A;  1SIH A;  1GYB A;  2HML B;  5AEU B;  3JUO A;  1GY7 A;  1W5Z A;  4BTW A;  2K54 A;  2UX0 A;  3STD A;  1CQS A;  2FXT A;  3DGO A;  2CIU A;  2XGL A;  1D6Z A;  1O7H B;  1NO3 A;  1S5A A;  1QJG A;  2O9U X;  2BNG A;  3KN4 A;  4HM0 B;  2GBX B;  1IV9 A;  1ZX2 A;  2YFL B;  4WWU C;  4L7K A;  3EX9 A;  5CLK A;  2CFK A;  2KXG A;  2SBL A;  3CNM A;  3LH4 A;  3L0R A;  3MYT A;  3LTA A;  1FGM A;  1Q42 A;  5AII A;  3BNC A;  5AIF A;  4R9L A;  3VF1 A;  4OUQ A;  3CCQ 3;  1US1 A;  1WQL B;  2BHM A;  3ECF A;  3LZA A;  3PXM A;  4XBX A;  1Q86 4;  2F98 A;  1EKM A;  3K5T A;  1Z1S A;  4H3U A;  1OHO A;  3WOF B;  1FGT A;  1KC8 4;  3KZT A;  4K90 B;  2P05 A;  3CCL 3;  3TDG A;  3KKG A;  4RNZ A;  5CK6 A;  3V98 A;  2R4I A;  3FGY A;  3I55 3;  1OHP A;  3FF2 A;  3GWR A;  3GZX B;  3BNB A;  1D6Y A;  1JRQ A;  2BMR B;  3F7X A;  1M1K 4;  4R80 A;  3H3H A;  3X40 A;  5EVH A;  3F8X A;  1CYU A;  3MG1 A;  4X2H A;  6STD A;  3KFQ C;  5JPU A;  3EE1 A;  5AEW B;  3K7C A;  2XF3 A;  4HZ9 B;  1RRH A;  4KFE A;  2CWV A;  5A0O B;  4NRE A;  3F9S A;  2HMM B;  3UNL A;  2Z77 A;  3B4O A;  5AIH A;  1W2Z A;  4AEQ A;  2KCD A;  3CPW 2;  1JB4 A;  3GZY B;  1R4C A;  3D9R A;  4Q53 A;  3EHC A;  1O7N B;  4L8O A;  4NHF A;  4N6V 0;  4JRF A;  5BXQ A;  4HM4 B;  2IUK A;  1N5P A;  3ER7 A;  5KP3 A;  3MWZ A;  1YIJ 3;  3BB9 A;  4XB5 A;  4I4K A;  2XRX B;  2F86 B;  5DRV A;  3CCE 3;  2L4V A;  2OOV A;  1DMQ A;  3FLJ A;  3LTB A;  4IT7 A;  4FMD A;  1PFP A;  3G6E 3;  4IIA A;  1OUN A;  3SLU A;  5CF1 A;  3FG3 A;  1EA2 A;  1NU3 A;  1EG9 B;  4L8P A;  4HM8 B;  5KP1 A;  3I56 3;  2BMO B;  2B1X B;  1FUW A;  3NV0 B;  3MKI A;  4HM3 B;  2CWU A;  3G71 3;  1TIJ A;  3PZW A;  1G96 A;  4QWT A;  5IF6 A;  1SII A;  1KD1 4;  1W6Y A;  1W6G A;  5IG5 A;  4FMC A;  4OK0 A;  4HM7 B;  3UL6 A;  1O7P B;  3OWU A;  2W0Q A;  4OVM A;  1JV2 B;  3UB1 A;  2C10 A;  2WO0 A;  2HMO B;  1AR0 A;  1YIT 3;  3LXU X;  4RNY A;  1DVC A;  3N54 B;  1UI8 A;  2P38 A;  3FF0 A;  4WFO A;  2XR8 B;  2Z7A A;  5I97 A;  1TP6 A;  3CPO A;  1VQ4 3;  3AMO A;  3EQQ B;  4AKY A;  1J2B A;  1K8A 4;  3K9M C;  2XFT A;  3O8Y A;  1OCV A;  2CFW A;  2ML6 A;  4HYZ A;  4LEH A;  2CK3 H;  4N3V A;  4N6O B;  3S67 A;  1OPY A;  1LXE A;  3BNE A;  3HII A;  3HIG A;  3WOD G;  3KSE D;  3LT8 A;  1K41 A;  4CDL A;  1M90 4;  4RBN A;  1W2B 2;  1VQ8 3;  2W9P A;  3MG2 A;  1VQO 3;  5CXO A;  1QAL A;  1Q40 A;  3S29 A;  1C7H A;  4XM4 A;  3IJE B;  1ROA A;  2GEX A;  5AYR B;  1S72 3;  1AV4 A;  3G8Z A;  3DM8 A;  1JN5 B;  1NJI 4;  2I9W A;  4N6L A;  1ZO2 A;  4XBY A;  1VQP 3;  2OTJ 3;  3FG4 A;  1JN5 A;  1IVW A;  2GU1 A;  2CHC A;  2Z6B A;  4J8T A;  3K0Z A;  1FGR A;  3LOY A;  4EV2 A;  1YHQ 3;  2PZV A;  1JB5 A;  3LT9 A;  5IEN A;  1YJN 3;  1Q81 4;  1U5O A;  5D83 A;  1VQL 3;  1CEW I;  3T0U A;  2IMJ A;  1TFK A;  2WOH A;  4U13 A;  1DVD A;  4RZM A;  2RCD A;  3F14 A;  3RGR A;  1NB3 I;  4N6T A;  3LTD A;  2Y74 A;  3CC7 3;  2CG0 A;  5JBS A;  5EQL A;  5IER A;  3JUQ A;  4FMB A;  4LSO A;  3T8N A;  3K63 A;  4O2H A;  5CF2 A;  1OHS A;  2ZL8 A;  4G1M B;  3GZR A;  4HJL B;  3CC4 3;  1W00 A;  3EB8 A;  1OGZ A;  3PYJ A;  1UW1 A;  1Q82 4;  1F8N A;  1WMP A;  3FKA A;  1VQ9 3;  5TGN A;  4HBR A;  4HVN A;  1TUH A;  1DMN A;  3X3X A;  2CFL A;  3SED A;  3M8C A;  2O3O A;  4O8S A;  2OTL 3;  1GY5 A;  2FGT A;  2OQE A;  4HM6 B;  2YX9 A;  3OX9 A;  3EN8 A;  1M9G A;  4EXR A;  3UL5 A;  1WNH A;  4JF8 A;  1O7W B;  3G4S 3;  5G2G A;  3X42 A;  5HGR A;  1VQK 3;  2D42 A;  3WA3 A;  1AVL A;  5BVB A;  4FMA A;  3GZB A;  4FCJ A;  2XEP A;  3ROB A;  1VQ5 3;  5LC7 A;  3V92 A;  4EC6 A;  3Q1C A;  1RKY A;  3KII A;  1IVV A;  3BND A;  2XSO B;  2OOV C;  2QGU A;  1GS3 A;  1HU9 A;  3DZL A;  2P0M A;  3G0K A;  3SXX A;  3QRD A;  3N8B A;  1N9J A;  4TX4 A;  2XH9 A;  2Z76 A;  3DUK A;  1ISK A;  1V74 A;  2OCT A;  3B8L A;  3JUN A;  1WTH A;  3DGN A;  3LTC A;  4H61 A;  5AI1 A;  4K1U A;  4GB5 A;  3FH1 A;  1LVN A;  2HMN B;  1OF5 A;  2ZDJ A;  3HZP A;  1T5Y A;  2WGQ A;  3B4P A;  4ZM8 A;  3RDE A;  4CCV A;  3FCS B;  1EQK A;  5ELU A;  4KZ1 A;  4KVH A;  3HK4 A;  1DYU A;  2RSX A;  1GY6 A;  3S27 A;  2CW9 A;  3SOA A;  1YJW 3;  4WYK A;  1LOX A;  4K61 A;  2W56 B;  4XBT A;  2QA4 3;  2JQ5 A;  3D3L A;  3X3Z A;  3LML A;  3BLZ A;  2W56 A;  4J9A A;  4GL6 A;  3KSP A;  1N8R 4;  1JB2 A;  1SPU A;  5IG3 A;  3CCJ 3;  4STD A;  4HM1 B;  4KFD A;  1IVX A;  2W6J H;  3NHX A;  2HMJ B;  4MMY B;  4WP5 A;  3U97 A;  3Q90 A;  3AMO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...