2QIYA

Yeast deubiquitinase ubp3 and bre5 cofactor complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
134
Chain Sequence
VTVQDICFAFLQNYYERMRTDPSKLAYFYASTAELTHTNYQSKKDDVLPTVKVTGRENINKFFSRNDAKVRSLKLKLDTIDFQYTGHLHKSILIMATGEMFWTGTPVYKFCQTFILLPSSTFDITNDIIRFISN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords UBP3-associated protein BRE5
publication title Molecular basis for bre5 cofactor recognition by the ubp3 deubiquitylating enzyme.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 37
structure length 134
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qiyA00
5AI1A 1OGXA 1IDPA 1JKGB 3GRDA 3GWRA 5AIGA 3EBYA 4U13A 2RFRA 1O7WB 3DXOA 3F9SA 3OWUA 2XSOB 3K0ZA 3F8HA 4R9KA 4R1KA 3MYTA 1Q40A 1DMQA 1O7NB 2XSHB 4J8TA 5IENA 5AIHA 5EVHA 1DMNA 3T8NA 1Q40B 1O7HB 3EBTA 2OWPA 3F40A 3ER7A 3NUVA 1C7HA 1JN5A 4X2HA 4RZMA 5CK6A 2UX0A 4K1UA 1S5AA 1HKXA 1NU3A 2Z76A 3EC9A 3JUOA 1JB4A 2F98A 2W2CA 3MG2A 3MKIA 2HMJB 3GZXB 5JPUA 3GZBA 1CQSA 1OPYA 2HMKB 5D81A 1AR0A 5TGNA 3H3HA 5KP4A 3G16A 1ZO2A 4WP5A 4MJDA 4HM8B 3NBRA 1OF5A 2GEXA 3VGNA 4OVMA 1ASKA 4FCJA 1ULJB 6STDA 3RGRA 1GYBA 3NV0B 1W01A 5IG4A 4FCMA 3OWYA 5AIIA 3IPTA 5BXQA 1WQLB 3EQQB 1TUHA 3DZLA 5IERA 2STDA 5AIFA 5FW5A 2F99A 3FGYA 4ORLA 3B8LA 1ZX2A 4L8PA 3VSYA 1JKGA 4L8OA 2Z77A 3OWSA 3LZAA 1NDOB 3UJMA 1K41A 5CXOA 2Z7AA 5IG3A 3GZRA 2YFIB 3FH1A 4XBTA 5CF2A 3GZYB 1OHPA 1UUVB 2INXA 3A76A 4HJLB 3OX9A 4H3UA 4HM4B 1Z1SA 3JUMA 3HK4A 3FKAA 5IEPA 2HMNB 2QGUA 4HKVB 3EX9A 4KVHA 3EN8A 1W02A 4XDVA 4XB5A 3KZTA 3I0YA 3CNMA 5CF1A 4HM0B 2B24B 3M8CA 1TP6A 2RCDA 3MG1A 1Q42A 3RGAA 4HM2B 3KKGA 2YFLB 4HM5B 1OH0A 4J9AA 1OHSA 1EG9B 4HM1B 2K54A 3EN1B 5IEOA 2HMLB 3EF8A 2XRXB 2PZVA 2BMOB 4OUQA 3B7CA 3KE7A 3JUNA 5HGRA 2YFJB 8CHOA 4PEJA 4XBXA 1OCVA 4XBYA 3DM8A 3SOYA 2JQ5A 2BMRB 2XR8B 3ROBA 4WYKA 4N3VA 4Q53A 1O7MB 1EA2A 1O7PB 5BVBA 3NV0A 4WYKB 4HZ9B 5IF6A 2BNGA 2GBWB 5G2GA 3FLJA 4LMIA 2GBXB 7STDA 1ULIB 1UUWB 4GB5A 2A15A 4XDWA 3FZWA 3BLZA 4HM6B 3MG3A 3G8ZA 5D82A 3CU3A 2QIYA 3FF2A 4HM7B 2B1XB 3ECFA 2F86B 5AEWB 3WMDA 2CHCA 4STDA 3HX8A 1GY6A 1BUQA 5KP3A 4HM3B 1U5OA 1GY7A 3EHCA 1E3VA 5CLKA 4XM4A 3FSDA 1SJWA 1JB5A 3FF0A 1W6YA 3HZPA 4HVNA 1DMMA 3EJVA 4X2OA 2IMJA 1OUNA 3CNXA 1E3RA 1NWWA 3F7XA 3NHXA 5AEUB 3H51A 4L7KA 3NM2A 5JPPA 3G0KA 4LGQA 5IG5A 3MSOA 1E97A 3B4PA 4K1VA 1QMAA 1VZZA 1GY5A 5IG0A 3NXJA 3F14A 5DRVA 2GXFA 4HZBB 3K7CA 1JN5B 1A2KA 1GS3A 5D83A 3JUPA 2I9WA 3JUQA 1OGZA 3E99A 3KSPA 1O7GB 3SOAA 5STDA 2GEYA 4WWUC 1STDA 3UNLA 4LEHA 1W00A 3STDA 3DMCA 4I4KA 3D9RA 1QJGA 3LYGA 4IIAA 2HMMB 2RGQA 3OXAA 3BB9A 3OV4A 3B4OA 3F7SA 2HMOB 1OF5B 5KP1A 4R9LA 3F8XA 3Q90A 4CDLA 3CPOA 3MHEA 3SEDA 5DREA 1ISKA 2R4IA 3S5CA 2CKFB 3DUKA 1JB2A 2BMQB 3T8UA 1OHOA
chains in the Genus database with same CATH superfamily
3X3XA 4RNTA 4O3VA 5JBSA 1RTUA 1RN4A 5AI1A 2OOVC 1CH0A 1JJ22 2XFTA 4WHAA 8RNTA 1OGXA 1IDPA 1JKGB 3GRDA 3GAXA 1ROAA 1MWRA 3EBYA 3GWRA 4KFFA 2KXGA 4U13A 3RDEA 2RFRA 1O7WB 3DXOA 3F9SA 3KCHA 3OWUA 2XSOB 3K0ZA 3CCS3 3CCU3 3F8HA 3CD63 1VQ83 2OQEA 2W03A 4R9KA 1VQQA 4R1KA 3DY5A 2KRTA 3MYTA 3URPA 1BGSA 1RGHA 3LH4A 4GL6A 1RGLA 1ZS7A 4ZM8A 1Q40A 1DMQA 1W6GA 2CWVA 1YJN3 1O7NB 3QRDA 2XSHB 1GMPA 3L0RA 1YGEA 1MNLA 1UW1A 4J8TA 5BU4A 5IENA 1MGWA 1BNGA 1RSNA 5M18A 5AIHA 5EVHA 1QAKA 2GSPA 1DMNA 3N54B 3SYUA 3T8NA 1Y4KA 4BL2A 1Q40B 2L4VA 2PNCA 1O7HB 1Q824 3CCQ3 2M7OA 4EXRA 2XFSA 1VQ93 1FA3A 1BRSA 3EBTA 1PFPA 3PCSA 1RCKA 2F5MA 2OWPA 1B2ZA 1DVCA 3F40A 7GSPA 3ER7A 2WOHA 1BANA 1TRQA 3NUVA 5A0OB 1VQ53 1BSAA 1C7HA 1JN5A 1AY7A 1STFI 4JRFA 4X2HA 3D3LA 1T3BA 4RZMA 1Q864 1RN7A 5CK6A 1FZUA 1GD3A 1MWTA 1LOXA 2UX0A 3WOFB 4FMDA 2XGLA 1KQS2 3FG4A 1BRIA 4K1UA 1S5AA 3CCR3 1EKMA 1U8CB 1HKXA 1BNJA 1NU3A 2Z76A 3EC9A 3JUOA 2D1WA 2FXTA 1I3FA 1VQN3 3SX1A 2QA43 3CC43 3CC73 3JVCA 1JB4A 2F98A 2W2CA 3KSED 3MG2A 3MKIA 4J5KA 2JDIH 1YIT3 1NB5I 2CIUA 1X1UA 2BU4A 2CFLA 3G713 1S723 4LZIA 1EUIC 2HMJB 3GZXB 1BNFA 1FGQA 3D5GA 2W6JH 5JPUA 2UUGC 3GZBA 2WO0A 1LNIA 1CQSA 1TJDA 3V98A 1CYVA 1JBSA 3V92A 1OPYA 2WGQA 1UCIA 1UGIA 3UB1A 2HMKB 5D81A 1DVDA 1AR0A 2IA7A 3PCRA 3WR2A 5TGNA 3H3HA 5KP4A 1T2HA 3BNCA 3G16A 1BRJA 1SIIA 2CX0A 1ZO2A 4WP5A 1HZ1A 4BL3A 4MJDA 1PYLA 1IU7A 4HM8B 3NBRA 1V74A 1BNIA 1OF5A 2F5WA 2GEXA 3VGNA 4OVMA 4BTXA 1JZDA 1ASKA 1J2BA 4FCJA 1ULJB 1K734 6STDA 3RGRA 1BRKA 1GYBA 1NO3A 1W01A 3NV0B 4BU4A 2CW9A 4AKZA 4EV2A 1T5YA 2RNTA 3SVAA 3V99A 5IG4A 1CEWI 4FCMA 1DETA 1LVNA 1X1WA 3OWYA 3IPTA 2ZA4A 1JNQA 5AIIA 4CCVA 5BXQA 1IT7A 1JBTA 3WOEB 1GSPA 1WQLB 3EQQB 2C4BA 1PY3A 2O9UX 2E2TA 3K9MC 4BIRA 1M9GA 1YJW3 1UI8A 1TUHA 3LOYA 3DZLA 2XF3A 1SARA 2D42A 5IERA 4AEQA 2STDA 4IPBA 1I8VA 1LQMB 5AIFA 5FW5A 3IJEB 1AV4A 2F4YA 2F99A 2V1LA 1BNEA 1QALA 1B3SA 1YJ93 3FGYA 3PGBA 2CC3A 2CFWA 3X3ZA 3X40A 2ZL8A 4ORLA 2CFGA 3B8LA 1ZX2A 1Q9EA 4L8PA 4TX4A 3VSYA 3SXXA 1JKGA 1RNTA 1B20A 1BSEA 1TFKA 3LT9A 2Y74A 2Z77A 3OWSA 4L8OA 1PU4A 1IVUA 2BO9B 3LZAA 1NDOB 1BSBA 1I2EA 1N5HA 1RGFA 3CC23 2BT3A 1A2VA 1K41A 5CXOA 3UJMA 1JBRA 1I70A 1RGGA 3AHSA 1VQK3 2Z7AA 5IG3A 3GZRA 2YFIB 3FH1A 4XBTA 5CF2A 3GZYB 1BSCA 4QWTA 1V58A 3AMOB 3T0UA 1OHPA 2UGIA 3CCJ3 1K8A4 1UUVB 2INXA 2P09A 3A76A 1RRLA 3WA3A 4HAAA 4HJLB 1RCLA 3OX9A 4H3UA 1BSDA 1Z1SA 3JUMA 4HM4B 1YVSA 1VQ43 4NHFA 1YI23 3HK4A 1N9EA 3FKAA 5IEPA 2KAAA 1US1A 2HMNB 3HIGA 2J8XB 2QGUA 4HKVB 1LOWA 2E2VA 2ZHXB 4HYZA 3EX9A 4KT3B 4MMZB 4KVHA 1TRPA 3LTDA 3EN8A 1Q814 1YVBI 1W02A 4K90B 3LTCA 4XDVA 5ELJA 2ML5A 4XB5A 1BAOA 3KZTA 1KC84 3I0YA 3CNMA 2CG1A 5CF1A 2HOHA 1UCLA 2B24B 4HM0B 1V57A 3KIIA 3M8CA 4K61A 1FGTA 1M1K4 2OQEC 1TP6A 1B21A 1BRHA 4MEIA 2RSXA 3PS8A 4R4KA 5AIGA 4CJNA 2AADA 4O8SA 2BIRA 2RCDA 3MG1A 1BIRA 1Q42A 3RGAA 3WHOA 4AKYA 1IVWA 4DKIA 4GSPA 4HM2B 3KKGA 2YFLB 4HM5B 1OH0A 4J9AA 1OHSA 4GHOA 1EG9B 4N6UA 5GSPA 4HM1B 3CCM3 2K54A 3EN1B 5IEOA 2KF6A 1VQM3 1WNHA 2HMLB 1LRAA 3Q3FA 3EF8A 3G6E3 2MF7A 2XRXB 1M1XB 2PZVA 4NPBA 1Q7HA 2BMOB 4OUQA 3B7CA 3RNTA 1VQ63 1D6UA 2W9PA 3KE7A 3JUNA 2CG0A 3S67A 5HGRA 3Q1CA 2OTL3 2YFJB 8CHOA 2E2UA 4PEJA 3S27A 4XBXA 1OCVA 1B2XA 1N8R4 4XBYA 1BRGA 1MWUA 3DM8A 1B2UA 4RNZA 1MGRA 3AGNA 4N6V0 2CX1A 3SOYA 4FMCA 2JQ5A 1A2PA 2H0HA 1GOUA 2BMRB 1RDSA 2XR8B 1Q7Y4 1LQGC 1R4YA 1I2GA 2OCTA 2IUJA 3EE1A 1G96A 2ZDJA 5LC7A 3ROBA 4WYKA 2AAEA 4HBRA 1DE3A 4BTWA 1RMSA 4N3VA 6RNTA 4Q53A 1N5PA 4EV5A 3MPHA 1O7MB 1IQ8A 1YHQ3 3CCE3 4EW5A 1YIJ3 2KCDA 1EA2A 2GU3A 1O7PB 5BVBA 2C10A 3NV0A 4EYCA 4WYKB 3OW22 2SBLA 4HZ9B 1VQL3 3DGLA 3UL6A 3D5IA 3NBJA 1NJI4 4R80A 5IF6A 2BNGA 1UGHI 1JZOA 2GBWB 2R41A 1W5ZA 5G2GA 3D4AA 2P0XA 3S28A 3X42A 4N6MA 4RNYA 5BIRA 3HIIA 2QEX3 1I3IA 1K28A 3FLJA 5AYSC 2LYXA 1DYUA 1X1YA 5LC6A 4J5GA 4LMIA 2YX9A 3ZFZA 3DGYA 1BRNL 2GBXB 3NBBA 7STDA 1ULIB 3BNEA 3NQYA 4KZ1A 1MWSA 1UUWB 2IUKA 1IV7A 4GB5A 1B2SA 3KFQC 1ZGXA 2Y73A 1EQKA 2L1SA 2A15A 3X41A 4XDWA 4EC6A 1TU5A 1NNVA 3FZWA 3BNDA 1UDII 3BLZA 3WODG 1HYFA 4HM6B 3MG3A 2K3DA 3G8ZA 1OHOA 2XH9A 1AQZA 5D82A 4O02B 1IYYA 1LNHA 1LOYA 3CU3A 2QIYA 3FF2A 3I553 3AMOA 2Z6BA 5I97A 2OOVA 4HM7B 2B1XB 2CWUA 3BIRA 2XEPA 2MC8A 3ECFA 1M904 2F86B 1G02A 5AEWB 3LMLA 3IMAB 3CCL3 3WMDA 1G0TA 1FW7A 5FGOA 4N6LA 1WMOA 1AVKA 2F56A 2CHCA 3NM7A 4STDA 1NB3I 3HX8A 5G1LA 1GY6A 3WDGB 1GD4A 2H0IA 1VQ73 1BUQA 3BNBA 5KP3A 1U5OA 4HM3B 3KN4A 1GY7A 4H61A 4KFDA 3EHCA 1YGWA 2ML6A 1IQXA 4LYLB 1RHLA 3ZG5A 3I563 1E3VA 2KF5A 5CLKA 3AHWA 4XM4A 3FSDA 1W2ZA 1SJWA 1BOXA 1JB5A 3FF0A 2CFKA 1WMNA 4FCZA 1W6YA 1ROVA 4CPKA 3HZPA 2W9QA 1DMMA 4HVNA 1RKYA 3CME3 1IK3A 4FMAA 3EJVA 4X2OA 2IMJA 1UI7A 5EQLA 1BU4A 1OUNA 1W2B2 3WA2X 5M1AA 2OTJ3 3CNXA 1RGEA 1K9M4 4LSOA 1EEJA 1E3RA 3CPW2 3LXUX 1NWWA 3F7XA 3NHXA 3NQZA 5AEUB 1GOVA 1FGOA 1TTOA 3PXMA 3PZWA 2XGNA 1RLSA 3DH2A 3LTAA 3H51A 1KSIA 4L7KA 3NM2A 1B27A 3G0KA 1OACA 9RNTA 5JPPA 1N8QA 4LGQA 3NX0A 3K5TA 5IG5A 3MSOA 1E97A 1D6ZA 3K63A 3B4PA 1FUSA 1IVXA 3DGMA 1IV9A 4K1VA 1JV2B 1QMAA 1VZZA 2FGTA 3FCSB 1BUJA 3CMA3 4BTYA 1CYUA 1WMPA 3FG1A 1GY5A 2W04A 1I2FA 1I0VA 3HI7A 2KF3A 5IW9A 1X1XA 3MWZA 3AGOA 5IG0A 1JRQA 1LXEA 3NXJA 3S29A 3HOHA 5G1KA 4N6NB 1UCKA 3F14A 1RNBA 2IY2A 1UUGB 3U97A 2CH9A 2CWTA 1IT8A 5DRVA 1BNSA 2GXFA 4HZBB 3K7CA 3ALAA 1JN5B 4EBGA 3J7Yd 1A2KA 1RJOA 5ELUA 1L5GB 1GS3A 2GU1A 1BVIA 4G1MB 1SIHA 4HOHA 3VF1A 3A5EA 1FGRA 3JUPA 5D83A 2I9WA 3JUQA 1OGZA 2C11A 1R4CA 2H0GA 2LQVA 1I0XA 3E99A 2Q07A 2WGOA 3KSPA 1GMRA 4FR9A 1B2MA 1QVG2 1QVF2 1O7GB 3SOAA 3U1WA 5STDA 2GEYA 1BNRA 5RNTA 3Q2PA 3PYJA 4WWUC 1GOYA 1STDA 2CK3H 1IVVA 4LEHA 4N6TA 3UNLA 1VQO3 1MOLA 2P0MA 1SPUA 1LOVA 6GSPA 2O3OA 2WOFA 3G4S3 3CXC2 2W56A 1W4NA 1D6YA 2RBIA 5EEOA 4MMYB 4O2HA 3CCV3 1A67A 1AVLA 1YNVX 3DGNA 4WFOA 1T2IA 3TDGA 1W00A 2P05A 1RRHA 2P38A 4FMBA 2K0MA 3STDA 1GMQA 1RGCA 4MMXB 4N6OB 1N9JA 2W56B 3DMCA 4I4KA 1VQP3 3D9RA 1QJGA 4JF8A 1IQYA 3LYGA 4IIAA 2HMMB 2RGQA 2W0QA 2CFDA 1WTHA 3OXAA 4I5QA 3BB9A 4NREA 1TIJA 4OK0A 3N9HA 3OV4A 3B4OA 1UCJA 2HMOB 1OF5B 3D79A 3F7SA 5KP1A 1C54A 4IT7A 2BHMA 4R9LA 3F8XA 3Q90A 3GSPA 4CDLA 1HU9A 3QK9A 3O8YA 3LT8A 3LTBA 3FG3A 3SLUA 3CPOA 1QAFA 5HOHA 1RN1A 3MHEA 1A90A 5AYRB 3SEDA 1RGKA 1KWIA 2FNQA 4RBNA 5DREA 1ISKA 4ILFA 1KD14 2KF4A 2SARA 3N8BA 1F8NA 2R4IA 3S5CA 1FYSA 1FUTA 2CKFB 3DUKA 1W6CA 1TFOA 7RNTA 1JB2A 4KFEA 3DGOA 1FUWA 1FGMA 2BMQB 3T8UA 1SQWA 3ZG0A 3X3YA 2IYJA 3BU4A 3UL5A 3EB8A 1RGAA 1W7CA 5M19A
chains in the Genus database with same CATH topology
3X3XA 4O3VA 5JBSA 5AI1A 2OOVC 1JJ22 2XFTA 4WHAA 1OGXA 1IDPA 1JKGB 3GRDA 3GAXA 1ROAA 3GWRA 3EBYA 4KFFA 4U13A 2KXGA 3RDEA 2RFRA 1O7WB 3DXOA 3F9SA 3OWUA 3CCS3 2XSOB 3K0ZA 3CD63 3CCU3 3F8HA 1VQ83 2OQEA 2W03A 4R9KA 4R1KA 3DY5A 2KRTA 3MYTA 3LH4A 4GL6A 4ZM8A 1Q40A 1DMQA 1W6GA 2CWVA 1YJN3 1O7NB 3QRDA 2XSHB 3L0RA 1YGEA 1MNLA 1UW1A 4J8TA 5IENA 5AIHA 5EVHA 1QAKA 1DMNA 3N54B 3T8NA 1Y4KA 1Q40B 2L4VA 2PNCA 1O7HB 1Q824 3CCQ3 2M7OA 4EXRA 2XFSA 1VQ93 1FA3A 3EBTA 3PCSA 1PFPA 2OWPA 1DVCA 3F40A 3ER7A 2WOHA 3NUVA 5A0OB 1VQ53 1C7HA 1JN5A 1STFI 4JRFA 4X2HA 3D3LA 4RZMA 1Q864 1RN7A 5CK6A 1GD3A 1LOXA 2UX0A 3WOFB 4FMDA 2XGLA 1KQS2 3FG4A 4K1UA 1S5AA 3CCR3 1EKMA 1U8CB 1HKXA 1NU3A 2Z76A 3EC9A 3JUOA 2D1WA 2FXTA 1VQN3 3SX1A 2QA43 3CC43 3CC73 3JVCA 1JB4A 2F98A 2W2CA 3KSED 3MG2A 3MKIA 1NB5I 2JDIH 1YIT3 2CIUA 2CFLA 3G713 1S723 4LZIA 2HMJB 3GZXB 1FGQA 2W6JH 5JPUA 3GZBA 2WO0A 1CQSA 3V98A 1CYVA 3V92A 1OPYA 2WGQA 3UB1A 2HMKB 5D81A 1DVDA 1AR0A 2IA7A 3PCRA 5TGNA 3H3HA 5KP4A 3BNCA 3G16A 1SIIA 1ZO2A 4WP5A 4MJDA 4HM8B 1IU7A 3NBRA 1V74A 1OF5A 2GEXA 3VGNA 4OVMA 4BTXA 1ASKA 1J2BA 4FCJA 1ULJB 1K734 6STDA 3RGRA 1GYBA 1NO3A 3NV0B 1W01A 2CW9A 4AKZA 4EV2A 1T5YA 3SVAA 3V99A 5IG4A 1CEWI 4FCMA 1LVNA 3OWYA 5AIIA 3IPTA 1JNQA 4CCVA 5BXQA 1IT7A 3WOEB 1WQLB 3EQQB 2O9UX 3K9MC 2E2TA 1M9GA 1YJW3 1UI8A 1TUHA 3LOYA 3DZLA 2XF3A 2D42A 5IERA 4AEQA 2STDA 4IPBA 5AIFA 5FW5A 3IJEB 1AV4A 2F99A 2V1LA 1YJ93 1QALA 3FGYA 3PGBA 2CC3A 2CFWA 3X3ZA 3X40A 2ZL8A 4ORLA 2CFGA 3B8LA 1ZX2A 4L8PA 4TX4A 3VSYA 3SXXA 1JKGA 3LT9A 1TFKA 4L8OA 2Y74A 2Z77A 3OWSA 1PU4A 1IVUA 2BO9B 3LZAA 1NDOB 3CC23 1N5HA 2BT3A 1A2VA 1K41A 5CXOA 3UJMA 1VQK3 2Z7AA 5IG3A 3GZRA 2YFIB 3FH1A 4XBTA 5CF2A 3GZYB 4QWTA 3AMOB 3T0UA 1OHPA 3CCJ3 1K8A4 1UUVB 2INXA 2P09A 3A76A 1RRLA 3WA3A 4HJLB 3OX9A 4H3UA 4HM4B 1Z1SA 3JUMA 1VQ43 4NHFA 1YI23 3HK4A 1N9EA 3FKAA 5IEPA 1US1A 2HMNB 3HIGA 2QGUA 4HKVB 2E2VA 4HYZA 3EX9A 4MMZB 4KVHA 3LTDA 3EN8A 1Q814 1YVBI 1W02A 4K90B 3LTCA 4XDVA 5ELJA 2ML5A 4XB5A 3KZTA 1KC84 3I0YA 3CNMA 2CG1A 5CF1A 4HM0B 2B24B 3KIIA 3M8CA 4K61A 1FGTA 1M1K4 2OQEC 1TP6A 4MEIA 2RSXA 3PS8A 4R4KA 5AIGA 4O8SA 2RCDA 3MG1A 1Q42A 3RGAA 4AKYA 1IVWA 4HM2B 3KKGA 2YFLB 4HM5B 1OH0A 4J9AA 1OHSA 1EG9B 4N6UA 3CCM3 4HM1B 1VQM3 2K54A 3EN1B 5IEOA 1WNHA 2HMLB 3EF8A 3G6E3 2MF7A 2XRXB 1M1XB 2PZVA 2BMOB 4OUQA 3B7CA 1VQ63 1D6UA 2W9PA 3KE7A 3JUNA 2CG0A 3S67A 5HGRA 3Q1CA 2OTL3 2YFJB 8CHOA 2E2UA 4PEJA 3S27A 4XBXA 1OCVA 1N8R4 4XBYA 3DM8A 4RNZA 3SOYA 4N6V0 4FMCA 2JQ5A 2BMRB 2XR8B 1Q7Y4 2OCTA 2IUJA 3EE1A 1G96A 2ZDJA 5LC7A 3ROBA 4WYKA 4HBRA 4BTWA 4N3VA 4Q53A 1N5PA 4EV5A 3MPHA 1O7MB 1IQ8A 1YHQ3 3CCE3 1YIJ3 2KCDA 1EA2A 2GU3A 1O7PB 5BVBA 2C10A 3NV0A 4EYCA 4WYKB 3OW22 2SBLA 4HZ9B 1VQL3 3DGLA 3UL6A 3NBJA 1NJI4 4R80A 5IF6A 2BNGA 2GBWB 1W5ZA 5G2GA 2P0XA 3S28A 3X42A 4N6MA 4RNYA 3HIIA 2QEX3 3FLJA 1K28A 5AYSC 2LYXA 1DYUA 5LC6A 4LMIA 2YX9A 2GBXB 3NBBA 7STDA 1ULIB 3BNEA 3NQYA 4KZ1A 1UUWB 2IUKA 1IV7A 4GB5A 3KFQC 2Y73A 1EQKA 2A15A 3X41A 4XDWA 4EC6A 1TU5A 3FZWA 3BNDA 3BLZA 3WODG 4HM6B 3MG3A 3G8ZA 2XH9A 1OHOA 5D82A 4O02B 1LNHA 3CU3A 2QIYA 3FF2A 3I553 3AMOA 2Z6BA 5I97A 2OOVA 4HM7B 2B1XB 2CWUA 2XEPA 2MC8A 3ECFA 1M904 2F86B 5AEWB 3LMLA 3IMAB 3CCL3 3WMDA 5FGOA 4N6LA 1WMOA 1AVKA 2CHCA 3NM7A 4STDA 1NB3I 3HX8A 1GY6A 3WDGB 1GD4A 1VQ73 1BUQA 3BNBA 5KP3A 1U5OA 4HM3B 3KN4A 1GY7A 4H61A 4KFDA 3EHCA 2ML6A 1IQXA 3I563 1E3VA 5CLKA 4XM4A 3FSDA 1W2ZA 1SJWA 1JB5A 3FF0A 2CFKA 1WMNA 4FCZA 1W6YA 1ROVA 3HZPA 2W9QA 1DMMA 4HVNA 1RKYA 3CME3 1IK3A 4FMAA 3EJVA 4X2OA 2IMJA 1UI7A 5EQLA 1W2B2 1OUNA 3WA2X 2OTJ3 3CNXA 1K9M4 4LSOA 1E3RA 3CPW2 3LXUX 1NWWA 3F7XA 3NHXA 3NQZA 5AEUB 1FGOA 3PXMA 3PZWA 2XGNA 3LTAA 3H51A 1KSIA 4L7KA 3NM2A 5JPPA 3G0KA 1OACA 1N8QA 4LGQA 3NX0A 3K5TA 5IG5A 3MSOA 1E97A 1D6ZA 3K63A 3B4PA 1IVXA 3DGMA 1IV9A 4K1VA 1JV2B 1QMAA 1VZZA 2FGTA 3FCSB 3CMA3 4BTYA 1CYUA 1WMPA 3FG1A 1GY5A 2W04A 3HI7A 5IW9A 3MWZA 5IG0A 1JRQA 1LXEA 3NXJA 3S29A 4N6NB 3F14A 3U97A 2CH9A 2CWTA 1IT8A 5DRVA 2GXFA 4HZBB 3K7CA 3ALAA 1JN5B 4EBGA 3J7Yd 1A2KA 1RJOA 5ELUA 1L5GB 1GS3A 2GU1A 4G1MB 1SIHA 3VF1A 5D83A 1FGRA 3JUPA 2I9WA 3JUQA 1OGZA 2C11A 1R4CA 2LQVA 3E99A 2Q07A 2WGOA 3KSPA 4FR9A 1QVG2 1QVF2 1O7GB 3SOAA 3U1WA 5STDA 2GEYA 3Q2PA 3PYJA 4WWUC 1STDA 4N6TA 1IVVA 4LEHA 3UNLA 1VQO3 1MOLA 2P0MA 1SPUA 2O3OA 2WOFA 3G4S3 3CXC2 2W56A 1W4NA 1D6YA 5EEOA 4MMYB 4O2HA 3CCV3 1A67A 1AVLA 3DGNA 4WFOA 3TDGA 1W00A 2P05A 1RRHA 2P38A 4FMBA 2K0MA 3STDA 4MMXB 4N6OB 1N9JA 2W56B 3DMCA 4I4KA 1VQP3 3D9RA 1QJGA 4JF8A 1IQYA 3LYGA 4IIAA 2HMMB 2RGQA 2W0QA 2CFDA 1WTHA 3OXAA 3BB9A 4NREA 1TIJA 4OK0A 3N9HA 3OV4A 3B4OA 3F7SA 2HMOB 1OF5B 5KP1A 4IT7A 2BHMA 4R9LA 3F8XA 3Q90A 4CDLA 1HU9A 3QK9A 3O8YA 3LT8A 3LTBA 3FG3A 3SLUA 3CPOA 1QAFA 3MHEA 1A90A 5AYRB 3SEDA 5DREA 1KWIA 2FNQA 4RBNA 1ISKA 1KD14 3N8BA 1F8NA 2R4IA 3S5CA 2CKFB 3DUKA 1W6CA 1TFOA 1JB2A 4KFEA 3DGOA 1FUWA 1FGMA 2BMQB 3T8UA 1SQWA 3X3YA 3UL5A 3EB8A 2CK3H 1W7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AI1 A;  1OGX A;  1IDP A;  1JKG B;  3GRD A;  3GWR A;  5AIG A;  3EBY A;  4U13 A;  2RFR A;  1O7W B;  3DXO A;  3F9S A;  3OWU A;  2XSO B;  3K0Z A;  3F8H A;  4R9K A;  4R1K A;  3MYT A;  1Q40 A;  1DMQ A;  1O7N B;  2XSH B;  4J8T A;  5IEN A;  5AIH A;  5EVH A;  1DMN A;  3T8N A;  1Q40 B;  1O7H B;  3EBT A;  2OWP A;  3F40 A;  3ER7 A;  3NUV A;  1C7H A;  1JN5 A;  4X2H A;  4RZM A;  5CK6 A;  2UX0 A;  4K1U A;  1S5A A;  1HKX A;  1NU3 A;  2Z76 A;  3EC9 A;  3JUO A;  1JB4 A;  2F98 A;  2W2C A;  3MG2 A;  3MKI A;  2HMJ B;  3GZX B;  5JPU A;  3GZB A;  1CQS A;  1OPY A;  2HMK B;  5D81 A;  1AR0 A;  5TGN A;  3H3H A;  5KP4 A;  3G16 A;  1ZO2 A;  4WP5 A;  4MJD A;  4HM8 B;  3NBR A;  1OF5 A;  2GEX A;  3VGN A;  4OVM A;  1ASK A;  4FCJ A;  1ULJ B;  6STD A;  3RGR A;  1GYB A;  3NV0 B;  1W01 A;  5IG4 A;  4FCM A;  3OWY A;  5AII A;  3IPT A;  5BXQ A;  1WQL B;  3EQQ B;  1TUH A;  3DZL A;  5IER A;  2STD A;  5AIF A;  5FW5 A;  2F99 A;  3FGY A;  4ORL A;  3B8L A;  1ZX2 A;  4L8P A;  3VSY A;  1JKG A;  4L8O A;  2Z77 A;  3OWS A;  3LZA A;  1NDO B;  3UJM A;  1K41 A;  5CXO A;  2Z7A A;  5IG3 A;  3GZR A;  2YFI B;  3FH1 A;  4XBT A;  5CF2 A;  3GZY B;  1OHP A;  1UUV B;  2INX A;  3A76 A;  4HJL B;  3OX9 A;  4H3U A;  4HM4 B;  1Z1S A;  3JUM A;  3HK4 A;  3FKA A;  5IEP A;  2HMN B;  2QGU A;  4HKV B;  3EX9 A;  4KVH A;  3EN8 A;  1W02 A;  4XDV A;  4XB5 A;  3KZT A;  3I0Y A;  3CNM A;  5CF1 A;  4HM0 B;  2B24 B;  3M8C A;  1TP6 A;  2RCD A;  3MG1 A;  1Q42 A;  3RGA A;  4HM2 B;  3KKG A;  2YFL B;  4HM5 B;  1OH0 A;  4J9A A;  1OHS A;  1EG9 B;  4HM1 B;  2K54 A;  3EN1 B;  5IEO A;  2HML B;  3EF8 A;  2XRX B;  2PZV A;  2BMO B;  4OUQ A;  3B7C A;  3KE7 A;  3JUN A;  5HGR A;  2YFJ B;  8CHO A;  4PEJ A;  4XBX A;  1OCV A;  4XBY A;  3DM8 A;  3SOY A;  2JQ5 A;  2BMR B;  2XR8 B;  3ROB A;  4WYK A;  4N3V A;  4Q53 A;  1O7M B;  1EA2 A;  1O7P B;  5BVB A;  3NV0 A;  4WYK B;  4HZ9 B;  5IF6 A;  2BNG A;  2GBW B;  5G2G A;  3FLJ A;  4LMI A;  2GBX B;  7STD A;  1ULI B;  1UUW B;  4GB5 A;  2A15 A;  4XDW A;  3FZW A;  3BLZ A;  4HM6 B;  3MG3 A;  3G8Z A;  5D82 A;  3CU3 A;  2QIY A;  3FF2 A;  4HM7 B;  2B1X B;  3ECF A;  2F86 B;  5AEW B;  3WMD A;  2CHC A;  4STD A;  3HX8 A;  1GY6 A;  1BUQ A;  5KP3 A;  4HM3 B;  1U5O A;  1GY7 A;  3EHC A;  1E3V A;  5CLK A;  4XM4 A;  3FSD A;  1SJW A;  1JB5 A;  3FF0 A;  1W6Y A;  3HZP A;  4HVN A;  1DMM A;  3EJV A;  4X2O A;  2IMJ A;  1OUN A;  3CNX A;  1E3R A;  1NWW A;  3F7X A;  3NHX A;  5AEU B;  3H51 A;  4L7K A;  3NM2 A;  5JPP A;  3G0K A;  4LGQ A;  5IG5 A;  3MSO A;  1E97 A;  3B4P A;  4K1V A;  1QMA A;  1VZZ A;  1GY5 A;  5IG0 A;  3NXJ A;  3F14 A;  5DRV A;  2GXF A;  4HZB B;  3K7C A;  1JN5 B;  1A2K A;  1GS3 A;  5D83 A;  3JUP A;  2I9W A;  3JUQ A;  1OGZ A;  3E99 A;  3KSP A;  1O7G B;  3SOA A;  5STD A;  2GEY A;  4WWU C;  1STD A;  3UNL A;  4LEH A;  1W00 A;  3STD A;  3DMC A;  4I4K A;  3D9R A;  1QJG A;  3LYG A;  4IIA A;  2HMM B;  2RGQ A;  3OXA A;  3BB9 A;  3OV4 A;  3B4O A;  3F7S A;  2HMO B;  1OF5 B;  5KP1 A;  4R9L A;  3F8X A;  3Q90 A;  4CDL A;  3CPO A;  3MHE A;  3SED A;  5DRE A;  1ISK A;  2R4I A;  3S5C A;  2CKF B;  3DUK A;  1JB2 A;  2BMQ B;  3T8U A;  1OHO A; 
#chains in the Genus database with same CATH topology
 3X3X A;  4RNT A;  4O3V A;  5JBS A;  1RTU A;  1RN4 A;  5AI1 A;  2OOV C;  1CH0 A;  1JJ2 2;  2XFT A;  4WHA A;  8RNT A;  1OGX A;  1IDP A;  1JKG B;  3GRD A;  3GAX A;  1ROA A;  1MWR A;  3EBY A;  3GWR A;  4KFF A;  2KXG A;  4U13 A;  3RDE A;  2RFR A;  1O7W B;  3DXO A;  3F9S A;  3KCH A;  3OWU A;  2XSO B;  3K0Z A;  3CCS 3;  3CCU 3;  3F8H A;  3CD6 3;  1VQ8 3;  2OQE A;  2W03 A;  4R9K A;  1VQQ A;  4R1K A;  3DY5 A;  2KRT A;  3MYT A;  3URP A;  1BGS A;  1RGH A;  3LH4 A;  4GL6 A;  1RGL A;  1ZS7 A;  4ZM8 A;  1Q40 A;  1DMQ A;  1W6G A;  2CWV A;  1YJN 3;  1O7N B;  3QRD A;  2XSH B;  1GMP A;  3L0R A;  1YGE A;  1MNL A;  1UW1 A;  4J8T A;  5BU4 A;  5IEN A;  1MGW A;  1BNG A;  1RSN A;  5M18 A;  5AIH A;  5EVH A;  1QAK A;  2GSP A;  1DMN A;  3N54 B;  3SYU A;  3T8N A;  1Y4K A;  4BL2 A;  1Q40 B;  2L4V A;  2PNC A;  1O7H B;  1Q82 4;  3CCQ 3;  2M7O A;  4EXR A;  2XFS A;  1VQ9 3;  1FA3 A;  1BRS A;  3EBT A;  1PFP A;  3PCS A;  1RCK A;  2F5M A;  2OWP A;  1B2Z A;  1DVC A;  3F40 A;  7GSP A;  3ER7 A;  2WOH A;  1BAN A;  1TRQ A;  3NUV A;  5A0O B;  1VQ5 3;  1BSA A;  1C7H A;  1JN5 A;  1AY7 A;  1STF I;  4JRF A;  4X2H A;  3D3L A;  1T3B A;  4RZM A;  1Q86 4;  1RN7 A;  5CK6 A;  1FZU A;  1GD3 A;  1MWT A;  1LOX A;  2UX0 A;  3WOF B;  4FMD A;  2XGL A;  1KQS 2;  3FG4 A;  1BRI A;  4K1U A;  1S5A A;  3CCR 3;  1EKM A;  1U8C B;  1HKX A;  1BNJ A;  1NU3 A;  2Z76 A;  3EC9 A;  3JUO A;  2D1W A;  2FXT A;  1I3F A;  1VQN 3;  3SX1 A;  2QA4 3;  3CC4 3;  3CC7 3;  3JVC A;  1JB4 A;  2F98 A;  2W2C A;  3KSE D;  3MG2 A;  3MKI A;  4J5K A;  2JDI H;  1YIT 3;  1NB5 I;  2CIU A;  1X1U A;  2BU4 A;  2CFL A;  3G71 3;  1S72 3;  4LZI A;  1EUI C;  2HMJ B;  3GZX B;  1BNF A;  1FGQ A;  3D5G A;  2W6J H;  5JPU A;  2UUG C;  3GZB A;  2WO0 A;  1LNI A;  1CQS A;  1TJD A;  3V98 A;  1CYV A;  1JBS A;  3V92 A;  1OPY A;  2WGQ A;  1UCI A;  1UGI A;  3UB1 A;  2HMK B;  5D81 A;  1DVD A;  1AR0 A;  2IA7 A;  3PCR A;  3WR2 A;  5TGN A;  3H3H A;  5KP4 A;  1T2H A;  3BNC A;  3G16 A;  1BRJ A;  1SII A;  2CX0 A;  1ZO2 A;  4WP5 A;  1HZ1 A;  4BL3 A;  4MJD A;  1PYL A;  1IU7 A;  4HM8 B;  3NBR A;  1V74 A;  1BNI A;  1OF5 A;  2F5W A;  2GEX A;  3VGN A;  4OVM A;  4BTX A;  1JZD A;  1ASK A;  1J2B A;  4FCJ A;  1ULJ B;  1K73 4;  6STD A;  3RGR A;  1BRK A;  1GYB A;  1NO3 A;  1W01 A;  3NV0 B;  4BU4 A;  2CW9 A;  4AKZ A;  4EV2 A;  1T5Y A;  2RNT A;  3SVA A;  3V99 A;  5IG4 A;  1CEW I;  4FCM A;  1DET A;  1LVN A;  1X1W A;  3OWY A;  3IPT A;  2ZA4 A;  1JNQ A;  5AII A;  4CCV A;  5BXQ A;  1IT7 A;  1JBT A;  3WOE B;  1GSP A;  1WQL B;  3EQQ B;  2C4B A;  1PY3 A;  2O9U X;  2E2T A;  3K9M C;  4BIR A;  1M9G A;  1YJW 3;  1UI8 A;  1TUH A;  3LOY A;  3DZL A;  2XF3 A;  1SAR A;  2D42 A;  5IER A;  4AEQ A;  2STD A;  4IPB A;  1I8V A;  1LQM B;  5AIF A;  5FW5 A;  3IJE B;  1AV4 A;  2F4Y A;  2F99 A;  2V1L A;  1BNE A;  1QAL A;  1B3S A;  1YJ9 3;  3FGY A;  3PGB A;  2CC3 A;  2CFW A;  3X3Z A;  3X40 A;  2ZL8 A;  4ORL A;  2CFG A;  3B8L A;  1ZX2 A;  1Q9E A;  4L8P A;  4TX4 A;  3VSY A;  3SXX A;  1JKG A;  1RNT A;  1B20 A;  1BSE A;  1TFK A;  3LT9 A;  2Y74 A;  2Z77 A;  3OWS A;  4L8O A;  1PU4 A;  1IVU A;  2BO9 B;  3LZA A;  1NDO B;  1BSB A;  1I2E A;  1N5H A;  1RGF A;  3CC2 3;  2BT3 A;  1A2V A;  1K41 A;  5CXO A;  3UJM A;  1JBR A;  1I70 A;  1RGG A;  3AHS A;  1VQK 3;  2Z7A A;  5IG3 A;  3GZR A;  2YFI B;  3FH1 A;  4XBT A;  5CF2 A;  3GZY B;  1BSC A;  4QWT A;  1V58 A;  3AMO B;  3T0U A;  1OHP A;  2UGI A;  3CCJ 3;  1K8A 4;  1UUV B;  2INX A;  2P09 A;  3A76 A;  1RRL A;  3WA3 A;  4HAA A;  4HJL B;  1RCL A;  3OX9 A;  4H3U A;  1BSD A;  1Z1S A;  3JUM A;  4HM4 B;  1YVS A;  1VQ4 3;  4NHF A;  1YI2 3;  3HK4 A;  1N9E A;  3FKA A;  5IEP A;  2KAA A;  1US1 A;  2HMN B;  3HIG A;  2J8X B;  2QGU A;  4HKV B;  1LOW A;  2E2V A;  2ZHX B;  4HYZ A;  3EX9 A;  4KT3 B;  4MMZ B;  4KVH A;  1TRP A;  3LTD A;  3EN8 A;  1Q81 4;  1YVB I;  1W02 A;  4K90 B;  3LTC A;  4XDV A;  5ELJ A;  2ML5 A;  4XB5 A;  1BAO A;  3KZT A;  1KC8 4;  3I0Y A;  3CNM A;  2CG1 A;  5CF1 A;  2HOH A;  1UCL A;  2B24 B;  4HM0 B;  1V57 A;  3KII A;  3M8C A;  4K61 A;  1FGT A;  1M1K 4;  2OQE C;  1TP6 A;  1B21 A;  1BRH A;  4MEI A;  2RSX A;  3PS8 A;  4R4K A;  5AIG A;  4CJN A;  2AAD A;  4O8S A;  2BIR A;  2RCD A;  3MG1 A;  1BIR A;  1Q42 A;  3RGA A;  3WHO A;  4AKY A;  1IVW A;  4DKI A;  4GSP A;  4HM2 B;  3KKG A;  2YFL B;  4HM5 B;  1OH0 A;  4J9A A;  1OHS A;  4GHO A;  1EG9 B;  4N6U A;  5GSP A;  4HM1 B;  3CCM 3;  2K54 A;  3EN1 B;  5IEO A;  2KF6 A;  1VQM 3;  1WNH A;  2HML B;  1LRA A;  3Q3F A;  3EF8 A;  3G6E 3;  2MF7 A;  2XRX B;  1M1X B;  2PZV A;  4NPB A;  1Q7H A;  2BMO B;  4OUQ A;  3B7C A;  3RNT A;  1VQ6 3;  1D6U A;  2W9P A;  3KE7 A;  3JUN A;  2CG0 A;  3S67 A;  5HGR A;  3Q1C A;  2OTL 3;  2YFJ B;  8CHO A;  2E2U A;  4PEJ A;  3S27 A;  4XBX A;  1OCV A;  1B2X A;  1N8R 4;  4XBY A;  1BRG A;  1MWU A;  3DM8 A;  1B2U A;  4RNZ A;  1MGR A;  3AGN A;  4N6V 0;  2CX1 A;  3SOY A;  4FMC A;  2JQ5 A;  1A2P A;  2H0H A;  1GOU A;  2BMR B;  1RDS A;  2XR8 B;  1Q7Y 4;  1LQG C;  1R4Y A;  1I2G A;  2OCT A;  2IUJ A;  3EE1 A;  1G96 A;  2ZDJ A;  5LC7 A;  3ROB A;  4WYK A;  2AAE A;  4HBR A;  1DE3 A;  4BTW A;  1RMS A;  4N3V A;  6RNT A;  4Q53 A;  1N5P A;  4EV5 A;  3MPH A;  1O7M B;  1IQ8 A;  1YHQ 3;  3CCE 3;  4EW5 A;  1YIJ 3;  2KCD A;  1EA2 A;  2GU3 A;  1O7P B;  5BVB A;  2C10 A;  3NV0 A;  4EYC A;  4WYK B;  3OW2 2;  2SBL A;  4HZ9 B;  1VQL 3;  3DGL A;  3UL6 A;  3D5I A;  3NBJ A;  1NJI 4;  4R80 A;  5IF6 A;  2BNG A;  1UGH I;  1JZO A;  2GBW B;  2R41 A;  1W5Z A;  5G2G A;  3D4A A;  2P0X A;  3S28 A;  3X42 A;  4N6M A;  4RNY A;  5BIR A;  3HII A;  2QEX 3;  1I3I A;  1K28 A;  3FLJ A;  5AYS C;  2LYX A;  1DYU A;  1X1Y A;  5LC6 A;  4J5G A;  4LMI A;  2YX9 A;  3ZFZ A;  3DGY A;  1BRN L;  2GBX B;  3NBB A;  7STD A;  1ULI B;  3BNE A;  3NQY A;  4KZ1 A;  1MWS A;  1UUW B;  2IUK A;  1IV7 A;  4GB5 A;  1B2S A;  3KFQ C;  1ZGX A;  2Y73 A;  1EQK A;  2L1S A;  2A15 A;  3X41 A;  4XDW A;  4EC6 A;  1TU5 A;  1NNV A;  3FZW A;  3BND A;  1UDI I;  3BLZ A;  3WOD G;  1HYF A;  4HM6 B;  3MG3 A;  2K3D A;  3G8Z A;  1OHO A;  2XH9 A;  1AQZ A;  5D82 A;  4O02 B;  1IYY A;  1LNH A;  1LOY A;  3CU3 A;  2QIY A;  3FF2 A;  3I55 3;  3AMO A;  2Z6B A;  5I97 A;  2OOV A;  4HM7 B;  2B1X B;  2CWU A;  3BIR A;  2XEP A;  2MC8 A;  3ECF A;  1M90 4;  2F86 B;  1G02 A;  5AEW B;  3LML A;  3IMA B;  3CCL 3;  3WMD A;  1G0T A;  1FW7 A;  5FGO A;  4N6L A;  1WMO A;  1AVK A;  2F56 A;  2CHC A;  3NM7 A;  4STD A;  1NB3 I;  3HX8 A;  5G1L A;  1GY6 A;  3WDG B;  1GD4 A;  2H0I A;  1VQ7 3;  1BUQ A;  3BNB A;  5KP3 A;  1U5O A;  4HM3 B;  3KN4 A;  1GY7 A;  4H61 A;  4KFD A;  3EHC A;  1YGW A;  2ML6 A;  1IQX A;  4LYL B;  1RHL A;  3ZG5 A;  3I56 3;  1E3V A;  2KF5 A;  5CLK A;  3AHW A;  4XM4 A;  3FSD A;  1W2Z A;  1SJW A;  1BOX A;  1JB5 A;  3FF0 A;  2CFK A;  1WMN A;  4FCZ A;  1W6Y A;  1ROV A;  4CPK A;  3HZP A;  2W9Q A;  1DMM A;  4HVN A;  1RKY A;  3CME 3;  1IK3 A;  4FMA A;  3EJV A;  4X2O A;  2IMJ A;  1UI7 A;  5EQL A;  1BU4 A;  1OUN A;  1W2B 2;  3WA2 X;  5M1A A;  2OTJ 3;  3CNX A;  1RGE A;  1K9M 4;  4LSO A;  1EEJ A;  1E3R A;  3CPW 2;  3LXU X;  1NWW A;  3F7X A;  3NHX A;  3NQZ A;  5AEU B;  1GOV A;  1FGO A;  1TTO A;  3PXM A;  3PZW A;  2XGN A;  1RLS A;  3DH2 A;  3LTA A;  3H51 A;  1KSI A;  4L7K A;  3NM2 A;  1B27 A;  3G0K A;  1OAC A;  9RNT A;  5JPP A;  1N8Q A;  4LGQ A;  3NX0 A;  3K5T A;  5IG5 A;  3MSO A;  1E97 A;  1D6Z A;  3K63 A;  3B4P A;  1FUS A;  1IVX A;  3DGM A;  1IV9 A;  4K1V A;  1JV2 B;  1QMA A;  1VZZ A;  2FGT A;  3FCS B;  1BUJ A;  3CMA 3;  4BTY A;  1CYU A;  1WMP A;  3FG1 A;  1GY5 A;  2W04 A;  1I2F A;  1I0V A;  3HI7 A;  2KF3 A;  5IW9 A;  1X1X A;  3MWZ A;  3AGO A;  5IG0 A;  1JRQ A;  1LXE A;  3NXJ A;  3S29 A;  3HOH A;  5G1K A;  4N6N B;  1UCK A;  3F14 A;  1RNB A;  2IY2 A;  1UUG B;  3U97 A;  2CH9 A;  2CWT A;  1IT8 A;  5DRV A;  1BNS A;  2GXF A;  4HZB B;  3K7C A;  3ALA A;  1JN5 B;  4EBG A;  3J7Y d;  1A2K A;  1RJO A;  5ELU A;  1L5G B;  1GS3 A;  2GU1 A;  1BVI A;  4G1M B;  1SIH A;  4HOH A;  3VF1 A;  3A5E A;  1FGR A;  3JUP A;  5D83 A;  2I9W A;  3JUQ A;  1OGZ A;  2C11 A;  1R4C A;  2H0G A;  2LQV A;  1I0X A;  3E99 A;  2Q07 A;  2WGO A;  3KSP A;  1GMR A;  4FR9 A;  1B2M A;  1QVG 2;  1QVF 2;  1O7G B;  3SOA A;  3U1W A;  5STD A;  2GEY A;  1BNR A;  5RNT A;  3Q2P A;  3PYJ A;  4WWU C;  1GOY A;  1STD A;  2CK3 H;  1IVV A;  4LEH A;  4N6T A;  3UNL A;  1VQO 3;  1MOL A;  2P0M A;  1SPU A;  1LOV A;  6GSP A;  2O3O A;  2WOF A;  3G4S 3;  3CXC 2;  2W56 A;  1W4N A;  1D6Y A;  2RBI A;  5EEO A;  4MMY B;  4O2H A;  3CCV 3;  1A67 A;  1AVL A;  1YNV X;  3DGN A;  4WFO A;  1T2I A;  3TDG A;  1W00 A;  2P05 A;  1RRH A;  2P38 A;  4FMB A;  2K0M A;  3STD A;  1GMQ A;  1RGC A;  4MMX B;  4N6O B;  1N9J A;  2W56 B;  3DMC A;  4I4K A;  1VQP 3;  3D9R A;  1QJG A;  4JF8 A;  1IQY A;  3LYG A;  4IIA A;  2HMM B;  2RGQ A;  2W0Q A;  2CFD A;  1WTH A;  3OXA A;  4I5Q A;  3BB9 A;  4NRE A;  1TIJ A;  4OK0 A;  3N9H A;  3OV4 A;  3B4O A;  1UCJ A;  2HMO B;  1OF5 B;  3D79 A;  3F7S A;  5KP1 A;  1C54 A;  4IT7 A;  2BHM A;  4R9L A;  3F8X A;  3Q90 A;  3GSP A;  4CDL A;  1HU9 A;  3QK9 A;  3O8Y A;  3LT8 A;  3LTB A;  3FG3 A;  3SLU A;  3CPO A;  1QAF A;  5HOH A;  1RN1 A;  3MHE A;  1A90 A;  5AYR B;  3SED A;  1RGK A;  1KWI A;  2FNQ A;  4RBN A;  5DRE A;  1ISK A;  4ILF A;  1KD1 4;  2KF4 A;  2SAR A;  3N8B A;  1F8N A;  2R4I A;  3S5C A;  1FYS A;  1FUT A;  2CKF B;  3DUK A;  1W6C A;  1TFO A;  7RNT A;  1JB2 A;  4KFE A;  3DGO A;  1FUW A;  1FGM A;  2BMQ B;  3T8U A;  1SQW A;  3ZG0 A;  3X3Y A;  2IYJ A;  3BU4 A;  3UL5 A;  3EB8 A;  1RGA A;  1W7C A;  5M19 A; 
#chains in the Genus database with same CATH homology
 3X3X A;  4O3V A;  5JBS A;  5AI1 A;  2OOV C;  1JJ2 2;  2XFT A;  4WHA A;  1OGX A;  1IDP A;  1JKG B;  3GRD A;  3GAX A;  1ROA A;  3GWR A;  3EBY A;  4KFF A;  4U13 A;  2KXG A;  3RDE A;  2RFR A;  1O7W B;  3DXO A;  3F9S A;  3OWU A;  3CCS 3;  2XSO B;  3K0Z A;  3CD6 3;  3CCU 3;  3F8H A;  1VQ8 3;  2OQE A;  2W03 A;  4R9K A;  4R1K A;  3DY5 A;  2KRT A;  3MYT A;  3LH4 A;  4GL6 A;  4ZM8 A;  1Q40 A;  1DMQ A;  1W6G A;  2CWV A;  1YJN 3;  1O7N B;  3QRD A;  2XSH B;  3L0R A;  1YGE A;  1MNL A;  1UW1 A;  4J8T A;  5IEN A;  5AIH A;  5EVH A;  1QAK A;  1DMN A;  3N54 B;  3T8N A;  1Y4K A;  1Q40 B;  2L4V A;  2PNC A;  1O7H B;  1Q82 4;  3CCQ 3;  2M7O A;  4EXR A;  2XFS A;  1VQ9 3;  1FA3 A;  3EBT A;  3PCS A;  1PFP A;  2OWP A;  1DVC A;  3F40 A;  3ER7 A;  2WOH A;  3NUV A;  5A0O B;  1VQ5 3;  1C7H A;  1JN5 A;  1STF I;  4JRF A;  4X2H A;  3D3L A;  4RZM A;  1Q86 4;  1RN7 A;  5CK6 A;  1GD3 A;  1LOX A;  2UX0 A;  3WOF B;  4FMD A;  2XGL A;  1KQS 2;  3FG4 A;  4K1U A;  1S5A A;  3CCR 3;  1EKM A;  1U8C B;  1HKX A;  1NU3 A;  2Z76 A;  3EC9 A;  3JUO A;  2D1W A;  2FXT A;  1VQN 3;  3SX1 A;  2QA4 3;  3CC4 3;  3CC7 3;  3JVC A;  1JB4 A;  2F98 A;  2W2C A;  3KSE D;  3MG2 A;  3MKI A;  1NB5 I;  2JDI H;  1YIT 3;  2CIU A;  2CFL A;  3G71 3;  1S72 3;  4LZI A;  2HMJ B;  3GZX B;  1FGQ A;  2W6J H;  5JPU A;  3GZB A;  2WO0 A;  1CQS A;  3V98 A;  1CYV A;  3V92 A;  1OPY A;  2WGQ A;  3UB1 A;  2HMK B;  5D81 A;  1DVD A;  1AR0 A;  2IA7 A;  3PCR A;  5TGN A;  3H3H A;  5KP4 A;  3BNC A;  3G16 A;  1SII A;  1ZO2 A;  4WP5 A;  4MJD A;  4HM8 B;  1IU7 A;  3NBR A;  1V74 A;  1OF5 A;  2GEX A;  3VGN A;  4OVM A;  4BTX A;  1ASK A;  1J2B A;  4FCJ A;  1ULJ B;  1K73 4;  6STD A;  3RGR A;  1GYB A;  1NO3 A;  3NV0 B;  1W01 A;  2CW9 A;  4AKZ A;  4EV2 A;  1T5Y A;  3SVA A;  3V99 A;  5IG4 A;  1CEW I;  4FCM A;  1LVN A;  3OWY A;  5AII A;  3IPT A;  1JNQ A;  4CCV A;  5BXQ A;  1IT7 A;  3WOE B;  1WQL B;  3EQQ B;  2O9U X;  3K9M C;  2E2T A;  1M9G A;  1YJW 3;  1UI8 A;  1TUH A;  3LOY A;  3DZL A;  2XF3 A;  2D42 A;  5IER A;  4AEQ A;  2STD A;  4IPB A;  5AIF A;  5FW5 A;  3IJE B;  1AV4 A;  2F99 A;  2V1L A;  1YJ9 3;  1QAL A;  3FGY A;  3PGB A;  2CC3 A;  2CFW A;  3X3Z A;  3X40 A;  2ZL8 A;  4ORL A;  2CFG A;  3B8L A;  1ZX2 A;  4L8P A;  4TX4 A;  3VSY A;  3SXX A;  1JKG A;  3LT9 A;  1TFK A;  4L8O A;  2Y74 A;  2Z77 A;  3OWS A;  1PU4 A;  1IVU A;  2BO9 B;  3LZA A;  1NDO B;  3CC2 3;  1N5H A;  2BT3 A;  1A2V A;  1K41 A;  5CXO A;  3UJM A;  1VQK 3;  2Z7A A;  5IG3 A;  3GZR A;  2YFI B;  3FH1 A;  4XBT A;  5CF2 A;  3GZY B;  4QWT A;  3AMO B;  3T0U A;  1OHP A;  3CCJ 3;  1K8A 4;  1UUV B;  2INX A;  2P09 A;  3A76 A;  1RRL A;  3WA3 A;  4HJL B;  3OX9 A;  4H3U A;  4HM4 B;  1Z1S A;  3JUM A;  1VQ4 3;  4NHF A;  1YI2 3;  3HK4 A;  1N9E A;  3FKA A;  5IEP A;  1US1 A;  2HMN B;  3HIG A;  2QGU A;  4HKV B;  2E2V A;  4HYZ A;  3EX9 A;  4MMZ B;  4KVH A;  3LTD A;  3EN8 A;  1Q81 4;  1YVB I;  1W02 A;  4K90 B;  3LTC A;  4XDV A;  5ELJ A;  2ML5 A;  4XB5 A;  3KZT A;  1KC8 4;  3I0Y A;  3CNM A;  2CG1 A;  5CF1 A;  4HM0 B;  2B24 B;  3KII A;  3M8C A;  4K61 A;  1FGT A;  1M1K 4;  2OQE C;  1TP6 A;  4MEI A;  2RSX A;  3PS8 A;  4R4K A;  5AIG A;  4O8S A;  2RCD A;  3MG1 A;  1Q42 A;  3RGA A;  4AKY A;  1IVW A;  4HM2 B;  3KKG A;  2YFL B;  4HM5 B;  1OH0 A;  4J9A A;  1OHS A;  1EG9 B;  4N6U A;  3CCM 3;  4HM1 B;  1VQM 3;  2K54 A;  3EN1 B;  5IEO A;  1WNH A;  2HML B;  3EF8 A;  3G6E 3;  2MF7 A;  2XRX B;  1M1X B;  2PZV A;  2BMO B;  4OUQ A;  3B7C A;  1VQ6 3;  1D6U A;  2W9P A;  3KE7 A;  3JUN A;  2CG0 A;  3S67 A;  5HGR A;  3Q1C A;  2OTL 3;  2YFJ B;  8CHO A;  2E2U A;  4PEJ A;  3S27 A;  4XBX A;  1OCV A;  1N8R 4;  4XBY A;  3DM8 A;  4RNZ A;  3SOY A;  4N6V 0;  4FMC A;  2JQ5 A;  2BMR B;  2XR8 B;  1Q7Y 4;  2OCT A;  2IUJ A;  3EE1 A;  1G96 A;  2ZDJ A;  5LC7 A;  3ROB A;  4WYK A;  4HBR A;  4BTW A;  4N3V A;  4Q53 A;  1N5P A;  4EV5 A;  3MPH A;  1O7M B;  1IQ8 A;  1YHQ 3;  3CCE 3;  1YIJ 3;  2KCD A;  1EA2 A;  2GU3 A;  1O7P B;  5BVB A;  2C10 A;  3NV0 A;  4EYC A;  4WYK B;  3OW2 2;  2SBL A;  4HZ9 B;  1VQL 3;  3DGL A;  3UL6 A;  3NBJ A;  1NJI 4;  4R80 A;  5IF6 A;  2BNG A;  2GBW B;  1W5Z A;  5G2G A;  2P0X A;  3S28 A;  3X42 A;  4N6M A;  4RNY A;  3HII A;  2QEX 3;  3FLJ A;  1K28 A;  5AYS C;  2LYX A;  1DYU A;  5LC6 A;  4LMI A;  2YX9 A;  2GBX B;  3NBB A;  7STD A;  1ULI B;  3BNE A;  3NQY A;  4KZ1 A;  1UUW B;  2IUK A;  1IV7 A;  4GB5 A;  3KFQ C;  2Y73 A;  1EQK A;  2A15 A;  3X41 A;  4XDW A;  4EC6 A;  1TU5 A;  3FZW A;  3BND A;  3BLZ A;  3WOD G;  4HM6 B;  3MG3 A;  3G8Z A;  2XH9 A;  1OHO A;  5D82 A;  4O02 B;  1LNH A;  3CU3 A;  2QIY A;  3FF2 A;  3I55 3;  3AMO A;  2Z6B A;  5I97 A;  2OOV A;  4HM7 B;  2B1X B;  2CWU A;  2XEP A;  2MC8 A;  3ECF A;  1M90 4;  2F86 B;  5AEW B;  3LML A;  3IMA B;  3CCL 3;  3WMD A;  5FGO A;  4N6L A;  1WMO A;  1AVK A;  2CHC A;  3NM7 A;  4STD A;  1NB3 I;  3HX8 A;  1GY6 A;  3WDG B;  1GD4 A;  1VQ7 3;  1BUQ A;  3BNB A;  5KP3 A;  1U5O A;  4HM3 B;  3KN4 A;  1GY7 A;  4H61 A;  4KFD A;  3EHC A;  2ML6 A;  1IQX A;  3I56 3;  1E3V A;  5CLK A;  4XM4 A;  3FSD A;  1W2Z A;  1SJW A;  1JB5 A;  3FF0 A;  2CFK A;  1WMN A;  4FCZ A;  1W6Y A;  1ROV A;  3HZP A;  2W9Q A;  1DMM A;  4HVN A;  1RKY A;  3CME 3;  1IK3 A;  4FMA A;  3EJV A;  4X2O A;  2IMJ A;  1UI7 A;  5EQL A;  1W2B 2;  1OUN A;  3WA2 X;  2OTJ 3;  3CNX A;  1K9M 4;  4LSO A;  1E3R A;  3CPW 2;  3LXU X;  1NWW A;  3F7X A;  3NHX A;  3NQZ A;  5AEU B;  1FGO A;  3PXM A;  3PZW A;  2XGN A;  3LTA A;  3H51 A;  1KSI A;  4L7K A;  3NM2 A;  5JPP A;  3G0K A;  1OAC A;  1N8Q A;  4LGQ A;  3NX0 A;  3K5T A;  5IG5 A;  3MSO A;  1E97 A;  1D6Z A;  3K63 A;  3B4P A;  1IVX A;  3DGM A;  1IV9 A;  4K1V A;  1JV2 B;  1QMA A;  1VZZ A;  2FGT A;  3FCS B;  3CMA 3;  4BTY A;  1CYU A;  1WMP A;  3FG1 A;  1GY5 A;  2W04 A;  3HI7 A;  5IW9 A;  3MWZ A;  5IG0 A;  1JRQ A;  1LXE A;  3NXJ A;  3S29 A;  4N6N B;  3F14 A;  3U97 A;  2CH9 A;  2CWT A;  1IT8 A;  5DRV A;  2GXF A;  4HZB B;  3K7C A;  3ALA A;  1JN5 B;  4EBG A;  3J7Y d;  1A2K A;  1RJO A;  5ELU A;  1L5G B;  1GS3 A;  2GU1 A;  4G1M B;  1SIH A;  3VF1 A;  5D83 A;  1FGR A;  3JUP A;  2I9W A;  3JUQ A;  1OGZ A;  2C11 A;  1R4C A;  2LQV A;  3E99 A;  2Q07 A;  2WGO A;  3KSP A;  4FR9 A;  1QVG 2;  1QVF 2;  1O7G B;  3SOA A;  3U1W A;  5STD A;  2GEY A;  3Q2P A;  3PYJ A;  4WWU C;  1STD A;  4N6T A;  1IVV A;  4LEH A;  3UNL A;  1VQO 3;  1MOL A;  2P0M A;  1SPU A;  2O3O A;  2WOF A;  3G4S 3;  3CXC 2;  2W56 A;  1W4N A;  1D6Y A;  5EEO A;  4MMY B;  4O2H A;  3CCV 3;  1A67 A;  1AVL A;  3DGN A;  4WFO A;  3TDG A;  1W00 A;  2P05 A;  1RRH A;  2P38 A;  4FMB A;  2K0M A;  3STD A;  4MMX B;  4N6O B;  1N9J A;  2W56 B;  3DMC A;  4I4K A;  1VQP 3;  3D9R A;  1QJG A;  4JF8 A;  1IQY A;  3LYG A;  4IIA A;  2HMM B;  2RGQ A;  2W0Q A;  2CFD A;  1WTH A;  3OXA A;  3BB9 A;  4NRE A;  1TIJ A;  4OK0 A;  3N9H A;  3OV4 A;  3B4O A;  3F7S A;  2HMO B;  1OF5 B;  5KP1 A;  4IT7 A;  2BHM A;  4R9L A;  3F8X A;  3Q90 A;  4CDL A;  1HU9 A;  3QK9 A;  3O8Y A;  3LT8 A;  3LTB A;  3FG3 A;  3SLU A;  3CPO A;  1QAF A;  3MHE A;  1A90 A;  5AYR B;  3SED A;  5DRE A;  1KWI A;  2FNQ A;  4RBN A;  1ISK A;  1KD1 4;  3N8B A;  1F8N A;  2R4I A;  3S5C A;  2CKF B;  3DUK A;  1W6C A;  1TFO A;  1JB2 A;  4KFE A;  3DGO A;  1FUW A;  1FGM A;  2BMQ B;  3T8U A;  1SQW A;  3X3Y A;  3UL5 A;  3EB8 A;  2CK3 H;  1W7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...