1B2UA

Structural response to mutation at a protein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
AQVINTFDGVADYLQTYHKLPDNYITASEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (BARNASE)
publication title Structural response to mutation at a protein-protein interface.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 32
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2uA00
1BSBA 2F4YA 1I8VA 1B21A 2BU4A 1RMSA 1UCLA 1YVSA 3A5EA 1MGRA 1RGCA 1LOVA 3BU4A 1JBRA 1I3FA 4HOHA 1B3SA 1BGSA 1BUJA 1BIRA 3URPA 2F56A 8RNTA 4J5GA 1I2EA 1DETA 1UCIA 1PYLA 1BRGA 2F5WA 2C4BA 1RDSA 1RCLA 1RSNA 3BIRA 2KF5A 2AADA 3D5GA 1BNSA 1B2XA 4J5KA 1BNFA 1RGFA 1I3IA 4GSPA 2GSPA 5RNTA 1X1UA 1JBSA 1LOYA 1C54A 1BU4A 1BNIA 5BIRA 1BRKA 7RNTA 1RTUA 1RN1A 1HZ1A 1I2FA 1GSPA 3Q3FA 1TRPA 1X1YA 1RCKA 4HAAA 1GMQA 1SARA 2BIRA 1LRAA 1I0VA 5GSPA 1AY7A 1BRSA 1FUTA 1YNVX 1RGEA 1BRNL 1RGHA 1B2SA 3DH2A 2RBIA 1BRHA 1T2HA 3AHWA 1I2GA 6RNTA 2SARA 1B2MA 1B20A 1GMRA 3AGNA 9RNTA 1T2IA 1B2UA 3HOHA 1R4YA 1IYYA 1TRQA 2ZA4A 6GSPA 1FW7A 1BNJA 3AHSA 1RHLA 3WR2A 1BNEA 1BNGA 3D4AA 1GOYA 1FZUA 4RNTA 2KAAA 7GSPA 4BIRA 1X1WA 3AGOA 1PY3A 2KF4A 5BU4A 1BANA 1I70A 1FYSA 1I0XA 2AAEA 1BVIA 1B2ZA 2F5MA 3KCHA 1RN4A 1DE3A 1BSEA 1MGWA 1RGKA 1RNTA 1BSAA 1YGWA 1RGLA 1AQZA 3DGYA 1RNBA 1FUSA 1BRJA 1UCKA 1X1XA 1Q9EA 1GMPA 1TTOA 1UCJA 3D5IA 1BAOA 4GHOA 1A2PA 1RGAA 1GOUA 1BSDA 5HOHA 1BSCA 1G02A 1GOVA 2KF6A 1RLSA 1CH0A 1LOWA 1JBTA 2HOHA 3WHOA 3SYUA 4BU4A 1BNRA 1RGGA 2KF3A 3GSPA 3RNTA 1HYFA 1ZGXA 1LNIA 2RNTA 1B27A 1BRIA 1BOXA
chains in the Genus database with same CATH superfamily
3CPW2 2OWPA 1V57A 3NBBA 3MG2A 3LZAA 4HZ9B 3MHEA 1NB3I 3CC73 3EBYA 1OACA 3GZXB 4HM1B 2YFLB 1M1XB 1VQ53 3BU4A 1MOLA 1OHPA 4N6TA 1I3FA 1PU4A 1QVF2 3F7SA 3WOFB 8RNTA 3J7Yd 4FR9A 2BO9B 1W01A 2Z7AA 4ORLA 3UJMA 3DGOA 4IIAA 1PYLA 2H0IA 4MMZB 3EN1B 2GBWB 3MPHA 2O3OA 3ZG0A 1D6YA 1S5AA 5JPUA 1W6YA 2KF5A 2R4IA 3D5GA 4JF8A 1BNSA 1STDA 3CCS3 1J2BA 3MG1A 4J5KA 1GY7A 4HVNA 3JUPA 3PS8A 1YIJ3 5LC7A 4GSPA 2W6JH 1AVLA 3LTAA 1OF5B 5RNTA 2GEXA 1N8R4 1C54A 1BU4A 3F7XA 2KXGA 4J8TA 3CCR3 1ISKA 4G1MB 2RCDA 2CH9A 5IG4A 4WHAA 2C11A 1OUNA 1JN5B 3BNEA 1WNHA 1D6ZA 1HZ1A 1ROAA 1GSPA 4KFFA 1N9JA 1VQ93 2QGUA 1F8NA 5AI1A 2E2TA 3JUNA 4OUQA 2OQEA 4DKIA 3ECFA 3MG3A 3G16A 4CCVA 3KFQC 3CCL3 1YNVX 2ML6A 1VQP3 1RGHA 1B2SA 3F9SA 2RBIA 1BRHA 4RBNA 2WOHA 1I2GA 1UDII 5KP4A 1OPYA 2SARA 2CX1A 1B20A 2CWUA 2YFJB 4BTXA 3AGNA 3V92A 4O2HA 1T5YA 1IU7A 3Q90A 3NQZA 9RNTA 3NQYA 1IQYA 2ZA4A 3WR2A 5KP1A 1BNEA 4L8PA 4R9KA 3DGNA 5AEUB 4KVHA 3JUMA 2W2CA 4RNTA 4WYKA 3S27A 4N6MA 3IJEB 4TX4A 7GSPA 3AMOB 3MKIA 4BIRA 1TFKA 1IVWA 1JJ22 1YGEA 3HX8A 2XRXB 1E3VA 1I0XA 1BVIA 2P0MA 3G0KA 2F5MA 1JZDA 1RN4A 1NU3A 3F8XA 1FGTA 2WGOA 1KD14 1YGWA 7STDA 1IQ8A 3L0RA 1Q40B 2L4VA 3DGYA 3FSDA 3X3YA 1TUHA 1BRJA 1UCKA 4GB5A 4CPKA 3CCE3 1YJN3 1Q824 1AV4A 3WODG 2L1SA 4R1KA 1WQLB 5AIGA 1NO3A 3OWUA 2QA43 4AEQA 1OHOA 1RGAA 1NNVA 1ULIB 3KIIA 1SQWA 1K28A 1BSCA 2KF6A 3G8ZA 4LZIA 3CCU3 1CH0A 1IDPA 1LOWA 2CFKA 2HOHA 4LEHA 2HMJB 3FCSB 4XDWA 2YFIB 5KP3A 3SYUA 4JRFA 3WHOA 4BU4A 3GSPA 5FW5A 3K5TA 2SBLA 3EQQB 4O8SA 1HYFA 3SOYA 1ZGXA 3G4S3 1SJWA 3E99A 4XBYA 2UUGC 5IEPA 3DGLA 1C7HA 2HMOB 1EEJA 2I9WA 3OXAA 5M19A 3FKAA 3GRDA 1YHQ3 3B4PA 1I8VA 3UL6A 3BNCA 5CF2A 2BU4A 1NB5I 1RMSA 3ZG5A 1T3BA 2QIYA 4R80A 4EV5A 1KSIA 5D82A 1YI23 3H3HA 1ULJB 3EBTA 3LTCA 5AIHA 1L5GB 3OV4A 2P0XA 4HOHA 4KT3B 1BUJA 1BIRA 2HMLB 3NV0B 1UW1A 1K734 2IUKA 1GY6A 1I2EA 3Q1CA 3A76A 2C4BA 2CFWA 3T8UA 3FF0A 4BTWA 4BL2A 2CIUA 2P05A 2AADA 1ASKA 3G6E3 3M8CA 3WA2X 2K0MA 2LYXA 1QJGA 2Y73A 2M7OA 4KFEA 3S67A 3UB1A 5IW9A 3OW22 1TFOA 5CK6A 1M904 1Q864 5BVBA 4FMDA 1JNQA 5BIRA 5AYSC 3PYJA 5AYRB 1BRKA 1E3RA 1RTUA 2OQEC 2YX9A 4KZ1A 2W56B 1LNHA 3OWSA 3Q3FA 1TRPA 4XBTA 3GAXA 1RCKA 2W04A 4HM0B 3ZFZA 3EN8A 3ER7A 1OF5A 3FF2A 1GMQA 4NPBA 1SARA 2BIRA 2BT3A 3ALAA 3HIIA 2LQVA 5DRVA 5STDA 1I0VA 2JDIH 1SIIA 1AY7A 3EX9A 4HZBB 4K90B 5GSPA 1JN5A 1M1K4 1BRNL 3DH2A 1KC84 4EBGA 1T2HA 3NM7A 1UUGB 6RNTA 1SIHA 4IT7A 2CK3H 2CWVA 1MWSA 3EC9A 6STDA 1IV7A 1MWTA 1YVBI 3H51A 1R4YA 5IG3A 1IYYA 1TRQA 3NM2A 4AKYA 1ZO2A 1BNJA 1MWRA 2E2VA 4WWUC 1UI8A 2XF3A 2P09A 3BNBA 1FZUA 2KAAA 2OOVA 1N5HA 3KSPA 4L8OA 5D83A 1X1WA 3X3ZA 2CHCA 1PY3A 2BMRB 5BXQA 3FG4A 2XR8B 3HIGA 1QALA 1I70A 3X3XA 3EE1A 1VQ73 2XGLA 1W7CA 4N3VA 4RNZA 3KCHA 2IUJA 3KE7A 1TJDA 2V1LA 2FGTA 1Q7HA 2BMQB 2JQ5A 4U13A 1BSAA 2XEPA 1GS3A 1W00A 1AQZA 1O7MB 4MEIA 3CC23 1RNBA 1QAFA 1DMNA 2IY2A 3SLUA 5G1KA 3DMCA 5FGOA 1IT8A 1Q9EA 1UGHI 3FG3A 2A15A 1G96A 3N9HA 3LYGA 2IA7A 3HI7A 3D5IA 3B7CA 5TGNA 2KCDA 4ILFA 1A2PA 1U8CB 3HK4A 2F99A 3D79A 1Q40A 2UX0A 1BSDA 2ML5A 2R41A 3SX1A 1JV2B 1G02A 3D9RA 1BNRA 3X42A 5CLKA 3FGYA 5AIFA 3CNXA 4X2OA 3RNTA 1STFI 3K63A 2RNTA 1KWIA 1OGZA 1W2ZA 2GU1A 3F14A 4AKZA 2GXFA 1W4NA 2K54A 1BOXA 3NXJA 1OGXA 2CFLA 4HM8B 4N6LA 1W2B2 2K3DA 1Q7Y4 4N6OB 1B21A 2F98A 4H3UA 1GD4A 1RN7A 1UCLA 4I5QA 3PXMA 1YVSA 3A5EA 5JBSA 1K41A 1RRLA 5AIIA 4FMBA 3V99A 1G0TA 4I4KA 3X40A 1RGCA 3QRDA 2CG0A 4FCJA 4XB5A 1B3SA 1EG9B 1VQK3 3URPA 2F56A 5LC6A 2RSXA 3DGMA 5JPPA 2Q07A 4IPBA 5I97A 2Z77A 1VQN3 1UCIA 3O8YA 1NJI4 1FA3A 1K8A4 2XGNA 2D42A 1RDSA 4H61A 3S29A 3V98A 1RSNA 1N5PA 2H0GA 3RGRA 2Y74A 3NV0A 5EQLA 1QAKA 4EXRA 3QK9A 1RGFA 3GZRA 1I3IA 2RFRA 1EA2A 1JBSA 1A90A 1X1UA 1LOYA 1RJOA 1ZX2A 2B1XB 3DM8A 2CKFB 1S723 1FGQA 3BLZA 3JUQA 1BNIA 2FNQA 1NDOB 3KN4A 4OVMA 4HYZA 4NREA 1IVVA 1CEWI 1MWUA 4K1VA 2CFGA 1RN1A 4MJDA 1I2FA 3TDGA 3CME3 4XDVA 2J8XB 3S28A 4CDLA 2W9QA 4MMYB 1VQ43 3MYTA 4KFDA 2STDA 2CWTA 1A67A 2XSHB 2PZVA 1VQM3 4HM6B 2Z6BA 1WTHA 2BHMA 3WOEB 3I563 1JKGB 4N6NB 5IENA 1JB4A 1RGEA 2BNGA 4R4KA 3PCSA 3ROBA 5IF6A 3DY5A 4ZM8A 1B2MA 8CHOA 1MNLA 1WMPA 3BNDA 4X2HA 1GD3A 1UUVB 1O7WB 1T2IA 3GWRA 3HOHA 3LT9A 4LGQA 2OOVC 3K7CA 3AHSA 2XFSA 4RNYA 3D4AA 1O7GB 1LOXA 2BMOB 1LQGC 4XBXA 4LMIA 3T8NA 1EKMA 3STDA 5D81A 3HZPA 3AGOA 2KF4A 4WP5A 3VF1A 3MSOA 2P38A 1BANA 1RRHA 1IVXA 5IERA 1RKYA 3FH1A 1U5OA 1O7NB 2H0HA 4HM7B 3IPTA 2RGQA 2UGIA 2ZDJA 3PGBA 3CPOA 3EF8A 1EQKA 4N6V0 2QEX3 1BSEA 1MGWA 1Q42A 1RGKA 1RNTA 3CCJ3 3LTBA 3LTDA 3KSED 4HBRA 1UGIA 1A2KA 1RGLA 2CX0A 3F8HA 5G2GA 1FGOA 1Y4KA 3CCQ3 4CJNA 4LSOA 2OTL3 3X41A 1X1XA 3KKGA 4BL3A 1ROVA 2XFTA 1TTOA 3LXUX 2OTJ3 5IEOA 2MC8A 1YJW3 3F40A 5M1AA 3CXC2 3D3LA 1DMQA 2W9PA 3FG1A 1JZOA 1LXEA 1M9GA 4Q53A 1GOUA 3LMLA 3JUOA 5HOHA 1GOVA 4XM4A 1TU5A 1RLSA 1JBTA 4J9AA 3CCM3 1V58A 2KF3A 2E2UA 3CCV3 1O7HB 2W0QA 2F86B 4FCZA 3UL5A 1B27A 3AMOA 3EJVA 2GBXB 4HM3B 5DREA 1DMMA 1BRIA 1PFPA 1BSBA 2F4YA 2C10A 3FLJA 4O3VA 3DXOA 1FGRA 1TIJA 3GZYB 1MGRA 3B4OA 4WFOA 1LOVA 4K1UA 1JBRA 1BGSA 1NWWA 2CFDA 3GZBA 5CXOA 1VQQA 1R4CA 2HMMB 2D1WA 4J5GA 1K9M4 2GEYA 3U1WA 3RDEA 1DETA 2ZHXB 2FXTA 1BRGA 1QMAA 2F5WA 1Q814 5M18A 3DZLA 3I553 5G1LA 1RCLA 2XH9A 3BIRA 3VSYA 1VQL3 1IT7A 1B2XA 3PCRA 1FGMA 1VQO3 2WGQA 3K0ZA 4FMAA 3JVCA 1BNFA 1IK3A 1YJ93 2GSPA 3WDGB 2Z76A 1OH0A 4HM5B 3NHXA 3WA3A 1OHSA 4EYCA 1LVNA 3NBRA 3N8BA 1UI7A 4RZMA 4NHFA 7RNTA 1CYUA 1ZS7A 3BB9A 1VZZA 2PNCA 3NBJA 3CC43 1IQXA 1OCVA 1X1YA 3CU3A 4HAAA 4O02B 4EC6A 3NX0A 4EV2A 4STDA 1LRAA 2XSOB 5IG0A 3EHCA 1D6UA 1FUTA 1BRSA 3S5CA 3OX9A 1DYUA 3AHWA 2CW9A 5EVHA 1W6CA 1GMRA 5AEWB 4L7KA 2CC3A 4WYKB 3I0YA 3SEDA 1YIT3 5IG5A 3T0UA 1GY5A 2HMNB 2GU3A 2HMKB 1B2UA 1UUWB 1BUQA 1FW7A 1JKGA 6GSPA 4BTYA 1VQ63 1DVDA 1RHLA 1W02A 1BNGA 3EB8A 4EW5A 1O7PB 1GOYA 3DUKA 1CYVA 4LYLB 3KZTA 4OK0A 5ELUA 5CF1A 3OWYA 1DVCA 1HU9A 1W5ZA 2INXA 1AVKA 5BU4A 4QWTA 1W6GA 2AAEA 1FYSA 1AR0A 3CNMA 1EUIC 1JRQA 1LQMB 3K9MC 3UNLA 1B2ZA 1VQ83 1SPUA 4HKVB 1QVG2 1WMOA 3RGAA 3IMAB 2W56A 3WMDA 3LH4A 4HM4B 1DE3A 1US1A 2O9UX 1A2VA 1GYBA 4R9LA 4K61A 3Q2PA 3PZWA 1V74A 3FZWA 4HJLB 2KRTA 4FCMA 1FUSA 5HGRA 3NUVA 1WMNA 1IVUA 1GMPA 1CQSA 1HKXA 2WOFA 1KQS2 3N54B 5ELJA 1UCJA 1BAOA 4GHOA 4HM2B 1N8QA 3LT8A 3VGNA 2WO0A 2ZL8A 2MF7A 3LOYA 2IYJA 2W03A 5A0OB 4PEJA 1N9EA 2OCTA 1IV9A 3MWZA 1Z1SA 2IMJA 1TP6A 3CMA3 4N6UA 2CG1A 1RGGA 3B8LA 3SVAA 3G713 3CD63 4GL6A 3SXXA 3SOAA 1LNIA 4FMCA 4MMXB 1E97A 2B24B 1FUWA 1JB5A 5EEOA 3U97A 1JB2A
chains in the Genus database with same CATH topology
1BSBA 2F4YA 1I8VA 1B21A 2BU4A 1RMSA 1UCLA 1YVSA 3A5EA 1MGRA 1RGCA 1LOVA 3BU4A 1JBRA 1I3FA 4HOHA 1B3SA 1BGSA 1BUJA 1BIRA 3URPA 2F56A 8RNTA 4J5GA 1I2EA 1DETA 1UCIA 1PYLA 1BRGA 2F5WA 2C4BA 1RDSA 1RCLA 1RSNA 3BIRA 2KF5A 2AADA 3D5GA 1BNSA 1B2XA 4J5KA 1BNFA 1RGFA 1I3IA 4GSPA 2GSPA 5RNTA 1X1UA 1JBSA 1LOYA 1C54A 1BU4A 1BNIA 5BIRA 1BRKA 7RNTA 1RTUA 1RN1A 1HZ1A 1I2FA 1GSPA 3Q3FA 1TRPA 1X1YA 1RCKA 4HAAA 1GMQA 1SARA 2BIRA 1LRAA 1I0VA 5GSPA 1AY7A 1BRSA 1FUTA 1YNVX 1RGEA 1BRNL 1RGHA 1B2SA 3DH2A 2RBIA 1BRHA 1T2HA 3AHWA 1I2GA 6RNTA 2SARA 1B2MA 1B20A 1GMRA 3AGNA 9RNTA 1T2IA 1B2UA 3HOHA 1R4YA 1IYYA 1TRQA 2ZA4A 6GSPA 1FW7A 1BNJA 3AHSA 1RHLA 3WR2A 1BNEA 1BNGA 3D4AA 1GOYA 1FZUA 4RNTA 2KAAA 7GSPA 4BIRA 1X1WA 3AGOA 1PY3A 2KF4A 5BU4A 1BANA 1I70A 1FYSA 1I0XA 2AAEA 1BVIA 1B2ZA 2F5MA 3KCHA 1RN4A 1DE3A 1BSEA 1MGWA 1RGKA 1RNTA 1BSAA 1YGWA 1RGLA 1AQZA 3DGYA 1RNBA 1FUSA 1BRJA 1UCKA 1X1XA 1Q9EA 1GMPA 1TTOA 1UCJA 3D5IA 1BAOA 4GHOA 1A2PA 1RGAA 1GOUA 1BSDA 5HOHA 1BSCA 1G02A 1GOVA 2KF6A 1RLSA 1CH0A 1LOWA 1JBTA 2HOHA 3WHOA 3SYUA 4BU4A 1BNRA 1RGGA 2KF3A 3GSPA 3RNTA 1HYFA 1ZGXA 1LNIA 2RNTA 1B27A 1BRIA 1BOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSB A;  2F4Y A;  1I8V A;  1B21 A;  2BU4 A;  1RMS A;  1UCL A;  1YVS A;  3A5E A;  1MGR A;  1RGC A;  1LOV A;  3BU4 A;  1JBR A;  1I3F A;  4HOH A;  1B3S A;  1BGS A;  1BUJ A;  1BIR A;  3URP A;  2F56 A;  8RNT A;  4J5G A;  1I2E A;  1DET A;  1UCI A;  1PYL A;  1BRG A;  2F5W A;  2C4B A;  1RDS A;  1RCL A;  1RSN A;  3BIR A;  2KF5 A;  2AAD A;  3D5G A;  1BNS A;  1B2X A;  4J5K A;  1BNF A;  1RGF A;  1I3I A;  4GSP A;  2GSP A;  5RNT A;  1X1U A;  1JBS A;  1LOY A;  1C54 A;  1BU4 A;  1BNI A;  5BIR A;  1BRK A;  7RNT A;  1RTU A;  1RN1 A;  1HZ1 A;  1I2F A;  1GSP A;  3Q3F A;  1TRP A;  1X1Y A;  1RCK A;  4HAA A;  1GMQ A;  1SAR A;  2BIR A;  1LRA A;  1I0V A;  5GSP A;  1AY7 A;  1BRS A;  1FUT A;  1YNV X;  1RGE A;  1BRN L;  1RGH A;  1B2S A;  3DH2 A;  2RBI A;  1BRH A;  1T2H A;  3AHW A;  1I2G A;  6RNT A;  2SAR A;  1B2M A;  1B20 A;  1GMR A;  3AGN A;  9RNT A;  1T2I A;  1B2U A;  3HOH A;  1R4Y A;  1IYY A;  1TRQ A;  2ZA4 A;  6GSP A;  1FW7 A;  1BNJ A;  3AHS A;  1RHL A;  3WR2 A;  1BNE A;  1BNG A;  3D4A A;  1GOY A;  1FZU A;  4RNT A;  2KAA A;  7GSP A;  4BIR A;  1X1W A;  3AGO A;  1PY3 A;  2KF4 A;  5BU4 A;  1BAN A;  1I70 A;  1FYS A;  1I0X A;  2AAE A;  1BVI A;  1B2Z A;  2F5M A;  3KCH A;  1RN4 A;  1DE3 A;  1BSE A;  1MGW A;  1RGK A;  1RNT A;  1BSA A;  1YGW A;  1RGL A;  1AQZ A;  3DGY A;  1RNB A;  1FUS A;  1BRJ A;  1UCK A;  1X1X A;  1Q9E A;  1GMP A;  1TTO A;  1UCJ A;  3D5I A;  1BAO A;  4GHO A;  1A2P A;  1RGA A;  1GOU A;  1BSD A;  5HOH A;  1BSC A;  1G02 A;  1GOV A;  2KF6 A;  1RLS A;  1CH0 A;  1LOW A;  1JBT A;  2HOH A;  3WHO A;  3SYU A;  4BU4 A;  1BNR A;  1RGG A;  2KF3 A;  3GSP A;  3RNT A;  1HYF A;  1ZGX A;  1LNI A;  2RNT A;  1B27 A;  1BRI A;  1BOX A; 
#chains in the Genus database with same CATH topology
 3CPW 2;  2OWP A;  1V57 A;  3NBB A;  3MG2 A;  3LZA A;  4HZ9 B;  3MHE A;  1NB3 I;  3CC7 3;  3EBY A;  1OAC A;  3GZX B;  4HM1 B;  2YFL B;  1M1X B;  1VQ5 3;  3BU4 A;  1MOL A;  1OHP A;  4N6T A;  1I3F A;  1PU4 A;  1QVF 2;  3F7S A;  3WOF B;  8RNT A;  3J7Y d;  4FR9 A;  2BO9 B;  1W01 A;  2Z7A A;  4ORL A;  3UJM A;  3DGO A;  4IIA A;  1PYL A;  2H0I A;  4MMZ B;  3EN1 B;  2GBW B;  3MPH A;  2O3O A;  3ZG0 A;  1D6Y A;  1S5A A;  5JPU A;  1W6Y A;  2KF5 A;  2R4I A;  3D5G A;  4JF8 A;  1BNS A;  1STD A;  3CCS 3;  1J2B A;  3MG1 A;  4J5K A;  1GY7 A;  4HVN A;  3JUP A;  3PS8 A;  1YIJ 3;  5LC7 A;  4GSP A;  2W6J H;  1AVL A;  3LTA A;  1OF5 B;  5RNT A;  2GEX A;  1N8R 4;  1C54 A;  1BU4 A;  3F7X A;  2KXG A;  4J8T A;  3CCR 3;  1ISK A;  4G1M B;  2RCD A;  2CH9 A;  5IG4 A;  4WHA A;  2C11 A;  1OUN A;  1JN5 B;  3BNE A;  1WNH A;  1D6Z A;  1HZ1 A;  1ROA A;  1GSP A;  4KFF A;  1N9J A;  1VQ9 3;  2QGU A;  1F8N A;  5AI1 A;  2E2T A;  3JUN A;  4OUQ A;  2OQE A;  4DKI A;  3ECF A;  3MG3 A;  3G16 A;  4CCV A;  3KFQ C;  3CCL 3;  1YNV X;  2ML6 A;  1VQP 3;  1RGH A;  1B2S A;  3F9S A;  2RBI A;  1BRH A;  4RBN A;  2WOH A;  1I2G A;  1UDI I;  5KP4 A;  1OPY A;  2SAR A;  2CX1 A;  1B20 A;  2CWU A;  2YFJ B;  4BTX A;  3AGN A;  3V92 A;  4O2H A;  1T5Y A;  1IU7 A;  3Q90 A;  3NQZ A;  9RNT A;  3NQY A;  1IQY A;  2ZA4 A;  3WR2 A;  5KP1 A;  1BNE A;  4L8P A;  4R9K A;  3DGN A;  5AEU B;  4KVH A;  3JUM A;  2W2C A;  4RNT A;  4WYK A;  3S27 A;  4N6M A;  3IJE B;  4TX4 A;  7GSP A;  3AMO B;  3MKI A;  4BIR A;  1TFK A;  1IVW A;  1JJ2 2;  1YGE A;  3HX8 A;  2XRX B;  1E3V A;  1I0X A;  1BVI A;  2P0M A;  3G0K A;  2F5M A;  1JZD A;  1RN4 A;  1NU3 A;  3F8X A;  1FGT A;  2WGO A;  1KD1 4;  1YGW A;  7STD A;  1IQ8 A;  3L0R A;  1Q40 B;  2L4V A;  3DGY A;  3FSD A;  3X3Y A;  1TUH A;  1BRJ A;  1UCK A;  4GB5 A;  4CPK A;  3CCE 3;  1YJN 3;  1Q82 4;  1AV4 A;  3WOD G;  2L1S A;  4R1K A;  1WQL B;  5AIG A;  1NO3 A;  3OWU A;  2QA4 3;  4AEQ A;  1OHO A;  1RGA A;  1NNV A;  1ULI B;  3KII A;  1SQW A;  1K28 A;  1BSC A;  2KF6 A;  3G8Z A;  4LZI A;  3CCU 3;  1CH0 A;  1IDP A;  1LOW A;  2CFK A;  2HOH A;  4LEH A;  2HMJ B;  3FCS B;  4XDW A;  2YFI B;  5KP3 A;  3SYU A;  4JRF A;  3WHO A;  4BU4 A;  3GSP A;  5FW5 A;  3K5T A;  2SBL A;  3EQQ B;  4O8S A;  1HYF A;  3SOY A;  1ZGX A;  3G4S 3;  1SJW A;  3E99 A;  4XBY A;  2UUG C;  5IEP A;  3DGL A;  1C7H A;  2HMO B;  1EEJ A;  2I9W A;  3OXA A;  5M19 A;  3FKA A;  3GRD A;  1YHQ 3;  3B4P A;  1I8V A;  3UL6 A;  3BNC A;  5CF2 A;  2BU4 A;  1NB5 I;  1RMS A;  3ZG5 A;  1T3B A;  2QIY A;  4R80 A;  4EV5 A;  1KSI A;  5D82 A;  1YI2 3;  3H3H A;  1ULJ B;  3EBT A;  3LTC A;  5AIH A;  1L5G B;  3OV4 A;  2P0X A;  4HOH A;  4KT3 B;  1BUJ A;  1BIR A;  2HML B;  3NV0 B;  1UW1 A;  1K73 4;  2IUK A;  1GY6 A;  1I2E A;  3Q1C A;  3A76 A;  2C4B A;  2CFW A;  3T8U A;  3FF0 A;  4BTW A;  4BL2 A;  2CIU A;  2P05 A;  2AAD A;  1ASK A;  3G6E 3;  3M8C A;  3WA2 X;  2K0M A;  2LYX A;  1QJG A;  2Y73 A;  2M7O A;  4KFE A;  3S67 A;  3UB1 A;  5IW9 A;  3OW2 2;  1TFO A;  5CK6 A;  1M90 4;  1Q86 4;  5BVB A;  4FMD A;  1JNQ A;  5BIR A;  5AYS C;  3PYJ A;  5AYR B;  1BRK A;  1E3R A;  1RTU A;  2OQE C;  2YX9 A;  4KZ1 A;  2W56 B;  1LNH A;  3OWS A;  3Q3F A;  1TRP A;  4XBT A;  3GAX A;  1RCK A;  2W04 A;  4HM0 B;  3ZFZ A;  3EN8 A;  3ER7 A;  1OF5 A;  3FF2 A;  1GMQ A;  4NPB A;  1SAR A;  2BIR A;  2BT3 A;  3ALA A;  3HII A;  2LQV A;  5DRV A;  5STD A;  1I0V A;  2JDI H;  1SII A;  1AY7 A;  3EX9 A;  4HZB B;  4K90 B;  5GSP A;  1JN5 A;  1M1K 4;  1BRN L;  3DH2 A;  1KC8 4;  4EBG A;  1T2H A;  3NM7 A;  1UUG B;  6RNT A;  1SIH A;  4IT7 A;  2CK3 H;  2CWV A;  1MWS A;  3EC9 A;  6STD A;  1IV7 A;  1MWT A;  1YVB I;  3H51 A;  1R4Y A;  5IG3 A;  1IYY A;  1TRQ A;  3NM2 A;  4AKY A;  1ZO2 A;  1BNJ A;  1MWR A;  2E2V A;  4WWU C;  1UI8 A;  2XF3 A;  2P09 A;  3BNB A;  1FZU A;  2KAA A;  2OOV A;  1N5H A;  3KSP A;  4L8O A;  5D83 A;  1X1W A;  3X3Z A;  2CHC A;  1PY3 A;  2BMR B;  5BXQ A;  3FG4 A;  2XR8 B;  3HIG A;  1QAL A;  1I70 A;  3X3X A;  3EE1 A;  1VQ7 3;  2XGL A;  1W7C A;  4N3V A;  4RNZ A;  3KCH A;  2IUJ A;  3KE7 A;  1TJD A;  2V1L A;  2FGT A;  1Q7H A;  2BMQ B;  2JQ5 A;  4U13 A;  1BSA A;  2XEP A;  1GS3 A;  1W00 A;  1AQZ A;  1O7M B;  4MEI A;  3CC2 3;  1RNB A;  1QAF A;  1DMN A;  2IY2 A;  3SLU A;  5G1K A;  3DMC A;  5FGO A;  1IT8 A;  1Q9E A;  1UGH I;  3FG3 A;  2A15 A;  1G96 A;  3N9H A;  3LYG A;  2IA7 A;  3HI7 A;  3D5I A;  3B7C A;  5TGN A;  2KCD A;  4ILF A;  1A2P A;  1U8C B;  3HK4 A;  2F99 A;  3D79 A;  1Q40 A;  2UX0 A;  1BSD A;  2ML5 A;  2R41 A;  3SX1 A;  1JV2 B;  1G02 A;  3D9R A;  1BNR A;  3X42 A;  5CLK A;  3FGY A;  5AIF A;  3CNX A;  4X2O A;  3RNT A;  1STF I;  3K63 A;  2RNT A;  1KWI A;  1OGZ A;  1W2Z A;  2GU1 A;  3F14 A;  4AKZ A;  2GXF A;  1W4N A;  2K54 A;  1BOX A;  3NXJ A;  1OGX A;  2CFL A;  4HM8 B;  4N6L A;  1W2B 2;  2K3D A;  1Q7Y 4;  4N6O B;  1B21 A;  2F98 A;  4H3U A;  1GD4 A;  1RN7 A;  1UCL A;  4I5Q A;  3PXM A;  1YVS A;  3A5E A;  5JBS A;  1K41 A;  1RRL A;  5AII A;  4FMB A;  3V99 A;  1G0T A;  4I4K A;  3X40 A;  1RGC A;  3QRD A;  2CG0 A;  4FCJ A;  4XB5 A;  1B3S A;  1EG9 B;  1VQK 3;  3URP A;  2F56 A;  5LC6 A;  2RSX A;  3DGM A;  5JPP A;  2Q07 A;  4IPB A;  5I97 A;  2Z77 A;  1VQN 3;  1UCI A;  3O8Y A;  1NJI 4;  1FA3 A;  1K8A 4;  2XGN A;  2D42 A;  1RDS A;  4H61 A;  3S29 A;  3V98 A;  1RSN A;  1N5P A;  2H0G A;  3RGR A;  2Y74 A;  3NV0 A;  5EQL A;  1QAK A;  4EXR A;  3QK9 A;  1RGF A;  3GZR A;  1I3I A;  2RFR A;  1EA2 A;  1JBS A;  1A90 A;  1X1U A;  1LOY A;  1RJO A;  1ZX2 A;  2B1X B;  3DM8 A;  2CKF B;  1S72 3;  1FGQ A;  3BLZ A;  3JUQ A;  1BNI A;  2FNQ A;  1NDO B;  3KN4 A;  4OVM A;  4HYZ A;  4NRE A;  1IVV A;  1CEW I;  1MWU A;  4K1V A;  2CFG A;  1RN1 A;  4MJD A;  1I2F A;  3TDG A;  3CME 3;  4XDV A;  2J8X B;  3S28 A;  4CDL A;  2W9Q A;  4MMY B;  1VQ4 3;  3MYT A;  4KFD A;  2STD A;  2CWT A;  1A67 A;  2XSH B;  2PZV A;  1VQM 3;  4HM6 B;  2Z6B A;  1WTH A;  2BHM A;  3WOE B;  3I56 3;  1JKG B;  4N6N B;  5IEN A;  1JB4 A;  1RGE A;  2BNG A;  4R4K A;  3PCS A;  3ROB A;  5IF6 A;  3DY5 A;  4ZM8 A;  1B2M A;  8CHO A;  1MNL A;  1WMP A;  3BND A;  4X2H A;  1GD3 A;  1UUV B;  1O7W B;  1T2I A;  3GWR A;  3HOH A;  3LT9 A;  4LGQ A;  2OOV C;  3K7C A;  3AHS A;  2XFS A;  4RNY A;  3D4A A;  1O7G B;  1LOX A;  2BMO B;  1LQG C;  4XBX A;  4LMI A;  3T8N A;  1EKM A;  3STD A;  5D81 A;  3HZP A;  3AGO A;  2KF4 A;  4WP5 A;  3VF1 A;  3MSO A;  2P38 A;  1BAN A;  1RRH A;  1IVX A;  5IER A;  1RKY A;  3FH1 A;  1U5O A;  1O7N B;  2H0H A;  4HM7 B;  3IPT A;  2RGQ A;  2UGI A;  2ZDJ A;  3PGB A;  3CPO A;  3EF8 A;  1EQK A;  4N6V 0;  2QEX 3;  1BSE A;  1MGW A;  1Q42 A;  1RGK A;  1RNT A;  3CCJ 3;  3LTB A;  3LTD A;  3KSE D;  4HBR A;  1UGI A;  1A2K A;  1RGL A;  2CX0 A;  3F8H A;  5G2G A;  1FGO A;  1Y4K A;  3CCQ 3;  4CJN A;  4LSO A;  2OTL 3;  3X41 A;  1X1X A;  3KKG A;  4BL3 A;  1ROV A;  2XFT A;  1TTO A;  3LXU X;  2OTJ 3;  5IEO A;  2MC8 A;  1YJW 3;  3F40 A;  5M1A A;  3CXC 2;  3D3L A;  1DMQ A;  2W9P A;  3FG1 A;  1JZO A;  1LXE A;  1M9G A;  4Q53 A;  1GOU A;  3LML A;  3JUO A;  5HOH A;  1GOV A;  4XM4 A;  1TU5 A;  1RLS A;  1JBT A;  4J9A A;  3CCM 3;  1V58 A;  2KF3 A;  2E2U A;  3CCV 3;  1O7H B;  2W0Q A;  2F86 B;  4FCZ A;  3UL5 A;  1B27 A;  3AMO A;  3EJV A;  2GBX B;  4HM3 B;  5DRE A;  1DMM A;  1BRI A;  1PFP A;  1BSB A;  2F4Y A;  2C10 A;  3FLJ A;  4O3V A;  3DXO A;  1FGR A;  1TIJ A;  3GZY B;  1MGR A;  3B4O A;  4WFO A;  1LOV A;  4K1U A;  1JBR A;  1BGS A;  1NWW A;  2CFD A;  3GZB A;  5CXO A;  1VQQ A;  1R4C A;  2HMM B;  2D1W A;  4J5G A;  1K9M 4;  2GEY A;  3U1W A;  3RDE A;  1DET A;  2ZHX B;  2FXT A;  1BRG A;  1QMA A;  2F5W A;  1Q81 4;  5M18 A;  3DZL A;  3I55 3;  5G1L A;  1RCL A;  2XH9 A;  3BIR A;  3VSY A;  1VQL 3;  1IT7 A;  1B2X A;  3PCR A;  1FGM A;  1VQO 3;  2WGQ A;  3K0Z A;  4FMA A;  3JVC A;  1BNF A;  1IK3 A;  1YJ9 3;  2GSP A;  3WDG B;  2Z76 A;  1OH0 A;  4HM5 B;  3NHX A;  3WA3 A;  1OHS A;  4EYC A;  1LVN A;  3NBR A;  3N8B A;  1UI7 A;  4RZM A;  4NHF A;  7RNT A;  1CYU A;  1ZS7 A;  3BB9 A;  1VZZ A;  2PNC A;  3NBJ A;  3CC4 3;  1IQX A;  1OCV A;  1X1Y A;  3CU3 A;  4HAA A;  4O02 B;  4EC6 A;  3NX0 A;  4EV2 A;  4STD A;  1LRA A;  2XSO B;  5IG0 A;  3EHC A;  1D6U A;  1FUT A;  1BRS A;  3S5C A;  3OX9 A;  1DYU A;  3AHW A;  2CW9 A;  5EVH A;  1W6C A;  1GMR A;  5AEW B;  4L7K A;  2CC3 A;  4WYK B;  3I0Y A;  3SED A;  1YIT 3;  5IG5 A;  3T0U A;  1GY5 A;  2HMN B;  2GU3 A;  2HMK B;  1B2U A;  1UUW B;  1BUQ A;  1FW7 A;  1JKG A;  6GSP A;  4BTY A;  1VQ6 3;  1DVD A;  1RHL A;  1W02 A;  1BNG A;  3EB8 A;  4EW5 A;  1O7P B;  1GOY A;  3DUK A;  1CYV A;  4LYL B;  3KZT A;  4OK0 A;  5ELU A;  5CF1 A;  3OWY A;  1DVC A;  1HU9 A;  1W5Z A;  2INX A;  1AVK A;  5BU4 A;  4QWT A;  1W6G A;  2AAE A;  1FYS A;  1AR0 A;  3CNM A;  1EUI C;  1JRQ A;  1LQM B;  3K9M C;  3UNL A;  1B2Z A;  1VQ8 3;  1SPU A;  4HKV B;  1QVG 2;  1WMO A;  3RGA A;  3IMA B;  2W56 A;  3WMD A;  3LH4 A;  4HM4 B;  1DE3 A;  1US1 A;  2O9U X;  1A2V A;  1GYB A;  4R9L A;  4K61 A;  3Q2P A;  3PZW A;  1V74 A;  3FZW A;  4HJL B;  2KRT A;  4FCM A;  1FUS A;  5HGR A;  3NUV A;  1WMN A;  1IVU A;  1GMP A;  1CQS A;  1HKX A;  2WOF A;  1KQS 2;  3N54 B;  5ELJ A;  1UCJ A;  1BAO A;  4GHO A;  4HM2 B;  1N8Q A;  3LT8 A;  3VGN A;  2WO0 A;  2ZL8 A;  2MF7 A;  3LOY A;  2IYJ A;  2W03 A;  5A0O B;  4PEJ A;  1N9E A;  2OCT A;  1IV9 A;  3MWZ A;  1Z1S A;  2IMJ A;  1TP6 A;  3CMA 3;  4N6U A;  2CG1 A;  1RGG A;  3B8L A;  3SVA A;  3G71 3;  3CD6 3;  4GL6 A;  3SXX A;  3SOA A;  1LNI A;  4FMC A;  4MMX B;  1E97 A;  2B24 B;  1FUW A;  1JB5 A;  5EEO A;  3U97 A;  1JB2 A; 
#chains in the Genus database with same CATH homology
 1BSB A;  2F4Y A;  1I8V A;  1B21 A;  2BU4 A;  1RMS A;  1UCL A;  1YVS A;  3A5E A;  1MGR A;  1RGC A;  1LOV A;  3BU4 A;  1JBR A;  1I3F A;  4HOH A;  1B3S A;  1BGS A;  1BUJ A;  1BIR A;  3URP A;  2F56 A;  8RNT A;  4J5G A;  1I2E A;  1DET A;  1UCI A;  1PYL A;  1BRG A;  2F5W A;  2C4B A;  1RDS A;  1RCL A;  1RSN A;  3BIR A;  2KF5 A;  2AAD A;  3D5G A;  1BNS A;  1B2X A;  4J5K A;  1BNF A;  1RGF A;  1I3I A;  4GSP A;  2GSP A;  5RNT A;  1X1U A;  1JBS A;  1LOY A;  1C54 A;  1BU4 A;  1BNI A;  5BIR A;  1BRK A;  7RNT A;  1RTU A;  1RN1 A;  1HZ1 A;  1I2F A;  1GSP A;  3Q3F A;  1TRP A;  1X1Y A;  1RCK A;  4HAA A;  1GMQ A;  1SAR A;  2BIR A;  1LRA A;  1I0V A;  5GSP A;  1AY7 A;  1BRS A;  1FUT A;  1YNV X;  1RGE A;  1BRN L;  1RGH A;  1B2S A;  3DH2 A;  2RBI A;  1BRH A;  1T2H A;  3AHW A;  1I2G A;  6RNT A;  2SAR A;  1B2M A;  1B20 A;  1GMR A;  3AGN A;  9RNT A;  1T2I A;  1B2U A;  3HOH A;  1R4Y A;  1IYY A;  1TRQ A;  2ZA4 A;  6GSP A;  1FW7 A;  1BNJ A;  3AHS A;  1RHL A;  3WR2 A;  1BNE A;  1BNG A;  3D4A A;  1GOY A;  1FZU A;  4RNT A;  2KAA A;  7GSP A;  4BIR A;  1X1W A;  3AGO A;  1PY3 A;  2KF4 A;  5BU4 A;  1BAN A;  1I70 A;  1FYS A;  1I0X A;  2AAE A;  1BVI A;  1B2Z A;  2F5M A;  3KCH A;  1RN4 A;  1DE3 A;  1BSE A;  1MGW A;  1RGK A;  1RNT A;  1BSA A;  1YGW A;  1RGL A;  1AQZ A;  3DGY A;  1RNB A;  1FUS A;  1BRJ A;  1UCK A;  1X1X A;  1Q9E A;  1GMP A;  1TTO A;  1UCJ A;  3D5I A;  1BAO A;  4GHO A;  1A2P A;  1RGA A;  1GOU A;  1BSD A;  5HOH A;  1BSC A;  1G02 A;  1GOV A;  2KF6 A;  1RLS A;  1CH0 A;  1LOW A;  1JBT A;  2HOH A;  3WHO A;  3SYU A;  4BU4 A;  1BNR A;  1RGG A;  2KF3 A;  3GSP A;  3RNT A;  1HYF A;  1ZGX A;  1LNI A;  2RNT A;  1B27 A;  1BRI A;  1BOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...