2CK3H

Azide inhibited bovine f1-atpase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How Azide Inhibits ATP Hydrolysis by the F-Atpases.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2ck3H02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ck3H01
4YXWH 2E5YA 2V7QH 2QE7H 2E5TA 1IFPA 1JEKA 1E79H 3PJSK 1FS0E 1AQTA 2CK3H 1BSHA 2W6JH 4TLFA 1BSNA 2JDIH 4QMAA 4WVZA 4DJGA 3USSA 3EFFK 2WSSH 2XNDH
chains in the Genus database with same CATH superfamily
3WODG 1GDTA 3NBBA 1FZBA 1JTHA 1JTHB 2QJYB 1ZGXA 1QGKB 1VQ4P 1XTGB 1RNBA 3H1JE 5E79E 2XR8B 2KSEA 4JYBA 5GTHH 2LYXA 3GRDA 3B8EB 1KB9D 3SFEC 1SFCA 1NU1D 3BCCG 3AE3C 1W7CA 3SFDC 4ASWA 2O3OA 4KT0J 2O3JA 3IJEB 1ZP0C 2WT7B 3M9QA 1SQVK 2WT7A 2IZ1A 4D6TD 2HODA 3MPHA 1JB0J 1NTZJ 1NWWA 4JQ0D 2V7QH 3RL0D 3H1HE 1JV2B 1OFCX 4CCVA 2Z7AA 2GM4A 4H13C 5AEUB 1KMIZ 1QAFA 2INXA 4B86A 3F7XA 4L7KA 1NYHA 1KILD 2YIUC 5AW9B 2MF7A 1O7HB 4GL6A 1M57D 1GYBA 1Q40B 2KCDA 1GTWA 5G2GA 3S67A 4YPCA 2HLOA 2KAAA 3QK9A 3GHGA 2H0IA 1DD3A 1HWTC 2W56B 4FMAA 1NKZB 4U13A 3TF5A 1FZCC 3QWOC 1X0TA 3GLMA 1SP4A 2P0XA 1N5HA 2BASA 1BNJA 1IQXA 3PLNA 5AVYB 3VMZA 2IUJA 1NJI4 3MUDC 2G8YA 2M5AA 1AQZA 4IFDK 3L74G 5APQA 1Q86Q 4O3VA 1RJOA 1FGTA 6STDA 4FMBA 3EQQB 5AW5B 2AADA 5EVHA 3NXSA 1YHQP 2HODB 4J5KA 1VQQA 2ZT9B 1GK6A 2KI7B 2L1SA 1JZDA 3V92A 3CXC2 2E76D 2OARA 1YJNP 3H1JD 4I2LC 3Q2YA 2YO2A 3HTKA 3GW6A 4FCJA 3CD63 2LR2A 3X40A 2YNYA 4IL6H 2Q9IA 1B2ZA 1VQ8P 1VF5C 2XH9A 5AW6B 5AVSB 2KUBA 3GHGB 4HYZA 1WT6A 1W4NA 4HBRA 4HJGH 1W01A 2KS1A 1RMSA 2R32A 3H1IE 3EN8A 5STDA 2P7JA 1LNQA 1UIXA 4BTWA 5B5EE 1BANA 5KAFE 3E7KA 1UCKA 3OXAA 1LNHA 2CG1A 3L70E 4K1UA 1YJ9P 3AE8C 2W0QA 2KK7A 1E97A 2E75B 1RN4A 1FA3A 1BOXA 1ZOYC 1IQYA 1ZR4A 1SQQJ 3D9RA 2L91A 1QMAA 1TFOA 2Q3IA 5KKZB 2P38A 2NPSC 1ZRTE 1N7SD 1NTZK 1GL2C 1LTAC 3H6PA 3OWUA 1RHLA 4HM3B 1GU4A 3A7OA 1DEBA 1LTIC 3G713 3HE5A 3FH1A 4GHOA 1FC2C 1IFPA 3CCJ3 2E74B 1LWUC 5KAIE 1I8VA 4WY4C 2QA4P 3CLQA 1KQLA 2P05A 3WA3A 2WOHA 2KSJA 1T3BA 3H1JG 1GS3A 2XV5A 4EC6A 1S9KE 1FJKA 3VYIA 2BCCE 1LOWA 1X8YA 5IERA 2I1KA 1OVUA 4A7PA 2MKVA 3L70J 1NAYA 1G2CB 2PAJA 1RSNA 1IFNA 1LTJB 5CXOA 1H0TA 1GOYA 2A45G 1GSPA 3R2PA 2J58A 1X79B 5AW0B 2P10A 1JZOA 5B66E 1L0NK 1BCCE 3I5CA 5AVWB 3Q1CA 2O01J 2ITAA 1ZN5A 4IL6X 1C54A 3MP7B 2N1TD 1DH3A 1KB9H 2IBZD 3JC22 1N2DC 1E79H 2N9YB 3OJAB 1IO4A 5CCHC 2HMJB 3X42A 4I1LA 3R4YA 1OUNA 3UL6A 1VQ53 1PIXA 4PJ0E 5KJ7C 4WB4A 3D71A 4H3UA 4N6UA 4D6TE 1V58A 2PGDA 1N73A 1NU3A 2F99A 3D5GA 3SYUA 1L4AD 3T8UA 4K3AA 1SQQK 3H1LJ 1VQ43 5CCGA 3FF2A 1O7NB 5BU5A 1LRAA 1YGEA 1BGYG 3VGNA 2K9YA 1JN5A 1JN5B 3E1RA 3EBTA 4EOTA 1EUIC 1M1K4 5HGRA 1E5WA 3A0HH 2Z6BA 3G6EP 4NPFX 1YI2P 1HGVA 1SQVD 1M904 1URQC 3H32B 1K9MQ 2JR8A 5I97A 1TU3F 4Y28J 2W90A 3Q5SA 4NHFA 3CPWO 2FFDB 3FG3A 1ULJB 3H1KD 5IG4A 2W83C 3KKGA 1IFMA 1BNFA 3CU3A 4GODA 2K9JB 2YXQB 3DGLA 1VQOP 3VMYA 4HM0B 1IVXA 3F9SA 1S5LX 1OIPA 1RE3A 3TGUG 1KD14 4NREA 1K04A 3G4SP 3SVAA 3HE4A 1PY3A 1IT8A 4BL2A 4CPGA 1RCLA 3HX8A 1HBWA 4EBGA 3L74E 1CQSA 2HFED 1BE3J 1BVIA 1URQA 4ORLA 1AVKA 1T2IA 1RGEA 1SVFA 1SIIA 2Y0DA 3L72E 1L0LE 2J8XB 3AGOA 2HMLB 5LC6A 4XE5B 2PRRA 3PCSA 3CCUP 2HMMB 2E42A 1BRJA 1KFMA 1LWUA 1A2PA 1SPUA 1B21A 9RNTA 4N6MA 5APUA 1OXZA 1PV3A 1ZLLA 1SQVJ 1ZV8A 3L73J 1UIIA 2OOVC 3L73G 4EXRA 1JRQA 4ILFA 1LJ2A 3M06A 4CPKA 2OYIB 1BSHA 1JMBA 3BU4A 3V2QA 1MGWA 4AUWA 1MZ9A 4NPEA 2IA7A 3TSIA 2KF3A 5AVRB 3LXUX 3L70G 2E75D 1YITP 2A45I 3TNUB 1VF5D 3BB9A 1HH0A 4OWFA 3LW5H 1GY7A 2OYHB 2BU4A 1NAFA 3WUVA 3M0AA 2D2CB 2KXGA 1N73C 1DETA 3WDGB 3KSPA 3NUVA 1N7SC 3CWBJ 4NPBA 3B4SA 3CXHI 1FOSF 2HMOB 1W2EA 1D6YA 1VQO3 2BO9B 1Q864 1BCCG 7RNTA 1QVGO 2IFNA 3QH9A 1SARA 1M90Q 1PGJA 1LOVA 2FYZA 2XNXA 3HI7A 4AEQA 2C4BA 4R4MA 2BT3A 2CHCA 1MWRA 1OCVA 3G4S3 3F40A 3JUOA 1DYUA 3T8NA 1KQSO 4N3YB 3MG3A 7GSPA 1NB5I 1T2KC 4ZM8A 1KILC 2HYNA 1HF9A 4MMXB 2H89C 1BSEA 1R5SA 1XTCC 2WPQA 3LTAA 1X1WA 4H44C 4PV1C 1GMQA 2FYNB 2BMOB 2CX0A 1Q9EA 1OW7A 2FBWC 5CCGD 5CBNA 4N78D 1LT1A 1M1JC 1L0LJ 2ZYAA 3WR2A 5HOHA 1USEA 2WO0A 1R4CA 3A0HE 2Q3EA 2ZT9C 3VP8A 3L70D 4YXDC 3KCHA 3LT9A 3GZYB 5CHXA 1JY2N 3CXHE 4UB6H 1Q2NA 1I2FA 1SFCC 4UB6E 5AW4B 1PGQA 3HRNA 1IVWA 3RK3C 5CK6A 4KVHA 2O01N 3VOPA 1FZFA 1FW7A 2R44A 4J8TA 3N8BA 4KFEA 1P84E 1NO4A 3T97B 1IJDB 3L72D 1B2MA 2C0XA 3EWKA 3S4RA 4RESB 3K5TA 2GBWB 1FZUA 4I7ZB 4YXWH 2AAEA 3E1IA 1LT9A 4O2HA 1JB4A 3B5NC 4H44D 3CNMA 1YQ3C 3AMOB 4QWTA 1RGGA 1BIRA 1PP9E 4HOHA 1FZGA 1FGQA 2IFMA 1DMNA 3VMAA 4Z1MH 3CCR3 2WPVB 1IT7A 5CCHA 1NTMK 4O9BA 3SOYA 3PP5A 2Y73A 5AIHA 3CCS3 5G1LA 3FXDA 3NTNA 3VMXA 1VQPP 1EZVG 3TNUA 1ZMEC 1LQMB 3LT8A 2OOVA 3CCLP 4BL3A 3CWBD 3NMDA 1I0VA 3PGBA 3RL0g 1YBKA 3OAKA 3BRVB 2HPCB 2E74C 1YVSA 2AXTH 1FYSA 3BRTB 2YO3A 2V4HA 2CIUA 1RE3C 3AGNA 3IAOA 1DX7A 5AEWB 1TP6A 4WY4B 3CI9A 3L37A 4N6V0 2L5GB 2KP8A 3NM2A 2IY2A 5KLVD 5EFWB 5M19A 3X3YA 4ZKPA 3PHLA 1W2ZA 3BNEA 1H88A 1B3SA 1IU7A 1U57A 5CBOA 1P84I 1L4AA 4R9KA 1RY3A 3H1KG 2FXPA 1BCCJ 3CC7P 3S28A 5IF6A 3C8VA 4AKYA 2OCTA 2ZHXB 1ZRTD 1Q7YQ 4BTXA 3GWRA 5IENA 2YIUB 2K9JA 5IG0A 4BXLA 1LT9B 5AVVB 3LTCA 1Z56A 2NPSD 3MHVA 2OYOA 1N9EA 1HKXA 1PYLA 2WQYC 1IZNB 2M8RA 1LNIA 1J1EB 1E3RA 1OVVA 1TIJA 3SXXA 3RL0B 2CWTA 4FCMA 4EIJA 1M9GA 4X2OA 1E3VA 1IK9A 1FZCB 1Q824 1MFTA 4IT7A 4D6TJ 5GTIE 2PZVA 1A02J 2B88A 1OZHA 4HM8B 1A90A 2DW3A 4EW5A 3EBYA 5AVXB 3O8ZA 3CD6P 5CF1A 1BNRA 3H1HD 4RNTA 1OW8A 1V57A 4LYLB 3HK4A 1NOHA 2Z5HA 3HUSC 1JO5A 1PL5A 4L73A 4KZ1A 1JM0A 3DH2A 1VQN3 2JKVA 3PYJA 5GTIH 2AEMA 1OACA 2GA1A 5DREA 4HAAA 4LSOA 4RO0A 4D6TG 1LP1A 2KLVA 3AEDC 3BNDA 3OW22 4GB5A 1YYCA 1U8CB 3IFMA 1T2HA 1ZX2A 1S5LE 1RE4A 5A0OB 3CX5E 1WMOA 3ROBA 3AE6C 1IK3A 3CCM3 1EXIA 4N6OB 5AW7B 1T6AA 1OF5A 2HMNB 2QJKB 3KN4A 3OA7A 3PXMA 1FDIA 2F86B 2QGUA 2AXCA 3CC4P 2O1KA 3PRJA 1S9KD 1QALA 2RSXA 2W6JH 3WMM0 1RCKA 3WOFB 1QAKA 2JDIH 4QMAA 2M3EA 4HM4B 1LTSC 1CI6A 2CKFB 4WHAA 1VQLP 1VZZA 4WYKA 2JWAA 1STDA 1BRSA 3NFQA 5APYA 2P0MA 3MUDA 2NZ2A 4GOEA 1GD3A 4WY4A 2P67A 1N8QA 2K54A 4GT1A 1NU1E 5KLVG 2QG4A 3ZDMA 2C9NY 1B2SA 2WOFA 3DY5A 1BCCD 5AYSC 1O7WB 2CK3H 3MKIA 1JY2P 5KKZC 5AVQB 1L2PA 3G3ZA 2E2VA 1R4YA 4BWNA 1G1IA 3RK2C 1GL2B 3A5TA 3VSYA 2R4IA 3VTPC 3K0ZA 3CCQP 4JPZB 3SWKA 1CYUA 5AVTB 2M3BA 3L75G 1LOYA 1FAVA 3ECFA 1UI7A 1K05A 3L73E 3CX5I 4HM6B 4RJTA 4XDVA 1PFIA 3CCRP 3HD7D 5APWA 1RHZB 4HM5B 3RK2D 2KB7P 3D3LA 1TRQA 3AMOA 2CFKA 2GEXA 3V4QA 3CNXA 3OWSA 2C11A 3K7CA 2QIYA 1IQ8A 4FMDA 2CH9A 4JF7A 1BAOA 3FX0A 4PD4H 4OGQB 3E99A 4O8SA 3L75J 1CEWI 2STDA 4N6NB 1TTOA 3H1ID 2RN0A 1Y9BA 4IFMA 3Q5PA 2W27A 1H8AA 1N7SB 3L74D 3JUNA 1O7PB 1JBRA 1BE3E 3JUQA 1VQ7P 1OGZA 3L74J 4WVZA 1QLED 3TGUJ 1MV8A 4WY4D 2Q7CA 1PPJE 3AE1C 2OTLP 2FNQA 4FCZA 5AW8B 2H88C 3HD7B 1IVUA 1X1UA 3HE5B 3B4OA 1GL2A 4K35A 4W80A 2RNTA 2IBZG 4RNZA 1EG9B 1YTZT 2KZJA 4EYCA 1YIT3 4R4LA 1L0ND 1LTGC 1AFOA 2R3CA 2IYJA 2XF3A 3L71G 3P8MC 2A06E 3MZWB 5JPUA 3T0UA 1DVDA 1KC84 3D4AA 1OX3A 1JY3O 1QL1A 4PV1B 2QA43 3H1LG 4XFJA 5CJ0A 2M7OA 4OK0A 1K8AQ 1KFNA 1G96A 1J2JB 4IFFA 2Q07A 1CSBA 4LGQA 1KYOD 1RDSA 2KLUA 1A2VA 3CCQ3 3NQZA 4H13B 2D42A 1AV4A 2ZVOB 4YTPC 3JCUE 3CCU3 1W2B2 1SFCB 1RF0A 1KTMA 1YJW3 1LTBC 2W03A 2XKMA 2WPSA 1UI8A 5APTA 1BUQA 1YIJ3 3O6QA 3FGAD 1GD2E 4RKUJ 2ZXXA 2MJZA 1RGHA 2QIWA 3WUUA 2JQ5A 2G3AA 1W6CA 4K1VA 2N1TC 1VQL3 1GMJA 1STFI 3U1WA 1O7GB 1RNTA 4G1MB 3VP9A 3I553 1K73Q 2ZYDA 2JJLA 4I7ZC 5D82A 2F5MA 2CG0A 1W00A 1VQMP 4ZNCA 2XFSA 4PEJA 4KT3B 3UB1A 1PPJG 1L4AB 3II6A 3WA2X 2O9UX 3BIRA 1FUTA 5BXQA 3P32A 1NTKK 1BGYD 2LXCB 4JF8A 3DUKA 1J1DB 4TLFA 3V2NA 2SARA 2W04A 4LMIA 1YTZI 1LVNA 1AV1A 2BCCJ 4MJDA 3MD0A 2E76C 1I2EA 1EQKA 2MC8A 4N6JA 4LEHA 1RQVA 1S1CX 3LZAA 5ELJA 4XBTA 1NTZD 3LIEA 3HIIA 3NHXA 3VN0A 4J9AA 1D6ZA 3Q90A 3RGRA 2BMQB 5CMZA 2KNCB 4KFFA 1NTMJ 2YFJB 3JVCA 1EZVI 3L75E 3SX1A 2K1AA 4Y99B 1BNIA 1OHSA 5K5GB 1PP9G 3FWLA 1OPYA 3KSED 2WGQA 2UX0A 1A02F 1I3IA 1LQGC 4HZ9B 5E79H 1R5LA 2B87B 3FLJA 3G71P 1ZR2A 2WSCJ 3N4XA 3S5CA 1NJIQ 3PS8A 2QEXP 5H2FH 5CJ4A 1Q82Q 2CWVA 5TISH 3JUPA 1YIJP 3L0RA 1NU1G 3BCCD 3AHSA 5IEPA 1L5GB 4MEIA 1KQS2 4HM7B 3ALAA 1WQLB 1SFCD 1VQ6P 3U1CA 1RH5B 4N3VA 1YI23 1DIPA 1OGXA 1WRGA 3L35A 1D6UA 2ML5A 1MWTA 1UUVB 3DM8A 1BSCA 1RF0C 3I55P 4AKZA 3S1KA 2GXFA 1Q7Y4 1NNVA 1BRGA 2QJPC 1JMMA 1K41A 4N6TA 1AA0A 1R8EA 2WWWA 1RGFA 3M8CA 1RGAA 1SQXK 4R1KA 4HJLB 5IG5A 1DEEG 1SLQA 3HUSB 1DMQA 5APSA 2E2UA 1GU5A 1L0LD 1KV4A 1P84D 1EZVE 3WHOA 2JP3A 3X3ZA 2CFLA 3EB8A 3EE1A 3BCCE 1NWQA 1F8NA 3OWYA 3CCL3 4WWIA 4BRYB 4IPBA 1RGCA 2D2CD 3FXEA 4UB8E 2XDJA 3GF3A 1Y8AA 1YHQ3 1NTMG 2FXMA 3FZWA 1SQBK 2WTYA 2OTL3 3A5EA 3KHUA 1JOCA 1UCIA 2WPRA 1IVVA 2R3SA 3A2AA 5CCHD 2W2CA 1S4XA 4OUQA 1RTUA 1FUSA 3GZBA 3FGYA 1BRNL 2SPZA 1QEXA 1B27A 3WOEB 1AJYA 4C7NA 1OWAA 4EV2A 1RGKA 1Q7HA 2QE7H 3H25A 3B5NA 5ELUA 4R4KA 1S5LH 1GMPA 3H1HG 2PFXA 2QEX3 2L4VA 1ZS7A 4O02B 1ZO2A 2IZ0A 1DE3A 1RN7A 5KLIB 2JO1A 3HUSA 2A45H 1PP9J 3RK2B 1ASKA 1FUWA 1H89A 4LLHA 3AE7C 1HYFA 1URQB 4RZMA 1KYOH 1AR0A 3H1KE 3DGNA 2FFDC 2RKLA 4BIRA 2HR3A 4WBAA 3MSOA 2F4YA 2ZVNB 2IX7C 3BNCA 2A15A 2R5BA 5LC7A 2OQQA 3GZXB 3CC23 3TGUD 2FYUK 4XBYA 4XM4A 1VDFA 4M3LA 1RF1B 1YQ4C 2XSHB 6RNTA 3LIDA 1VQNP 4JRFA 1W5ZA 1WTHA 2E75C 3CCVP 1OHOA 5DJUB 1JKGB 1YGWA 1M1JA 3A3YB 2NPSB 1DMMA 3MWZA 2LKMA 1EC5A 3HOHA 1DD4A 3A0BH 3AE2C 2XEPA 5FW5A 3FG4A 2WITA 2PP6A 2XGNA 1HZ1A 1RRLA 2CFWA 1EDIA 2K37A 1BDDA 3L73D 1SQWA 3S9OA 1EKMA 1NO3A 1M1XB 2IYPA 3CCMP 1QL2A 2CX1A 5D83A 4DZOA 3MGNA 3HIGA 1US1A 1MUUA 2FYUD 2IBZI 5EQLA 1FDMA 3UIAA 2W9QA 4WWUC 1EEJA 2XFTA 3ZFZA 1SQXD 3D6YA 5M1AA 3T97A 3OX9A 1MKMA 2IMJA 3F89A 3Q5RA 1GY6A 4AYCA 2Z5IA 4C46A 1VQ5P 2OQEC 4EDFA 5CCGC 1JBSA 1I3FA 1G0TA 4IOIH 3M0DA 1JNMA 3EJVA 1LXEA 1JCDA 1PPJD 4IIAA 2I1JA 2GU1A 1KD1Q 3JSVC 1BU4A 1SQXG 1YJN3 3CC2P 2IYOA 2PNCA 1T2KD 4TX4A 4JBZA 2OGUA 4GSPA 2Z76A 3L71J 1UGIA 1FGOA 3H1LE 1NTZE 4W7YA 2POHA 1VQKP 1N9JA 3STDA 1BGYJ 1W5CE 3SSUA 4K61A 1SIHA 2K3RA 2ZYGA 2B24B 4HM1B 1K734 1T3UA 5KLVE 2HPCA 3H1KJ 3FG1A 3G16A 1VPCA 4WFOA 2FY8A 1IC2A 2IBZE 4DT0A 3NM7A 2KXPB 1MGRA 2ZJSE 1IK7A 3O8YA 1WMKA 3AEFC 1T5YA 2UWJE 3CC43 1V74A 5KJ7D 1SQPK 3CX5H 4C7RA 3NQYA 3JCUH 1FGMA 3D70A 1KWIA 3M0DC 3P8CD 1JY3N 5IW9A 1J1DC 2FFDA 2O01H 2WSFH 2W56A 3KIIA 2FYNC 1ISKA 1IFDA 1KYOI 3L72J 3LOYA 1M1JB 4OH8B 1H0TB 1VQ73 3EFGA 4AQRD 3X3XA 3L4FA 1DVCA 1GZLA 5JBSA 2KF6A 2AXTE 1PU4A 3KZIH 1X1YA 3GHGC 1NTKE 1LGHB 3KPEA 1GW3A 7STDA 2CPSA 4OVMA 4H0LD 1BUJA 1U5OA 4X2HA 5C39A 3L71E 4U7JA 3S29A 1PZQA 2Q1KA 1CI6B 4HKZH 4IL6E 1ZW0A 4XDWA 1BNGA 3GSPA 3H1HJ 2WVRA 5CF2A 2XSOB 1OVRA 2E5YA 2B89A 1EA2A 1NTKG 1P84H 4GOFA 3IMAB 4DCKA 2CPBA 3S27A 1NU1J 2CFGA 4H0LB 5AW3B 4DOJA 2O1JA 3SLUA 3P7KA 1FBMA 1MNLA 3N7NA 1Q40A 5M1BA 3B7CA 3GZRA 1AVYA 4XB5A 2YFLB 3H1JJ 4H61A 1VQP3 3BATA 3EFFK 3GAXA 2GSPA 1LP1B 3EX9A 3PH0A 2P58A 5AI1A 2CWUA 4BRYA 1N86A 1KYOE 2A06G 1L0NG 2UGIA 2BCCG 1LOXA 1C7HA 2Y0CA 2GU3A 3L71D 1KSIA 1QX8A 3AECC 1NB3I 2C0WA 3CX5D 1M1KQ 3L75D 3EN1B 1QVFO 2YMKA 2QJPB 3K9MC 1U7JA 3V6IA 2KF4A 2D2CC 3RGAA 1FU1A 4PD4I 1KB9E 3PZWA 2NRGA 3GG2A 5H2FE 4ZMDA 1UDII 1HUCA 2M5AB 4L8PA 1IFJA 1Y47A 3F5HA 1FS0E 3CXHD 3H3HA 3KE7A 2J5UA 3B5ND 3A0BE 3CMAP 1TRPA 1YVBI 5KP3A 3K63A 1BRIA 2OYHC 1K28A 2IDBA 1RE4C 2FYUJ 2P2UA 2F98A 3CCSP 1BE3D 4CDLA 1BGYE 1JCCA 1KILE 3U97A 4HB1A 5B66H 3DMCA 5BU8B 4EYYQ 3QRDA 2P09A 3U1AA 2W6AA 3RNTA 1KC8Q 3LTDA 1URQD 1HGZA 1IV7A 4HKVB 1EDJA 2ZFCA 3ZG0A 1X22A 4FR9A 3LYGA 4N78E 4KJMA 2HOHA 3RBZA 1JJ22 2WMMA 1UCLA 3CXHH 4GDOA 3V5BA 3CWBG 1Y4KA 1RQUA 3AHWA 3CCEP 3IF4A 5DJTB 1KB9I 4LGDE 3CMEP 3RDEA 1QVF2 1OHPA 2Q6QA 1S3JA 5KLIC 1Q81Q 1MWSA 1KQGB 2QRXA 2M0BA 4TT3H 1D7MA 3FCSB 2OYHA 3ABVC 3MG1A 1N7LA 1M7LA 4BTYA 4R9LA 1TJDA 3G0KA 1FZEA 3V2PA 3L36A 2H0HA 2KNCA 1SQQD 2W6BA 2KRTA 5AVUB 3FF0A 2LXBA 3AEAC 4JYCA 4OVNF 3RK3B 1BSNA 2A06D 1B2XA 3ER7A 4L8OA 1NTMD 2F56A 1JY2O 5RNTA 3Q2PA 2XZRA 2KS1B 1RRHA 5IEOA 1Q90D 4Y99C 5TGNA 2QVAA 1ULIB 2N9BA 1AVLA 1HJ0A 2Z4EA 3LH4A 1B2UA 1KORA 1JEKA 3BNBA 3PJSK 4NPDA 2ZDJA 3B71A 3GMAA 5KLVK 3CWBE 1TUHA 2KIKA 1YNVX 3ZG5A 3D79A 2IUKA 1EQ7A 3B5NB 1NTKD 3BASA 1I2GA 3MHEA 1PP9D 2WSSH 2B1XB 2D1WA 1JB5A 3Q3DA 2BNGA 3KFQC 1HTLC 1L0NE 1NH4A 3EHCA 3KQGA 3NV0A 2ZL8A 1S723 1RN1A 1UGHI 2YMYA 2K88A 1N5PA 4KHXA 2RH0A 4GKGA 3LMLA 3H51A 4I5QA 1VQ93 3DGOA 1NVOA 1VF5B 1EZVD 4EI2A 4FMCA 2Y74A 2E74D 3WUTA 5M18A 1SQVE 3NBRA 2QSIA 2BEZF 1N73B 1N8R4 2ZAEB 1A2KA 1VQK3 2E43A 1AY7A 3UJMA 4LZIA 3I563 2BIRA 1B20A 5CLKA 1LTJA 1LT9C 2FKWB 1KQFB 2YFIB 3NXJA 2KOGA 2K3DA 1U7MA 3CMA3 1JKGA 4MMYB 1G02A 1EDLA 2E2TA 1SQXJ 3CCJP 4PJ0H 2JWDA 3A76A 4WP5A 2KZIA 3W67A 1FE6A 3F7SA 5KJ7A 2Z77A 2R5DA 1GW4A 2QJYC 3DGMA 2SBLA 3G6E3 4UB8H 1KILB 1UW1A 3K5BA 2FGTA 3Q3FA 5GSPA 3FWNA 1VQM3 3RGUA 4C7NB 2W8ZA 4W7ZA 1BE3G 1FOSE 1S2EA 1IFIA 4H44B 5AW2B 2AEJA 3BCCJ 1GD4A 2I8DA 1L0NJ 1GMRA 1YJ93 1OW6A 1Q814 1UCJA 5L8RJ 1MOLA 3J7Yd 2QM7A 4Q53A 4MMZB 2RBIA 1VQ63 3D6ZA 4L76A 1SQBG 2OTKE 1LTJC 3H1LD 3AEGC 3EF8A 1BSBA 5TJHA 3JUMA 2B9BA 1W02A 1SJWA 5EEOA 1ROVA 5JPPA 1NKNA 1JY3P 1ZXGA 5APXA 3WMDA 1GOUA 4HM2B 3URPA 1SQQG 2F5WA 1Z1SA 2YKPA 2R41A 3AE9C 1SQPJ 1RF1A 3SWYA 1K9M4 4OGQD 1BDCA 3CME3 4HH2A 1RKYA 1I0XA 5DRVA 1NHLA 2WZ7A 2LQVA 4HYTB 2H7HA 1JUNA 2BCCD 2XGLA 2OQEA 3PTZA 4RBNA 2RMZA 1RF1C 1NU1K 4STDA 3HZPA 1IDPA 4U3FE 5FGOA 4MN4C 2QM8A 5KAFH 1KZUB 3HE4B 2IPPA 1W6YA 3MTUE 1KILA 1SQBD 3I56P 2XNDH 2FYUE 1RGLA 3M9BA 2GUVA 1JB2A 2J59M 4PV1D 5B5EH 2V7QJ 4H0LC 3UNLA 4DKIA 5AYRB 1UUGB 1L0LG 3BLZA 4U3FJ 3ITKA 2XRXB 1X1XA 2C9LY 1TU5A 2WSCH 5G1KA 1BNSA 1J2BA 1MWUA 1CH0A 2OTJ3 5AVZB 2Y0EA 3V4WA 1FGRA 3G9RA 3N9HA 3IPTA 4U3FD 1CZQA 3TDKA 1EXJA 1VL2A 3F8HA 1SQPE 3GF7A 3CPOA 3B8LA 3CCE3 4J5GA 1MFZA 1PGOA 3KDPB 4RNYA 1BRKA 2Q5UA 1NTZG 5TISE 3AEEC 2BHMA 1K8A4 1QJGA 5KAIH 2OWPA 1OF5B 1G2CA 1X9VA 1JNQA 1BRHA 3TGUE 1SQBJ 2GBXB 1S72P 2FXTA 1VQ83 1VQ9P 3P8CE 5BVBA 2CC3A 1UUWB 1USDA 5BIRA 3M9HA 2OTJP 4PD4E 2UUGC 3V2RA 3TYYA 4LC1A 3RK3E 3IN6A 1AQTA 3KXDA 4EV5A 5KTBA 3DXOA 2V1LA 1M56D 5APVA 2YKQA 3M91A 2VRSA 4H13D 1SQPD 1CYVA 1J1EC 3RL0C 2RGQA 1FZAA 2WSEH 2HG5D 1PGPA 3HTKB 2RFRA 3HD7A 3LW5J 3DGYA 1GK4A 1NGMB 4L74A 3KYQA 2WSEJ 3W68A 3L72G 1T3JA 4R80A 2I9WA 1LTTC 4XA4A 3OW2O 4KFDA 1LWUB 2ML6A 3TK1A 1SQXE 1HU9A 1OMIA 2OYIC 4I6MC 2BEQD 3DZLA 1GL2D 5BVZA 1M8OB 1RLSA 2XU6A 3H1IG 4PD4D 1G1JA 3AE5C 2NPSA 2ZA4A 3G8ZA 1JBTA 2OYIA 3FSDA 3B4PA 2C10A 3IR9A 1W6GA 3MYTA 2E5TA 3SWFA 1WMNA 1NDOB 1IYYA 1WMPA 1BSAA 3Q1MA 4ZKUA 2H0GA 3SOAA 3LTBA 4WYKB 3RK3D 1S5AA 3I0YA 1W2BO 1BNEA 1Q42A 3USSA 5AIGA 3N54B 2QJKC 3KZIE 2AEFA 1WNHA 1SS1A 4GIFA 2H43A 3MG2A 1NTME 3MIWA 2ZT9D 2FYUG 5KP1A 1L0LK 3FKAA 4BU4A 1QVG2 3U59A 2YKOA 1FJPA 2CW9A 5GTHE 1SQPG 2Y9ZA 2W9PA 5IG3A 2FXOA 3UL5A 3V99A 3OV4A 3CL3D 2WGOA 3CCV3 8CHOA 1I70A 2BMRB 2WSFJ 3BVHA 3EQ2A 4HZBB 4N6LA 3C1LA 1KN7A 1GOVA 3F14A 4CJNA 1BSDA 2H8PD 4L75A 1T8ZA 2GEYA 1HJBA 2N1TB 4I4KA 2N1TA 3V98A 3EC9A 3NX0A 2CFDA 1O7MB 3H32A 3D5IA 2YX9A 3VF1A 1L4AC 3C9IA 3H1IJ 5AIFA 1SQVG 5BU4A 3X41A 4U3FG 3SEDA 2KYVA 1PFPA 5AIIA 5KP4A 2P1JA 3AE4C 1IV9A 2JEEA 3NV0B 1FZCA 1N7SA 4XBXA 2YXRB 1EDKA 5KLVJ 1N8RQ 2ZXEB 6GSPA 3CC73 3WU2E 2E76B 1HVVA 3WU2H 1ROAA 3RBXA 1SQQE 1TFKA 3PCRA 8RNTA 4OGQC 2RCDA 1AQ5A 2K0MA 2GUSA 1A67A 1CW5A 1NTKJ 1GY5A 3KZTA 4HVNA 3O6QB 2HMKB 2Y9YA 5D81A 1BGSA 1AVOA 1SQBE 4K90B 3TDGA 2B87A 1FDOA 3F8XA 3CPW2 3HD7C 1YJWP 4DJGA 3AEBC 3NBJA 1OH0A 5AW1B 2KF5A 4ASVA
chains in the Genus database with same CATH topology
3WODG 4BTYA 4MEIA 3NBBA 4R9LA 1KQS2 3G0KA 1IVWA 5CK6A 4KVHA 4HM7B 3ALAA 1WQLB 2KRTA 4N3VA 3FF0A 1YI23 1OGXA 2XR8B 1D6UA 4J8TA 3N8BA 4KFEA 2LYXA 2ML5A 1UUVB 3GRDA 3DM8A 1BSNA 4L8OA 3ER7A 4AKZA 2GXFA 1Q7Y4 1W7CA 3Q2PA 1K41A 1RRHA 2O3OA 4N6TA 5IEOA 3IJEB 3M8CA 4R1KA 5IG5A 3K5TA 4HJLB 2GBWB 5TGNA 4YXWH 1ULIB 3MPHA 1DMQA 2E2UA 1AVLA 1NWWA 2V7QH 3LH4A 1JV2B 4O2HA 4CCVA 1JEKA 1JB4A 2Z7AA 3BNBA 3PJSK 3CNMA 2ZDJA 2CFLA 3X3ZA 3EB8A 3AMOB 4QWTA 3EE1A 1TUHA 5AEUB 2INXA 1QAFA 1F8NA 3OWYA 1FGQA 3F7XA 4L7KA 2IUKA 3CCL3 1DMNA 3CCR3 1IT7A 3CCS3 4IPBA 3SOYA 2Y73A 5AIHA 2MF7A 1O7HB 4GL6A 2OOVA 3LT8A 3MHEA 2WSSH 1GYBA 1Q40B 2B1XB 2D1WA 2KCDA 1JB5A 5G2GA 3PGBA 3S67A 2BNGA 3KFQC 3EHCA 1YHQ3 3NV0A 2ZL8A 3QK9A 3FZWA 1S723 2OTL3 2CIUA 2W56B 5AEWB 4FMAA 4U13A 1TP6A 1N5PA 3LMLA 1IVVA 3H51A 1VQ93 2P0XA 2W2CA 1N5HA 3DGOA 4N6V0 4OUQA 1IQXA 4FMCA 2Y74A 3NM2A 3GZBA 3FGYA 3X3YA 3NBRA 1W2ZA 3BNEA 2IUJA 1IU7A 1N8R4 1A2KA 1NJI4 4R9KA 3WOEB 1VQK3 3UJMA 4LZIA 4O3VA 4EV2A 3I563 1RJOA 2QE7H 1FGTA 5ELUA 6STDA 4FMBA 5CLKA 3S28A 3EQQB 5IF6A 4R4KA 4AKYA 2OCTA 5EVHA 2QEX3 2L4VA 2YFIB 3NXJA 4O02B 1ZO2A 1RN7A 4BTXA 3CMA3 1JKGA 3GWRA 4MMYB 5IENA 1ASKA 5IG0A 1FUWA 2E2TA 3LTCA 3V92A 3CXC2 1N9EA 4RZMA 3A76A 4WP5A 1HKXA 1AR0A 3DGNA 3F7SA 2Z77A 3MSOA 1E3RA 3DGMA 1TIJA 2SBLA 3SXXA 2CWTA 4FCJA 4FCMA 3BNCA 3G6E3 2A15A 3CD63 1M9GA 1UW1A 4X2OA 1E3VA 2FGTA 5LC7A 3GZXB 3X40A 3CC23 1Q824 4IT7A 2PZVA 1VQM3 4XBYA 4XM4A 4HM8B 2XSHB 1A90A 2XH9A 3EBYA 4HYZA 1GD4A 1W4NA 4HBRA 4JRFA 1W01A 5CF1A 1W5ZA 1WTHA 1YJ93 3EN8A 1Q814 5STDA 1OHOA 3HK4A 4BTWA 3J7Yd 1MOLA 1JKGB 2CG1A 3OXAA 1LNHA 4K1UA 1DMMA 3MWZA 4Q53A 4KZ1A 2W0QA 4MMZB 1E97A 1VQN3 3PYJA 1VQ63 1OACA 2XEPA 5FW5A 1FA3A 5DREA 4LSOA 1IQYA 3FG4A 3D9RA 2XGNA 1QMAA 3EF8A 1TFOA 2P38A 3JUMA 1W02A 1RRLA 3BNDA 1SJWA 4GB5A 3OW22 2CFWA 5EEOA 1ROVA 3OWUA 1U8CB 5JPPA 1ZX2A 5A0OB 4HM3B 3WMDA 4HM2B 1WMOA 3ROBA 1SQWA 1IK3A 3CCM3 1Z1SA 4N6OB 3G713 1EKMA 1NO3A 3FH1A 1M1XB 1K9M4 5D83A 3CME3 1RKYA 1IFPA 1OF5A 2HMNB 5DRVA 3KN4A 3CCJ3 3HIGA 2LQVA 1US1A 3PXMA 2F86B 2QGUA 2XGLA 5EQLA 1QALA 2RSXA 2OQEA 4RBNA 2W6JH 2P05A 3WA3A 2WOHA 3WOFB 1QAKA 4STDA 2JDIH 3HZPA 4QMAA 1IDPA 2W9QA 5FGOA 4HM4B 4WWUC 1GS3A 1W6YA 2CKFB 2XFTA 4WHAA 1VZZA 4EC6A 2XNDH 4WYKA 3OX9A 2IMJA 1STDA 1GY6A 5IERA 2P0MA 1GD3A 2OQEC 1JB2A 1N8QA 2K54A 2WOFA 5CXOA 3DY5A 3EJVA 5AYSC 1LXEA 1O7WB 2CK3H 4IIAA 3UNLA 2GU1A 3MKIA 5AYRB 3BLZA 2E2VA 1YJN3 2XRXB 2PNCA 4TX4A 1TU5A 3Q1CA 3VSYA 2R4IA 1J2BA 2Z76A 1FGOA 3K0ZA 2OTJ3 1FGRA 1CYUA 3N9HA 3IPTA 1N9JA 3F8HA 3ECFA 3STDA 1UI7A 4K61A 3CPOA 1SIHA 3B8LA 4HM6B 1E79H 2B24B 4HM1B 4XDVA 3CCE3 2HMJB 3X42A 1K734 4RNYA 1OUNA 3FG1A 3UL6A 3G16A 4HM5B 1VQ53 4WFOA 4H3UA 2BHMA 1K8A4 3D3LA 4N6UA 1QJGA 3AMOA 2OWPA 1NU3A 2CFKA 1OF5B 2F99A 2GEXA 3CNXA 3NM7A 3T8UA 1JNQA 3OWSA 2C11A 3K7CA 2QIYA 1IQ8A 2GBXB 1VQ43 4FMDA 3FF2A 1O7NB 2CH9A 2FXTA 3O8YA 1YGEA 1VQ83 3VGNA 1JN5A 1T5YA 1JN5B 5BVBA 2CC3A 3E99A 1UUWB 3EBTA 4O8SA 1M1K4 1CEWI 5HGRA 3CC43 2STDA 1V74A 4N6NB 2Z6BA 3NQYA 1AQTA 1M904 1FGMA 4EV5A 1KWIA 3DXOA 2V1LA 5IW9A 5I97A 3JUNA 4NHFA 1O7PB 3FG3A 1ULJB 2W56A 1OGZA 3JUQA 3KIIA 1ISKA 4WVZA 5IG4A 1CYVA 3KKGA 2RGQA 3LOYA 4FCZA 2FNQA 3CU3A 3DGLA 1VQ73 2RFRA 1IVUA 3X3XA 4HM0B 1DVCA 5JBSA 3B4OA 1IVXA 3F9SA 1PU4A 1KD14 4NREA 4R80A 2I9WA 4RNZA 4KFDA 2ML6A 1EG9B 7STDA 4OVMA 1HU9A 1U5OA 4X2HA 4EYCA 1YIT3 3DZLA 3S29A 3SVAA 2XF3A 4XDWA 5CF2A 1IT8A 5JPUA 2XSOB 3G8ZA 3T0UA 1KC84 1DVDA 3FSDA 3HX8A 4EBGA 2E5YA 3B4PA 2C10A 2QA43 1W6GA 1CQSA 4ORLA 1EA2A 2M7OA 3MYTA 1AVKA 2E5TA 3IMAB 4OK0A 1G96A 1SIIA 1WMNA 2Q07A 3S27A 1NDOB 1WMPA 2CFGA 4LGQA 3SOAA 1A2VA 3LTBA 3SLUA 4WYKB 1S5AA 3CCQ3 2HMLB 3I0YA 5LC6A 1MNLA 1Q40A 3GZRA 1Q42A 3B7CA 3PCSA 3NQZA 3USSA 2YFLB 4H61A 4XB5A 5AIGA 3N54B 3EFFK 2D42A 2HMMB 3GAXA 1AV4A 1VQP3 3EX9A 3CCU3 5AI1A 1W2B2 1WNHA 2CWUA 1SPUA 4N6MA 3MG2A 1YJW3 2W03A 5KP1A 1UI8A 1LOXA 1C7HA 1BUQA 2GU3A 3FKAA 1QVG2 2OOVC 1YIJ3 4EXRA 2CW9A 1JRQA 2W9PA 1KSIA 5IG3A 3UL5A 1NB3I 1BSHA 3V99A 3EN1B 3OV4A 2WGOA 2JQ5A 3CCV3 1W6CA 3K9MC 4K1VA 2IA7A 8CHOA 2BMRB 1VQL3 1STFI 4HZBB 3U1WA 1O7GB 3LXUX 4G1MB 4N6LA 3I553 3RGAA 3F14A 3PZWA 2CG0A 5D82A 1W00A 2XFSA 4PEJA 3BB9A 3UB1A 2GEYA 4I4KA 4L8PA 3WA2X 1GY7A 2O9UX 3V98A 1FS0E 3EC9A 2KXGA 2CFDA 3H3HA 1O7MB 3KE7A 3NX0A 5BXQA 3WDGB 3KSPA 3NUVA 4JF8A 3DUKA 4TLFA 2YX9A 1YVBI 2W04A 5KP3A 2HMOB 4LMIA 3VF1A 1D6YA 3K63A 1VQO3 1LVNA 2BO9B 1K28A 1Q864 5AIFA 2F98A 3X41A 3SEDA 1PFPA 5AIIA 5KP4A 4CDLA 4MJDA 1IV9A 3U97A 3NV0B 1EQKA 2MC8A 4LEHA 3HI7A 4XBXA 3DMCA 4AEQA 3QRDA 2P09A 2BT3A 3LZAA 2CHCA 5ELJA 4XBTA 1OCVA 3HIIA 3LTDA 3G4S3 3F40A 3CC73 3JUOA 1DYUA 3NHXA 4J9AA 3T8NA 1D6ZA 3Q90A 1ROAA 3MG3A 3RGRA 2BMQB 1TFKA 3PCRA 1NB5I 1IV7A 4HKVB 2RCDA 4FR9A 2K0MA 3LYGA 4ZM8A 1A67A 1GY5A 3KZTA 4HVNA 4KFFA 2HMKB 2YFJB 3JVCA 4MMXB 3SX1A 1JJ22 3LTAA 1OHSA 5D81A 1OPYA 1Y4KA 2BMOB 3KSED 4K90B 3TDGA 2WGQA 2UX0A 3RDEA 1QVF2 1OHPA 4HZ9B 3F8XA 3CPW2 2WO0A 3FLJA 1R4CA 3S5CA 3PS8A 4DJGA 2CWVA 3FCSB 3JUPA 3L0RA 3NBJA 1OH0A 3LT9A 3GZYB 3MG1A 5IEPA 1L5GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXW H;  2E5Y A;  2V7Q H;  2QE7 H;  2E5T A;  1IFP A;  1JEK A;  1E79 H;  3PJS K;  1FS0 E;  1AQT A;  2CK3 H;  1BSH A;  2W6J H;  4TLF A;  1BSN A;  2JDI H;  4QMA A;  4WVZ A;  4DJG A;  3USS A;  3EFF K;  2WSS H;  2XND H; 
#chains in the Genus database with same CATH topology
 3WOD G;  1GDT A;  3NBB A;  1FZB A;  1JTH A;  1JTH B;  2QJY B;  1ZGX A;  1QGK B;  1VQ4 P;  1XTG B;  1RNB A;  3H1J E;  5E79 E;  2XR8 B;  2KSE A;  4JYB A;  5GTH H;  2LYX A;  3GRD A;  3B8E B;  1KB9 D;  3SFE C;  1SFC A;  1NU1 D;  3BCC G;  3AE3 C;  1W7C A;  3SFD C;  4ASW A;  2O3O A;  4KT0 J;  2O3J A;  3IJE B;  1ZP0 C;  2WT7 B;  3M9Q A;  1SQV K;  2WT7 A;  2IZ1 A;  4D6T D;  2HOD A;  3MPH A;  1JB0 J;  1NTZ J;  1NWW A;  4JQ0 D;  2V7Q H;  3RL0 D;  3H1H E;  1JV2 B;  1OFC X;  4CCV A;  2Z7A A;  2GM4 A;  4H13 C;  5AEU B;  1KMI Z;  1QAF A;  2INX A;  4B86 A;  3F7X A;  4L7K A;  1NYH A;  1KIL D;  2YIU C;  5AW9 B;  2MF7 A;  1O7H B;  4GL6 A;  1M57 D;  1GYB A;  1Q40 B;  2KCD A;  1GTW A;  5G2G A;  3S67 A;  4YPC A;  2HLO A;  2KAA A;  3QK9 A;  3GHG A;  2H0I A;  1DD3 A;  1HWT C;  2W56 B;  4FMA A;  1NKZ B;  4U13 A;  3TF5 A;  1FZC C;  3QWO C;  1X0T A;  3GLM A;  1SP4 A;  2P0X A;  1N5H A;  2BAS A;  1BNJ A;  1IQX A;  3PLN A;  5AVY B;  3VMZ A;  2IUJ A;  1NJI 4;  3MUD C;  2G8Y A;  2M5A A;  1AQZ A;  4IFD K;  3L74 G;  5APQ A;  1Q86 Q;  4O3V A;  1RJO A;  1FGT A;  6STD A;  4FMB A;  3EQQ B;  5AW5 B;  2AAD A;  5EVH A;  3NXS A;  1YHQ P;  2HOD B;  4J5K A;  1VQQ A;  2ZT9 B;  1GK6 A;  2KI7 B;  2L1S A;  1JZD A;  3V92 A;  3CXC 2;  2E76 D;  2OAR A;  1YJN P;  3H1J D;  4I2L C;  3Q2Y A;  2YO2 A;  3HTK A;  3GW6 A;  4FCJ A;  3CD6 3;  2LR2 A;  3X40 A;  2YNY A;  4IL6 H;  2Q9I A;  1B2Z A;  1VQ8 P;  1VF5 C;  2XH9 A;  5AW6 B;  5AVS B;  2KUB A;  3GHG B;  4HYZ A;  1WT6 A;  1W4N A;  4HBR A;  4HJG H;  1W01 A;  2KS1 A;  1RMS A;  2R32 A;  3H1I E;  3EN8 A;  5STD A;  2P7J A;  1LNQ A;  1UIX A;  4BTW A;  5B5E E;  1BAN A;  5KAF E;  3E7K A;  1UCK A;  3OXA A;  1LNH A;  2CG1 A;  3L70 E;  4K1U A;  1YJ9 P;  3AE8 C;  2W0Q A;  2KK7 A;  1E97 A;  2E75 B;  1RN4 A;  1FA3 A;  1BOX A;  1ZOY C;  1IQY A;  1ZR4 A;  1SQQ J;  3D9R A;  2L91 A;  1QMA A;  1TFO A;  2Q3I A;  5KKZ B;  2P38 A;  2NPS C;  1ZRT E;  1N7S D;  1NTZ K;  1GL2 C;  1LTA C;  3H6P A;  3OWU A;  1RHL A;  4HM3 B;  1GU4 A;  3A7O A;  1DEB A;  1LTI C;  3G71 3;  3HE5 A;  3FH1 A;  4GHO A;  1FC2 C;  1IFP A;  3CCJ 3;  2E74 B;  1LWU C;  5KAI E;  1I8V A;  4WY4 C;  2QA4 P;  3CLQ A;  1KQL A;  2P05 A;  3WA3 A;  2WOH A;  2KSJ A;  1T3B A;  3H1J G;  1GS3 A;  2XV5 A;  4EC6 A;  1S9K E;  1FJK A;  3VYI A;  2BCC E;  1LOW A;  1X8Y A;  5IER A;  2I1K A;  1OVU A;  4A7P A;  2MKV A;  3L70 J;  1NAY A;  1G2C B;  2PAJ A;  1RSN A;  1IFN A;  1LTJ B;  5CXO A;  1H0T A;  1GOY A;  2A45 G;  1GSP A;  3R2P A;  2J58 A;  1X79 B;  5AW0 B;  2P10 A;  1JZO A;  5B66 E;  1L0N K;  1BCC E;  3I5C A;  5AVW B;  3Q1C A;  2O01 J;  2ITA A;  1ZN5 A;  4IL6 X;  1C54 A;  3MP7 B;  2N1T D;  1DH3 A;  1KB9 H;  2IBZ D;  3JC2 2;  1N2D C;  1E79 H;  2N9Y B;  3OJA B;  1IO4 A;  5CCH C;  2HMJ B;  3X42 A;  4I1L A;  3R4Y A;  1OUN A;  3UL6 A;  1VQ5 3;  1PIX A;  4PJ0 E;  5KJ7 C;  4WB4 A;  3D71 A;  4H3U A;  4N6U A;  4D6T E;  1V58 A;  2PGD A;  1N73 A;  1NU3 A;  2F99 A;  3D5G A;  3SYU A;  1L4A D;  3T8U A;  4K3A A;  1SQQ K;  3H1L J;  1VQ4 3;  5CCG A;  3FF2 A;  1O7N B;  5BU5 A;  1LRA A;  1YGE A;  1BGY G;  3VGN A;  2K9Y A;  1JN5 A;  1JN5 B;  3E1R A;  3EBT A;  4EOT A;  1EUI C;  1M1K 4;  5HGR A;  1E5W A;  3A0H H;  2Z6B A;  3G6E P;  4NPF X;  1YI2 P;  1HGV A;  1SQV D;  1M90 4;  1URQ C;  3H32 B;  1K9M Q;  2JR8 A;  5I97 A;  1TU3 F;  4Y28 J;  2W90 A;  3Q5S A;  4NHF A;  3CPW O;  2FFD B;  3FG3 A;  1ULJ B;  3H1K D;  5IG4 A;  2W83 C;  3KKG A;  1IFM A;  1BNF A;  3CU3 A;  4GOD A;  2K9J B;  2YXQ B;  3DGL A;  1VQO P;  3VMY A;  4HM0 B;  1IVX A;  3F9S A;  1S5L X;  1OIP A;  1RE3 A;  3TGU G;  1KD1 4;  4NRE A;  1K04 A;  3G4S P;  3SVA A;  3HE4 A;  1PY3 A;  1IT8 A;  4BL2 A;  4CPG A;  1RCL A;  3HX8 A;  1HBW A;  4EBG A;  3L74 E;  1CQS A;  2HFE D;  1BE3 J;  1BVI A;  1URQ A;  4ORL A;  1AVK A;  1T2I A;  1RGE A;  1SVF A;  1SII A;  2Y0D A;  3L72 E;  1L0L E;  2J8X B;  3AGO A;  2HML B;  5LC6 A;  4XE5 B;  2PRR A;  3PCS A;  3CCU P;  2HMM B;  2E42 A;  1BRJ A;  1KFM A;  1LWU A;  1A2P A;  1SPU A;  1B21 A;  9RNT A;  4N6M A;  5APU A;  1OXZ A;  1PV3 A;  1ZLL A;  1SQV J;  1ZV8 A;  3L73 J;  1UII A;  2OOV C;  3L73 G;  4EXR A;  1JRQ A;  4ILF A;  1LJ2 A;  3M06 A;  4CPK A;  2OYI B;  1BSH A;  1JMB A;  3BU4 A;  3V2Q A;  1MGW A;  4AUW A;  1MZ9 A;  4NPE A;  2IA7 A;  3TSI A;  2KF3 A;  5AVR B;  3LXU X;  3L70 G;  2E75 D;  1YIT P;  2A45 I;  3TNU B;  1VF5 D;  3BB9 A;  1HH0 A;  4OWF A;  3LW5 H;  1GY7 A;  2OYH B;  2BU4 A;  1NAF A;  3WUV A;  3M0A A;  2D2C B;  2KXG A;  1N73 C;  1DET A;  3WDG B;  3KSP A;  3NUV A;  1N7S C;  3CWB J;  4NPB A;  3B4S A;  3CXH I;  1FOS F;  2HMO B;  1W2E A;  1D6Y A;  1VQO 3;  2BO9 B;  1Q86 4;  1BCC G;  7RNT A;  1QVG O;  2IFN A;  3QH9 A;  1SAR A;  1M90 Q;  1PGJ A;  1LOV A;  2FYZ A;  2XNX A;  3HI7 A;  4AEQ A;  2C4B A;  4R4M A;  2BT3 A;  2CHC A;  1MWR A;  1OCV A;  3G4S 3;  3F40 A;  3JUO A;  1DYU A;  3T8N A;  1KQS O;  4N3Y B;  3MG3 A;  7GSP A;  1NB5 I;  1T2K C;  4ZM8 A;  1KIL C;  2HYN A;  1HF9 A;  4MMX B;  2H89 C;  1BSE A;  1R5S A;  1XTC C;  2WPQ A;  3LTA A;  1X1W A;  4H44 C;  4PV1 C;  1GMQ A;  2FYN B;  2BMO B;  2CX0 A;  1Q9E A;  1OW7 A;  2FBW C;  5CCG D;  5CBN A;  4N78 D;  1LT1 A;  1M1J C;  1L0L J;  2ZYA A;  3WR2 A;  5HOH A;  1USE A;  2WO0 A;  1R4C A;  3A0H E;  2Q3E A;  2ZT9 C;  3VP8 A;  3L70 D;  4YXD C;  3KCH A;  3LT9 A;  3GZY B;  5CHX A;  1JY2 N;  3CXH E;  4UB6 H;  1Q2N A;  1I2F A;  1SFC C;  4UB6 E;  5AW4 B;  1PGQ A;  3HRN A;  1IVW A;  3RK3 C;  5CK6 A;  4KVH A;  2O01 N;  3VOP A;  1FZF A;  1FW7 A;  2R44 A;  4J8T A;  3N8B A;  4KFE A;  1P84 E;  1NO4 A;  3T97 B;  1IJD B;  3L72 D;  1B2M A;  2C0X A;  3EWK A;  3S4R A;  4RES B;  3K5T A;  2GBW B;  1FZU A;  4I7Z B;  4YXW H;  2AAE A;  3E1I A;  1LT9 A;  4O2H A;  1JB4 A;  3B5N C;  4H44 D;  3CNM A;  1YQ3 C;  3AMO B;  4QWT A;  1RGG A;  1BIR A;  1PP9 E;  4HOH A;  1FZG A;  1FGQ A;  2IFM A;  1DMN A;  3VMA A;  4Z1M H;  3CCR 3;  2WPV B;  1IT7 A;  5CCH A;  1NTM K;  4O9B A;  3SOY A;  3PP5 A;  2Y73 A;  5AIH A;  3CCS 3;  5G1L A;  3FXD A;  3NTN A;  3VMX A;  1VQP P;  1EZV G;  3TNU A;  1ZME C;  1LQM B;  3LT8 A;  2OOV A;  3CCL P;  4BL3 A;  3CWB D;  3NMD A;  1I0V A;  3PGB A;  3RL0 g;  1YBK A;  3OAK A;  3BRV B;  2HPC B;  2E74 C;  1YVS A;  2AXT H;  1FYS A;  3BRT B;  2YO3 A;  2V4H A;  2CIU A;  1RE3 C;  3AGN A;  3IAO A;  1DX7 A;  5AEW B;  1TP6 A;  4WY4 B;  3CI9 A;  3L37 A;  4N6V 0;  2L5G B;  2KP8 A;  3NM2 A;  2IY2 A;  5KLV D;  5EFW B;  5M19 A;  3X3Y A;  4ZKP A;  3PHL A;  1W2Z A;  3BNE A;  1H88 A;  1B3S A;  1IU7 A;  1U57 A;  5CBO A;  1P84 I;  1L4A A;  4R9K A;  1RY3 A;  3H1K G;  2FXP A;  1BCC J;  3CC7 P;  3S28 A;  5IF6 A;  3C8V A;  4AKY A;  2OCT A;  2ZHX B;  1ZRT D;  1Q7Y Q;  4BTX A;  3GWR A;  5IEN A;  2YIU B;  2K9J A;  5IG0 A;  4BXL A;  1LT9 B;  5AVV B;  3LTC A;  1Z56 A;  2NPS D;  3MHV A;  2OYO A;  1N9E A;  1HKX A;  1PYL A;  2WQY C;  1IZN B;  2M8R A;  1LNI A;  1J1E B;  1E3R A;  1OVV A;  1TIJ A;  3SXX A;  3RL0 B;  2CWT A;  4FCM A;  4EIJ A;  1M9G A;  4X2O A;  1E3V A;  1IK9 A;  1FZC B;  1Q82 4;  1MFT A;  4IT7 A;  4D6T J;  5GTI E;  2PZV A;  1A02 J;  2B88 A;  1OZH A;  4HM8 B;  1A90 A;  2DW3 A;  4EW5 A;  3EBY A;  5AVX B;  3O8Z A;  3CD6 P;  5CF1 A;  1BNR A;  3H1H D;  4RNT A;  1OW8 A;  1V57 A;  4LYL B;  3HK4 A;  1NOH A;  2Z5H A;  3HUS C;  1JO5 A;  1PL5 A;  4L73 A;  4KZ1 A;  1JM0 A;  3DH2 A;  1VQN 3;  2JKV A;  3PYJ A;  5GTI H;  2AEM A;  1OAC A;  2GA1 A;  5DRE A;  4HAA A;  4LSO A;  4RO0 A;  4D6T G;  1LP1 A;  2KLV A;  3AED C;  3BND A;  3OW2 2;  4GB5 A;  1YYC A;  1U8C B;  3IFM A;  1T2H A;  1ZX2 A;  1S5L E;  1RE4 A;  5A0O B;  3CX5 E;  1WMO A;  3ROB A;  3AE6 C;  1IK3 A;  3CCM 3;  1EXI A;  4N6O B;  5AW7 B;  1T6A A;  1OF5 A;  2HMN B;  2QJK B;  3KN4 A;  3OA7 A;  3PXM A;  1FDI A;  2F86 B;  2QGU A;  2AXC A;  3CC4 P;  2O1K A;  3PRJ A;  1S9K D;  1QAL A;  2RSX A;  2W6J H;  3WMM 0;  1RCK A;  3WOF B;  1QAK A;  2JDI H;  4QMA A;  2M3E A;  4HM4 B;  1LTS C;  1CI6 A;  2CKF B;  4WHA A;  1VQL P;  1VZZ A;  4WYK A;  2JWA A;  1STD A;  1BRS A;  3NFQ A;  5APY A;  2P0M A;  3MUD A;  2NZ2 A;  4GOE A;  1GD3 A;  4WY4 A;  2P67 A;  1N8Q A;  2K54 A;  4GT1 A;  1NU1 E;  5KLV G;  2QG4 A;  3ZDM A;  2C9N Y;  1B2S A;  2WOF A;  3DY5 A;  1BCC D;  5AYS C;  1O7W B;  2CK3 H;  3MKI A;  1JY2 P;  5KKZ C;  5AVQ B;  1L2P A;  3G3Z A;  2E2V A;  1R4Y A;  4BWN A;  1G1I A;  3RK2 C;  1GL2 B;  3A5T A;  3VSY A;  2R4I A;  3VTP C;  3K0Z A;  3CCQ P;  4JPZ B;  3SWK A;  1CYU A;  5AVT B;  2M3B A;  3L75 G;  1LOY A;  1FAV A;  3ECF A;  1UI7 A;  1K05 A;  3L73 E;  3CX5 I;  4HM6 B;  4RJT A;  4XDV A;  1PFI A;  3CCR P;  3HD7 D;  5APW A;  1RHZ B;  4HM5 B;  3RK2 D;  2KB7 P;  3D3L A;  1TRQ A;  3AMO A;  2CFK A;  2GEX A;  3V4Q A;  3CNX A;  3OWS A;  2C11 A;  3K7C A;  2QIY A;  1IQ8 A;  4FMD A;  2CH9 A;  4JF7 A;  1BAO A;  3FX0 A;  4PD4 H;  4OGQ B;  3E99 A;  4O8S A;  3L75 J;  1CEW I;  2STD A;  4N6N B;  1TTO A;  3H1I D;  2RN0 A;  1Y9B A;  4IFM A;  3Q5P A;  2W27 A;  1H8A A;  1N7S B;  3L74 D;  3JUN A;  1O7P B;  1JBR A;  1BE3 E;  3JUQ A;  1VQ7 P;  1OGZ A;  3L74 J;  4WVZ A;  1QLE D;  3TGU J;  1MV8 A;  4WY4 D;  2Q7C A;  1PPJ E;  3AE1 C;  2OTL P;  2FNQ A;  4FCZ A;  5AW8 B;  2H88 C;  3HD7 B;  1IVU A;  1X1U A;  3HE5 B;  3B4O A;  1GL2 A;  4K35 A;  4W80 A;  2RNT A;  2IBZ G;  4RNZ A;  1EG9 B;  1YTZ T;  2KZJ A;  4EYC A;  1YIT 3;  4R4L A;  1L0N D;  1LTG C;  1AFO A;  2R3C A;  2IYJ A;  2XF3 A;  3L71 G;  3P8M C;  2A06 E;  3MZW B;  5JPU A;  3T0U A;  1DVD A;  1KC8 4;  3D4A A;  1OX3 A;  1JY3 O;  1QL1 A;  4PV1 B;  2QA4 3;  3H1L G;  4XFJ A;  5CJ0 A;  2M7O A;  4OK0 A;  1K8A Q;  1KFN A;  1G96 A;  1J2J B;  4IFF A;  2Q07 A;  1CSB A;  4LGQ A;  1KYO D;  1RDS A;  2KLU A;  1A2V A;  3CCQ 3;  3NQZ A;  4H13 B;  2D42 A;  1AV4 A;  2ZVO B;  4YTP C;  3JCU E;  3CCU 3;  1W2B 2;  1SFC B;  1RF0 A;  1KTM A;  1YJW 3;  1LTB C;  2W03 A;  2XKM A;  2WPS A;  1UI8 A;  5APT A;  1BUQ A;  1YIJ 3;  3O6Q A;  3FGA D;  1GD2 E;  4RKU J;  2ZXX A;  2MJZ A;  1RGH A;  2QIW A;  3WUU A;  2JQ5 A;  2G3A A;  1W6C A;  4K1V A;  2N1T C;  1VQL 3;  1GMJ A;  1STF I;  3U1W A;  1O7G B;  1RNT A;  4G1M B;  3VP9 A;  3I55 3;  1K73 Q;  2ZYD A;  2JJL A;  4I7Z C;  5D82 A;  2F5M A;  2CG0 A;  1W00 A;  1VQM P;  4ZNC A;  2XFS A;  4PEJ A;  4KT3 B;  3UB1 A;  1PPJ G;  1L4A B;  3II6 A;  3WA2 X;  2O9U X;  3BIR A;  1FUT A;  5BXQ A;  3P32 A;  1NTK K;  1BGY D;  2LXC B;  4JF8 A;  3DUK A;  1J1D B;  4TLF A;  3V2N A;  2SAR A;  2W04 A;  4LMI A;  1YTZ I;  1LVN A;  1AV1 A;  2BCC J;  4MJD A;  3MD0 A;  2E76 C;  1I2E A;  1EQK A;  2MC8 A;  4N6J A;  4LEH A;  1RQV A;  1S1C X;  3LZA A;  5ELJ A;  4XBT A;  1NTZ D;  3LIE A;  3HII A;  3NHX A;  3VN0 A;  4J9A A;  1D6Z A;  3Q90 A;  3RGR A;  2BMQ B;  5CMZ A;  2KNC B;  4KFF A;  1NTM J;  2YFJ B;  3JVC A;  1EZV I;  3L75 E;  3SX1 A;  2K1A A;  4Y99 B;  1BNI A;  1OHS A;  5K5G B;  1PP9 G;  3FWL A;  1OPY A;  3KSE D;  2WGQ A;  2UX0 A;  1A02 F;  1I3I A;  1LQG C;  4HZ9 B;  5E79 H;  1R5L A;  2B87 B;  3FLJ A;  3G71 P;  1ZR2 A;  2WSC J;  3N4X A;  3S5C A;  1NJI Q;  3PS8 A;  2QEX P;  5H2F H;  5CJ4 A;  1Q82 Q;  2CWV A;  5TIS H;  3JUP A;  1YIJ P;  3L0R A;  1NU1 G;  3BCC D;  3AHS A;  5IEP A;  1L5G B;  4MEI A;  1KQS 2;  4HM7 B;  3ALA A;  1WQL B;  1SFC D;  1VQ6 P;  3U1C A;  1RH5 B;  4N3V A;  1YI2 3;  1DIP A;  1OGX A;  1WRG A;  3L35 A;  1D6U A;  2ML5 A;  1MWT A;  1UUV B;  3DM8 A;  1BSC A;  1RF0 C;  3I55 P;  4AKZ A;  3S1K A;  2GXF A;  1Q7Y 4;  1NNV A;  1BRG A;  2QJP C;  1JMM A;  1K41 A;  4N6T A;  1AA0 A;  1R8E A;  2WWW A;  1RGF A;  3M8C A;  1RGA A;  1SQX K;  4R1K A;  4HJL B;  5IG5 A;  1DEE G;  1SLQ A;  3HUS B;  1DMQ A;  5APS A;  2E2U A;  1GU5 A;  1L0L D;  1KV4 A;  1P84 D;  1EZV E;  3WHO A;  2JP3 A;  3X3Z A;  2CFL A;  3EB8 A;  3EE1 A;  3BCC E;  1NWQ A;  1F8N A;  3OWY A;  3CCL 3;  4WWI A;  4BRY B;  4IPB A;  1RGC A;  2D2C D;  3FXE A;  4UB8 E;  2XDJ A;  3GF3 A;  1Y8A A;  1YHQ 3;  1NTM G;  2FXM A;  3FZW A;  1SQB K;  2WTY A;  2OTL 3;  3A5E A;  3KHU A;  1JOC A;  1UCI A;  2WPR A;  1IVV A;  2R3S A;  3A2A A;  5CCH D;  2W2C A;  1S4X A;  4OUQ A;  1RTU A;  1FUS A;  3GZB A;  3FGY A;  1BRN L;  2SPZ A;  1QEX A;  1B27 A;  3WOE B;  1AJY A;  4C7N A;  1OWA A;  4EV2 A;  1RGK A;  1Q7H A;  2QE7 H;  3H25 A;  3B5N A;  5ELU A;  4R4K A;  1S5L H;  1GMP A;  3H1H G;  2PFX A;  2QEX 3;  2L4V A;  1ZS7 A;  4O02 B;  1ZO2 A;  2IZ0 A;  1DE3 A;  1RN7 A;  5KLI B;  2JO1 A;  3HUS A;  2A45 H;  1PP9 J;  3RK2 B;  1ASK A;  1FUW A;  1H89 A;  4LLH A;  3AE7 C;  1HYF A;  1URQ B;  4RZM A;  1KYO H;  1AR0 A;  3H1K E;  3DGN A;  2FFD C;  2RKL A;  4BIR A;  2HR3 A;  4WBA A;  3MSO A;  2F4Y A;  2ZVN B;  2IX7 C;  3BNC A;  2A15 A;  2R5B A;  5LC7 A;  2OQQ A;  3GZX B;  3CC2 3;  3TGU D;  2FYU K;  4XBY A;  4XM4 A;  1VDF A;  4M3L A;  1RF1 B;  1YQ4 C;  2XSH B;  6RNT A;  3LID A;  1VQN P;  4JRF A;  1W5Z A;  1WTH A;  2E75 C;  3CCV P;  1OHO A;  5DJU B;  1JKG B;  1YGW A;  1M1J A;  3A3Y B;  2NPS B;  1DMM A;  3MWZ A;  2LKM A;  1EC5 A;  3HOH A;  1DD4 A;  3A0B H;  3AE2 C;  2XEP A;  5FW5 A;  3FG4 A;  2WIT A;  2PP6 A;  2XGN A;  1HZ1 A;  1RRL A;  2CFW A;  1EDI A;  2K37 A;  1BDD A;  3L73 D;  1SQW A;  3S9O A;  1EKM A;  1NO3 A;  1M1X B;  2IYP A;  3CCM P;  1QL2 A;  2CX1 A;  5D83 A;  4DZO A;  3MGN A;  3HIG A;  1US1 A;  1MUU A;  2FYU D;  2IBZ I;  5EQL A;  1FDM A;  3UIA A;  2W9Q A;  4WWU C;  1EEJ A;  2XFT A;  3ZFZ A;  1SQX D;  3D6Y A;  5M1A A;  3T97 A;  3OX9 A;  1MKM A;  2IMJ A;  3F89 A;  3Q5R A;  1GY6 A;  4AYC A;  2Z5I A;  4C46 A;  1VQ5 P;  2OQE C;  4EDF A;  5CCG C;  1JBS A;  1I3F A;  1G0T A;  4IOI H;  3M0D A;  1JNM A;  3EJV A;  1LXE A;  1JCD A;  1PPJ D;  4IIA A;  2I1J A;  2GU1 A;  1KD1 Q;  3JSV C;  1BU4 A;  1SQX G;  1YJN 3;  3CC2 P;  2IYO A;  2PNC A;  1T2K D;  4TX4 A;  4JBZ A;  2OGU A;  4GSP A;  2Z76 A;  3L71 J;  1UGI A;  1FGO A;  3H1L E;  1NTZ E;  4W7Y A;  2POH A;  1VQK P;  1N9J A;  3STD A;  1BGY J;  1W5C E;  3SSU A;  4K61 A;  1SIH A;  2K3R A;  2ZYG A;  2B24 B;  4HM1 B;  1K73 4;  1T3U A;  5KLV E;  2HPC A;  3H1K J;  3FG1 A;  3G16 A;  1VPC A;  4WFO A;  2FY8 A;  1IC2 A;  2IBZ E;  4DT0 A;  3NM7 A;  2KXP B;  1MGR A;  2ZJS E;  1IK7 A;  3O8Y A;  1WMK A;  3AEF C;  1T5Y A;  2UWJ E;  3CC4 3;  1V74 A;  5KJ7 D;  1SQP K;  3CX5 H;  4C7R A;  3NQY A;  3JCU H;  1FGM A;  3D70 A;  1KWI A;  3M0D C;  3P8C D;  1JY3 N;  5IW9 A;  1J1D C;  2FFD A;  2O01 H;  2WSF H;  2W56 A;  3KII A;  2FYN C;  1ISK A;  1IFD A;  1KYO I;  3L72 J;  3LOY A;  1M1J B;  4OH8 B;  1H0T B;  1VQ7 3;  3EFG A;  4AQR D;  3X3X A;  3L4F A;  1DVC A;  1GZL A;  5JBS A;  2KF6 A;  2AXT E;  1PU4 A;  3KZI H;  1X1Y A;  3GHG C;  1NTK E;  1LGH B;  3KPE A;  1GW3 A;  7STD A;  2CPS A;  4OVM A;  4H0L D;  1BUJ A;  1U5O A;  4X2H A;  5C39 A;  3L71 E;  4U7J A;  3S29 A;  1PZQ A;  2Q1K A;  1CI6 B;  4HKZ H;  4IL6 E;  1ZW0 A;  4XDW A;  1BNG A;  3GSP A;  3H1H J;  2WVR A;  5CF2 A;  2XSO B;  1OVR A;  2E5Y A;  2B89 A;  1EA2 A;  1NTK G;  1P84 H;  4GOF A;  3IMA B;  4DCK A;  2CPB A;  3S27 A;  1NU1 J;  2CFG A;  4H0L B;  5AW3 B;  4DOJ A;  2O1J A;  3SLU A;  3P7K A;  1FBM A;  1MNL A;  3N7N A;  1Q40 A;  5M1B A;  3B7C A;  3GZR A;  1AVY A;  4XB5 A;  2YFL B;  3H1J J;  4H61 A;  1VQP 3;  3BAT A;  3EFF K;  3GAX A;  2GSP A;  1LP1 B;  3EX9 A;  3PH0 A;  2P58 A;  5AI1 A;  2CWU A;  4BRY A;  1N86 A;  1KYO E;  2A06 G;  1L0N G;  2UGI A;  2BCC G;  1LOX A;  1C7H A;  2Y0C A;  2GU3 A;  3L71 D;  1KSI A;  1QX8 A;  3AEC C;  1NB3 I;  2C0W A;  3CX5 D;  1M1K Q;  3L75 D;  3EN1 B;  1QVF O;  2YMK A;  2QJP B;  3K9M C;  1U7J A;  3V6I A;  2KF4 A;  2D2C C;  3RGA A;  1FU1 A;  4PD4 I;  1KB9 E;  3PZW A;  2NRG A;  3GG2 A;  5H2F E;  4ZMD A;  1UDI I;  1HUC A;  2M5A B;  4L8P A;  1IFJ A;  1Y47 A;  3F5H A;  1FS0 E;  3CXH D;  3H3H A;  3KE7 A;  2J5U A;  3B5N D;  3A0B E;  3CMA P;  1TRP A;  1YVB I;  5KP3 A;  3K63 A;  1BRI A;  2OYH C;  1K28 A;  2IDB A;  1RE4 C;  2FYU J;  2P2U A;  2F98 A;  3CCS P;  1BE3 D;  4CDL A;  1BGY E;  1JCC A;  1KIL E;  3U97 A;  4HB1 A;  5B66 H;  3DMC A;  5BU8 B;  4EYY Q;  3QRD A;  2P09 A;  3U1A A;  2W6A A;  3RNT A;  1KC8 Q;  3LTD A;  1URQ D;  1HGZ A;  1IV7 A;  4HKV B;  1EDJ A;  2ZFC A;  3ZG0 A;  1X22 A;  4FR9 A;  3LYG A;  4N78 E;  4KJM A;  2HOH A;  3RBZ A;  1JJ2 2;  2WMM A;  1UCL A;  3CXH H;  4GDO A;  3V5B A;  3CWB G;  1Y4K A;  1RQU A;  3AHW A;  3CCE P;  3IF4 A;  5DJT B;  1KB9 I;  4LGD E;  3CME P;  3RDE A;  1QVF 2;  1OHP A;  2Q6Q A;  1S3J A;  5KLI C;  1Q81 Q;  1MWS A;  1KQG B;  2QRX A;  2M0B A;  4TT3 H;  1D7M A;  3FCS B;  2OYH A;  3ABV C;  3MG1 A;  1N7L A;  1M7L A;  4BTY A;  4R9L A;  1TJD A;  3G0K A;  1FZE A;  3V2P A;  3L36 A;  2H0H A;  2KNC A;  1SQQ D;  2W6B A;  2KRT A;  5AVU B;  3FF0 A;  2LXB A;  3AEA C;  4JYC A;  4OVN F;  3RK3 B;  1BSN A;  2A06 D;  1B2X A;  3ER7 A;  4L8O A;  1NTM D;  2F56 A;  1JY2 O;  5RNT A;  3Q2P A;  2XZR A;  2KS1 B;  1RRH A;  5IEO A;  1Q90 D;  4Y99 C;  5TGN A;  2QVA A;  1ULI B;  2N9B A;  1AVL A;  1HJ0 A;  2Z4E A;  3LH4 A;  1B2U A;  1KOR A;  1JEK A;  3BNB A;  3PJS K;  4NPD A;  2ZDJ A;  3B71 A;  3GMA A;  5KLV K;  3CWB E;  1TUH A;  2KIK A;  1YNV X;  3ZG5 A;  3D79 A;  2IUK A;  1EQ7 A;  3B5N B;  1NTK D;  3BAS A;  1I2G A;  3MHE A;  1PP9 D;  2WSS H;  2B1X B;  2D1W A;  1JB5 A;  3Q3D A;  2BNG A;  3KFQ C;  1HTL C;  1L0N E;  1NH4 A;  3EHC A;  3KQG A;  3NV0 A;  2ZL8 A;  1S72 3;  1RN1 A;  1UGH I;  2YMY A;  2K88 A;  1N5P A;  4KHX A;  2RH0 A;  4GKG A;  3LML A;  3H51 A;  4I5Q A;  1VQ9 3;  3DGO A;  1NVO A;  1VF5 B;  1EZV D;  4EI2 A;  4FMC A;  2Y74 A;  2E74 D;  3WUT A;  5M18 A;  1SQV E;  3NBR A;  2QSI A;  2BEZ F;  1N73 B;  1N8R 4;  2ZAE B;  1A2K A;  1VQK 3;  2E43 A;  1AY7 A;  3UJM A;  4LZI A;  3I56 3;  2BIR A;  1B20 A;  5CLK A;  1LTJ A;  1LT9 C;  2FKW B;  1KQF B;  2YFI B;  3NXJ A;  2KOG A;  2K3D A;  1U7M A;  3CMA 3;  1JKG A;  4MMY B;  1G02 A;  1EDL A;  2E2T A;  1SQX J;  3CCJ P;  4PJ0 H;  2JWD A;  3A76 A;  4WP5 A;  2KZI A;  3W67 A;  1FE6 A;  3F7S A;  5KJ7 A;  2Z77 A;  2R5D A;  1GW4 A;  2QJY C;  3DGM A;  2SBL A;  3G6E 3;  4UB8 H;  1KIL B;  1UW1 A;  3K5B A;  2FGT A;  3Q3F A;  5GSP A;  3FWN A;  1VQM 3;  3RGU A;  4C7N B;  2W8Z A;  4W7Z A;  1BE3 G;  1FOS E;  1S2E A;  1IFI A;  4H44 B;  5AW2 B;  2AEJ A;  3BCC J;  1GD4 A;  2I8D A;  1L0N J;  1GMR A;  1YJ9 3;  1OW6 A;  1Q81 4;  1UCJ A;  5L8R J;  1MOL A;  3J7Y d;  2QM7 A;  4Q53 A;  4MMZ B;  2RBI A;  1VQ6 3;  3D6Z A;  4L76 A;  1SQB G;  2OTK E;  1LTJ C;  3H1L D;  3AEG C;  3EF8 A;  1BSB A;  5TJH A;  3JUM A;  2B9B A;  1W02 A;  1SJW A;  5EEO A;  1ROV A;  5JPP A;  1NKN A;  1JY3 P;  1ZXG A;  5APX A;  3WMD A;  1GOU A;  4HM2 B;  3URP A;  1SQQ G;  2F5W A;  1Z1S A;  2YKP A;  2R41 A;  3AE9 C;  1SQP J;  1RF1 A;  3SWY A;  1K9M 4;  4OGQ D;  1BDC A;  3CME 3;  4HH2 A;  1RKY A;  1I0X A;  5DRV A;  1NHL A;  2WZ7 A;  2LQV A;  4HYT B;  2H7H A;  1JUN A;  2BCC D;  2XGL A;  2OQE A;  3PTZ A;  4RBN A;  2RMZ A;  1RF1 C;  1NU1 K;  4STD A;  3HZP A;  1IDP A;  4U3F E;  5FGO A;  4MN4 C;  2QM8 A;  5KAF H;  1KZU B;  3HE4 B;  2IPP A;  1W6Y A;  3MTU E;  1KIL A;  1SQB D;  3I56 P;  2XND H;  2FYU E;  1RGL A;  3M9B A;  2GUV A;  1JB2 A;  2J59 M;  4PV1 D;  5B5E H;  2V7Q J;  4H0L C;  3UNL A;  4DKI A;  5AYR B;  1UUG B;  1L0L G;  3BLZ A;  4U3F J;  3ITK A;  2XRX B;  1X1X A;  2C9L Y;  1TU5 A;  2WSC H;  5G1K A;  1BNS A;  1J2B A;  1MWU A;  1CH0 A;  2OTJ 3;  5AVZ B;  2Y0E A;  3V4W A;  1FGR A;  3G9R A;  3N9H A;  3IPT A;  4U3F D;  1CZQ A;  3TDK A;  1EXJ A;  1VL2 A;  3F8H A;  1SQP E;  3GF7 A;  3CPO A;  3B8L A;  3CCE 3;  4J5G A;  1MFZ A;  1PGO A;  3KDP B;  4RNY A;  1BRK A;  2Q5U A;  1NTZ G;  5TIS E;  3AEE C;  2BHM A;  1K8A 4;  1QJG A;  5KAI H;  2OWP A;  1OF5 B;  1G2C A;  1X9V A;  1JNQ A;  1BRH A;  3TGU E;  1SQB J;  2GBX B;  1S72 P;  2FXT A;  1VQ8 3;  1VQ9 P;  3P8C E;  5BVB A;  2CC3 A;  1UUW B;  1USD A;  5BIR A;  3M9H A;  2OTJ P;  4PD4 E;  2UUG C;  3V2R A;  3TYY A;  4LC1 A;  3RK3 E;  3IN6 A;  1AQT A;  3KXD A;  4EV5 A;  5KTB A;  3DXO A;  2V1L A;  1M56 D;  5APV A;  2YKQ A;  3M91 A;  2VRS A;  4H13 D;  1SQP D;  1CYV A;  1J1E C;  3RL0 C;  2RGQ A;  1FZA A;  2WSE H;  2HG5 D;  1PGP A;  3HTK B;  2RFR A;  3HD7 A;  3LW5 J;  3DGY A;  1GK4 A;  1NGM B;  4L74 A;  3KYQ A;  2WSE J;  3W68 A;  3L72 G;  1T3J A;  4R80 A;  2I9W A;  1LTT C;  4XA4 A;  3OW2 O;  4KFD A;  1LWU B;  2ML6 A;  3TK1 A;  1SQX E;  1HU9 A;  1OMI A;  2OYI C;  4I6M C;  2BEQ D;  3DZL A;  1GL2 D;  5BVZ A;  1M8O B;  1RLS A;  2XU6 A;  3H1I G;  4PD4 D;  1G1J A;  3AE5 C;  2NPS A;  2ZA4 A;  3G8Z A;  1JBT A;  2OYI A;  3FSD A;  3B4P A;  2C10 A;  3IR9 A;  1W6G A;  3MYT A;  2E5T A;  3SWF A;  1WMN A;  1NDO B;  1IYY A;  1WMP A;  1BSA A;  3Q1M A;  4ZKU A;  2H0G A;  3SOA A;  3LTB A;  4WYK B;  3RK3 D;  1S5A A;  3I0Y A;  1W2B O;  1BNE A;  1Q42 A;  3USS A;  5AIG A;  3N54 B;  2QJK C;  3KZI E;  2AEF A;  1WNH A;  1SS1 A;  4GIF A;  2H43 A;  3MG2 A;  1NTM E;  3MIW A;  2ZT9 D;  2FYU G;  5KP1 A;  1L0L K;  3FKA A;  4BU4 A;  1QVG 2;  3U59 A;  2YKO A;  1FJP A;  2CW9 A;  5GTH E;  1SQP G;  2Y9Z A;  2W9P A;  5IG3 A;  2FXO A;  3UL5 A;  3V99 A;  3OV4 A;  3CL3 D;  2WGO A;  3CCV 3;  8CHO A;  1I70 A;  2BMR B;  2WSF J;  3BVH A;  3EQ2 A;  4HZB B;  4N6L A;  3C1L A;  1KN7 A;  1GOV A;  3F14 A;  4CJN A;  1BSD A;  2H8P D;  4L75 A;  1T8Z A;  2GEY A;  1HJB A;  2N1T B;  4I4K A;  2N1T A;  3V98 A;  3EC9 A;  3NX0 A;  2CFD A;  1O7M B;  3H32 A;  3D5I A;  2YX9 A;  3VF1 A;  1L4A C;  3C9I A;  3H1I J;  5AIF A;  1SQV G;  5BU4 A;  3X41 A;  4U3F G;  3SED A;  2KYV A;  1PFP A;  5AII A;  5KP4 A;  2P1J A;  3AE4 C;  1IV9 A;  2JEE A;  3NV0 B;  1FZC A;  1N7S A;  4XBX A;  2YXR B;  1EDK A;  5KLV J;  1N8R Q;  2ZXE B;  6GSP A;  3CC7 3;  3WU2 E;  2E76 B;  1HVV A;  3WU2 H;  1ROA A;  3RBX A;  1SQQ E;  1TFK A;  3PCR A;  8RNT A;  4OGQ C;  2RCD A;  1AQ5 A;  2K0M A;  2GUS A;  1A67 A;  1CW5 A;  1NTK J;  1GY5 A;  3KZT A;  4HVN A;  3O6Q B;  2HMK B;  2Y9Y A;  5D81 A;  1BGS A;  1AVO A;  1SQB E;  4K90 B;  3TDG A;  2B87 A;  1FDO A;  3F8X A;  3CPW 2;  3HD7 C;  1YJW P;  4DJG A;  3AEB C;  3NBJ A;  1OH0 A;  5AW1 B;  2KF5 A;  4ASV A; 
#chains in the Genus database with same CATH homology
 3WOD G;  4BTY A;  4MEI A;  3NBB A;  4R9L A;  1KQS 2;  3G0K A;  1IVW A;  5CK6 A;  4KVH A;  4HM7 B;  3ALA A;  1WQL B;  2KRT A;  4N3V A;  3FF0 A;  1YI2 3;  1OGX A;  2XR8 B;  1D6U A;  4J8T A;  3N8B A;  4KFE A;  2LYX A;  2ML5 A;  1UUV B;  3GRD A;  3DM8 A;  1BSN A;  4L8O A;  3ER7 A;  4AKZ A;  2GXF A;  1Q7Y 4;  1W7C A;  3Q2P A;  1K41 A;  1RRH A;  2O3O A;  4N6T A;  5IEO A;  3IJE B;  3M8C A;  4R1K A;  5IG5 A;  3K5T A;  4HJL B;  2GBW B;  5TGN A;  4YXW H;  1ULI B;  3MPH A;  1DMQ A;  2E2U A;  1AVL A;  1NWW A;  2V7Q H;  3LH4 A;  1JV2 B;  4O2H A;  4CCV A;  1JEK A;  1JB4 A;  2Z7A A;  3BNB A;  3PJS K;  3CNM A;  2ZDJ A;  2CFL A;  3X3Z A;  3EB8 A;  3AMO B;  4QWT A;  3EE1 A;  1TUH A;  5AEU B;  2INX A;  1QAF A;  1F8N A;  3OWY A;  1FGQ A;  3F7X A;  4L7K A;  2IUK A;  3CCL 3;  1DMN A;  3CCR 3;  1IT7 A;  3CCS 3;  4IPB A;  3SOY A;  2Y73 A;  5AIH A;  2MF7 A;  1O7H B;  4GL6 A;  2OOV A;  3LT8 A;  3MHE A;  2WSS H;  1GYB A;  1Q40 B;  2B1X B;  2D1W A;  2KCD A;  1JB5 A;  5G2G A;  3PGB A;  3S67 A;  2BNG A;  3KFQ C;  3EHC A;  1YHQ 3;  3NV0 A;  2ZL8 A;  3QK9 A;  3FZW A;  1S72 3;  2OTL 3;  2CIU A;  2W56 B;  5AEW B;  4FMA A;  4U13 A;  1TP6 A;  1N5P A;  3LML A;  1IVV A;  3H51 A;  1VQ9 3;  2P0X A;  2W2C A;  1N5H A;  3DGO A;  4N6V 0;  4OUQ A;  1IQX A;  4FMC A;  2Y74 A;  3NM2 A;  3GZB A;  3FGY A;  3X3Y A;  3NBR A;  1W2Z A;  3BNE A;  2IUJ A;  1IU7 A;  1N8R 4;  1A2K A;  1NJI 4;  4R9K A;  3WOE B;  1VQK 3;  3UJM A;  4LZI A;  4O3V A;  4EV2 A;  3I56 3;  1RJO A;  2QE7 H;  1FGT A;  5ELU A;  6STD A;  4FMB A;  5CLK A;  3S28 A;  3EQQ B;  5IF6 A;  4R4K A;  4AKY A;  2OCT A;  5EVH A;  2QEX 3;  2L4V A;  2YFI B;  3NXJ A;  4O02 B;  1ZO2 A;  1RN7 A;  4BTX A;  3CMA 3;  1JKG A;  3GWR A;  4MMY B;  5IEN A;  1ASK A;  5IG0 A;  1FUW A;  2E2T A;  3LTC A;  3V92 A;  3CXC 2;  1N9E A;  4RZM A;  3A76 A;  4WP5 A;  1HKX A;  1AR0 A;  3DGN A;  3F7S A;  2Z77 A;  3MSO A;  1E3R A;  3DGM A;  1TIJ A;  2SBL A;  3SXX A;  2CWT A;  4FCJ A;  4FCM A;  3BNC A;  3G6E 3;  2A15 A;  3CD6 3;  1M9G A;  1UW1 A;  4X2O A;  1E3V A;  2FGT A;  5LC7 A;  3GZX B;  3X40 A;  3CC2 3;  1Q82 4;  4IT7 A;  2PZV A;  1VQM 3;  4XBY A;  4XM4 A;  4HM8 B;  2XSH B;  1A90 A;  2XH9 A;  3EBY A;  4HYZ A;  1GD4 A;  1W4N A;  4HBR A;  4JRF A;  1W01 A;  5CF1 A;  1W5Z A;  1WTH A;  1YJ9 3;  3EN8 A;  1Q81 4;  5STD A;  1OHO A;  3HK4 A;  4BTW A;  3J7Y d;  1MOL A;  1JKG B;  2CG1 A;  3OXA A;  1LNH A;  4K1U A;  1DMM A;  3MWZ A;  4Q53 A;  4KZ1 A;  2W0Q A;  4MMZ B;  1E97 A;  1VQN 3;  3PYJ A;  1VQ6 3;  1OAC A;  2XEP A;  5FW5 A;  1FA3 A;  5DRE A;  4LSO A;  1IQY A;  3FG4 A;  3D9R A;  2XGN A;  1QMA A;  3EF8 A;  1TFO A;  2P38 A;  3JUM A;  1W02 A;  1RRL A;  3BND A;  1SJW A;  4GB5 A;  3OW2 2;  2CFW A;  5EEO A;  1ROV A;  3OWU A;  1U8C B;  5JPP A;  1ZX2 A;  5A0O B;  4HM3 B;  3WMD A;  4HM2 B;  1WMO A;  3ROB A;  1SQW A;  1IK3 A;  3CCM 3;  1Z1S A;  4N6O B;  3G71 3;  1EKM A;  1NO3 A;  3FH1 A;  1M1X B;  1K9M 4;  5D83 A;  3CME 3;  1RKY A;  1IFP A;  1OF5 A;  2HMN B;  5DRV A;  3KN4 A;  3CCJ 3;  3HIG A;  2LQV A;  1US1 A;  3PXM A;  2F86 B;  2QGU A;  2XGL A;  5EQL A;  1QAL A;  2RSX A;  2OQE A;  4RBN A;  2W6J H;  2P05 A;  3WA3 A;  2WOH A;  3WOF B;  1QAK A;  4STD A;  2JDI H;  3HZP A;  4QMA A;  1IDP A;  2W9Q A;  5FGO A;  4HM4 B;  4WWU C;  1GS3 A;  1W6Y A;  2CKF B;  2XFT A;  4WHA A;  1VZZ A;  4EC6 A;  2XND H;  4WYK A;  3OX9 A;  2IMJ A;  1STD A;  1GY6 A;  5IER A;  2P0M A;  1GD3 A;  2OQE C;  1JB2 A;  1N8Q A;  2K54 A;  2WOF A;  5CXO A;  3DY5 A;  3EJV A;  5AYS C;  1LXE A;  1O7W B;  2CK3 H;  4IIA A;  3UNL A;  2GU1 A;  3MKI A;  5AYR B;  3BLZ A;  2E2V A;  1YJN 3;  2XRX B;  2PNC A;  4TX4 A;  1TU5 A;  3Q1C A;  3VSY A;  2R4I A;  1J2B A;  2Z76 A;  1FGO A;  3K0Z A;  2OTJ 3;  1FGR A;  1CYU A;  3N9H A;  3IPT A;  1N9J A;  3F8H A;  3ECF A;  3STD A;  1UI7 A;  4K61 A;  3CPO A;  1SIH A;  3B8L A;  4HM6 B;  1E79 H;  2B24 B;  4HM1 B;  4XDV A;  3CCE 3;  2HMJ B;  3X42 A;  1K73 4;  4RNY A;  1OUN A;  3FG1 A;  3UL6 A;  3G16 A;  4HM5 B;  1VQ5 3;  4WFO A;  4H3U A;  2BHM A;  1K8A 4;  3D3L A;  4N6U A;  1QJG A;  3AMO A;  2OWP A;  1NU3 A;  2CFK A;  1OF5 B;  2F99 A;  2GEX A;  3CNX A;  3NM7 A;  3T8U A;  1JNQ A;  3OWS A;  2C11 A;  3K7C A;  2QIY A;  1IQ8 A;  2GBX B;  1VQ4 3;  4FMD A;  3FF2 A;  1O7N B;  2CH9 A;  2FXT A;  3O8Y A;  1YGE A;  1VQ8 3;  3VGN A;  1JN5 A;  1T5Y A;  1JN5 B;  5BVB A;  2CC3 A;  3E99 A;  1UUW B;  3EBT A;  4O8S A;  1M1K 4;  1CEW I;  5HGR A;  3CC4 3;  2STD A;  1V74 A;  4N6N B;  2Z6B A;  3NQY A;  1AQT A;  1M90 4;  1FGM A;  4EV5 A;  1KWI A;  3DXO A;  2V1L A;  5IW9 A;  5I97 A;  3JUN A;  4NHF A;  1O7P B;  3FG3 A;  1ULJ B;  2W56 A;  1OGZ A;  3JUQ A;  3KII A;  1ISK A;  4WVZ A;  5IG4 A;  1CYV A;  3KKG A;  2RGQ A;  3LOY A;  4FCZ A;  2FNQ A;  3CU3 A;  3DGL A;  1VQ7 3;  2RFR A;  1IVU A;  3X3X A;  4HM0 B;  1DVC A;  5JBS A;  3B4O A;  1IVX A;  3F9S A;  1PU4 A;  1KD1 4;  4NRE A;  4R80 A;  2I9W A;  4RNZ A;  4KFD A;  2ML6 A;  1EG9 B;  7STD A;  4OVM A;  1HU9 A;  1U5O A;  4X2H A;  4EYC A;  1YIT 3;  3DZL A;  3S29 A;  3SVA A;  2XF3 A;  4XDW A;  5CF2 A;  1IT8 A;  5JPU A;  2XSO B;  3G8Z A;  3T0U A;  1KC8 4;  1DVD A;  3FSD A;  3HX8 A;  4EBG A;  2E5Y A;  3B4P A;  2C10 A;  2QA4 3;  1W6G A;  1CQS A;  4ORL A;  1EA2 A;  2M7O A;  3MYT A;  1AVK A;  2E5T A;  3IMA B;  4OK0 A;  1G96 A;  1SII A;  1WMN A;  2Q07 A;  3S27 A;  1NDO B;  1WMP A;  2CFG A;  4LGQ A;  3SOA A;  1A2V A;  3LTB A;  3SLU A;  4WYK B;  1S5A A;  3CCQ 3;  2HML B;  3I0Y A;  5LC6 A;  1MNL A;  1Q40 A;  3GZR A;  1Q42 A;  3B7C A;  3PCS A;  3NQZ A;  3USS A;  2YFL B;  4H61 A;  4XB5 A;  5AIG A;  3N54 B;  3EFF K;  2D42 A;  2HMM B;  3GAX A;  1AV4 A;  1VQP 3;  3EX9 A;  3CCU 3;  5AI1 A;  1W2B 2;  1WNH A;  2CWU A;  1SPU A;  4N6M A;  3MG2 A;  1YJW 3;  2W03 A;  5KP1 A;  1UI8 A;  1LOX A;  1C7H A;  1BUQ A;  2GU3 A;  3FKA A;  1QVG 2;  2OOV C;  1YIJ 3;  4EXR A;  2CW9 A;  1JRQ A;  2W9P A;  1KSI A;  5IG3 A;  3UL5 A;  1NB3 I;  1BSH A;  3V99 A;  3EN1 B;  3OV4 A;  2WGO A;  2JQ5 A;  3CCV 3;  1W6C A;  3K9M C;  4K1V A;  2IA7 A;  8CHO A;  2BMR B;  1VQL 3;  1STF I;  4HZB B;  3U1W A;  1O7G B;  3LXU X;  4G1M B;  4N6L A;  3I55 3;  3RGA A;  3F14 A;  3PZW A;  2CG0 A;  5D82 A;  1W00 A;  2XFS A;  4PEJ A;  3BB9 A;  3UB1 A;  2GEY A;  4I4K A;  4L8P A;  3WA2 X;  1GY7 A;  2O9U X;  3V98 A;  1FS0 E;  3EC9 A;  2KXG A;  2CFD A;  3H3H A;  1O7M B;  3KE7 A;  3NX0 A;  5BXQ A;  3WDG B;  3KSP A;  3NUV A;  4JF8 A;  3DUK A;  4TLF A;  2YX9 A;  1YVB I;  2W04 A;  5KP3 A;  2HMO B;  4LMI A;  3VF1 A;  1D6Y A;  3K63 A;  1VQO 3;  1LVN A;  2BO9 B;  1K28 A;  1Q86 4;  5AIF A;  2F98 A;  3X41 A;  3SED A;  1PFP A;  5AII A;  5KP4 A;  4CDL A;  4MJD A;  1IV9 A;  3U97 A;  3NV0 B;  1EQK A;  2MC8 A;  4LEH A;  3HI7 A;  4XBX A;  3DMC A;  4AEQ A;  3QRD A;  2P09 A;  2BT3 A;  3LZA A;  2CHC A;  5ELJ A;  4XBT A;  1OCV A;  3HII A;  3LTD A;  3G4S 3;  3F40 A;  3CC7 3;  3JUO A;  1DYU A;  3NHX A;  4J9A A;  3T8N A;  1D6Z A;  3Q90 A;  1ROA A;  3MG3 A;  3RGR A;  2BMQ B;  1TFK A;  3PCR A;  1NB5 I;  1IV7 A;  4HKV B;  2RCD A;  4FR9 A;  2K0M A;  3LYG A;  4ZM8 A;  1A67 A;  1GY5 A;  3KZT A;  4HVN A;  4KFF A;  2HMK B;  2YFJ B;  3JVC A;  4MMX B;  3SX1 A;  1JJ2 2;  3LTA A;  1OHS A;  5D81 A;  1OPY A;  1Y4K A;  2BMO B;  3KSE D;  4K90 B;  3TDG A;  2WGQ A;  2UX0 A;  3RDE A;  1QVF 2;  1OHP A;  4HZ9 B;  3F8X A;  3CPW 2;  2WO0 A;  3FLJ A;  1R4C A;  3S5C A;  3PS8 A;  4DJG A;  2CWV A;  3FCS B;  3JUP A;  3L0R A;  3NBJ A;  1OH0 A;  3LT9 A;  3GZY B;  3MG1 A;  5IEP A;  1L5G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...