2CK3H

Azide inhibited bovine f1-atpase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title How Azide Inhibits ATP Hydrolysis by the F-Atpases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2ck3H02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ck3H01
1AQTA 4TLFA 1IFPA 2W6JH 2V7QH 2JDIH 1BSHA 2E5TA 3PJSK 4DJGA 1BSNA 2XNDH 4QMAA 4YXWH 2CK3H 4WVZA 3USSA 2E5YA 3EFFK 2WSSH 1FS0E 2QE7H 1JEKA 1E79H
chains in the Genus database with same CATH superfamily
4GDOA 3I563 2B87A 1X1WA 1RF0C 4RKUJ 2IBZE 5CMZA 2XNDH 1PGQA 1RN7A 2WOHA 2A45G 3ZG5A 2ZT9D 2LR2A 1EEJA 4DZOA 1IO4A 1YVSA 1CEWI 1STFI 1N8RQ 4WWUC 2OQEA 2OTJ3 5AW9B 1DETA 1JZDA 2M3BA 3BCCD 2CPSA 2E74D 3CCSP 2GU3A 4H3UA 1Q42A 4L76A 4AYCA 2RMZA 2KYVA 2C0WA 1D6YA 1I3IA 3BRVB 1OMIA 2FKWB 1FZAA 4ASVA 3O6QB 3GZYB 4ZM8A 1M56D 4C7NA 1LTJC 1YJWP 1KB9I 2ITAA 4U3FD 5AW5B 4N6V0 2XSHB 1Q90D 2P7JA 3WOEB 1I70A 3JCUE 2CW9A 3PGBA 1IVXA 1PY3A 1R5LA 1M57D 1GL2A 4LLHA 1NYHA 2KI7B 1YYCA 2IBZI 2L5GB 5KP1A 1SQQK 3CWBJ 4IPBA 1S5LE 1FGRA 5CK6A 3L71J 1ROAA 1CW5A 1NAFA 2YMYA 1BOXA 3Q1MA 3J7Yd 1ZOYC 3VN0A 2M5AB 3GWRA 1SJWA 4N6LA 2W04A 5GTHE 1FUSA 2OQQA 2P05A 4RNYA 1D6ZA 1AJYA 3GF3A 4K1UA 1RE4C 1LGHB 1N7SB 1Q7HA 5FW5A 3A3YB 2WQYC 1HF9A 4I2LC 3Q2YA 1A67A 1VQNP 4Z1MH 2KF6A 3CCMP 4J5GA 1Q864 2IBZD 2J5UA 3USSA 1NTKD 2R41A 1DVDA 1R4YA 1BUQA 2E42A 5GTIE 3G3ZA 3L70J 1AVLA 2BMOB 5KAFH 3CWBG 1MWUA 1QAKA 3CCRP 3CCUP 1J2JB 4XBXA 3SVAA 3L71G 1IFNA 1B27A 2C0XA 2HPCB 2KOGA 3HK4A 1B2MA 3S67A 2HMMB 2LKMA 3BVHA 1I2EA 1W02A 2W9PA 1FDMA 2F86B 5IG3A 1YITP 4BRYB 3VF1A 3P8CE 1JBRA 5KJ7C 1FJKA 1YJ9P 1DD3A 3LXUX 1NTMK 2CG1A 4HJGH 1PP9J 3SFDC 1YTZI 1LWUC 1NVOA 3AE7C 3L74J 1T6AA 4JF8A 3MWZA 1EZVG 2UX0A 1BE3J 1IC2A 1W7CA 5DREA 1OGZA 3HIIA 1I3FA 3L70G 1OZHA 1D6UA 1FYSA 1N2DC 1N7SD 3L75J 4HH2A 1KQSO 2NPSA 1OACA 2RSXA 1VQ53 2WPQA 3GG2A 1YIJ3 4GT1A 2FYNC 5KKZC 1HGZA 4W80A 5CCHA 1LXEA 2I9WA 3TNUA 3K7CA 1PP9G 3KCHA 3CD63 1VQMP 2W2CA 3L74G 1UDII 3G6E3 1BE3G 3WU2E 1PZQA 4LYLB 2N9BA 1JKGA 1FOSE 2PP6A 3HX8A 1LT1A 4EV2A 2BCCJ 1VQ73 3QK9A 2YIUC 4KJMA 2F5WA 4OGQC 2O01H 2JJLA 3L75G 3LTCA 4ZKUA 3B71A 1BGYD 1FBMA 4JPZB 1LNIA 3CMEP 2FFDC 2E5TA 4DJGA 4I5QA 1SQPE 1DYUA 1W6CA 4I7ZB 1KC8Q 1IQYA 3FG1A 1FDIA 1I2GA 5AVQB 4AQRD 3P8CD 1SQQD 4JF7A 1EG9B 2D2CB 2WPSA 1WMPA 1HH0A 1VDFA 1KD14 4MMYB 2NZ2A 1VQ43 3D6ZA 4CCVA 1GK6A 2P2UA 3V92A 2WSFJ 3ROBA 1HJBA 2BCCG 4I4KA 1JBTA 3EBTA 5AIIA 2G3AA 3L36A 1KILA 1S9KE 1EKMA 4HM1B 1ZRTD 3G4S3 3C9IA 2Z4EA 2M0BA 4R9LA 3SYUA 3KFQC 2DW3A 1UCLA 3V4WA 2IZ0A 3AE5C 1KORA 1IYYA 4GOEA 3JUOA 2P0XA 1E79H 2WT7A 4QWTA 4LGQA 1M7LA 2AXTH 2IYOA 5EVHA 1J1DB 4EDFA 2H43A 1L5GB 2V7QH 4HM2B 2WTYA 4HYTB 3WUUA 2BNGA 4HZ9B 3MZWB 1CZQA 4L8OA 3D6YA 3CCQP 3N54B 2YFIB 5APSA 3CCEP 1UIIA 2GBWB 2D2CD 2B88A 1NTMD 3PCRA 1GW3A 2D1WA 2RNTA 3AMOB 3OJAB 4B86A 1RGAA 3GHGA 3H1HD 3N9HA 3SWYA 1S5AA 6STDA 3BASA 1R4CA 2E76C 1BCCJ 2OYHC 3WMM0 3RL0g 1S3JA 2LYXA 3F8HA 5IEPA 3U97A 1HTLC 3ZFZA 1FZFA 4L74A 3MUDC 4NREA 4DT0A 1J1EC 5TJHA 4HJLB 3LOYA 1O7WB 2OTJP 2WO0A 1FGOA 1RCKA 3FCSB 5H2FH 4OH8B 2Q9IA 1N86A 2A45I 2HODA 1RCLA 3KKGA 1I2FA 2QIYA 1GD2E 5IG5A 2O01N 3M06A 1SQVJ 1S9KD 4D6TJ 1NO3A 2QA43 3S1KA 1NKZB 1LTJB 2PRRA 1BCCG 3DGLA 1NOHA 1BNIA 1T2KD 4N6NB 2NRGA 1MKMA 2UUGC 1GY7A 3ZG0A 1W2B2 2K9JA 1F8NA 1BSCA 4IFMA 2ZXEB 2F98A 4K3AA 3CWBE 1DMQA 3D4AA 7RNTA 3LTDA 1AQZA 1JB2A 5L8RJ 3L71E 1PGJA 3BRTB 3HTKA 1BRSA 1T3BA 1MFZA 3KQGA 1VQOP 3DGNA 4XB5A 3B5NA 3M0DA 1MV8A 3N7NA 1SQVG 2E75C 5M1AA 1E97A 4D6TG 3K0ZA 3S9OA 7STDA 5E79H 1ZR4A 1M1JB 3HD7A 1RF1A 2YO2A 1R5SA 1DEEG 1EQ7A 1JUNA 3LTBA 3TDGA 2QEXP 1EZVE 2CFLA 1LRAA 3M8CA 2O3JA 3M0AA 3ZDMA 2HMLB 3L70E 3A5EA 2BIRA 3F7SA 5LC6A 2JP3A 2FXMA 1C7HA 1MGWA 1YVBI 3FH1A 3H1LJ 3FG4A 3CI9A 3G713 1A90A 1BNGA 2I1KA 3FZWA 5C39A 2H89C 4LEHA 2WOFA 1NAYA 3WDGB 2N1TD 3RBZA 1RH5B 2FXOA 5KLIC 3NV0A 3MG2A 1TP6A 1LOWA 2MJZA 3T97B 3DM8A 2H8PD 1PP9E 2O9UX 2FY8A 3MTUE 2CWVA 2WSFH 1LWUB 1LJ2A 3L72D 2Y73A 1ZGXA 3L74E 2R3CA 3GZXB 4HM8B 3B8EB 1BE3E 5BIRA 5BVBA 1QL2A 3E1IA 1P84H 1YJN3 2RCDA 1VQ63 1SFCC 3H3HA 2WPRA 3KN4A 1T3JA 3HOHA 1NB3I 2XNXA 2IYJA 3F8XA 3AEEC 1EZVI 2FXTA 3H1LG 2XDJA 1G2CA 1YI23 1LNQA 3GF7A 1GK4A 4R4LA 3CWBD 2WSSH 3L75E 1CI6A 1KQFB 1YIJP 1FGQA 3H25A 1B2ZA 4WY4A 1IZNB 3L71D 3PH0A 2JO1A 1EC5A 3CX5I 3A0HE 2FYNB 5AIFA 5KKZB 3GSPA 1LTSC 3BNBA 1KFMA 3WA3A 2M3EA 1AR0A 4NPBA 1B21A 1URQA 1KFNA 2CPBA 2Q5UA 3G6EP 1FOSF 2G8YA 3L73E 3NXJA 4KVHA 1GMQA 1N8QA 3AEAC 3MD0A 4K1VA 5IERA 3PZWA 1NGMB 2K0MA 3D71A 1Q40B 2BCCE 4FMCA 2CFWA 3KSED 3HUSC 3I553 1IVWA 2YIUB 1LOXA 4R4KA 3K5BA 3IR9A 4MMXB 1RHLA 1VQP3 3URPA 3TF5A 2K37A 4OGQB 3WUVA 1STDA 4OVNF 4GB5A 2P1JA 5RNTA 3CX5D 2K3DA 2KS1B 2E2TA 1G1JA 4NPFX 3WMDA 2FFDB 1DVCA 2QIWA 1SQXJ 1SIIA 3EHCA 1PIXA 2UWJE 1FZCA 4RZMA 1NB5I 1PFPA 1IK7A 3L35A 3V2PA 3MIWA 1H0TB 1LTBC 1VQ4P 1WTHA 2GBXB 3Q5RA 1RE3C 1IDPA 4C46A 2JR8A 1KTMA 5B5EH 1K8A4 3K63A 1FJPA 1EXJA 3L74D 3HI7A 2RBIA 3NX0A 2R5BA 1SVFA 4KHXA 2V1LA 2BMRB 2D2CC 3VTPC 3G4SP 1JY3P 1M8OB 1RGGA 1S1CX 3CL3D 3MHEA 4BU4A 2OTLP 4ZMDA 3RGUA 1BDDA 3GMAA 2HMOB 4XM4A 1ZP0C 1SQXG 3E99A 2W0QA 2HG5D 4H61A 4OGQD 2B89A 4IFDK 1NWQA 1TU3F 2CIUA 1U57A 4BTXA 1LT9A 2Y0EA 3GZRA 2WSEJ 1W4NA 2RH0A 1IQ8A 3JUNA 2R4IA 2JKVA 3KDPB 2W8ZA 2JEEA 1EXIA 2CFKA 3KZTA 1TUHA 1GOYA 3HE4A 2BCCD 4FCMA 1OW8A 3HRNA 3M9BA 2KK7A 2V4HA 1RGFA 1IFDA 1I8VA 3EN1B 4GL6A 1BCCE 4MN4C 5M19A 2E76B 1NU3A 1KN7A 3AE2C 2YFJB 3KPEA 1W2BO 3RK2C 1BVIA 1UI7A 3BNDA 5TGNA 1QEXA 1NWWA 1USEA 2O01J 1J1EB 3F9SA 1S4XA 3OW2O 2INXA 3DGOA 4L8PA 3F14A 2FYZA 1B3SA 4KFEA 1VQ93 4ORLA 5B66H 2H0HA 4J9AA 3AEBC 3HE5B 5AYSC 1MWTA 1BSEA 5B5EE 4R1KA 4MJDA 2OWPA 3NM2A 5IG4A 1OH0A 2QA4P 3B4SA 3E7KA 1SQVE 2SBLA 5APUA 4D6TE 2Q3EA 3GW6A 4HKVB 4JYBA 1SQBJ 1KYOD 2A06E 3FLJA 5AI1A 3R4YA 2C9LY 2KZIA 5CBNA 4C7NB 3F7XA 3I5CA 1EDIA 1FZEA 2QGUA 5CCGC 2ZXXA 3NBRA 3MG3A 3FF0A 4XA4A 2E76D 2XFSA 3X3XA 1E3RA 2BT3A 2N1TC 1RNTA 3ECFA 3UJMA 1CYVA 4IOIH 1K28A 3D9RA 2JWAA 1RQVA 2V7QJ 1N5PA 3O6QA 1OFCX 2E75B 1QALA 3DH2A 2KUBA 4YTPC 4EC6A 3KSPA 1BRIA 4OVMA 1SQBG 4FMBA 1MUUA 2VRSA 5JPUA 2BO9B 3II6A 2QVAA 2I8DA 2Z7AA 2PAJA 1YGWA 2M8RA 1I0XA 1K04A 1KB9D 1K41A 1NJI4 2KZJA 1M1JC 3V4QA 2MF7A 2K9YA 3H1LE 1IT7A 2YXQB 1HZ1A 3UNLA 2POHA 1UUVB 4L73A 1JN5A 1M90Q 3TYYA 1JM0A 4CJNA 1O7MB 5KLIB 2M5AA 1JNQA 5B66E 2QM8A 1IU7A 4WB4A 3D3LA 4G1MB 1V74A 1BUJA 1LP1B 5AVSB 2BU4A 1QLED 1WMKA 1BSAA 2AEMA 2OYIC 1U7MA 3EX9A 3PHLA 3KE7A 1VF5C 1N7SA 2O1JA 1YJNP 1IFMA 1BSBA 2ML5A 2YFLB 3N8BA 1TRQA 3AECC 1BRJA 1SFCB 3CXHH 5ELJA 2Z77A 1SQXK 2E75D 3SSUA 2ZHXB 5CJ4A 3VOPA 4BIRA 4BTYA 2YKPA 4YPCA 2QJKB 2PZVA 3K9MC 1MNLA 1GY5A 2HPCA 1UI8A 3G8ZA 5IENA 1SQPK 2W6AA 3MG1A 4BRYA 2D42A 3IN6A 3U59A 1BSNA 2YKQA 1UUWB 1EDLA 3FG3A 2WSEH 5APWA 2OOVC 1JMBA 3RDEA 1W5CE 2FBWC 3H1IJ 5AW6B 3C8VA 1V58A 3DGMA 1NU1J 2OYOA 3T0UA 5EFWB 1Q814 1J2BA 3MYTA 3HZPA 1AQTA 4OUQA 3PYJA 5TISH 1RDSA 1SPUA 4HM7B 1A02J 1VQPP 3KZIH 4PV1D 1N73C 3HUSB 2FNQA 1JCDA 2H88C 3L73J 2AXCA 3CC73 3FF2A 5APXA 1NNVA 3IPTA 1JKGB 3H1LD 2W6BA 3AE1C 5AIHA 3CPW2 1SFCD 2FXPA 1SQXE 2KAAA 1L0NJ 4RO0A 1RN4A 3T8NA 1QVF2 2GU1A 1N8R4 4IL6H 3A0BH 2ZL8A 4GIFA 4IT7A 5KAFE 1OXZA 3H1IG 2JDIH 1OVUA 3RL0B 2W56B 4IIAA 3T8UA 1NU1G 3RK3E 1KILE 1O7PB 3LH4A 1A2KA 4RNTA 2WSCJ 2J8XB 2O3OA 2KSEA 4GOFA 1ULIB 5G1KA 1OCVA 1OPYA 3CXHE 1TU5A 3AE9C 3L73G 4UB6H 1AA0A 4XE5B 4AEQA 1GOVA 4TLFA 5JBSA 5CCHD 1GDTA 2Z6BA 5KTBA 2CKFB 1DMMA 1L0NG 2W83C 3W67A 1YQ3C 2PNCA 2IYPA 1YHQP 4RNZA 3NTNA 1DMNA 3G9RA 3TDKA 4GODA 1IVUA 3Q3FA 1NO4A 1DD4A 5AEUB 3CCL3 1FW7A 1RJOA 4HB1A 4L7KA 4LSOA 1GMJA 2YNYA 3JC22 3OAKA 1PL5A 5KLVJ 3EN8A 2B9BA 1Q2NA 3RL0D 5TISE 2BMQB 2KXPB 4ASWA 3KZIE 1LTIC 3L37A 4NPDA 1VQKP 2H0IA 2XGLA 3K5TA 4X2OA 1G96A 2ZA4A 2CHCA 3X3YA 2P10A 4PD4H 3B4PA 1Q82Q 3F89A 1L4AC 1RGLA 3ITKA 1SQXD 1IFPA 3I56P 2BHMA 3RK2B 5I97A 3CPOA 5AEWB 2XEPA 2H7HA 2XH9A 1VQ9P 1IK3A 1IK9A 1L0LJ 3A0BE 4N6TA 4K35A 3BU4A 5KAIH 4IFFA 4I1LA 1SQPD 5KLVG 2KSJA 1JB0J 3X3ZA 2WGOA 4N3YB 1NH4A 1M1XB 2KNCB 4FMDA 3CNMA 4O3VA 1O7NB 3AMOA 2HODB 1SIHA 4N6OB 4N78E 5HGRA 4LGDE 3PJSK 4UB6E 1RF0A 3IJEB 1US1A 5AVYB 1SQBE 4XBTA 3CCV3 2W90A 2KXGA 3PCSA 1O7HB 2OQEC 3JVCA 3H32B 3AHWA 2OARA 1X1XA 4MMZB 3V6IA 4RESB 3GRDA 1S5LX 3STDA 2GEYA 1L0LG 3VYIA 3VMAA 4I6MC 4BL3A 4HYZA 3EQ2A 2F99A 2Q3IA 3PXMA 2N1TB 1QMAA 5CXOA 1Y9BA 4H13C 3B8LA 3RK2D 2AXTE 3AGOA 3RBXA 1W6GA 3QWOC 1JTHB 1EDJA 1G0TA 4FR9A 3HTKB 5AW2B 1OWAA 3TGUJ 2QG4A 3OX9A 3SWFA 5APVA 3OW22 4RBNA 1GU5A 2IFNA 1GL2C 1B2SA 4WWIA 2C4BA 1LTJA 3WUTA 4HOHA 2A15A 3CCS3 1VQ83 2P38A 2MC8A 3EF8A 5APYA 3NBBA 1QGKB 3UB1A 1GOUA 1YNVX 4DOJA 1UGIA 3HD7B 2WVRA 4N3VA 1MFTA 1YJW3 1FE6A 2YO3A 3UIAA 4HM6B 4DKIA 3Q2PA 4BWNA 5IG0A 2A06G 3Q5PA 1KC84 1CH0A 4OWFA 2QE7H 2Y0CA 2F4YA 5KP3A 5KAIE 3CXC2 4KT0J 1BGSA 3GZBA 5LC7A 5CCGD 3VP9A 1AVOA 3TGUG 1PGOA 1GYBA 2E43A 3M9HA 1UIXA 2Z5HA 2OYIB 2WSCH 2R32A 5H2FE 1A2VA 1UCJA 1MZ9A 1W00A 2CWUA 1MGRA 1RE4A 3NV0B 2O1KA 1VF5B 1N9EA 1ZO2A 4XFJA 2ZFCA 5AW4B 1RY3A 1OGXA 5GSPA 4PV1C 3AEFC 4RJTA 1HYFA 1LNHA 4O02B 4U7JA 4O8SA 3CMA3 3OWUA 1EA2A 3CPWO 4N6UA 3F40A 1ZV8A 4OK0A 1VQN3 2BASA 1W6YA 3CCM3 2W03A 2Y9YA 1QVFO 5EEOA 3Q5SA 1BGYJ 1G2CB 3HD7D 5IEOA 1K9MQ 2QJKC 3B7CA 1K73Q 3LZAA 5G2GA 5KJ7A 5AVTB 3T97A 2GXFA 1BRNL 1VQ5P 3AEGC 3BB9A 1DE3A 3H1IE 3LIDA 1LWUA 1JNMA 4UB8H 4JRFA 5D83A 1NU1E 1ZN5A 1G02A 3FGYA 1SQQJ 1TRPA 3CD6P 5D81A 3DXOA 1JY3N 2NPSC 3E1RA 3KIIA 3Q90A 4WYKB 1BIRA 4K61A 1X1UA 1VQQA 2CWTA 2GA1A 1N73B 3CC7P 5AVUB 4X2HA 4PJ0H 5CCHC 5E79E 1VF5D 1VQ7P 1OHOA 3VSYA 1LOVA 2Y9ZA 1EZVD 2GUSA 2HYNA 3PTZA 5IW9A 2XSOB 2W9QA 1BGYG 3H1JJ 4HM0B 3OXAA 1L0NE 2Q6QA 1B20A 3H1KJ 3L70D 1RGKA 2I1JA 2H0GA 3P7KA 2GUVA 3D70A 3ABVC 4N6MA 1S2EA 3U1WA 1KQGB 1VL2A 2Z5IA 4WFOA 4Y99C 1WMOA 1FZCB 3B4OA 1SQQG 3AE4C 3H6PA 3UL6A 4CPKA 2RN0A 1FS0E 1RHZB 5APQA 1PFIA 4KT3B 1WMNA 1Q40A 3RL0C 5CF2A 2F5MA 1TTOA 2WITA 1PP9D 4Q53A 1JY2N 1EQKA 3F5HA 1NDOB 1E3VA 3SWKA 4LZIA 2KS1A 1L0LK 3LMLA 1BE3D 4HZBB 4ZKPA 2CG0A 2FFDA 3H1JG 1P84E 2AAEA 3H1HJ 3H1KG 1A2PA 4LC1A 3FKAA 5DJTB 2KF3A 1UUGB 5BU8B 1H0TA 3ER7A 1GW4A 5DJUB 1HKXA 5BVZA 1IQXA 4FMAA 3S5CA 3L75D 3HIGA 3CME3 2P67A 3RK3C 1KILC 4ZNCA 1W01A 1Q86Q 1GTWA 5BU5A 4UB8E 1JZOA 5KLVE 1FZUA 3S27A 1PGPA 3VMZA 1AVYA 2K54A 4WVZA 4U13A 5IF6A 1FZBA 1H89A 1RNBA 1SQVK 1BRKA 1JCCA 5CJ0A 1QAFA 1VPCA 3L73D 4PJ0E 1AVKA 1NTMG 3IFMA 1OHSA 3CCJ3 2SPZA 1YBKA 2W6JH 3H1HG 2GEXA 1L4AB 2YKOA 3Q1CA 3M91A 1L0ND 3FWLA 6RNTA 3QH9A 3JCUH 2PGDA 4TX4A 1P84I 3PP5A 1L0LE 3WA2X 1WNHA 1OF5B 3GHGC 3A7OA 4H44B 2RKLA 3MKIA 5CF1A 2B87B 3BIRA 4HKZH 1Z56A 1MWSA 2QJPC 4AUWA 3U1AA 1WQLB 3CCVP 1M9GA 1FAVA 3CCE3 2OYHA 2E5YA 4HM5B 4HM3B 1GY6A 2YXRB 3FGAD 1SARA 2E2UA 1K9M4 1P84D 1W2ZA 3RNTA 1ZXGA 1PU4A 1N5HA 3MUDA 2PFXA 4CPGA 1BSHA 1NTKE 3P32A 4STDA 5GTIH 2KF4A 2XV5A 3IF4A 1RGHA 3HE5A 1L4AD 4H13B 3WOFB 5KLVD 1MOLA 1NTZJ 3TGUE 2K88A 3P8MC 1ZS7A 1YGEA 1GL2B 1GU4A 1VQ8P 3KHUA 1OIPA 4H44D 4XDWA 2AEFA 1ZR2A 5ELUA 2BEQD 3CLQA 4R4MA 4H0LC 2KF5A 3V2QA 4EXRA 3L72J 4TT3H 5AVWB 4EOTA 1KD1Q 1N9JA 1JBSA 1EDKA 1AV1A 3B5NC 3M0DC 3NMDA 5EQLA 2HR3A 1L0LD 1BCCD 4XBYA 1TFKA 1GS3A 1GSPA 5AVZB 1RN1A 2IFMA 4R9KA 2Y74A 2WWWA 3HD7C 1RF1C 2ZVNB 3G71P 2HMJB 2N9YB 2J59M 3V98A 1NTZG 1TFOA 1JN5B 4L75A 2F56A 3PS8A 3EFGA 1QX8A 2KCDA 2P0MA 2XRXB 1BAOA 1H8AA 4H13D 1LQMB 2CC3A 4WHAA 2C10A 1VQO3 2AADA 1JRQA 3LW5J 1IJDB 3L72G 3EE1A 4HAAA 5AW1B 3CMAP 4PV1B 3WU2H 2B24B 1ASKA 5M1BA 1SQVD 1UW1A 4D6TD 3VP8A 1GL2D 1BRHA 1VQ6P 5STDA 4KFFA 1B2UA 2QEX3 3I0YA 2A06D 3W68A 4C7RA 1FZGA 1C54A 2Z76A 1U5OA 5G1LA 1YI2P 1BGYE 2HLOA 4FCJA 1QJGA 1BNFA 1LP1A 1FUWA 2QRXA 3VMYA 1RTUA 2E2VA 1AFOA 3TGUD 1OW7A 1A02F 5BU4A 1N7LA 1Z1SA 1SQQE 5AW3B 1PV3A 2NPSB 4EV5A 1SFCA 4WY4C 3O8ZA 4EI2A 3V5BA 1AQ5A 1FU1A 1PYLA 2KP8A 1S723 2STDA 3TNUB 3FSDA 4JBZA 1URQC 4O2HA 1KQLA 3I55P 1ZRTE 2P58A 3RGAA 1JO5A 3LTAA 3H1JE 5M18A 3H1KE 3NXSA 3OV4A 1YTZT 2HFED 1UCIA 4A7PA 4Y28J 2QSIA 4KFDA 1M1KQ 1VZZA 3MHVA 4EW5A 1KZUB 2A45H 4Y99B 2XF3A 3X42A 2R5DA 1WRGA 3V2NA 1X0TA 3D5IA 3FXEA 4LMIA 1IFIA 1RQUA 2RFRA 2ZVOB 4O9BA 3HUSA 2FYUJ 1LQGC 1FZCC 5AIGA 2LXCB 4QMAA 4ILFA 8RNTA 3CC23 1JB5A 3A2AA 1K05A 3DMCA 1NTME 1LVNA 4JQ0D 2NPSD 3OWSA 3SOAA 3H1HE 3WODG 1GD3A 3TSIA 2CFGA 1BNSA 2ZAEB 3V2RA 3NQYA 1OHPA 4HVNA 1RE3A 2W56A 3SFEC 3PRJA 1IT8A 3DY5A 3NFQA 3RK3B 1KILB 2C11A 3L0RA 1RGCA 5KP4A 1W2EA 1QVG2 2YMKA 3Q3DA 1BNJA 3EFFK 1V57A 3AE6C 2CX1A 2FYUG 1BNEA 3BNCA 5DRVA 2WT7B 3CC43 3GLMA 1PPJG 2L91A 3CCJP 1RSNA 1JV2B 3NM7A 1ZLLA 3A5TA 1CYUA 1SQBK 1HGVA 5AVVB 1ZW0A 3SLUA 4BL2A 1LT9C 2QJYC 1RMSA 3G16A 2ZYDA 1JJ22 1Q7YQ 2WZ7A 3H1JD 3DGYA 3BCCJ 3H1KD 2OTL3 9RNTA 1ISKA 2IA7A 1CQSA 2AEJA 1HWTC 1M904 3EBYA 1ROVA 2CH9A 3CXHI 1OUNA 2GM4A 4PEJA 1NTZK 3BLZA 3JUPA 5K5GB 2IY2A 3EJVA 2ZT9C 2IPPA 2LXBA 4U3FJ 3GHGB 3N4XA 1OVVA 3U1CA 4NHFA 3WR2A 1HUCA 2QJPB 2XGNA 4IL6E 1JOCA 4GSPA 1IFJA 3C1LA 1KILD 2E74C 3RK3D 2GSPA 4H44C 1Y8AA 1Y4KA 5A0OB 3LW5H 1IVVA 1RKYA 4CDLA 1UCKA 1T2IA 3KXDA 3DUKA 1W5ZA 2L4VA 2IUKA 3BCCG 4DCKA 1VQL3 5CBOA 1U7JA 1LTGC 3CXHD 4EYYQ 2IX7C 2KB7P 1DX7A 1Q9EA 4MEIA 4U3FG 4J8TA 1XTCC 1T2HA 3CX5H 1R8EA 3M9QA 3TK1A 1IV7A 1RGEA 1SLQA 2KNCA 1T5YA 4BXLA 2HMNB 4EBGA 2CX0A 1NTKJ 1NTZE 4K90B 2YX9A 3O8YA 1LTTC 3CU3A 2WPVB 3SX1A 2LQVA 5BXQA 1XTGB 2K9JB 1NHLA 3AGNA 5JPPA 3IAOA 5AYRB 3AE8C 3SEDA 3H32A 4H0LB 3L72E 1GD4A 1EUIC 1FGTA 3LYGA 3NUVA 5CCGA 5AW8B 1M1K4 1K8AQ 3B5NB 3DZLA 1D7MA 3JUMA 2N1TA 1LTAC 4PD4E 3X41A 3WHOA 1RF1B 1X9VA 1LOYA 1BNRA 3OA7A 3ALAA 1JTHA 3FXDA 1U8CB 2IBZG 1NTKG 2R44A 3MP7B 3A0HH 1BSDA 4YXDC 1BANA 1HBWA 2Y0DA 1SP4A 1NU1K 3BNEA 1YQ4C 2IMJA 1ZMEC 3A76A 3MGNA 4M3LA 2HOHA 1QL1A 3NHXA 2CFDA 1OW6A 1X79B 5AW0B 1H88A 3G0KA 3RGRA 3GAXA 4YXWH 1M1JA 4N78D 1RRHA 2ZYAA 2XFTA 1SQBD 3SXXA 1KSIA 3IMAB 1KMIZ 1USDA 4R80A 1BDCA 3JSVC 4H0LD 1JEKA 3R2PA 1L0NK 1N7SC 1KWIA 2W27A 1GMPA 3CX5E 3EB8A 4JYCA 2IZ1A 4PD4I 3B5ND 3S28A 7GSPA 1NTZD 2OYIA 3H51A 2FYUK 2XZRA 2OGUA 1UGHI 1T3UA 2ZJSE 3LT9A 3FWNA 4J5KA 4FCZA 2C9NY 1Q7Y4 3FX0A 3VGNA 1X8YA 1CI6B 3BATA 3CNXA 4XDVA 2SARA 3CCR3 3CCU3 4WY4B 1O7GB 1G1IA 4KZ1A 3NQZA 1SS1A 1S72P 4GHOA 3LT8A 5APTA 3KYQA 4GKGA 4WBAA 3MSOA 2WGQA 2WMMA 1Q824 2XR8B 1YIT3 2JWDA 1URQB 1Y47A 3AE3C 1YJ93 1RLSA 1KYOH 3JUQA 4PD4D 4BTWA 1GMRA 1HJ0A 2R3SA 2BEZF 5AW7B 1RRLA 1WT6A 1SQWA 3D5GA 2FGTA 4EIJA 3AEDC 2OOVA 3SOYA 1E5WA 1NKNA 6GSPA 1QVGO 4NPEA 2P09A 1FUTA 2IUJA 1JMMA 3S4RA 5KLVK 4WYKA 2ZDJA 1T8ZA 3CC2P 1HU9A 2HMKB 2CK3H 1N73A 3EC9A 2FYUE 1OVRA 2UGIA 1KV4A 1PPJE 2L1SA 2ZYGA 5KJ7D 5AVXB 2XKMA 4HBRA 4WY4D 1I0VA 4HM4B 1VQM3 2IDBA 3L4FA 1OX3A 2KLUA 2Q07A 5D82A 3S29A 1KB9H 4EYCA 2OTKE 2Q7CA 8CHOA 1ZX2A 1BU4A 1NTMJ 2B1XB 1URQD 1CSBA 2JQ5A 3X40A 1L2PA 1NJIQ 3CC4P 1KQS2 3CCLP 1AY7A 2KRTA 1SQPJ 4I7ZC 1GZLA 3H1ID 3EWKA 4W7ZA 1NU1D 1JY3O 1LT9B 2QJYB 2RGQA 2MKVA 1B2XA 1KYOE 3BCCE 4IL6X 3QRDA 2K3RA 4W7YA 5HOHA 2QM7A 1NTKK 5AVRB 3HE4B 1JB4A 1AV4A 2ZT9B 5CLKA 4U3FE 1TIJA 1X1YA 3LIEA 3AHSA 3PLNA 1IV9A 4AKZA 1YHQ3 2K1AA 1ULJB 2Q1KA 1FA3A 4AKYA 3MPHA 2ML6A 1SQPG 2KIKA 3NBJA 1J1DC 2J58A 2FYUD 2E74B 1HVVA 1PPJD 1FC2C 1TJDA 1S5LH 2M7OA 1VQLP 5FGOA 5CHXA 1L4AA 1BRGA 1JY2O 3EQQB 1FDOA 1T2KC 1JY2P 1DIPA 3VMXA 3OWYA 3CCQ3 2OYHB 1VQK3 5GTHH 3D79A 4N6JA 2OCTA 1Q81Q 4WP5A 1KB9E 1FGMA 1X22A 1KYOI 1MWRA 1DEBA 1OF5A 2XU6A 1DH3A 3V99A 3UL5A 2KLVA 1K734
chains in the Genus database with same CATH topology
1M1XB 2STDA 4FMDA 3FSDA 3CNMA 3I563 4O3VA 1O7NB 3AMOA 4O2HA 5AIFA 1SIHA 4N6OB 3RGAA 5HGRA 3BNBA 3WA3A 3PJSK 3LTAA 1AR0A 3IJEB 4XBTA 1US1A 3CCV3 3OV4A 2XNDH 2KXGA 3PCSA 1RN7A 2WOHA 1O7HB 2OQEC 3JVCA 3NXJA 4KVHA 4KFDA 1N8QA 4MMZB 1CEWI 1VZZA 4K1VA 5IERA 3GRDA 1STFI 3PZWA 4WWUC 2K0MA 3STDA 2GEYA 2OQEA 2XF3A 3X42A 1Q40B 2OTJ3 4FMCA 2CFWA 3KSED 4HYZA 3I553 1IVWA 2F99A 1LOXA 4R4KA 3PXMA 4LMIA 4MMXB 2GU3A 4H3UA 1QMAA 1VQP3 5CXOA 1Q42A 1STDA 2RFRA 3B8LA 4GB5A 1D6YA 2E2TA 5AIGA 3CC23 4QMAA 3GZYB 4ZM8A 3WMDA 1W6GA 1DVCA 1JB5A 1SIIA 3EHCA 3DMCA 4FR9A 4RZMA 3OX9A 1NB5I 4N6V0 1LVNA 3OW22 1PFPA 2XSHB 4RBNA 3WOEB 3OWSA 1WTHA 3SOAA 3WODG 2GBXB 2CW9A 3PGBA 1IVXA 1GD3A 1IDPA 2CFGA 2A15A 3CCS3 1VQ83 2P38A 2MC8A 3NQYA 1OHPA 3EF8A 4HVNA 5KP1A 3K63A 1K8A4 2W56A 3NBBA 3UB1A 3HI7A 1IT8A 4IPBA 1FGRA 3NX0A 5CK6A 3DY5A 2C11A 2V1LA 4N3VA 1ROAA 2BMRB 1YJW3 4HM6B 3L0RA 5KP4A 3Q2PA 3J7Yd 5IG0A 1QVG2 3EFFK 3MHEA 1KC84 3GWRA 2QE7H 1SJWA 4N6LA 5KP3A 2W04A 3BNCA 5DRVA 3CC43 2HMOB 4XM4A 3CXC2 2P05A 3GZBA 4RNYA 5LC7A 1D6ZA 1JV2B 3NM7A 1CYUA 3E99A 4K1UA 2W0QA 1GYBA 3SLUA 5FW5A 1A2VA 1W00A 2CWUA 3NV0B 4H61A 1A67A 3G16A 1JJ22 1Q864 3USSA 1N9EA 2CIUA 1ZO2A 4BTXA 1DVDA 1BUQA 3GZRA 2OTL3 1W4NA 2BMOB 1AVLA 1ISKA 2IA7A 1CQSA 1M904 1OGXA 1IQ8A 3JUNA 1QAKA 2R4IA 1ROVA 2CH9A 3EBYA 1K734 1OUNA 4PEJA 4XBXA 1LNHA 4O02B 3BLZA 3SVAA 2CFKA 4O8SA 3CMA3 3JUPA 1TUHA 3KZTA 3OWUA 1EA2A 3EJVA 3HK4A 3S67A 2HMMB 4N6UA 1W02A 3F40A 2W9PA 4NHFA 2F86B 5IG3A 4FCMA 3VF1A 4OK0A 1VQN3 1W6YA 3CCM3 2XGNA 2W03A 3EN1B 3LXUX 4GL6A 5EEOA 2CG1A 5IEOA 1NU3A 3B7CA 3LZAA 2YFJB 5G2GA 2GXFA 1Y4KA 5A0OB 1IVVA 1RKYA 3BB9A 4CDLA 1UI7A 4JF8A 3MWZA 2UX0A 3BNDA 5TGNA 3DUKA 1NWWA 4JRFA 1W7CA 5D83A 1W5ZA 2L4VA 1OGZA 5DREA 2IUKA 3F9SA 3FGYA 1VQL3 3HIIA 3DGOA 2INXA 4L8PA 3F14A 5D81A 4KFEA 3DXOA 1VQ93 3KIIA 3Q90A 1D6UA 4ORLA 4WYKB 4K61A 4MEIA 2CWTA 4J9AA 5AYSC 4R1KA 4X2HA 4MJDA 2OWPA 3NM2A 1OACA 2RSXA 4J8TA 5IG4A 1OH0A 1VQ53 1OHOA 1YIJ3 1IV7A 3VSYA 2SBLA 1LXEA 2I9WA 1T5YA 5IW9A 4HKVB 2XSOB 2W9QA 2HMNB 3K7CA 4EBGA 4HM0B 3OXAA 4K90B 2YX9A 3O8YA 3CD63 3CU3A 3SX1A 2LQVA 3FLJA 5BXQA 2W2CA 4N6MA 5AI1A 5JPPA 3U1WA 3G6E3 3F7XA 5AYRB 2QGUA 3SEDA 4WFOA 1JKGA 1WMOA 3B4OA 3HX8A 3NBRA 1GD4A 3UL6A 4EV2A 1VQ73 3MG3A 3FF0A 1FS0E 3QK9A 1FGTA 3LYGA 2XFSA 3X3XA 1E3RA 1WMNA 3NUVA 2BT3A 1M1K4 1Q40A 3ECFA 3UJMA 5CF2A 3LTCA 3DZLA 1CYVA 3JUMA 4Q53A 1EQKA 1K28A 2E5TA 4DJGA 3D9RA 1NDOB 1E3VA 4LZIA 3X41A 1DYUA 1W6CA 1N5PA 3LMLA 1IQYA 3FG1A 1QALA 4HZBB 2CG0A 3ALAA 1U8CB 4EC6A 3KSPA 4OVMA 4FMBA 1EG9B 3FKAA 1WMPA 5JPUA 2BO9B 1KD14 4MMYB 1VQ43 3ER7A 2Z7AA 4CCVA 1HKXA 3BNEA 1IQXA 4FMAA 3S5CA 2IMJA 3V92A 1K41A 3HIGA 3CME3 3ROBA 3A76A 1W01A 1NJI4 4I4KA 2MF7A 3NHXA 2CFDA 3EBTA 3G0KA 1IT7A 3RGRA 5AIIA 3UNLA 3GAXA 1EKMA 4HM1B 3S27A 1UUVB 4YXWH 1JN5A 1RRHA 2K54A 2XFTA 3G4S3 4WVZA 4U13A 4R9LA 5IF6A 3KFQC 1O7MB 3SXXA 1KSIA 1JNQA 3IMAB 1IU7A 4R80A 3D3LA 4G1MB 1V74A 1QAFA 3JUOA 1JEKA 2P0XA 1E79H 1AVKA 4QWTA 3CCJ3 1OHSA 4LGQA 1KWIA 5EVHA 3EB8A 1L5GB 2W6JH 2V7QH 3EX9A 4HM2B 3KE7A 2GEXA 3S28A 3Q1CA 2YFLB 2ML5A 3N8BA 3H51A 2BNGA 4HZ9B 4L8OA 3LT9A 4TX4A 3N54B 5ELJA 4FCZA 2YFIB 2Z77A 3WA2X 1Q7Y4 3VGNA 4BTYA 1WNHA 1OF5B 3CNXA 4XDVA 3CCR3 3CCU3 1O7GB 2GBWB 2PZVA 4KZ1A 3NQZA 3K9MC 3LT8A 3MKIA 5CF1A 1MNLA 1GY5A 1UI8A 3PCRA 2D1WA 3G8ZA 3AMOB 3MSOA 2WGQA 5IENA 3N9HA 1Q824 1S5AA 2XR8B 1WQLB 1R4CA 6STDA 3MG1A 1YIT3 2D42A 1BSNA 1YJ93 1UUWB 3JUQA 1M9GA 3FG3A 4BTWA 2OOVC 3CCE3 3RDEA 2E5YA 2LYXA 3F8HA 5IEPA 3U97A 1RRLA 4HM5B 3DGMA 1GY6A 1SQWA 4HM3B 2FGTA 2E2UA 4NREA 1K9M4 3T0UA 2OOVA 4HJLB 3LOYA 1W2ZA 3SOYA 1Q814 1O7WB 1J2BA 1PU4A 2WO0A 1FGOA 1N5HA 3FCSB 3HZPA 1AQTA 3MYTA 4OUQA 3PYJA 1SPUA 2P09A 4HM7B 1BSHA 3KKGA 2IUJA 4STDA 2FNQA 4WYKA 2QIYA 2ZDJA 5IG5A 1HU9A 2HMKB 3FF2A 3CC73 2CK3H 3IPTA 1JKGB 3EC9A 5AIHA 3CPW2 3WOFB 1NO3A 1MOLA 2QA43 3DGLA 4N6NB 3T8NA 1QVF2 2GU1A 1N8R4 1YGEA 2ZL8A 4HBRA 4IT7A 4HM4B 4XDWA 1VQM3 5ELUA 2JDIH 2W56B 4IIAA 3T8UA 1GY7A 2Q07A 5D82A 1O7PB 3S29A 1W2B2 1F8NA 3LH4A 1A2KA 4EYCA 4EXRA 2F98A 1DMQA 8CHOA 1ZX2A 2B1XB 1N9JA 3LTDA 1JB2A 2O3OA 5EQLA 2JQ5A 1ULIB 4XBYA 1OCVA 1OPYA 1GS3A 1TFKA 3X40A 1TU5A 4AEQA 3DGNA 4R9KA 4XB5A 1KQS2 4TLFA 5JBSA 2Y74A 2KRTA 2Z6BA 1E97A 2HMJB 2CKFB 3K0ZA 7STDA 3V98A 1DMMA 1TFOA 1JN5B 2PNCA 3PS8A 3LTBA 2KCDA 3TDGA 2P0MA 4RNZA 2XRXB 1DMNA 3M8CA 2CFLA 2RGQA 2CC3A 1IVUA 4WHAA 3QRDA 2HMLB 2C10A 1VQO3 1JRQA 5AEUB 5LC6A 3F7SA 3EE1A 3CCL3 1C7HA 1YVBI 3FH1A 3FG4A 1RJOA 2B24B 3G713 1ASKA 4L7KA 4LSOA 1A90A 1JB4A 1AV4A 1UW1A 3FZWA 3EN8A 4LEHA 2WOFA 3WDGB 5STDA 5CLKA 1TIJA 4KFFA 1IV9A 4AKZA 1YHQ3 1ULJB 3NV0A 2BMQB 2QEX3 3I0YA 1FA3A 3MG2A 1TP6A 4AKYA 3MPHA 2ML6A 2XGLA 3K5TA 2Z76A 1U5OA 4X2OA 3NBJA 1G96A 3DM8A 4FCJA 1QJGA 2CHCA 3X3YA 2O9UX 2CWVA 3B4PA 1FUWA 2Y73A 2E2VA 3GZXB 1IFPA 4HM8B 2BHMA 2M7OA 5BVBA 3CPOA 5I97A 5AEWB 2XEPA 5FGOA 1YJN3 2RCDA 1VQ63 2XH9A 3H3HA 1IK3A 3KN4A 1Z1SA 3EQQB 1NB3I 4N6TA 3F8XA 3OWYA 3CCQ3 4EV5A 1VQK3 2FXTA 2OCTA 4WP5A 1YI23 1FGMA 2WSSH 1OF5A 1FGQA 2WGOA 3UL5A 3V99A 3X3ZA 1S723
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQT A;  4TLF A;  1IFP A;  2W6J H;  2V7Q H;  2JDI H;  1BSH A;  2E5T A;  3PJS K;  4DJG A;  1BSN A;  2XND H;  4QMA A;  4YXW H;  2CK3 H;  4WVZ A;  3USS A;  2E5Y A;  3EFF K;  2WSS H;  1FS0 E;  2QE7 H;  1JEK A;  1E79 H; 
#chains in the Genus database with same CATH topology
 4GDO A;  3I56 3;  2B87 A;  1X1W A;  1RF0 C;  4RKU J;  2IBZ E;  5CMZ A;  2XND H;  1PGQ A;  1RN7 A;  2WOH A;  2A45 G;  3ZG5 A;  2ZT9 D;  2LR2 A;  1EEJ A;  4DZO A;  1IO4 A;  1YVS A;  1CEW I;  1STF I;  1N8R Q;  4WWU C;  2OQE A;  2OTJ 3;  5AW9 B;  1DET A;  1JZD A;  2M3B A;  3BCC D;  2CPS A;  2E74 D;  3CCS P;  2GU3 A;  4H3U A;  1Q42 A;  4L76 A;  4AYC A;  2RMZ A;  2KYV A;  2C0W A;  1D6Y A;  1I3I A;  3BRV B;  1OMI A;  2FKW B;  1FZA A;  4ASV A;  3O6Q B;  3GZY B;  4ZM8 A;  1M56 D;  4C7N A;  1LTJ C;  1YJW P;  1KB9 I;  2ITA A;  4U3F D;  5AW5 B;  4N6V 0;  2XSH B;  1Q90 D;  2P7J A;  3WOE B;  1I70 A;  3JCU E;  2CW9 A;  3PGB A;  1IVX A;  1PY3 A;  1R5L A;  1M57 D;  1GL2 A;  4LLH A;  1NYH A;  2KI7 B;  1YYC A;  2IBZ I;  2L5G B;  5KP1 A;  1SQQ K;  3CWB J;  4IPB A;  1S5L E;  1FGR A;  5CK6 A;  3L71 J;  1ROA A;  1CW5 A;  1NAF A;  2YMY A;  1BOX A;  3Q1M A;  3J7Y d;  1ZOY C;  3VN0 A;  2M5A B;  3GWR A;  1SJW A;  4N6L A;  2W04 A;  5GTH E;  1FUS A;  2OQQ A;  2P05 A;  4RNY A;  1D6Z A;  1AJY A;  3GF3 A;  4K1U A;  1RE4 C;  1LGH B;  1N7S B;  1Q7H A;  5FW5 A;  3A3Y B;  2WQY C;  1HF9 A;  4I2L C;  3Q2Y A;  1A67 A;  1VQN P;  4Z1M H;  2KF6 A;  3CCM P;  4J5G A;  1Q86 4;  2IBZ D;  2J5U A;  3USS A;  1NTK D;  2R41 A;  1DVD A;  1R4Y A;  1BUQ A;  2E42 A;  5GTI E;  3G3Z A;  3L70 J;  1AVL A;  2BMO B;  5KAF H;  3CWB G;  1MWU A;  1QAK A;  3CCR P;  3CCU P;  1J2J B;  4XBX A;  3SVA A;  3L71 G;  1IFN A;  1B27 A;  2C0X A;  2HPC B;  2KOG A;  3HK4 A;  1B2M A;  3S67 A;  2HMM B;  2LKM A;  3BVH A;  1I2E A;  1W02 A;  2W9P A;  1FDM A;  2F86 B;  5IG3 A;  1YIT P;  4BRY B;  3VF1 A;  3P8C E;  1JBR A;  5KJ7 C;  1FJK A;  1YJ9 P;  1DD3 A;  3LXU X;  1NTM K;  2CG1 A;  4HJG H;  1PP9 J;  3SFD C;  1YTZ I;  1LWU C;  1NVO A;  3AE7 C;  3L74 J;  1T6A A;  4JF8 A;  3MWZ A;  1EZV G;  2UX0 A;  1BE3 J;  1IC2 A;  1W7C A;  5DRE A;  1OGZ A;  3HII A;  1I3F A;  3L70 G;  1OZH A;  1D6U A;  1FYS A;  1N2D C;  1N7S D;  3L75 J;  4HH2 A;  1KQS O;  2NPS A;  1OAC A;  2RSX A;  1VQ5 3;  2WPQ A;  3GG2 A;  1YIJ 3;  4GT1 A;  2FYN C;  5KKZ C;  1HGZ A;  4W80 A;  5CCH A;  1LXE A;  2I9W A;  3TNU A;  3K7C A;  1PP9 G;  3KCH A;  3CD6 3;  1VQM P;  2W2C A;  3L74 G;  1UDI I;  3G6E 3;  1BE3 G;  3WU2 E;  1PZQ A;  4LYL B;  2N9B A;  1JKG A;  1FOS E;  2PP6 A;  3HX8 A;  1LT1 A;  4EV2 A;  2BCC J;  1VQ7 3;  3QK9 A;  2YIU C;  4KJM A;  2F5W A;  4OGQ C;  2O01 H;  2JJL A;  3L75 G;  3LTC A;  4ZKU A;  3B71 A;  1BGY D;  1FBM A;  4JPZ B;  1LNI A;  3CME P;  2FFD C;  2E5T A;  4DJG A;  4I5Q A;  1SQP E;  1DYU A;  1W6C A;  4I7Z B;  1KC8 Q;  1IQY A;  3FG1 A;  1FDI A;  1I2G A;  5AVQ B;  4AQR D;  3P8C D;  1SQQ D;  4JF7 A;  1EG9 B;  2D2C B;  2WPS A;  1WMP A;  1HH0 A;  1VDF A;  1KD1 4;  4MMY B;  2NZ2 A;  1VQ4 3;  3D6Z A;  4CCV A;  1GK6 A;  2P2U A;  3V92 A;  2WSF J;  3ROB A;  1HJB A;  2BCC G;  4I4K A;  1JBT A;  3EBT A;  5AII A;  2G3A A;  3L36 A;  1KIL A;  1S9K E;  1EKM A;  4HM1 B;  1ZRT D;  3G4S 3;  3C9I A;  2Z4E A;  2M0B A;  4R9L A;  3SYU A;  3KFQ C;  2DW3 A;  1UCL A;  3V4W A;  2IZ0 A;  3AE5 C;  1KOR A;  1IYY A;  4GOE A;  3JUO A;  2P0X A;  1E79 H;  2WT7 A;  4QWT A;  4LGQ A;  1M7L A;  2AXT H;  2IYO A;  5EVH A;  1J1D B;  4EDF A;  2H43 A;  1L5G B;  2V7Q H;  4HM2 B;  2WTY A;  4HYT B;  3WUU A;  2BNG A;  4HZ9 B;  3MZW B;  1CZQ A;  4L8O A;  3D6Y A;  3CCQ P;  3N54 B;  2YFI B;  5APS A;  3CCE P;  1UII A;  2GBW B;  2D2C D;  2B88 A;  1NTM D;  3PCR A;  1GW3 A;  2D1W A;  2RNT A;  3AMO B;  3OJA B;  4B86 A;  1RGA A;  3GHG A;  3H1H D;  3N9H A;  3SWY A;  1S5A A;  6STD A;  3BAS A;  1R4C A;  2E76 C;  1BCC J;  2OYH C;  3WMM 0;  3RL0 g;  1S3J A;  2LYX A;  3F8H A;  5IEP A;  3U97 A;  1HTL C;  3ZFZ A;  1FZF A;  4L74 A;  3MUD C;  4NRE A;  4DT0 A;  1J1E C;  5TJH A;  4HJL B;  3LOY A;  1O7W B;  2OTJ P;  2WO0 A;  1FGO A;  1RCK A;  3FCS B;  5H2F H;  4OH8 B;  2Q9I A;  1N86 A;  2A45 I;  2HOD A;  1RCL A;  3KKG A;  1I2F A;  2QIY A;  1GD2 E;  5IG5 A;  2O01 N;  3M06 A;  1SQV J;  1S9K D;  4D6T J;  1NO3 A;  2QA4 3;  3S1K A;  1NKZ B;  1LTJ B;  2PRR A;  1BCC G;  3DGL A;  1NOH A;  1BNI A;  1T2K D;  4N6N B;  2NRG A;  1MKM A;  2UUG C;  1GY7 A;  3ZG0 A;  1W2B 2;  2K9J A;  1F8N A;  1BSC A;  4IFM A;  2ZXE B;  2F98 A;  4K3A A;  3CWB E;  1DMQ A;  3D4A A;  7RNT A;  3LTD A;  1AQZ A;  1JB2 A;  5L8R J;  3L71 E;  1PGJ A;  3BRT B;  3HTK A;  1BRS A;  1T3B A;  1MFZ A;  3KQG A;  1VQO P;  3DGN A;  4XB5 A;  3B5N A;  3M0D A;  1MV8 A;  3N7N A;  1SQV G;  2E75 C;  5M1A A;  1E97 A;  4D6T G;  3K0Z A;  3S9O A;  7STD A;  5E79 H;  1ZR4 A;  1M1J B;  3HD7 A;  1RF1 A;  2YO2 A;  1R5S A;  1DEE G;  1EQ7 A;  1JUN A;  3LTB A;  3TDG A;  2QEX P;  1EZV E;  2CFL A;  1LRA A;  3M8C A;  2O3J A;  3M0A A;  3ZDM A;  2HML B;  3L70 E;  3A5E A;  2BIR A;  3F7S A;  5LC6 A;  2JP3 A;  2FXM A;  1C7H A;  1MGW A;  1YVB I;  3FH1 A;  3H1L J;  3FG4 A;  3CI9 A;  3G71 3;  1A90 A;  1BNG A;  2I1K A;  3FZW A;  5C39 A;  2H89 C;  4LEH A;  2WOF A;  1NAY A;  3WDG B;  2N1T D;  3RBZ A;  1RH5 B;  2FXO A;  5KLI C;  3NV0 A;  3MG2 A;  1TP6 A;  1LOW A;  2MJZ A;  3T97 B;  3DM8 A;  2H8P D;  1PP9 E;  2O9U X;  2FY8 A;  3MTU E;  2CWV A;  2WSF H;  1LWU B;  1LJ2 A;  3L72 D;  2Y73 A;  1ZGX A;  3L74 E;  2R3C A;  3GZX B;  4HM8 B;  3B8E B;  1BE3 E;  5BIR A;  5BVB A;  1QL2 A;  3E1I A;  1P84 H;  1YJN 3;  2RCD A;  1VQ6 3;  1SFC C;  3H3H A;  2WPR A;  3KN4 A;  1T3J A;  3HOH A;  1NB3 I;  2XNX A;  2IYJ A;  3F8X A;  3AEE C;  1EZV I;  2FXT A;  3H1L G;  2XDJ A;  1G2C A;  1YI2 3;  1LNQ A;  3GF7 A;  1GK4 A;  4R4L A;  3CWB D;  2WSS H;  3L75 E;  1CI6 A;  1KQF B;  1YIJ P;  1FGQ A;  3H25 A;  1B2Z A;  4WY4 A;  1IZN B;  3L71 D;  3PH0 A;  2JO1 A;  1EC5 A;  3CX5 I;  3A0H E;  2FYN B;  5AIF A;  5KKZ B;  3GSP A;  1LTS C;  3BNB A;  1KFM A;  3WA3 A;  2M3E A;  1AR0 A;  4NPB A;  1B21 A;  1URQ A;  1KFN A;  2CPB A;  2Q5U A;  3G6E P;  1FOS F;  2G8Y A;  3L73 E;  3NXJ A;  4KVH A;  1GMQ A;  1N8Q A;  3AEA C;  3MD0 A;  4K1V A;  5IER A;  3PZW A;  1NGM B;  2K0M A;  3D71 A;  1Q40 B;  2BCC E;  4FMC A;  2CFW A;  3KSE D;  3HUS C;  3I55 3;  1IVW A;  2YIU B;  1LOX A;  4R4K A;  3K5B A;  3IR9 A;  4MMX B;  1RHL A;  1VQP 3;  3URP A;  3TF5 A;  2K37 A;  4OGQ B;  3WUV A;  1STD A;  4OVN F;  4GB5 A;  2P1J A;  5RNT A;  3CX5 D;  2K3D A;  2KS1 B;  2E2T A;  1G1J A;  4NPF X;  3WMD A;  2FFD B;  1DVC A;  2QIW A;  1SQX J;  1SII A;  3EHC A;  1PIX A;  2UWJ E;  1FZC A;  4RZM A;  1NB5 I;  1PFP A;  1IK7 A;  3L35 A;  3V2P A;  3MIW A;  1H0T B;  1LTB C;  1VQ4 P;  1WTH A;  2GBX B;  3Q5R A;  1RE3 C;  1IDP A;  4C46 A;  2JR8 A;  1KTM A;  5B5E H;  1K8A 4;  3K63 A;  1FJP A;  1EXJ A;  3L74 D;  3HI7 A;  2RBI A;  3NX0 A;  2R5B A;  1SVF A;  4KHX A;  2V1L A;  2BMR B;  2D2C C;  3VTP C;  3G4S P;  1JY3 P;  1M8O B;  1RGG A;  1S1C X;  3CL3 D;  3MHE A;  4BU4 A;  2OTL P;  4ZMD A;  3RGU A;  1BDD A;  3GMA A;  2HMO B;  4XM4 A;  1ZP0 C;  1SQX G;  3E99 A;  2W0Q A;  2HG5 D;  4H61 A;  4OGQ D;  2B89 A;  4IFD K;  1NWQ A;  1TU3 F;  2CIU A;  1U57 A;  4BTX A;  1LT9 A;  2Y0E A;  3GZR A;  2WSE J;  1W4N A;  2RH0 A;  1IQ8 A;  3JUN A;  2R4I A;  2JKV A;  3KDP B;  2W8Z A;  2JEE A;  1EXI A;  2CFK A;  3KZT A;  1TUH A;  1GOY A;  3HE4 A;  2BCC D;  4FCM A;  1OW8 A;  3HRN A;  3M9B A;  2KK7 A;  2V4H A;  1RGF A;  1IFD A;  1I8V A;  3EN1 B;  4GL6 A;  1BCC E;  4MN4 C;  5M19 A;  2E76 B;  1NU3 A;  1KN7 A;  3AE2 C;  2YFJ B;  3KPE A;  1W2B O;  3RK2 C;  1BVI A;  1UI7 A;  3BND A;  5TGN A;  1QEX A;  1NWW A;  1USE A;  2O01 J;  1J1E B;  3F9S A;  1S4X A;  3OW2 O;  2INX A;  3DGO A;  4L8P A;  3F14 A;  2FYZ A;  1B3S A;  4KFE A;  1VQ9 3;  4ORL A;  5B66 H;  2H0H A;  4J9A A;  3AEB C;  3HE5 B;  5AYS C;  1MWT A;  1BSE A;  5B5E E;  4R1K A;  4MJD A;  2OWP A;  3NM2 A;  5IG4 A;  1OH0 A;  2QA4 P;  3B4S A;  3E7K A;  1SQV E;  2SBL A;  5APU A;  4D6T E;  2Q3E A;  3GW6 A;  4HKV B;  4JYB A;  1SQB J;  1KYO D;  2A06 E;  3FLJ A;  5AI1 A;  3R4Y A;  2C9L Y;  2KZI A;  5CBN A;  4C7N B;  3F7X A;  3I5C A;  1EDI A;  1FZE A;  2QGU A;  5CCG C;  2ZXX A;  3NBR A;  3MG3 A;  3FF0 A;  4XA4 A;  2E76 D;  2XFS A;  3X3X A;  1E3R A;  2BT3 A;  2N1T C;  1RNT A;  3ECF A;  3UJM A;  1CYV A;  4IOI H;  1K28 A;  3D9R A;  2JWA A;  1RQV A;  2V7Q J;  1N5P A;  3O6Q A;  1OFC X;  2E75 B;  1QAL A;  3DH2 A;  2KUB A;  4YTP C;  4EC6 A;  3KSP A;  1BRI A;  4OVM A;  1SQB G;  4FMB A;  1MUU A;  2VRS A;  5JPU A;  2BO9 B;  3II6 A;  2QVA A;  2I8D A;  2Z7A A;  2PAJ A;  1YGW A;  2M8R A;  1I0X A;  1K04 A;  1KB9 D;  1K41 A;  1NJI 4;  2KZJ A;  1M1J C;  3V4Q A;  2MF7 A;  2K9Y A;  3H1L E;  1IT7 A;  2YXQ B;  1HZ1 A;  3UNL A;  2POH A;  1UUV B;  4L73 A;  1JN5 A;  1M90 Q;  3TYY A;  1JM0 A;  4CJN A;  1O7M B;  5KLI B;  2M5A A;  1JNQ A;  5B66 E;  2QM8 A;  1IU7 A;  4WB4 A;  3D3L A;  4G1M B;  1V74 A;  1BUJ A;  1LP1 B;  5AVS B;  2BU4 A;  1QLE D;  1WMK A;  1BSA A;  2AEM A;  2OYI C;  1U7M A;  3EX9 A;  3PHL A;  3KE7 A;  1VF5 C;  1N7S A;  2O1J A;  1YJN P;  1IFM A;  1BSB A;  2ML5 A;  2YFL B;  3N8B A;  1TRQ A;  3AEC C;  1BRJ A;  1SFC B;  3CXH H;  5ELJ A;  2Z77 A;  1SQX K;  2E75 D;  3SSU A;  2ZHX B;  5CJ4 A;  3VOP A;  4BIR A;  4BTY A;  2YKP A;  4YPC A;  2QJK B;  2PZV A;  3K9M C;  1MNL A;  1GY5 A;  2HPC A;  1UI8 A;  3G8Z A;  5IEN A;  1SQP K;  2W6A A;  3MG1 A;  4BRY A;  2D42 A;  3IN6 A;  3U59 A;  1BSN A;  2YKQ A;  1UUW B;  1EDL A;  3FG3 A;  2WSE H;  5APW A;  2OOV C;  1JMB A;  3RDE A;  1W5C E;  2FBW C;  3H1I J;  5AW6 B;  3C8V A;  1V58 A;  3DGM A;  1NU1 J;  2OYO A;  3T0U A;  5EFW B;  1Q81 4;  1J2B A;  3MYT A;  3HZP A;  1AQT A;  4OUQ A;  3PYJ A;  5TIS H;  1RDS A;  1SPU A;  4HM7 B;  1A02 J;  1VQP P;  3KZI H;  4PV1 D;  1N73 C;  3HUS B;  2FNQ A;  1JCD A;  2H88 C;  3L73 J;  2AXC A;  3CC7 3;  3FF2 A;  5APX A;  1NNV A;  3IPT A;  1JKG B;  3H1L D;  2W6B A;  3AE1 C;  5AIH A;  3CPW 2;  1SFC D;  2FXP A;  1SQX E;  2KAA A;  1L0N J;  4RO0 A;  1RN4 A;  3T8N A;  1QVF 2;  2GU1 A;  1N8R 4;  4IL6 H;  3A0B H;  2ZL8 A;  4GIF A;  4IT7 A;  5KAF E;  1OXZ A;  3H1I G;  2JDI H;  1OVU A;  3RL0 B;  2W56 B;  4IIA A;  3T8U A;  1NU1 G;  3RK3 E;  1KIL E;  1O7P B;  3LH4 A;  1A2K A;  4RNT A;  2WSC J;  2J8X B;  2O3O A;  2KSE A;  4GOF A;  1ULI B;  5G1K A;  1OCV A;  1OPY A;  3CXH E;  1TU5 A;  3AE9 C;  3L73 G;  4UB6 H;  1AA0 A;  4XE5 B;  4AEQ A;  1GOV A;  4TLF A;  5JBS A;  5CCH D;  1GDT A;  2Z6B A;  5KTB A;  2CKF B;  1DMM A;  1L0N G;  2W83 C;  3W67 A;  1YQ3 C;  2PNC A;  2IYP A;  1YHQ P;  4RNZ A;  3NTN A;  1DMN A;  3G9R A;  3TDK A;  4GOD A;  1IVU A;  3Q3F A;  1NO4 A;  1DD4 A;  5AEU B;  3CCL 3;  1FW7 A;  1RJO A;  4HB1 A;  4L7K A;  4LSO A;  1GMJ A;  2YNY A;  3JC2 2;  3OAK A;  1PL5 A;  5KLV J;  3EN8 A;  2B9B A;  1Q2N A;  3RL0 D;  5TIS E;  2BMQ B;  2KXP B;  4ASW A;  3KZI E;  1LTI C;  3L37 A;  4NPD A;  1VQK P;  2H0I A;  2XGL A;  3K5T A;  4X2O A;  1G96 A;  2ZA4 A;  2CHC A;  3X3Y A;  2P10 A;  4PD4 H;  3B4P A;  1Q82 Q;  3F89 A;  1L4A C;  1RGL A;  3ITK A;  1SQX D;  1IFP A;  3I56 P;  2BHM A;  3RK2 B;  5I97 A;  3CPO A;  5AEW B;  2XEP A;  2H7H A;  2XH9 A;  1VQ9 P;  1IK3 A;  1IK9 A;  1L0L J;  3A0B E;  4N6T A;  4K35 A;  3BU4 A;  5KAI H;  4IFF A;  4I1L A;  1SQP D;  5KLV G;  2KSJ A;  1JB0 J;  3X3Z A;  2WGO A;  4N3Y B;  1NH4 A;  1M1X B;  2KNC B;  4FMD A;  3CNM A;  4O3V A;  1O7N B;  3AMO A;  2HOD B;  1SIH A;  4N6O B;  4N78 E;  5HGR A;  4LGD E;  3PJS K;  4UB6 E;  1RF0 A;  3IJE B;  1US1 A;  5AVY B;  1SQB E;  4XBT A;  3CCV 3;  2W90 A;  2KXG A;  3PCS A;  1O7H B;  2OQE C;  3JVC A;  3H32 B;  3AHW A;  2OAR A;  1X1X A;  4MMZ B;  3V6I A;  4RES B;  3GRD A;  1S5L X;  3STD A;  2GEY A;  1L0L G;  3VYI A;  3VMA A;  4I6M C;  4BL3 A;  4HYZ A;  3EQ2 A;  2F99 A;  2Q3I A;  3PXM A;  2N1T B;  1QMA A;  5CXO A;  1Y9B A;  4H13 C;  3B8L A;  3RK2 D;  2AXT E;  3AGO A;  3RBX A;  1W6G A;  3QWO C;  1JTH B;  1EDJ A;  1G0T A;  4FR9 A;  3HTK B;  5AW2 B;  1OWA A;  3TGU J;  2QG4 A;  3OX9 A;  3SWF A;  5APV A;  3OW2 2;  4RBN A;  1GU5 A;  2IFN A;  1GL2 C;  1B2S A;  4WWI A;  2C4B A;  1LTJ A;  3WUT A;  4HOH A;  2A15 A;  3CCS 3;  1VQ8 3;  2P38 A;  2MC8 A;  3EF8 A;  5APY A;  3NBB A;  1QGK B;  3UB1 A;  1GOU A;  1YNV X;  4DOJ A;  1UGI A;  3HD7 B;  2WVR A;  4N3V A;  1MFT A;  1YJW 3;  1FE6 A;  2YO3 A;  3UIA A;  4HM6 B;  4DKI A;  3Q2P A;  4BWN A;  5IG0 A;  2A06 G;  3Q5P A;  1KC8 4;  1CH0 A;  4OWF A;  2QE7 H;  2Y0C A;  2F4Y A;  5KP3 A;  5KAI E;  3CXC 2;  4KT0 J;  1BGS A;  3GZB A;  5LC7 A;  5CCG D;  3VP9 A;  1AVO A;  3TGU G;  1PGO A;  1GYB A;  2E43 A;  3M9H A;  1UIX A;  2Z5H A;  2OYI B;  2WSC H;  2R32 A;  5H2F E;  1A2V A;  1UCJ A;  1MZ9 A;  1W00 A;  2CWU A;  1MGR A;  1RE4 A;  3NV0 B;  2O1K A;  1VF5 B;  1N9E A;  1ZO2 A;  4XFJ A;  2ZFC A;  5AW4 B;  1RY3 A;  1OGX A;  5GSP A;  4PV1 C;  3AEF C;  4RJT A;  1HYF A;  1LNH A;  4O02 B;  4U7J A;  4O8S A;  3CMA 3;  3OWU A;  1EA2 A;  3CPW O;  4N6U A;  3F40 A;  1ZV8 A;  4OK0 A;  1VQN 3;  2BAS A;  1W6Y A;  3CCM 3;  2W03 A;  2Y9Y A;  1QVF O;  5EEO A;  3Q5S A;  1BGY J;  1G2C B;  3HD7 D;  5IEO A;  1K9M Q;  2QJK C;  3B7C A;  1K73 Q;  3LZA A;  5G2G A;  5KJ7 A;  5AVT B;  3T97 A;  2GXF A;  1BRN L;  1VQ5 P;  3AEG C;  3BB9 A;  1DE3 A;  3H1I E;  3LID A;  1LWU A;  1JNM A;  4UB8 H;  4JRF A;  5D83 A;  1NU1 E;  1ZN5 A;  1G02 A;  3FGY A;  1SQQ J;  1TRP A;  3CD6 P;  5D81 A;  3DXO A;  1JY3 N;  2NPS C;  3E1R A;  3KII A;  3Q90 A;  4WYK B;  1BIR A;  4K61 A;  1X1U A;  1VQQ A;  2CWT A;  2GA1 A;  1N73 B;  3CC7 P;  5AVU B;  4X2H A;  4PJ0 H;  5CCH C;  5E79 E;  1VF5 D;  1VQ7 P;  1OHO A;  3VSY A;  1LOV A;  2Y9Z A;  1EZV D;  2GUS A;  2HYN A;  3PTZ A;  5IW9 A;  2XSO B;  2W9Q A;  1BGY G;  3H1J J;  4HM0 B;  3OXA A;  1L0N E;  2Q6Q A;  1B20 A;  3H1K J;  3L70 D;  1RGK A;  2I1J A;  2H0G A;  3P7K A;  2GUV A;  3D70 A;  3ABV C;  4N6M A;  1S2E A;  3U1W A;  1KQG B;  1VL2 A;  2Z5I A;  4WFO A;  4Y99 C;  1WMO A;  1FZC B;  3B4O A;  1SQQ G;  3AE4 C;  3H6P A;  3UL6 A;  4CPK A;  2RN0 A;  1FS0 E;  1RHZ B;  5APQ A;  1PFI A;  4KT3 B;  1WMN A;  1Q40 A;  3RL0 C;  5CF2 A;  2F5M A;  1TTO A;  2WIT A;  1PP9 D;  4Q53 A;  1JY2 N;  1EQK A;  3F5H A;  1NDO B;  1E3V A;  3SWK A;  4LZI A;  2KS1 A;  1L0L K;  3LML A;  1BE3 D;  4HZB B;  4ZKP A;  2CG0 A;  2FFD A;  3H1J G;  1P84 E;  2AAE A;  3H1H J;  3H1K G;  1A2P A;  4LC1 A;  3FKA A;  5DJT B;  2KF3 A;  1UUG B;  5BU8 B;  1H0T A;  3ER7 A;  1GW4 A;  5DJU B;  1HKX A;  5BVZ A;  1IQX A;  4FMA A;  3S5C A;  3L75 D;  3HIG A;  3CME 3;  2P67 A;  3RK3 C;  1KIL C;  4ZNC A;  1W01 A;  1Q86 Q;  1GTW A;  5BU5 A;  4UB8 E;  1JZO A;  5KLV E;  1FZU A;  3S27 A;  1PGP A;  3VMZ A;  1AVY A;  2K54 A;  4WVZ A;  4U13 A;  5IF6 A;  1FZB A;  1H89 A;  1RNB A;  1SQV K;  1BRK A;  1JCC A;  5CJ0 A;  1QAF A;  1VPC A;  3L73 D;  4PJ0 E;  1AVK A;  1NTM G;  3IFM A;  1OHS A;  3CCJ 3;  2SPZ A;  1YBK A;  2W6J H;  3H1H G;  2GEX A;  1L4A B;  2YKO A;  3Q1C A;  3M91 A;  1L0N D;  3FWL A;  6RNT A;  3QH9 A;  3JCU H;  2PGD A;  4TX4 A;  1P84 I;  3PP5 A;  1L0L E;  3WA2 X;  1WNH A;  1OF5 B;  3GHG C;  3A7O A;  4H44 B;  2RKL A;  3MKI A;  5CF1 A;  2B87 B;  3BIR A;  4HKZ H;  1Z56 A;  1MWS A;  2QJP C;  4AUW A;  3U1A A;  1WQL B;  3CCV P;  1M9G A;  1FAV A;  3CCE 3;  2OYH A;  2E5Y A;  4HM5 B;  4HM3 B;  1GY6 A;  2YXR B;  3FGA D;  1SAR A;  2E2U A;  1K9M 4;  1P84 D;  1W2Z A;  3RNT A;  1ZXG A;  1PU4 A;  1N5H A;  3MUD A;  2PFX A;  4CPG A;  1BSH A;  1NTK E;  3P32 A;  4STD A;  5GTI H;  2KF4 A;  2XV5 A;  3IF4 A;  1RGH A;  3HE5 A;  1L4A D;  4H13 B;  3WOF B;  5KLV D;  1MOL A;  1NTZ J;  3TGU E;  2K88 A;  3P8M C;  1ZS7 A;  1YGE A;  1GL2 B;  1GU4 A;  1VQ8 P;  3KHU A;  1OIP A;  4H44 D;  4XDW A;  2AEF A;  1ZR2 A;  5ELU A;  2BEQ D;  3CLQ A;  4R4M A;  4H0L C;  2KF5 A;  3V2Q A;  4EXR A;  3L72 J;  4TT3 H;  5AVW B;  4EOT A;  1KD1 Q;  1N9J A;  1JBS A;  1EDK A;  1AV1 A;  3B5N C;  3M0D C;  3NMD A;  5EQL A;  2HR3 A;  1L0L D;  1BCC D;  4XBY A;  1TFK A;  1GS3 A;  1GSP A;  5AVZ B;  1RN1 A;  2IFM A;  4R9K A;  2Y74 A;  2WWW A;  3HD7 C;  1RF1 C;  2ZVN B;  3G71 P;  2HMJ B;  2N9Y B;  2J59 M;  3V98 A;  1NTZ G;  1TFO A;  1JN5 B;  4L75 A;  2F56 A;  3PS8 A;  3EFG A;  1QX8 A;  2KCD A;  2P0M A;  2XRX B;  1BAO A;  1H8A A;  4H13 D;  1LQM B;  2CC3 A;  4WHA A;  2C10 A;  1VQO 3;  2AAD A;  1JRQ A;  3LW5 J;  1IJD B;  3L72 G;  3EE1 A;  4HAA A;  5AW1 B;  3CMA P;  4PV1 B;  3WU2 H;  2B24 B;  1ASK A;  5M1B A;  1SQV D;  1UW1 A;  4D6T D;  3VP8 A;  1GL2 D;  1BRH A;  1VQ6 P;  5STD A;  4KFF A;  1B2U A;  2QEX 3;  3I0Y A;  2A06 D;  3W68 A;  4C7R A;  1FZG A;  1C54 A;  2Z76 A;  1U5O A;  5G1L A;  1YI2 P;  1BGY E;  2HLO A;  4FCJ A;  1QJG A;  1BNF A;  1LP1 A;  1FUW A;  2QRX A;  3VMY A;  1RTU A;  2E2V A;  1AFO A;  3TGU D;  1OW7 A;  1A02 F;  5BU4 A;  1N7L A;  1Z1S A;  1SQQ E;  5AW3 B;  1PV3 A;  2NPS B;  4EV5 A;  1SFC A;  4WY4 C;  3O8Z A;  4EI2 A;  3V5B A;  1AQ5 A;  1FU1 A;  1PYL A;  2KP8 A;  1S72 3;  2STD A;  3TNU B;  3FSD A;  4JBZ A;  1URQ C;  4O2H A;  1KQL A;  3I55 P;  1ZRT E;  2P58 A;  3RGA A;  1JO5 A;  3LTA A;  3H1J E;  5M18 A;  3H1K E;  3NXS A;  3OV4 A;  1YTZ T;  2HFE D;  1UCI A;  4A7P A;  4Y28 J;  2QSI A;  4KFD A;  1M1K Q;  1VZZ A;  3MHV A;  4EW5 A;  1KZU B;  2A45 H;  4Y99 B;  2XF3 A;  3X42 A;  2R5D A;  1WRG A;  3V2N A;  1X0T A;  3D5I A;  3FXE A;  4LMI A;  1IFI A;  1RQU A;  2RFR A;  2ZVO B;  4O9B A;  3HUS A;  2FYU J;  1LQG C;  1FZC C;  5AIG A;  2LXC B;  4QMA A;  4ILF A;  8RNT A;  3CC2 3;  1JB5 A;  3A2A A;  1K05 A;  3DMC A;  1NTM E;  1LVN A;  4JQ0 D;  2NPS D;  3OWS A;  3SOA A;  3H1H E;  3WOD G;  1GD3 A;  3TSI A;  2CFG A;  1BNS A;  2ZAE B;  3V2R A;  3NQY A;  1OHP A;  4HVN A;  1RE3 A;  2W56 A;  3SFE C;  3PRJ A;  1IT8 A;  3DY5 A;  3NFQ A;  3RK3 B;  1KIL B;  2C11 A;  3L0R A;  1RGC A;  5KP4 A;  1W2E A;  1QVG 2;  2YMK A;  3Q3D A;  1BNJ A;  3EFF K;  1V57 A;  3AE6 C;  2CX1 A;  2FYU G;  1BNE A;  3BNC A;  5DRV A;  2WT7 B;  3CC4 3;  3GLM A;  1PPJ G;  2L91 A;  3CCJ P;  1RSN A;  1JV2 B;  3NM7 A;  1ZLL A;  3A5T A;  1CYU A;  1SQB K;  1HGV A;  5AVV B;  1ZW0 A;  3SLU A;  4BL2 A;  1LT9 C;  2QJY C;  1RMS A;  3G16 A;  2ZYD A;  1JJ2 2;  1Q7Y Q;  2WZ7 A;  3H1J D;  3DGY A;  3BCC J;  3H1K D;  2OTL 3;  9RNT A;  1ISK A;  2IA7 A;  1CQS A;  2AEJ A;  1HWT C;  1M90 4;  3EBY A;  1ROV A;  2CH9 A;  3CXH I;  1OUN A;  2GM4 A;  4PEJ A;  1NTZ K;  3BLZ A;  3JUP A;  5K5G B;  2IY2 A;  3EJV A;  2ZT9 C;  2IPP A;  2LXB A;  4U3F J;  3GHG B;  3N4X A;  1OVV A;  3U1C A;  4NHF A;  3WR2 A;  1HUC A;  2QJP B;  2XGN A;  4IL6 E;  1JOC A;  4GSP A;  1IFJ A;  3C1L A;  1KIL D;  2E74 C;  3RK3 D;  2GSP A;  4H44 C;  1Y8A A;  1Y4K A;  5A0O B;  3LW5 H;  1IVV A;  1RKY A;  4CDL A;  1UCK A;  1T2I A;  3KXD A;  3DUK A;  1W5Z A;  2L4V A;  2IUK A;  3BCC G;  4DCK A;  1VQL 3;  5CBO A;  1U7J A;  1LTG C;  3CXH D;  4EYY Q;  2IX7 C;  2KB7 P;  1DX7 A;  1Q9E A;  4MEI A;  4U3F G;  4J8T A;  1XTC C;  1T2H A;  3CX5 H;  1R8E A;  3M9Q A;  3TK1 A;  1IV7 A;  1RGE A;  1SLQ A;  2KNC A;  1T5Y A;  4BXL A;  2HMN B;  4EBG A;  2CX0 A;  1NTK J;  1NTZ E;  4K90 B;  2YX9 A;  3O8Y A;  1LTT C;  3CU3 A;  2WPV B;  3SX1 A;  2LQV A;  5BXQ A;  1XTG B;  2K9J B;  1NHL A;  3AGN A;  5JPP A;  3IAO A;  5AYR B;  3AE8 C;  3SED A;  3H32 A;  4H0L B;  3L72 E;  1GD4 A;  1EUI C;  1FGT A;  3LYG A;  3NUV A;  5CCG A;  5AW8 B;  1M1K 4;  1K8A Q;  3B5N B;  3DZL A;  1D7M A;  3JUM A;  2N1T A;  1LTA C;  4PD4 E;  3X41 A;  3WHO A;  1RF1 B;  1X9V A;  1LOY A;  1BNR A;  3OA7 A;  3ALA A;  1JTH A;  3FXD A;  1U8C B;  2IBZ G;  1NTK G;  2R44 A;  3MP7 B;  3A0H H;  1BSD A;  4YXD C;  1BAN A;  1HBW A;  2Y0D A;  1SP4 A;  1NU1 K;  3BNE A;  1YQ4 C;  2IMJ A;  1ZME C;  3A76 A;  3MGN A;  4M3L A;  2HOH A;  1QL1 A;  3NHX A;  2CFD A;  1OW6 A;  1X79 B;  5AW0 B;  1H88 A;  3G0K A;  3RGR A;  3GAX A;  4YXW H;  1M1J A;  4N78 D;  1RRH A;  2ZYA A;  2XFT A;  1SQB D;  3SXX A;  1KSI A;  3IMA B;  1KMI Z;  1USD A;  4R80 A;  1BDC A;  3JSV C;  4H0L D;  1JEK A;  3R2P A;  1L0N K;  1N7S C;  1KWI A;  2W27 A;  1GMP A;  3CX5 E;  3EB8 A;  4JYC A;  2IZ1 A;  4PD4 I;  3B5N D;  3S28 A;  7GSP A;  1NTZ D;  2OYI A;  3H51 A;  2FYU K;  2XZR A;  2OGU A;  1UGH I;  1T3U A;  2ZJS E;  3LT9 A;  3FWN A;  4J5K A;  4FCZ A;  2C9N Y;  1Q7Y 4;  3FX0 A;  3VGN A;  1X8Y A;  1CI6 B;  3BAT A;  3CNX A;  4XDV A;  2SAR A;  3CCR 3;  3CCU 3;  4WY4 B;  1O7G B;  1G1I A;  4KZ1 A;  3NQZ A;  1SS1 A;  1S72 P;  4GHO A;  3LT8 A;  5APT A;  3KYQ A;  4GKG A;  4WBA A;  3MSO A;  2WGQ A;  2WMM A;  1Q82 4;  2XR8 B;  1YIT 3;  2JWD A;  1URQ B;  1Y47 A;  3AE3 C;  1YJ9 3;  1RLS A;  1KYO H;  3JUQ A;  4PD4 D;  4BTW A;  1GMR A;  1HJ0 A;  2R3S A;  2BEZ F;  5AW7 B;  1RRL A;  1WT6 A;  1SQW A;  3D5G A;  2FGT A;  4EIJ A;  3AED C;  2OOV A;  3SOY A;  1E5W A;  1NKN A;  6GSP A;  1QVG O;  4NPE A;  2P09 A;  1FUT A;  2IUJ A;  1JMM A;  3S4R A;  5KLV K;  4WYK A;  2ZDJ A;  1T8Z A;  3CC2 P;  1HU9 A;  2HMK B;  2CK3 H;  1N73 A;  3EC9 A;  2FYU E;  1OVR A;  2UGI A;  1KV4 A;  1PPJ E;  2L1S A;  2ZYG A;  5KJ7 D;  5AVX B;  2XKM A;  4HBR A;  4WY4 D;  1I0V A;  4HM4 B;  1VQM 3;  2IDB A;  3L4F A;  1OX3 A;  2KLU A;  2Q07 A;  5D82 A;  3S29 A;  1KB9 H;  4EYC A;  2OTK E;  2Q7C A;  8CHO A;  1ZX2 A;  1BU4 A;  1NTM J;  2B1X B;  1URQ D;  1CSB A;  2JQ5 A;  3X40 A;  1L2P A;  1NJI Q;  3CC4 P;  1KQS 2;  3CCL P;  1AY7 A;  2KRT A;  1SQP J;  4I7Z C;  1GZL A;  3H1I D;  3EWK A;  4W7Z A;  1NU1 D;  1JY3 O;  1LT9 B;  2QJY B;  2RGQ A;  2MKV A;  1B2X A;  1KYO E;  3BCC E;  4IL6 X;  3QRD A;  2K3R A;  4W7Y A;  5HOH A;  2QM7 A;  1NTK K;  5AVR B;  3HE4 B;  1JB4 A;  1AV4 A;  2ZT9 B;  5CLK A;  4U3F E;  1TIJ A;  1X1Y A;  3LIE A;  3AHS A;  3PLN A;  1IV9 A;  4AKZ A;  1YHQ 3;  2K1A A;  1ULJ B;  2Q1K A;  1FA3 A;  4AKY A;  3MPH A;  2ML6 A;  1SQP G;  2KIK A;  3NBJ A;  1J1D C;  2J58 A;  2FYU D;  2E74 B;  1HVV A;  1PPJ D;  1FC2 C;  1TJD A;  1S5L H;  2M7O A;  1VQL P;  5FGO A;  5CHX A;  1L4A A;  1BRG A;  1JY2 O;  3EQQ B;  1FDO A;  1T2K C;  1JY2 P;  1DIP A;  3VMX A;  3OWY A;  3CCQ 3;  2OYH B;  1VQK 3;  5GTH H;  3D79 A;  4N6J A;  2OCT A;  1Q81 Q;  4WP5 A;  1KB9 E;  1FGM A;  1X22 A;  1KYO I;  1MWR A;  1DEB A;  1OF5 A;  2XU6 A;  1DH3 A;  3V99 A;  3UL5 A;  2KLV A;  1K73 4; 
#chains in the Genus database with same CATH homology
 1M1X B;  2STD A;  4FMD A;  3FSD A;  3CNM A;  3I56 3;  4O3V A;  1O7N B;  3AMO A;  4O2H A;  5AIF A;  1SIH A;  4N6O B;  3RGA A;  5HGR A;  3BNB A;  3WA3 A;  3PJS K;  3LTA A;  1AR0 A;  3IJE B;  4XBT A;  1US1 A;  3CCV 3;  3OV4 A;  2XND H;  2KXG A;  3PCS A;  1RN7 A;  2WOH A;  1O7H B;  2OQE C;  3JVC A;  3NXJ A;  4KVH A;  4KFD A;  1N8Q A;  4MMZ B;  1CEW I;  1VZZ A;  4K1V A;  5IER A;  3GRD A;  1STF I;  3PZW A;  4WWU C;  2K0M A;  3STD A;  2GEY A;  2OQE A;  2XF3 A;  3X42 A;  1Q40 B;  2OTJ 3;  4FMC A;  2CFW A;  3KSE D;  4HYZ A;  3I55 3;  1IVW A;  2F99 A;  1LOX A;  4R4K A;  3PXM A;  4LMI A;  4MMX B;  2GU3 A;  4H3U A;  1QMA A;  1VQP 3;  5CXO A;  1Q42 A;  1STD A;  2RFR A;  3B8L A;  4GB5 A;  1D6Y A;  2E2T A;  5AIG A;  3CC2 3;  4QMA A;  3GZY B;  4ZM8 A;  3WMD A;  1W6G A;  1DVC A;  1JB5 A;  1SII A;  3EHC A;  3DMC A;  4FR9 A;  4RZM A;  3OX9 A;  1NB5 I;  4N6V 0;  1LVN A;  3OW2 2;  1PFP A;  2XSH B;  4RBN A;  3WOE B;  3OWS A;  1WTH A;  3SOA A;  3WOD G;  2GBX B;  2CW9 A;  3PGB A;  1IVX A;  1GD3 A;  1IDP A;  2CFG A;  2A15 A;  3CCS 3;  1VQ8 3;  2P38 A;  2MC8 A;  3NQY A;  1OHP A;  3EF8 A;  4HVN A;  5KP1 A;  3K63 A;  1K8A 4;  2W56 A;  3NBB A;  3UB1 A;  3HI7 A;  1IT8 A;  4IPB A;  1FGR A;  3NX0 A;  5CK6 A;  3DY5 A;  2C11 A;  2V1L A;  4N3V A;  1ROA A;  2BMR B;  1YJW 3;  4HM6 B;  3L0R A;  5KP4 A;  3Q2P A;  3J7Y d;  5IG0 A;  1QVG 2;  3EFF K;  3MHE A;  1KC8 4;  3GWR A;  2QE7 H;  1SJW A;  4N6L A;  5KP3 A;  2W04 A;  3BNC A;  5DRV A;  3CC4 3;  2HMO B;  4XM4 A;  3CXC 2;  2P05 A;  3GZB A;  4RNY A;  5LC7 A;  1D6Z A;  1JV2 B;  3NM7 A;  1CYU A;  3E99 A;  4K1U A;  2W0Q A;  1GYB A;  3SLU A;  5FW5 A;  1A2V A;  1W00 A;  2CWU A;  3NV0 B;  4H61 A;  1A67 A;  3G16 A;  1JJ2 2;  1Q86 4;  3USS A;  1N9E A;  2CIU A;  1ZO2 A;  4BTX A;  1DVD A;  1BUQ A;  3GZR A;  2OTL 3;  1W4N A;  2BMO B;  1AVL A;  1ISK A;  2IA7 A;  1CQS A;  1M90 4;  1OGX A;  1IQ8 A;  3JUN A;  1QAK A;  2R4I A;  1ROV A;  2CH9 A;  3EBY A;  1K73 4;  1OUN A;  4PEJ A;  4XBX A;  1LNH A;  4O02 B;  3BLZ A;  3SVA A;  2CFK A;  4O8S A;  3CMA 3;  3JUP A;  1TUH A;  3KZT A;  3OWU A;  1EA2 A;  3EJV A;  3HK4 A;  3S67 A;  2HMM B;  4N6U A;  1W02 A;  3F40 A;  2W9P A;  4NHF A;  2F86 B;  5IG3 A;  4FCM A;  3VF1 A;  4OK0 A;  1VQN 3;  1W6Y A;  3CCM 3;  2XGN A;  2W03 A;  3EN1 B;  3LXU X;  4GL6 A;  5EEO A;  2CG1 A;  5IEO A;  1NU3 A;  3B7C A;  3LZA A;  2YFJ B;  5G2G A;  2GXF A;  1Y4K A;  5A0O B;  1IVV A;  1RKY A;  3BB9 A;  4CDL A;  1UI7 A;  4JF8 A;  3MWZ A;  2UX0 A;  3BND A;  5TGN A;  3DUK A;  1NWW A;  4JRF A;  1W7C A;  5D83 A;  1W5Z A;  2L4V A;  1OGZ A;  5DRE A;  2IUK A;  3F9S A;  3FGY A;  1VQL 3;  3HII A;  3DGO A;  2INX A;  4L8P A;  3F14 A;  5D81 A;  4KFE A;  3DXO A;  1VQ9 3;  3KII A;  3Q90 A;  1D6U A;  4ORL A;  4WYK B;  4K61 A;  4MEI A;  2CWT A;  4J9A A;  5AYS C;  4R1K A;  4X2H A;  4MJD A;  2OWP A;  3NM2 A;  1OAC A;  2RSX A;  4J8T A;  5IG4 A;  1OH0 A;  1VQ5 3;  1OHO A;  1YIJ 3;  1IV7 A;  3VSY A;  2SBL A;  1LXE A;  2I9W A;  1T5Y A;  5IW9 A;  4HKV B;  2XSO B;  2W9Q A;  2HMN B;  3K7C A;  4EBG A;  4HM0 B;  3OXA A;  4K90 B;  2YX9 A;  3O8Y A;  3CD6 3;  3CU3 A;  3SX1 A;  2LQV A;  3FLJ A;  5BXQ A;  2W2C A;  4N6M A;  5AI1 A;  5JPP A;  3U1W A;  3G6E 3;  3F7X A;  5AYR B;  2QGU A;  3SED A;  4WFO A;  1JKG A;  1WMO A;  3B4O A;  3HX8 A;  3NBR A;  1GD4 A;  3UL6 A;  4EV2 A;  1VQ7 3;  3MG3 A;  3FF0 A;  1FS0 E;  3QK9 A;  1FGT A;  3LYG A;  2XFS A;  3X3X A;  1E3R A;  1WMN A;  3NUV A;  2BT3 A;  1M1K 4;  1Q40 A;  3ECF A;  3UJM A;  5CF2 A;  3LTC A;  3DZL A;  1CYV A;  3JUM A;  4Q53 A;  1EQK A;  1K28 A;  2E5T A;  4DJG A;  3D9R A;  1NDO B;  1E3V A;  4LZI A;  3X41 A;  1DYU A;  1W6C A;  1N5P A;  3LML A;  1IQY A;  3FG1 A;  1QAL A;  4HZB B;  2CG0 A;  3ALA A;  1U8C B;  4EC6 A;  3KSP A;  4OVM A;  4FMB A;  1EG9 B;  3FKA A;  1WMP A;  5JPU A;  2BO9 B;  1KD1 4;  4MMY B;  1VQ4 3;  3ER7 A;  2Z7A A;  4CCV A;  1HKX A;  3BNE A;  1IQX A;  4FMA A;  3S5C A;  2IMJ A;  3V92 A;  1K41 A;  3HIG A;  3CME 3;  3ROB A;  3A76 A;  1W01 A;  1NJI 4;  4I4K A;  2MF7 A;  3NHX A;  2CFD A;  3EBT A;  3G0K A;  1IT7 A;  3RGR A;  5AII A;  3UNL A;  3GAX A;  1EKM A;  4HM1 B;  3S27 A;  1UUV B;  4YXW H;  1JN5 A;  1RRH A;  2K54 A;  2XFT A;  3G4S 3;  4WVZ A;  4U13 A;  4R9L A;  5IF6 A;  3KFQ C;  1O7M B;  3SXX A;  1KSI A;  1JNQ A;  3IMA B;  1IU7 A;  4R80 A;  3D3L A;  4G1M B;  1V74 A;  1QAF A;  3JUO A;  1JEK A;  2P0X A;  1E79 H;  1AVK A;  4QWT A;  3CCJ 3;  1OHS A;  4LGQ A;  1KWI A;  5EVH A;  3EB8 A;  1L5G B;  2W6J H;  2V7Q H;  3EX9 A;  4HM2 B;  3KE7 A;  2GEX A;  3S28 A;  3Q1C A;  2YFL B;  2ML5 A;  3N8B A;  3H51 A;  2BNG A;  4HZ9 B;  4L8O A;  3LT9 A;  4TX4 A;  3N54 B;  5ELJ A;  4FCZ A;  2YFI B;  2Z77 A;  3WA2 X;  1Q7Y 4;  3VGN A;  4BTY A;  1WNH A;  1OF5 B;  3CNX A;  4XDV A;  3CCR 3;  3CCU 3;  1O7G B;  2GBW B;  2PZV A;  4KZ1 A;  3NQZ A;  3K9M C;  3LT8 A;  3MKI A;  5CF1 A;  1MNL A;  1GY5 A;  1UI8 A;  3PCR A;  2D1W A;  3G8Z A;  3AMO B;  3MSO A;  2WGQ A;  5IEN A;  3N9H A;  1Q82 4;  1S5A A;  2XR8 B;  1WQL B;  1R4C A;  6STD A;  3MG1 A;  1YIT 3;  2D42 A;  1BSN A;  1YJ9 3;  1UUW B;  3JUQ A;  1M9G A;  3FG3 A;  4BTW A;  2OOV C;  3CCE 3;  3RDE A;  2E5Y A;  2LYX A;  3F8H A;  5IEP A;  3U97 A;  1RRL A;  4HM5 B;  3DGM A;  1GY6 A;  1SQW A;  4HM3 B;  2FGT A;  2E2U A;  4NRE A;  1K9M 4;  3T0U A;  2OOV A;  4HJL B;  3LOY A;  1W2Z A;  3SOY A;  1Q81 4;  1O7W B;  1J2B A;  1PU4 A;  2WO0 A;  1FGO A;  1N5H A;  3FCS B;  3HZP A;  1AQT A;  3MYT A;  4OUQ A;  3PYJ A;  1SPU A;  2P09 A;  4HM7 B;  1BSH A;  3KKG A;  2IUJ A;  4STD A;  2FNQ A;  4WYK A;  2QIY A;  2ZDJ A;  5IG5 A;  1HU9 A;  2HMK B;  3FF2 A;  3CC7 3;  2CK3 H;  3IPT A;  1JKG B;  3EC9 A;  5AIH A;  3CPW 2;  3WOF B;  1NO3 A;  1MOL A;  2QA4 3;  3DGL A;  4N6N B;  3T8N A;  1QVF 2;  2GU1 A;  1N8R 4;  1YGE A;  2ZL8 A;  4HBR A;  4IT7 A;  4HM4 B;  4XDW A;  1VQM 3;  5ELU A;  2JDI H;  2W56 B;  4IIA A;  3T8U A;  1GY7 A;  2Q07 A;  5D82 A;  1O7P B;  3S29 A;  1W2B 2;  1F8N A;  3LH4 A;  1A2K A;  4EYC A;  4EXR A;  2F98 A;  1DMQ A;  8CHO A;  1ZX2 A;  2B1X B;  1N9J A;  3LTD A;  1JB2 A;  2O3O A;  5EQL A;  2JQ5 A;  1ULI B;  4XBY A;  1OCV A;  1OPY A;  1GS3 A;  1TFK A;  3X40 A;  1TU5 A;  4AEQ A;  3DGN A;  4R9K A;  4XB5 A;  1KQS 2;  4TLF A;  5JBS A;  2Y74 A;  2KRT A;  2Z6B A;  1E97 A;  2HMJ B;  2CKF B;  3K0Z A;  7STD A;  3V98 A;  1DMM A;  1TFO A;  1JN5 B;  2PNC A;  3PS8 A;  3LTB A;  2KCD A;  3TDG A;  2P0M A;  4RNZ A;  2XRX B;  1DMN A;  3M8C A;  2CFL A;  2RGQ A;  2CC3 A;  1IVU A;  4WHA A;  3QRD A;  2HML B;  2C10 A;  1VQO 3;  1JRQ A;  5AEU B;  5LC6 A;  3F7S A;  3EE1 A;  3CCL 3;  1C7H A;  1YVB I;  3FH1 A;  3FG4 A;  1RJO A;  2B24 B;  3G71 3;  1ASK A;  4L7K A;  4LSO A;  1A90 A;  1JB4 A;  1AV4 A;  1UW1 A;  3FZW A;  3EN8 A;  4LEH A;  2WOF A;  3WDG B;  5STD A;  5CLK A;  1TIJ A;  4KFF A;  1IV9 A;  4AKZ A;  1YHQ 3;  1ULJ B;  3NV0 A;  2BMQ B;  2QEX 3;  3I0Y A;  1FA3 A;  3MG2 A;  1TP6 A;  4AKY A;  3MPH A;  2ML6 A;  2XGL A;  3K5T A;  2Z76 A;  1U5O A;  4X2O A;  3NBJ A;  1G96 A;  3DM8 A;  4FCJ A;  1QJG A;  2CHC A;  3X3Y A;  2O9U X;  2CWV A;  3B4P A;  1FUW A;  2Y73 A;  2E2V A;  3GZX B;  1IFP A;  4HM8 B;  2BHM A;  2M7O A;  5BVB A;  3CPO A;  5I97 A;  5AEW B;  2XEP A;  5FGO A;  1YJN 3;  2RCD A;  1VQ6 3;  2XH9 A;  3H3H A;  1IK3 A;  3KN4 A;  1Z1S A;  3EQQ B;  1NB3 I;  4N6T A;  3F8X A;  3OWY A;  3CCQ 3;  4EV5 A;  1VQK 3;  2FXT A;  2OCT A;  4WP5 A;  1YI2 3;  1FGM A;  2WSS H;  1OF5 A;  1FGQ A;  2WGO A;  3UL5 A;  3V99 A;  3X3Z A;  1S72 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...