2CK3H

Azide inhibited bovine f1-atpase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title How Azide Inhibits ATP Hydrolysis by the F-Atpases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2ck3H02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ck3H01
1JEKA 1BSNA 2E5TA 2E5YA 2JDIH 2V7QH 4DJGA 3EFFK 1AQTA 1IFPA 2XNDH 3USSA 4QMAA 2W6JH 4TLFA 4YXWH 2WSSH 2QE7H 1BSHA 1FS0E 4WVZA 3PJSK 1E79H 2CK3H
chains in the Genus database with same CATH superfamily
3F8HA 2D42A 3CWBD 3D5GA 2Z6BA 1VQNP 1AVOA 3BRTB 1HGZA 1VQOP 4ZKUA 3AECC 1ISKA 4WYKA 3V6IA 1RGHA 4FMAA 1XTCC 4GOFA 1RHLA 4U7JA 1N86A 1OPYA 4HBRA 1GD2E 3HZPA 3BRVB 1Q2NA 1NTKK 1GYBA 1NO3A 4PD4H 1MKMA 3O6QB 4J8TA 4L74A 1M8OB 2WITA 1IFPA 1G1IA 2QM8A 2XFSA 4XB5A 3FF2A 1S9KD 1FUWA 4IIAA 1L4AB 1CYVA 1PGQA 4AKZA 4KHXA 1EDJA 3CC73 1BU4A 3G71P 1I2FA 1JBRA 1OH0A 5AW4B 3C9IA 3WOFB 3HUSA 2KF4A 1Q42A 3CD63 3Q1CA 2M3BA 1BE3J 4NPEA 5G1KA 4NPFX 3IR9A 3O8ZA 2WPVB 4R4LA 4EV5A 3CXC2 3AGNA 3G0KA 3AE1C 3FSDA 2QIYA 1NTMG 2XKMA 4HM0B 3Q90A 2K9JB 1IV9A 2ZYDA 5AVXB 1K8A4 2FFDA 1SPUA 1N9JA 1B21A 4Y28J 3M9HA 2V1LA 5H2FH 3DH2A 3CXHH 1T3JA 2IYPA 1LQMB 3CCS3 1YJ93 3GWRA 1HTLC 2A06E 2ZA4A 3LW5H 1VQO3 1FJKA 3MP7B 3S29A 1IJDB 3Q2YA 2CWTA 1RCKA 1ULIB 1OCVA 1YJN3 1LT9B 1X1XA 3NX0A 1QGKB 1QL2A 1GTWA 3WU2H 5IERA 3WODG 1OVUA 1RF0C 1SQPK 3JUQA 2OTJ3 1KYOE 3AE5C 1MWTA 1BNSA 1E3RA 1MUUA 2IBZG 1G96A 2Q9IA 2J58A 1NH4A 1IO4A 3N54B 7RNTA 3W68A 4ZM8A 3CMEP 3TGUJ 3G713 3BIRA 1V74A 1JN5B 2HLOA 4NHFA 4ORLA 1GL2A 3SLUA 3V98A 3L72E 3E1RA 2HMLB 8RNTA 2KZJA 1SQQD 1AQ5A 3FLJA 3A0BE 1RGCA 3LXUX 1BGYJ 5KLVD 1HKXA 3HD7D 3RK2C 2G3AA 2NPSA 1KILB 3CX5D 3T8UA 3TDKA 4OGQB 1L0NJ 1UCKA 3K63A 3BB9A 2H8PD 2IFMA 3VMXA 1UIIA 1U8CB 2Y74A 1PGOA 3MYTA 1NDOB 6STDA 4U3FD 1KILC 1LTJB 4H13B 2Z76A 4OGQC 3AE3C 2ZAEB 1RDSA 5B66H 1IK3A 1S5LE 4OK0A 2CK3H 1LTJC 2KB7P 4H13C 1HUCA 1GD3A 3L0RA 1LNQA 1PIXA 3V2PA 2CIUA 3BCCG 1IV7A 3K5TA 4WHAA 2QJYC 2W6JH 3ZDMA 2K3DA 2QGUA 1QALA 1ZOYC 1SS1A 3D4AA 1BSDA 2GUVA 3RGAA 2R3SA 2E2UA 5AW8B 1S5LX 4EYCA 2M7OA 5KP3A 1BRJA 2KF6A 4HOHA 2K9YA 2HFED 3M0DC 1OFCX 5BVZA 3V99A 3CME3 3EHCA 2PP6A 3OXAA 1V58A 5C39A 3DY5A 1AA0A 3M9BA 5CCGA 2WSCH 1Q86Q 2O9UX 3E99A 5FGOA 4C46A 1CQSA 1IYYA 4FR9A 2IBZI 1RRHA 4NPBA 3AEGC 4PJ0E 1JY3O 1DD4A 3KDPB 3EC9A 1CI6A 3D3LA 4Y99B 3IN6A 5I97A 3CCJP 1K04A 2E5YA 3MG3A 2N9YB 1Q82Q 2K3RA 1KTMA 4HKZH 4HZ9B 4DJGA 3CCEP 1JM0A 2B87B 3D70A 1EXJA 1ZLLA 1GOYA 2M0BA 4PD4E 2W56B 2ZDJA 3DUKA 1L4AA 5KAIH 2W04A 1SLQA 3P32A 1BRHA 1NU1E 3CCQP 3X41A 1E79H 3FGYA 2JEEA 5M1AA 3T0UA 3WA2X 1N7SA 3S28A 5AIHA 2XU6A 1BCCG 1ZX2A 2FKWB 3CMAP 3FX0A 2W6AA 4BRYA 1U57A 1CW5A 3EE1A 4R4KA 1GS3A 5IENA 2INXA 1L0NK 3CPWO 4N6NB 3NBBA 1NJIQ 3RK3B 2WGOA 2YXRB 4ASWA 5CXOA 4UB8H 2B1XB 1RJOA 3F40A 3LTBA 3VMAA 1AJYA 4X2HA 1R4CA 4EDFA 2QJKB 2P09A 1N73A 3NQZA 2Z77A 4IT7A 1BDCA 1SQQE 1VQQA 1KD1Q 2YXQB 1HF9A 3B7CA 2QVAA 1PPJE 3F8XA 5G2GA 1LT9A 2QJKC 2P7JA 4RESB 3I55P 2YKPA 4KFFA 5HGRA 2JR8A 3FH1A 4GODA 5AIGA 1B3SA 3RGRA 3RL0B 3B4PA 1A90A 3LW5J 2RBIA 1USEA 3V5BA 1O7MB 3CCJ3 2XV5A 3WU2E 3SX1A 1LVNA 1K8AQ 1JB5A 1KC8Q 3CCVP 3RL0C 3CCE3 3SWKA 1ZV8A 1GSPA 4HYZA 2KXPB 3KE7A 3KXDA 1IFMA 1BOXA 2OYHC 1BNFA 3H1LG 2P0XA 4OWFA 1T2HA 1TJDA 4XBXA 2FYUJ 2WPSA 1VQM3 4DT0A 1LTSC 1NYHA 3A7OA 5L8RJ 3RK2D 2E75D 3SXXA 1WT6A 3JCUH 4BL2A 3CMA3 1C7HA 3NM2A 3NBRA 4N78D 1KQGB 4D6TG 2AAEA 5AVYB 1JY2O 1NU3A 1URQC 1Y8AA 2GUSA 1SQXE 1KILD 2A06G 1NTKD 1TRPA 3BNEA 3X3XA 1DD3A 4C7NA 3HK4A 1Z1SA 1M1XB 3PTZA 1UI7A 1UIXA 5M1BA 2OOVA 1JKGB 1SQXJ 1QMAA 2QA4P 1VF5C 1RN7A 3HRNA 1JMMA 1KQS2 1OIPA 4LSOA 3DGOA 1YYCA 1R4YA 1ZRTD 4TX4A 1RLSA 1HU9A 3SFEC 1OW7A 3NMDA 5IG5A 1BIRA 4LGDE 3I553 1FAVA 3HOHA 2C0XA 3DM8A 1R8EA 3H6PA 3L71D 2UX0A 4HM5B 4O3VA 1ASKA 3H1JD 3RBXA 1SARA 2LXCB 2LR2A 2KNCB 5GTIH 2J5UA 1WMNA 5AVSB 2Y0EA 7GSPA 3RBZA 2ITAA 1FDMA 4RNTA 4M3LA 4PV1B 1L0LJ 2FYZA 1W02A 2E74B 2IY2A 4STDA 4HH2A 2CX0A 2D1WA 1GW3A 1RQVA 1PFPA 3H1HD 5IG0A 3BVHA 3OW22 1J1DB 1YQ3C 5BU4A 3KZTA 3WA3A 2FXMA 2W6BA 1FC2C 3CWBG 3AEDC 5CCHA 4J5KA 1NHLA 4ILFA 3P8CE 3S1KA 2XZRA 1QAKA 2CG0A 1CEWI 1FZEA 2WSCJ 2W2CA 4RJTA 2H0GA 1G2CA 1J1EC 1KFMA 2J8XB 1NTZE 5IG4A 4GKGA 1E97A 1RQUA 2FYUK 3RL0g 4BL3A 4HB1A 1HBWA 4XBYA 1FU1A 3L74E 5DRVA 1LRAA 3QWOC 2C0WA 2W03A 3GLMA 5KAIE 2XSHB 1OHOA 3RNTA 2C10A 3PYJA 4GOEA 1MV8A 1I0XA 2BMRB 3GZRA 3L74J 3OWSA 1SQBE 3LIEA 2N1TD 1PP9E 1QVFO 1RE3A 5APYA 1IU7A 1HZ1A 4QMAA 3VGNA 2CW9A 2O3OA 5AIFA 1SQXK 1FS0E 4RNYA 2BCCE 6RNTA 3L70E 2RSXA 3Q2PA 4IL6H 1A2KA 3A5EA 1VQ7P 1VPCA 1GMQA 4WY4C 1TFKA 1RN1A 2M3EA 5ELUA 2BCCJ 3EQ2A 4HJLB 2CPSA 3TK1A 1KV4A 1W6GA 5G1LA 3PZWA 4GT1A 2KAAA 2QG4A 1BE3D 3PHLA 4L8PA 4XM4A 3B8EB 1L0LK 1STFI 5B5EE 2CFKA 2XF3A 1BNGA 1RGAA 1NU1G 2RNTA 5AYRB 1PZQA 4HZBB 2K88A 1LT1A 4ZKPA 3GSPA 3U1CA 3L4FA 1YHQ3 3GHGB 1USDA 1H88A 3WHOA 1BRSA 1IDPA 1PU4A 2HODA 4H44C 1NGMB 1GU4A 1URQD 4HM3B 5KLIC 3M0AA 1DMNA 2C11A 3V92A 2C9LY 1M7LA 3HD7B 4R9LA 1LOXA 5E79E 4K1UA 2I9WA 2YO3A 3AEAC 4IFFA 1SQQG 1VF5D 1VQL3 3BLZA 3HD7C 2GEYA 5AYSC 1JB0J 1JKGA 5KLVG 1DMMA 1ZGXA 4JF8A 2L91A 1JNMA 2OYOA 1A2VA 4I5QA 1VQ73 2A45I 2ZL8A 1KYOD 1IQXA 1QEXA 1ZMEC 1MWUA 1KFNA 1RN4A 2Z7AA 1T2IA 3H51A 3X40A 4O02B 3V2RA 1JY2N 4I7ZB 3X42A 1Q864 3RGUA 4U3FG 3IPTA 4LGQA 3AEBC 1OUNA 4WWUC 1RGGA 1KQLA 4O8SA 2E42A 1Q81Q 3TNUA 3AE9C 3L72D 1KB9E 4RNZA 5JBSA 1LJ2A 1NWWA 1SQPE 1BNIA 4I7ZC 1G02A 1GY7A 1QJGA 3ZG5A 3H1IE 1OVRA 3A3YB 1LWUA 1P84E 4UB6H 2D2CC 5APWA 1FGRA 5AW1B 3UL5A 1SQVE 3DZLA 2WZ7A 3L35A 1UUWB 3HE4A 3F89A 3H1IJ 1I8VA 5TGNA 3U59A 3CC4P 1Q824 1T2KD 1EZVE 1X0TA 1W2B2 2P0MA 2OCTA 2W9QA 3CCSP 1SQVJ 1YJ9P 1N5HA 2YO2A 3TYYA 4AYCA 3CCMP 1H0TB 5AW7B 1RE4C 1EG9B 1T5YA 2WWWA 3WUTA 2WOFA 2A45H 4IOIH 4JYBA 4ZMDA 2F99A 3UNLA 2OGUA 1YJNP 1FGMA 3N8BA 3EWKA 3ZFZA 3T8NA 2P58A 1SIIA 1FGTA 1BCCJ 5RNTA 3H1KE 2PZVA 3JUMA 3I563 4H61A 1DVDA 4XE5B 2OTJP 2R5DA 1NJI4 4N3VA 5AW3B 1FUSA 3H1KJ 2I1KA 1GZLA 5APUA 1AQZA 2XSOB 5JPUA 1FYSA 3LZAA 2QRXA 2XGNA 3FXEA 1UCLA 1J2BA 1NOHA 4AKYA 3H32B 1BE3E 3PP5A 2HMJB 1KD14 5M19A 5BIRA 4HAAA 5TISE 3R4YA 4HM1B 3CX5I 5GTHE 3EBTA 2CWUA 4EIJA 4GL6A 2OYIA 3BU4A 3NV0A 4PEJA 4XDWA 1UGHI 2HYNA 4WBAA 4WY4D 4N3YB 3AMOB 2WVRA 2KS1B 1YGEA 4OUQA 1MGRA 1FUTA 3ABVC 3LTCA 3AEEC 5KKZC 4L7KA 3CC43 1KC84 2PNCA 1OVVA 2R5BA 1DYUA 2O01H 1FW7A 3CCM3 1RRLA 4MMYB 4IL6E 1YVBI 4PD4D 2XDJA 2V7QH 4LLHA 1IT7A 1QAFA 1N7SC 2STDA 1LTBC 3VF1A 2CX1A 2L1SA 2MC8A 2BNGA 4W7YA 3MPHA 1NU1D 1QLED 1A67A 5M18A 2P05A 2PAJA 2P2UA 3FZWA 2GEXA 4AUWA 1SP4A 1FZUA 1YI23 4IL6X 1FZBA 2AADA 2Y9ZA 1LTIC 3CX5H 3V4QA 3TGUE 3KFQC 2W90A 3M9QA 1H8AA 1SQVK 2AXCA 1JRQA 1KORA 4MN4C 1N73C 3A76A 1RGKA 1AQTA 4H44D 4MMXB 2MJZA 1X1UA 7STDA 3KCHA 1OMIA 2POHA 1BGYE 2BEZF 2WSSH 1VQKP 3RK2B 2ZFCA 2E75B 2QSIA 2GU1A 3IMAB 1C54A 1X8YA 2NZ2A 3CXHD 1YNVX 1RCLA 1L0NE 3BATA 1RF1A 2XFTA 1PPJD 2E75C 3B5NC 1VDFA 5BU8B 1E3VA 3MKIA 3URPA 4N6TA 2SPZA 1LP1B 5IG3A 2BMOB 3M8CA 3F5HA 1LQGC 1X1YA 2KLUA 2GXFA 1NAYA 1JB4A 4KJMA 1GU5A 1MOLA 1NTKG 1SFCA 3GF3A 4I1LA 2FYUD 3KYQA 3UJMA 2QJYB 3PCSA 1JJ22 1O7WB 1IFJA 1N5PA 2KCDA 3MD0A 2WPRA 2D2CD 2K1AA 1YQ4C 4JYCA 4FCZA 1IC2A 3CWBJ 4BXLA 3A0HH 4CJNA 1D6YA 2R4IA 3K5BA 2K54A 1RNBA 5CBOA 2OWPA 3L71G 2HMNB 2H89C 3H1JG 3VN0A 3H25A 2M5AB 1Q7YQ 3G3ZA 1SQXD 3NHXA 1B27A 1FZCB 2IZ1A 3AHWA 1JBTA 5LC6A 1VQK3 1VQ63 3NFQA 4L76A 1Z56A 2QM7A 3SFDC 1FZCC 3H1HG 3AHSA 3DGMA 1BSHA 4Z1MH 1A2PA 2F86B 2QJPC 3MG1A 4WB4A 1LXEA 3SWYA 1I3IA 3U1AA 1NNVA 3NBJA 3O6QA 2CFWA 1MWSA 2Q1KA 1UCJA 2E2VA 1BRKA 4H3UA 5CCGD 1EA2A 1O7NB 3NM7A 1ZXGA 1FA3A 4JRFA 2IUJA 2BO9B 1JUNA 1PV3A 3L73E 3GRDA 3G4S3 2XH9A 1OXZA 1Y47A 1LOVA 1VQMP 2E43A 4CCVA 3B71A 3L73J 1R5SA 5CCHC 4RZMA 3KIIA 2N1TB 3O8YA 3F7SA 1W5CE 3V2NA 2AXTH 1VQPP 3CC23 1N8QA 3UIAA 1BGSA 4MJDA 3R2PA 3L75J 5IW9A 2K9JA 3P8CD 1BRIA 2KS1A 2N1TC 3S27A 1KN7A 3LIDA 1OX3A 1N7SD 1PGJA 4HM7B 3SOAA 1M1JC 3FGAD 1SIHA 2XGLA 5H2FE 3CXHE 1NTZD 1S4XA 1ZR2A 3MTUE 1AVKA 2H0IA 3WUUA 3HE5B 1D6UA 2GA1A 2KZIA 6GSPA 4DZOA 3L74D 3BNDA 4BU4A 2F5WA 5BXQA 2QE7H 2B89A 2O01J 5K5GB 1WQLB 3HI7A 5EEOA 3DMCA 1BSAA 3JC22 2V7QJ 4OH8B 3U1WA 1SQBD 1PP9D 2OYHB 1GDTA 2F98A 1NKNA 1BE3G 1BDDA 2FYUE 4N6OB 3PLNA 2WT7B 4YPCA 1YIJP 3Q1MA 2K0MA 2BCCD 1JN5A 5GSPA 3L70D 4HKVB 3MG2A 1MZ9A 4XA4A 3I0YA 1UGIA 1URQB 1HYFA 1OF5B 2GU3A 3B5ND 1CYUA 2FYNC 1OZHA 2BASA 1FGQA 2F56A 1XTGB 2HOHA 1VQP3 2SBLA 3STDA 3T97B 1KILA 1Q814 3HTKB 3SOYA 1I2GA 1JBSA 4LC1A 1VF5B 2OTKE 1VQ5P 3EQQB 2L5GB 1LTJA 1GOUA 1W5ZA 4K1VA 3B4SA 3OA7A 2Z5IA 3FCSB 2ZXEB 4GIFA 2GBXB 1D7MA 5AW9B 1I0VA 2IYJA 4JBZA 4R4MA 3UL6A 2GM4A 4N6V0 5APQA 1DEEG 1HJBA 1JTHB 1IQ8A 1JZDA 5B66E 1AV1A 5KJ7A 1LTGC 5JPPA 2KIKA 5FW5A 1WMKA 2B88A 3CNMA 2P1JA 4J9AA 4EC6A 4I2LC 1L0LE 1MNLA 5AVUB 1STDA 1AVLA 4WVZA 1T6AA 1Q40B 5A0OB 5AW5B 1NO4A 3A0HE 2YMYA 3VMZA 1UDII 2R41A 3L72G 1A02F 2Q7CA 4RKUJ 1BSNA 5APXA 1YIJ3 3NQYA 1Q9EA 2Q07A 1KQFB 1NB5I 3EFFK 3VTPC 3MSOA 1Y4KA 1ZO2A 1X22A 2GSPA 1T2KC 1WMPA 4N6UA 5D82A 1PGPA 5KTBA 5CBNA 4EBGA 1RGEA 1UI8A 1JCDA 3J7Yd 2AEFA 3AE7C 1VQ93 1YBKA 3CCUP 1J1EB 2HPCB 3KHUA 5AVRB 3KSPA 1NTME 2V4HA 3II6A 1FGOA 2E5TA 2KUBA 3GAXA 1O7HB 3LH4A 1JO5A 3S67A 1VQ53 1KB9D 2KF5A 3LTDA 1SQPD 2IUKA 2B87A 3H1ID 4WYKB 1NTMJ 1P84D 2W56A 2MF7A 1A02J 1M56D 1SQVD 1JY3N 1YHQP 2LKMA 5CCHD 3NUVA 4FCMA 1OACA 1EZVD 3PXMA 5LC7A 1BNEA 5KP1A 5APSA 1YTZT 2LYXA 1ZP0C 1SQWA 4HYTB 2OQEA 3D5IA 4KFDA 1JY3P 1I3FA 1DX7A 4WY4B 2WPQA 3OWYA 1VQLP 3S5CA 1CSBA 1IT8A 4NREA 2E76C 1KYOI 3MZWB 1W2BO 3H1KD 4BIRA 2KYVA 2ML5A 1AVYA 3NXSA 4UB8E 1PL5A 2ZT9C 3G9RA 2JDIH 3VSYA 3UB1A 5AVZB 1BRNL 2IZ0A 2IFNA 1GK6A 1EQ7A 3HUSC 2RCDA 2VRSA 3CCU3 1W01A 2M8RA 3OWUA 1UCIA 2FFDB 1HGVA 3MIWA 3C8VA 1QVG2 2ZHXB 2OYIC 4GB5A 1L2PA 1GMRA 5APTA 3BNBA 2Z4EA 4W7ZA 3AE8C 3GW6A 3LOYA 1LGHB 2Q3EA 2OYHA 3EFGA 1G1JA 2C4BA 2FFDC 4BWNA 5AVTB 2QEX3 1BVIA 2LQVA 1W6CA 4H44B 3DGNA 3KPEA 5KLIB 1IFIA 1J2JB 1WNHA 2WQYC 4DOJA 1UW1A 1GY5A 3G8ZA 4HM4B 2P67A 5BVBA 1X9VA 4BTYA 4C7RA 3N7NA 3VP9A 2Y0CA 5CHXA 3M91A 3JCUE 4ZNCA 1T8ZA 3SYUA 1JZOA 2ZYAA 3E7KA 3ER7A 3BCCJ 2CPBA 2XNXA 1S1CX 2JWDA 1NTMK 3I56P 3A0BH 4G1MB 1Y9BA 1PPJG 3ECFA 2XRXB 3KKGA 1I70A 3QRDA 2FXPA 3PJSK 1BSBA 1Q7Y4 3E1IA 2ZXXA 1FDIA 3JSVC 4IFMA 3TGUD 2Q5UA 4WWIA 1GL2C 1YGWA 2ML6A 1BSEA 3PGBA 3DXOA 2NPSB 2ZVOB 2HMMB 2KSEA 3D6YA 2D2CB 2Y9YA 3JUPA 2W27A 1RF1C 1BGYD 2KNCA 1IVXA 3W67A 2NPSC 2FYUG 3H1HJ 2F4YA 1S5LH 2W9PA 1JY2P 2HG5D 1Q40A 3WUVA 5GTIE 1L0ND 5DJUB 2Q3IA 2R32A 1IFNA 2H88C 5AVWB 1W2EA 3SSUA 3WDGB 4YXDC 1OW6A 1O7PB 4PD4I 3V2QA 4IFDK 3SEDA 1AV4A 2FGTA 1Q7HA 1SQXG 3AE6C 4DCKA 1DETA 1IQYA 1X1WA 1BCCE 4JQ0D 1EDLA 2YFJB 1BSCA 5AW0B 1EUIC 3P7KA 3ALAA 3FXDA 3MUDA 1VL2A 1B2UA 4WP5A 4K3AA 1S2EA 3GZBA 1IK7A 1QX8A 1FBMA 2YKQA 1N8RQ 2KF3A 1YI2P 2RH0A 2O1KA 3GG2A 3WOEB 2YKOA 1BAOA 3IJEB 1U5OA 4PJ0H 5IF6A 3DGLA 3LT9A 1RGLA 1ZR4A 1W4NA 1DVCA 3VYIA 3S9OA 3RK3E 1NVOA 2KRTA 4J5GA 5CCGC 4GDOA 1L0LG 5EVHA 3NXJA 1CI6B 1WMOA 3CXHI 4N6MA 3C1LA 3AE2C 1K73Q 1FE6A 4H0LB 3JVCA 5KKZB 1UUGB 1BNJA 2E76D 5HOHA 5KAFH 3LMLA 4WY4A 1EQKA 1S3JA 2CH9A 4R80A 4HM2B 2HMKB 3AGOA 4H0LC 4W80A 3TDGA 3VP8A 4DKIA 2ZT9D 3CCRP 2UGIA 2L4VA 3S4RA 1N7SB 3Q3DA 1L4AC 3H1LE 1KZUB 2N9BA 3ITKA 4BRYB 3Q3FA 1RTUA 4IPBA 2KK7A 2WSEH 4GHOA 5DREA 2RGQA 1K41A 3L73D 3H1LJ 2IMJA 1MWRA 3LTAA 4LEHA 4D6TE 1ZS7A 2IA7A 3EJVA 1GOVA 3CNXA 2XEPA 2WTYA 1NTZG 3GZYB 2CWVA 3FG3A 2RFRA 1VQN3 4HM6B 1N73B 3GZXB 1HWTC 1JV2B 3L75D 2KSJA 1HH0A 1L5GB 2O01N 4D6TJ 3V4WA 3KN4A 3L74G 2CFLA 1WTHA 3FWNA 3GHGA 3PS8A 1VQ8P 3HIGA 1SQBG 1PP9G 1N7LA 2JJLA 1LT9C 1VQ6P 3B5NB 2JKVA 1W6YA 5IEPA 4EW5A 2AEJA 2A15A 3HD7A 2BCCG 2ZJSE 3L70G 3KSED 1G0TA 1OGZA 5AI1A 3D6ZA 3CU3A 1B2MA 1IZNB 1FZAA 1EC5A 1GL2D 3CCR3 3HIIA 4GSPA 3PH0A 1X79B 1TUHA 2P10A 4QWTA 3L72J 3G4SP 2ZYGA 4HM8B 3L36A 4XFJA 2NPSD 3MGNA 2WSFH 3CWBE 1JMBA 4MEIA 3I5CA 1NB3I 3OJAB 4C7NB 2H7HA 1ROAA 1ZW0A 3CC2P 2IDBA 1IVUA 1DMQA 4TT3H 1RE4A 1SFCD 3IF4A 4BTWA 2WMMA 2Y73A 2OOVC 2RKLA 4UB6E 3EN8A 1GW4A 4EOTA 1EXIA 4L75A 4LMIA 2QIWA 1VQ83 1H0TA 2QJPB 1RNTA 5TJHA 5STDA 1R5LA 5KJ7C 4A7PA 4I6MC 1S9KE 1US1A 1BUJA 4RO0A 5BU5A 3EBYA 3KQGA 4K90B 1YTZI 3FWLA 3ROBA 1T3UA 5ELJA 1L0LD 2OTLP 2J59M 2XNDH 5AW6B 1EDIA 4EI2A 5D83A 1D6ZA 4O2HA 3H3HA 1LTTC 5IEOA 1VZZA 1M904 1KQSO 2JO1A 3AE4C 1FDOA 1NAFA 3H32A 2HMOB 1SQPG 3H1IG 4XBTA 1YITP 1BUQA 2GBWB 1G2CB 1SQVG 2CHCA 3L75E 3Q5SA 3KZIH 4Y99C 4H0LD 1EZVG 1BNRA 3CI9A 2YIUB 1L4AD 3AMOA 5CJ0A 3B4OA 1IFDA 2YX9A 4MMZB 1M1JB 1K05A 1M57D 1F8NA 5KAFE 1NTMD 1FZGA 2KXGA 1U7MA 4N6LA 3CL3D 2YIUC 3OW2O 1NKZB 1NU1J 1EEJA 1M1K4 3X3ZA 1FOSF 4EXRA 4HVNA 3F14A 3FG4A 1RF0A 1N2DC 3K7CA 2G8YA 3H1KG 2PGDA 9RNTA 2OQEC 1S72P 1MGWA 1RE3C 4L73A 4YTPC 1PFIA 3RK3C 1U7JA 2WSEJ 3F7XA 1DE3A 1HVVA 1S5AA 2OTL3 1TFOA 1LTAC 4JF7A 5KLVE 2Y0DA 2CFDA 3LYGA 1FOSE 2I8DA 1YJWP 1SQQJ 3CX5E 2FYNB 2IBZD 2KLVA 1KWIA 5KLVJ 4OVMA 5B5EH 2FXOA 5CMZA 2OQQA 4L8OA 1GMJA 3MHEA 4CPKA 2Q6QA 4LZIA 1YIT3 3B5NA 3CCLP 4U3FE 4CPGA 4K61A 1JB2A 4AEQA 2RN0A 2JQ5A 1SVFA 1VQ9P 4U3FJ 2SARA 5APVA 1RH5B 4O9BA 2JP3A 1KB9I 4N6JA 3EF8A 3G6EP 3DGYA 1LP1A 3M06A 3CCQ3 1BANA 4KFEA 1P84I 1GK4A 2HODB 2PRRA 1LOYA 5E79H 1OGXA 2KI7B 1M9GA 4LYLB 2BEQD 5CF2A 1I2EA 1EZVI 4OVNF 4I4KA 2YMKA 4EYYQ 3GMAA 1O7GB 3EB8A 1B20A 4OGQD 3VMYA 3K9MC 3A5TA 2KOGA 1BRGA 1FZFA 3USSA 4FMDA 1S723 4TLFA 3TGUG 2FXTA 3OAKA 1QVGO 2FBWC 3D71A 1RMSA 2IYOA 1UUVB 1K9M4 4H13D 3M0DA 5KP4A 3BCCD 1DIPA 2WSFJ 3FF0A 4X2OA 2YFLB 2WOHA 1RGFA 1BGYG 2M5AA 1PY3A 1N8R4 1LOWA 1H89A 1JEKA 1PYLA 1YJW3 1KB9H 1NU1K 2I1JA 1FZCA 3PRJA 2W83C 2W8ZA 2AEMA 1YVSA 5KJ7D 1EDKA 2DW3A 1P84H 2Z5HA 1K28A 3QK9A 4KT3B 1L0NG 3TNUB 2H43A 3IFMA 1EKMA 3CCL3 2MKVA 1LWUB 3CPW2 3CCV3 1IK9A 5AEUB 3P8MC 4FMBA 3QH9A 5AVVB 3HE4B 1K734 3TSIA 1LWUC 1T3BA 5CJ4A 4PV1C 3G6E3 2E74C 1OWAA 1W7CA 1SQQK 4EV2A 3ZG0A 2UUGC 2QEXP 3WR2A 2R3CA 5KLVK 3PCRA 3B8LA 1J1DC 1NWQA 3L37A 3RDEA 4ASVA 1KSIA 4KVHA 5AVQB 3OV4A 2N1TA 2B24B 3WMDA 1GY6A 3MUDC 2P38A 3GF7A 2E76B 4FCJA 2KP8A 2QA43 5EFWB 1GMPA 1BCCD 1TP6A 3KZIE 1TTOA 3TF5A 3BNCA 3U97A 1M1JA 2XR8B 2AXTE 1JNQA 3AEFC 3OX9A 1MFTA 2IBZE 3K0ZA 1NTZJ 2ZT9B 3N4XA 4NPDA 3WMM0 5TISH 2RMZA 1OW8A 1M90Q 5DJTB 5GTHH 2NRGA 2BHMA 3HUSB 1ZN5A 4RBNA 1JCCA 2ZVNB 1B2ZA 1TIJA 2A45G 3D9RA 1TU5A 1ULJB 2PFXA 1Q90D 3A2AA 3EX9A 2OYIB 1V57A 3HE5A 3NV0B 4WFOA 3VOPA 1HJ0A 1SQBJ 3RK3D 1W2ZA 3BASA 1PP9J 2YFIB 1TU3F 4Q53A 5CK6A 2BIRA 3D79A 2CKFB 3X3YA 2YNYA 2BMQB 1RKYA 2O1JA 2FY8A 4KT0J 1N9EA 3L73G 3FG1A 3JUOA 1JOCA 3L70J 5CF1A 4FMCA 1DEBA 2F5MA 1VQ4P 4N78E 3MHVA 2JWAA 1M1KQ 2WT7A 1KILE 3LT8A 3MWZA 1NTKE 3L75G 3RL0D 4R9KA 1KYOH 1MFZA 1AY7A 1URQA 1OF5A 4R1KA 1NTKJ 3H1LD 2FNQA 1GD4A 2WO0A 1IVWA 2H0HA 1WRGA 3BCCE 3JUNA 1ZRTE 3T97A 1W00A 1RY3A 2OARA 3HTKA 2W0QA 2BU4A 3FKAA 2IX7C 5AIIA 3L71E 3H1JE 4D6TD 1ROVA 1GL2B 1OHSA 2BT3A 2A06D 4AQRD 3GHGC 3L71J 3G16A 1KMIZ 3H1JJ 3SVAA 2O3JA 1FJPA 1E5WA 3NTNA 2CFGA 1RF1B 1AR0A 1QL1A 1CH0A 2UWJE 5CLKA 5EQLA 1JTHA 3H1HE 2C9NY 3CLQA 2R44A 3CPOA 3N9HA 2K37A 2CC3A 4XDVA 4YXWH 5AW2B 4BTXA 2IPPA 1LNHA 4B86A 2HR3A 4KZ1A 2LXBA 2WGQA 1DH3A 1NTZK 1B2SA 1RHZB 3CC7P 1SFCB 1LNIA 1TRQA 1VQ43 2E2TA 1AFOA 1CZQA 4U13A 3IAOA 8CHOA 3Q5PA 1OHPA 4CDLA 3CD6P 1IVVA 1SFCC 2B9BA 3HX8A 4HJGH 5AEWB 1QVF2 1SQBK 3F9SA 5D81A 2CG1A 3EN1B 4JPZB 3SWFA 3Q5RA 4PV1D 1SQPJ 1K9MQ 2E74D 2HPCA 1SJWA 1RSNA 1B2XA 4K35A
chains in the Genus database with same CATH topology
4HM8B 3F8HA 2D42A 2F98A 3GZRA 2BMRB 2Z6BA 3OWSA 4N6OB 1IU7A 4QMAA 4MEIA 4WYKA 1ISKA 1NB3I 2K0MA 3PYJA 4FMAA 1JN5A 4HKVB 2CW9A 3VGNA 1ROAA 2O3OA 3MG2A 5AIFA 3I0YA 1FS0E 4RNYA 1IVUA 1OPYA 1DMQA 4HBRA 1OF5B 2RSXA 3Q2PA 2GU3A 1A2KA 3HZPA 1CYUA 1FGQA 4BTWA 1GYBA 1TFKA 2OOVC 2Y73A 3EN8A 5ELUA 1NO3A 2SBLA 1VQP3 4LMIA 3STDA 4HJLB 1Q814 4J8TA 3SOYA 1W6GA 1VQ83 3PZWA 1IFPA 2XFSA 5STDA 4XB5A 3FF2A 3EQQB 1FUWA 4IIAA 1CYVA 4AKZA 3CC73 4K1VA 1W5ZA 3FCSB 4L8PA 4XM4A 1US1A 2GBXB 1OH0A 1STFI 3EBYA 3UL6A 3WOFB 2CFKA 2XF3A 4N6V0 4K90B 1Q42A 3CD63 3Q1CA 3ROBA 5AYRB 1IQ8A 4EV5A 5ELJA 3CXC2 4HZBB 5JPPA 3G0KA 2XNDH 5FW5A 4J9AA 3FSDA 3CNMA 4EC6A 2QIYA 1D6ZA 4HM0B 5D83A 1YHQ3 3Q90A 1MNLA 4O2HA 3H3HA 1STDA 5IEOA 1VZZA 1M904 1IV9A 1IDPA 1AVLA 1PU4A 1K8A4 4WVZA 1SPUA 1N9JA 1Q40B 5A0OB 2HMOB 2V1LA 4HM3B 3CCS3 1YJ93 1DMNA 3GWRA 2C11A 3V92A 4XBTA 1BUQA 2GBWB 1VQO3 4R9LA 1LOXA 1BSNA 3S29A 2CWTA 1YIJ3 3NQYA 1ULIB 2CHCA 1OCVA 4K1UA 2Q07A 1NB5I 3EFFK 2I9WA 3MSOA 1YJN3 3NX0A 1Y4KA 1ZO2A 1VQL3 3BLZA 1WMPA 4N6UA 5D82A 2GEYA 5AYSC 1JKGA 5IERA 3WODG 1DMMA 3AMOA 4JF8A 4EBGA 3B4OA 2YX9A 1UI8A 1A2VA 4MMZB 1VQ73 3J7Yd 2ZL8A 1F8NA 1IQXA 2Z7AA 1VQ93 3H51A 3X40A 3JUQA 2OTJ3 4O02B 2KXGA 3KSPA 4N6LA 1E3RA 1G96A 1M1K4 1FGOA 3X42A 2E5TA 3X3ZA 1Q864 3GAXA 4EXRA 1O7HB 3LH4A 3IPTA 3N54B 4LGQA 3S67A 1VQ53 1OUNA 3F14A 3LTDA 4HVNA 3FG4A 4WWUC 2IUKA 4O8SA 4ZM8A 3K7CA 4WYKB 3G713 4RNZA 2W56A 5JBSA 1V74A 1JN5B 1NWWA 2MF7A 4NHFA 4ORLA 3SLUA 3V98A 1GY7A 1QJGA 2OQEC 4FCMA 3NUVA 2HMLB 1FGRA 1OACA 3UL5A 3FLJA 3DZLA 3PXMA 5LC7A 3LXUX 1UUWB 5TGNA 5KP1A 1Q824 2LYXA 3F7XA 1HKXA 1S5AA 2OTL3 1TFOA 1W2B2 2P0MA 2OCTA 2W9QA 3T8UA 1SQWA 1N5HA 1EG9B 2CFDA 3LYGA 2OQEA 1T5YA 4KFDA 3K63A 3BB9A 2WOFA 1U8CB 1KWIA 2Y74A 4OVMA 2F99A 3MYTA 1NDOB 3UNLA 3N8BA 6STDA 1FGMA 3OWYA 2Z76A 4L8OA 3S5CA 3MHEA 1IT8A 4NREA 3T8NA 1YIT3 4K61A 1JB2A 1SIIA 2ML5A 1IK3A 1FGTA 4AEQA 4OK0A 2CK3H 2JQ5A 1GD3A 2PZVA 3JUMA 3I563 4H61A 3L0RA 2JDIH 1DVDA 3VSYA 1NJI4 2CIUA 1IV7A 3UB1A 3EF8A 3K5TA 4WHAA 4N3VA 2W6JH 2RCDA 3CCQ3 2QGUA 4KFEA 1QALA 2XSOB 5JPUA 3CCU3 3LZAA 1W01A 3OWUA 2XGNA 1J2BA 3RGAA 2E2UA 1QVG2 4AKYA 4GB5A 1OGXA 1M9GA 4EYCA 2M7OA 5KP3A 3BNBA 5CF2A 3LOYA 2HMJB 1KD14 4I4KA 3V99A 3CME3 3EHCA 1O7GB 3EB8A 3OXAA 3DY5A 2QEX3 4HM1B 3K9MC 2LQVA 1W6CA 3EBTA 3USSA 2CWUA 2O9UX 3DGNA 3E99A 4GL6A 5FGOA 4FMDA 1CQSA 3NV0A 4PEJA 4TLFA 2FXTA 4FR9A 1S723 4XDWA 1WNHA 1UUVB 3AMOB 4OUQA 1K9M4 1RRHA 1UW1A 1YGEA 1GY5A 3G8ZA 3LTCA 5KP4A 4HM4B 4L7KA 3CC43 1KC84 2PNCA 5BVBA 3EC9A 4BTYA 3FF0A 4X2OA 2YFLB 3D3LA 2WOHA 5I97A 1DYUA 1N8R4 3CCM3 1JEKA 1RRLA 4MMYB 1YJW3 2E5YA 3MG3A 1YVBI 4HZ9B 2V7QH 4DJGA 1IT7A 3ER7A 1QAFA 1K28A 2STDA 3QK9A 3VF1A 2W56B 2ZDJA 2MC8A 3DUKA 2BNGA 3MPHA 1EKMA 3CCL3 4G1MB 2W04A 1A67A 3ECFA 2XRXB 3KKGA 3QRDA 3CPW2 3CCV3 2P05A 5AEUB 3PJSK 4FMBA 1Q7Y4 3X41A 3FZWA 1E79H 2GEXA 3FGYA 3T0UA 3WA2X 1YI23 1K734 2ML6A 3S28A 3PGBA 5AIHA 3DXOA 1ZX2A 3KFQC 3G6E3 2HMMB 3EE1A 4R4KA 1GS3A 1JRQA 3A76A 2INXA 5IENA 1AQTA 3JUPA 4MMXB 1W7CA 4EV2A 1IVXA 7STDA 4N6NB 3NBBA 2WGOA 3PCRA 2WSSH 2W9PA 5CXOA 3B8LA 2B1XB 1RJOA 3F40A 3LTBA 1Q40A 4X2HA 2GU1A 3IMAB 1R4CA 2P09A 3RDEA 3NQZA 1KSIA 2Z77A 4IT7A 2XFTA 4KVHA 3OV4A 3WDGB 3B7CA 3F8XA 1O7PB 2B24B 5G2GA 3WMDA 1E3VA 1GY6A 3MKIA 4N6TA 2P38A 4FCJA 4KFFA 5IG3A 2BMOB 3M8CA 2QA43 5HGRA 3FH1A 3SEDA 1TP6A 1AV4A 5AIGA 2FGTA 3BNCA 3RGRA 3U97A 3B4PA 2XR8B 1A90A 1JNQA 1IQYA 2GXFA 1JB4A 3OX9A 1O7MB 2YFJB 3K0ZA 3CCJ3 1MOLA 3SX1A 1LVNA 3ALAA 1JB5A 2BHMA 3UJMA 3PCSA 4WP5A 3CCE3 4RBNA 1JJ22 3D9RA 3GZBA 1TIJA 1O7WB 1TU5A 1ULJB 1N5PA 4HYZA 2KCDA 3WOEB 3KE7A 3EX9A 3IJEB 1U5OA 3NV0B 5IF6A 4WFOA 2P0XA 3DGLA 4XBXA 1W2ZA 3LT9A 1VQM3 4FCZA 1W4NA 2YFIB 1DVCA 4Q53A 1D6YA 2R4IA 5CK6A 2K54A 2KRTA 2OWPA 3SXXA 5EVHA 2CKFB 2HMNB 3X3YA 3NXJA 3CMA3 2BMQB 1RKYA 1WMOA 1C7HA 1N9EA 3NM2A 3NBRA 3FG1A 3JUOA 4N6MA 5CF1A 4FMCA 3NHXA 1NU3A 5LC6A 3JVCA 1VQK3 3BNEA 3X3XA 1VQ63 3LT8A 3HK4A 1Z1SA 1M1XB 3MWZA 1UI7A 3LMLA 2OOVA 1EQKA 1JKGB 2CH9A 1QMAA 4HM2B 4R9KA 3DGMA 4R80A 2HMKB 1BSHA 3TDGA 1RN7A 1OF5A 2F86B 4R1KA 3MG1A 1KQS2 2L4VA 3DGOA 2FNQA 4LSOA 1GD4A 1LXEA 2WO0A 1IVWA 4TX4A 1HU9A 3JUNA 5IG5A 3I553 3DM8A 3NBJA 2CFWA 4IPBA 2UX0A 4HM5B 4O3VA 1ASKA 1W00A 2E2VA 2W0QA 4H3UA 5DREA 1EA2A 2RGQA 3FKAA 1K41A 1O7NB 5AIIA 3NM7A 2IMJA 1WMNA 1FA3A 4JRFA 2IUJA 1ROVA 3LTAA 1OHSA 2BT3A 2BO9B 4LEHA 2IA7A 3GRDA 3EJVA 2XH9A 3G4S3 3CNXA 2XEPA 3G16A 1W02A 3GZYB 2CWVA 3FG3A 2RFRA 4STDA 3SVAA 4CCVA 4HM6B 1VQN3 3GZXB 1JV2B 2CFGA 2D1WA 1PFPA 1L5GB 1AR0A 5IG0A 4RZMA 3KN4A 5CLKA 5EQLA 3KIIA 3O8YA 3OW22 2CFLA 3F7SA 1WTHA 3CC23 3CPOA 3N9HA 1N8QA 2CC3A 3KZTA 3WA3A 4XDVA 3PS8A 4YXWH 4MJDA 3HIGA 5IW9A 4BTXA 1LNHA 4KZ1A 2CG0A 1QAKA 3S27A 2WGQA 1W6YA 5IEPA 1CEWI 1VQ43 2A15A 2E2TA 4HM7B 3SOAA 2W2CA 1SIHA 3KSED 2XGLA 4U13A 8CHOA 1OHPA 1OGZA 5AI1A 4CDLA 1IVVA 1AVKA 3CU3A 3HX8A 5IG4A 1D6UA 5AEWB 1QVF2 1E97A 3BNDA 3F9SA 5D81A 2CG1A 3CCR3 3EN1B 3HIIA 5BXQA 2QE7H 1WQLB 3HI7A 4XBYA 5EEOA 1TUHA 3DMCA 5DRVA 2W03A 1SJWA 2XSHB 1OHOA 4QWTA 3U1WA 4LZIA 2C10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JEK A;  1BSN A;  2E5T A;  2E5Y A;  2JDI H;  2V7Q H;  4DJG A;  3EFF K;  1AQT A;  1IFP A;  2XND H;  3USS A;  4QMA A;  2W6J H;  4TLF A;  4YXW H;  2WSS H;  2QE7 H;  1BSH A;  1FS0 E;  4WVZ A;  3PJS K;  1E79 H;  2CK3 H; 
#chains in the Genus database with same CATH topology
 3F8H A;  2D42 A;  3CWB D;  3D5G A;  2Z6B A;  1VQN P;  1AVO A;  3BRT B;  1HGZ A;  1VQO P;  4ZKU A;  3AEC C;  1ISK A;  4WYK A;  3V6I A;  1RGH A;  4FMA A;  1XTC C;  4GOF A;  1RHL A;  4U7J A;  1N86 A;  1OPY A;  4HBR A;  1GD2 E;  3HZP A;  3BRV B;  1Q2N A;  1NTK K;  1GYB A;  1NO3 A;  4PD4 H;  1MKM A;  3O6Q B;  4J8T A;  4L74 A;  1M8O B;  2WIT A;  1IFP A;  1G1I A;  2QM8 A;  2XFS A;  4XB5 A;  3FF2 A;  1S9K D;  1FUW A;  4IIA A;  1L4A B;  1CYV A;  1PGQ A;  4AKZ A;  4KHX A;  1EDJ A;  3CC7 3;  1BU4 A;  3G71 P;  1I2F A;  1JBR A;  1OH0 A;  5AW4 B;  3C9I A;  3WOF B;  3HUS A;  2KF4 A;  1Q42 A;  3CD6 3;  3Q1C A;  2M3B A;  1BE3 J;  4NPE A;  5G1K A;  4NPF X;  3IR9 A;  3O8Z A;  2WPV B;  4R4L A;  4EV5 A;  3CXC 2;  3AGN A;  3G0K A;  3AE1 C;  3FSD A;  2QIY A;  1NTM G;  2XKM A;  4HM0 B;  3Q90 A;  2K9J B;  1IV9 A;  2ZYD A;  5AVX B;  1K8A 4;  2FFD A;  1SPU A;  1N9J A;  1B21 A;  4Y28 J;  3M9H A;  2V1L A;  5H2F H;  3DH2 A;  3CXH H;  1T3J A;  2IYP A;  1LQM B;  3CCS 3;  1YJ9 3;  3GWR A;  1HTL C;  2A06 E;  2ZA4 A;  3LW5 H;  1VQO 3;  1FJK A;  3MP7 B;  3S29 A;  1IJD B;  3Q2Y A;  2CWT A;  1RCK A;  1ULI B;  1OCV A;  1YJN 3;  1LT9 B;  1X1X A;  3NX0 A;  1QGK B;  1QL2 A;  1GTW A;  3WU2 H;  5IER A;  3WOD G;  1OVU A;  1RF0 C;  1SQP K;  3JUQ A;  2OTJ 3;  1KYO E;  3AE5 C;  1MWT A;  1BNS A;  1E3R A;  1MUU A;  2IBZ G;  1G96 A;  2Q9I A;  2J58 A;  1NH4 A;  1IO4 A;  3N54 B;  7RNT A;  3W68 A;  4ZM8 A;  3CME P;  3TGU J;  3G71 3;  3BIR A;  1V74 A;  1JN5 B;  2HLO A;  4NHF A;  4ORL A;  1GL2 A;  3SLU A;  3V98 A;  3L72 E;  3E1R A;  2HML B;  8RNT A;  2KZJ A;  1SQQ D;  1AQ5 A;  3FLJ A;  3A0B E;  1RGC A;  3LXU X;  1BGY J;  5KLV D;  1HKX A;  3HD7 D;  3RK2 C;  2G3A A;  2NPS A;  1KIL B;  3CX5 D;  3T8U A;  3TDK A;  4OGQ B;  1L0N J;  1UCK A;  3K63 A;  3BB9 A;  2H8P D;  2IFM A;  3VMX A;  1UII A;  1U8C B;  2Y74 A;  1PGO A;  3MYT A;  1NDO B;  6STD A;  4U3F D;  1KIL C;  1LTJ B;  4H13 B;  2Z76 A;  4OGQ C;  3AE3 C;  2ZAE B;  1RDS A;  5B66 H;  1IK3 A;  1S5L E;  4OK0 A;  2CK3 H;  1LTJ C;  2KB7 P;  4H13 C;  1HUC A;  1GD3 A;  3L0R A;  1LNQ A;  1PIX A;  3V2P A;  2CIU A;  3BCC G;  1IV7 A;  3K5T A;  4WHA A;  2QJY C;  2W6J H;  3ZDM A;  2K3D A;  2QGU A;  1QAL A;  1ZOY C;  1SS1 A;  3D4A A;  1BSD A;  2GUV A;  3RGA A;  2R3S A;  2E2U A;  5AW8 B;  1S5L X;  4EYC A;  2M7O A;  5KP3 A;  1BRJ A;  2KF6 A;  4HOH A;  2K9Y A;  2HFE D;  3M0D C;  1OFC X;  5BVZ A;  3V99 A;  3CME 3;  3EHC A;  2PP6 A;  3OXA A;  1V58 A;  5C39 A;  3DY5 A;  1AA0 A;  3M9B A;  5CCG A;  2WSC H;  1Q86 Q;  2O9U X;  3E99 A;  5FGO A;  4C46 A;  1CQS A;  1IYY A;  4FR9 A;  2IBZ I;  1RRH A;  4NPB A;  3AEG C;  4PJ0 E;  1JY3 O;  1DD4 A;  3KDP B;  3EC9 A;  1CI6 A;  3D3L A;  4Y99 B;  3IN6 A;  5I97 A;  3CCJ P;  1K04 A;  2E5Y A;  3MG3 A;  2N9Y B;  1Q82 Q;  2K3R A;  1KTM A;  4HKZ H;  4HZ9 B;  4DJG A;  3CCE P;  1JM0 A;  2B87 B;  3D70 A;  1EXJ A;  1ZLL A;  1GOY A;  2M0B A;  4PD4 E;  2W56 B;  2ZDJ A;  3DUK A;  1L4A A;  5KAI H;  2W04 A;  1SLQ A;  3P32 A;  1BRH A;  1NU1 E;  3CCQ P;  3X41 A;  1E79 H;  3FGY A;  2JEE A;  5M1A A;  3T0U A;  3WA2 X;  1N7S A;  3S28 A;  5AIH A;  2XU6 A;  1BCC G;  1ZX2 A;  2FKW B;  3CMA P;  3FX0 A;  2W6A A;  4BRY A;  1U57 A;  1CW5 A;  3EE1 A;  4R4K A;  1GS3 A;  5IEN A;  2INX A;  1L0N K;  3CPW O;  4N6N B;  3NBB A;  1NJI Q;  3RK3 B;  2WGO A;  2YXR B;  4ASW A;  5CXO A;  4UB8 H;  2B1X B;  1RJO A;  3F40 A;  3LTB A;  3VMA A;  1AJY A;  4X2H A;  1R4C A;  4EDF A;  2QJK B;  2P09 A;  1N73 A;  3NQZ A;  2Z77 A;  4IT7 A;  1BDC A;  1SQQ E;  1VQQ A;  1KD1 Q;  2YXQ B;  1HF9 A;  3B7C A;  2QVA A;  1PPJ E;  3F8X A;  5G2G A;  1LT9 A;  2QJK C;  2P7J A;  4RES B;  3I55 P;  2YKP A;  4KFF A;  5HGR A;  2JR8 A;  3FH1 A;  4GOD A;  5AIG A;  1B3S A;  3RGR A;  3RL0 B;  3B4P A;  1A90 A;  3LW5 J;  2RBI A;  1USE A;  3V5B A;  1O7M B;  3CCJ 3;  2XV5 A;  3WU2 E;  3SX1 A;  1LVN A;  1K8A Q;  1JB5 A;  1KC8 Q;  3CCV P;  3RL0 C;  3CCE 3;  3SWK A;  1ZV8 A;  1GSP A;  4HYZ A;  2KXP B;  3KE7 A;  3KXD A;  1IFM A;  1BOX A;  2OYH C;  1BNF A;  3H1L G;  2P0X A;  4OWF A;  1T2H A;  1TJD A;  4XBX A;  2FYU J;  2WPS A;  1VQM 3;  4DT0 A;  1LTS C;  1NYH A;  3A7O A;  5L8R J;  3RK2 D;  2E75 D;  3SXX A;  1WT6 A;  3JCU H;  4BL2 A;  3CMA 3;  1C7H A;  3NM2 A;  3NBR A;  4N78 D;  1KQG B;  4D6T G;  2AAE A;  5AVY B;  1JY2 O;  1NU3 A;  1URQ C;  1Y8A A;  2GUS A;  1SQX E;  1KIL D;  2A06 G;  1NTK D;  1TRP A;  3BNE A;  3X3X A;  1DD3 A;  4C7N A;  3HK4 A;  1Z1S A;  1M1X B;  3PTZ A;  1UI7 A;  1UIX A;  5M1B A;  2OOV A;  1JKG B;  1SQX J;  1QMA A;  2QA4 P;  1VF5 C;  1RN7 A;  3HRN A;  1JMM A;  1KQS 2;  1OIP A;  4LSO A;  3DGO A;  1YYC A;  1R4Y A;  1ZRT D;  4TX4 A;  1RLS A;  1HU9 A;  3SFE C;  1OW7 A;  3NMD A;  5IG5 A;  1BIR A;  4LGD E;  3I55 3;  1FAV A;  3HOH A;  2C0X A;  3DM8 A;  1R8E A;  3H6P A;  3L71 D;  2UX0 A;  4HM5 B;  4O3V A;  1ASK A;  3H1J D;  3RBX A;  1SAR A;  2LXC B;  2LR2 A;  2KNC B;  5GTI H;  2J5U A;  1WMN A;  5AVS B;  2Y0E A;  7GSP A;  3RBZ A;  2ITA A;  1FDM A;  4RNT A;  4M3L A;  4PV1 B;  1L0L J;  2FYZ A;  1W02 A;  2E74 B;  2IY2 A;  4STD A;  4HH2 A;  2CX0 A;  2D1W A;  1GW3 A;  1RQV A;  1PFP A;  3H1H D;  5IG0 A;  3BVH A;  3OW2 2;  1J1D B;  1YQ3 C;  5BU4 A;  3KZT A;  3WA3 A;  2FXM A;  2W6B A;  1FC2 C;  3CWB G;  3AED C;  5CCH A;  4J5K A;  1NHL A;  4ILF A;  3P8C E;  3S1K A;  2XZR A;  1QAK A;  2CG0 A;  1CEW I;  1FZE A;  2WSC J;  2W2C A;  4RJT A;  2H0G A;  1G2C A;  1J1E C;  1KFM A;  2J8X B;  1NTZ E;  5IG4 A;  4GKG A;  1E97 A;  1RQU A;  2FYU K;  3RL0 g;  4BL3 A;  4HB1 A;  1HBW A;  4XBY A;  1FU1 A;  3L74 E;  5DRV A;  1LRA A;  3QWO C;  2C0W A;  2W03 A;  3GLM A;  5KAI E;  2XSH B;  1OHO A;  3RNT A;  2C10 A;  3PYJ A;  4GOE A;  1MV8 A;  1I0X A;  2BMR B;  3GZR A;  3L74 J;  3OWS A;  1SQB E;  3LIE A;  2N1T D;  1PP9 E;  1QVF O;  1RE3 A;  5APY A;  1IU7 A;  1HZ1 A;  4QMA A;  3VGN A;  2CW9 A;  2O3O A;  5AIF A;  1SQX K;  1FS0 E;  4RNY A;  2BCC E;  6RNT A;  3L70 E;  2RSX A;  3Q2P A;  4IL6 H;  1A2K A;  3A5E A;  1VQ7 P;  1VPC A;  1GMQ A;  4WY4 C;  1TFK A;  1RN1 A;  2M3E A;  5ELU A;  2BCC J;  3EQ2 A;  4HJL B;  2CPS A;  3TK1 A;  1KV4 A;  1W6G A;  5G1L A;  3PZW A;  4GT1 A;  2KAA A;  2QG4 A;  1BE3 D;  3PHL A;  4L8P A;  4XM4 A;  3B8E B;  1L0L K;  1STF I;  5B5E E;  2CFK A;  2XF3 A;  1BNG A;  1RGA A;  1NU1 G;  2RNT A;  5AYR B;  1PZQ A;  4HZB B;  2K88 A;  1LT1 A;  4ZKP A;  3GSP A;  3U1C A;  3L4F A;  1YHQ 3;  3GHG B;  1USD A;  1H88 A;  3WHO A;  1BRS A;  1IDP A;  1PU4 A;  2HOD A;  4H44 C;  1NGM B;  1GU4 A;  1URQ D;  4HM3 B;  5KLI C;  3M0A A;  1DMN A;  2C11 A;  3V92 A;  2C9L Y;  1M7L A;  3HD7 B;  4R9L A;  1LOX A;  5E79 E;  4K1U A;  2I9W A;  2YO3 A;  3AEA C;  4IFF A;  1SQQ G;  1VF5 D;  1VQL 3;  3BLZ A;  3HD7 C;  2GEY A;  5AYS C;  1JB0 J;  1JKG A;  5KLV G;  1DMM A;  1ZGX A;  4JF8 A;  2L91 A;  1JNM A;  2OYO A;  1A2V A;  4I5Q A;  1VQ7 3;  2A45 I;  2ZL8 A;  1KYO D;  1IQX A;  1QEX A;  1ZME C;  1MWU A;  1KFN A;  1RN4 A;  2Z7A A;  1T2I A;  3H51 A;  3X40 A;  4O02 B;  3V2R A;  1JY2 N;  4I7Z B;  3X42 A;  1Q86 4;  3RGU A;  4U3F G;  3IPT A;  4LGQ A;  3AEB C;  1OUN A;  4WWU C;  1RGG A;  1KQL A;  4O8S A;  2E42 A;  1Q81 Q;  3TNU A;  3AE9 C;  3L72 D;  1KB9 E;  4RNZ A;  5JBS A;  1LJ2 A;  1NWW A;  1SQP E;  1BNI A;  4I7Z C;  1G02 A;  1GY7 A;  1QJG A;  3ZG5 A;  3H1I E;  1OVR A;  3A3Y B;  1LWU A;  1P84 E;  4UB6 H;  2D2C C;  5APW A;  1FGR A;  5AW1 B;  3UL5 A;  1SQV E;  3DZL A;  2WZ7 A;  3L35 A;  1UUW B;  3HE4 A;  3F89 A;  3H1I J;  1I8V A;  5TGN A;  3U59 A;  3CC4 P;  1Q82 4;  1T2K D;  1EZV E;  1X0T A;  1W2B 2;  2P0M A;  2OCT A;  2W9Q A;  3CCS P;  1SQV J;  1YJ9 P;  1N5H A;  2YO2 A;  3TYY A;  4AYC A;  3CCM P;  1H0T B;  5AW7 B;  1RE4 C;  1EG9 B;  1T5Y A;  2WWW A;  3WUT A;  2WOF A;  2A45 H;  4IOI H;  4JYB A;  4ZMD A;  2F99 A;  3UNL A;  2OGU A;  1YJN P;  1FGM A;  3N8B A;  3EWK A;  3ZFZ A;  3T8N A;  2P58 A;  1SII A;  1FGT A;  1BCC J;  5RNT A;  3H1K E;  2PZV A;  3JUM A;  3I56 3;  4H61 A;  1DVD A;  4XE5 B;  2OTJ P;  2R5D A;  1NJI 4;  4N3V A;  5AW3 B;  1FUS A;  3H1K J;  2I1K A;  1GZL A;  5APU A;  1AQZ A;  2XSO B;  5JPU A;  1FYS A;  3LZA A;  2QRX A;  2XGN A;  3FXE A;  1UCL A;  1J2B A;  1NOH A;  4AKY A;  3H32 B;  1BE3 E;  3PP5 A;  2HMJ B;  1KD1 4;  5M19 A;  5BIR A;  4HAA A;  5TIS E;  3R4Y A;  4HM1 B;  3CX5 I;  5GTH E;  3EBT A;  2CWU A;  4EIJ A;  4GL6 A;  2OYI A;  3BU4 A;  3NV0 A;  4PEJ A;  4XDW A;  1UGH I;  2HYN A;  4WBA A;  4WY4 D;  4N3Y B;  3AMO B;  2WVR A;  2KS1 B;  1YGE A;  4OUQ A;  1MGR A;  1FUT A;  3ABV C;  3LTC A;  3AEE C;  5KKZ C;  4L7K A;  3CC4 3;  1KC8 4;  2PNC A;  1OVV A;  2R5B A;  1DYU A;  2O01 H;  1FW7 A;  3CCM 3;  1RRL A;  4MMY B;  4IL6 E;  1YVB I;  4PD4 D;  2XDJ A;  2V7Q H;  4LLH A;  1IT7 A;  1QAF A;  1N7S C;  2STD A;  1LTB C;  3VF1 A;  2CX1 A;  2L1S A;  2MC8 A;  2BNG A;  4W7Y A;  3MPH A;  1NU1 D;  1QLE D;  1A67 A;  5M18 A;  2P05 A;  2PAJ A;  2P2U A;  3FZW A;  2GEX A;  4AUW A;  1SP4 A;  1FZU A;  1YI2 3;  4IL6 X;  1FZB A;  2AAD A;  2Y9Z A;  1LTI C;  3CX5 H;  3V4Q A;  3TGU E;  3KFQ C;  2W90 A;  3M9Q A;  1H8A A;  1SQV K;  2AXC A;  1JRQ A;  1KOR A;  4MN4 C;  1N73 C;  3A76 A;  1RGK A;  1AQT A;  4H44 D;  4MMX B;  2MJZ A;  1X1U A;  7STD A;  3KCH A;  1OMI A;  2POH A;  1BGY E;  2BEZ F;  2WSS H;  1VQK P;  3RK2 B;  2ZFC A;  2E75 B;  2QSI A;  2GU1 A;  3IMA B;  1C54 A;  1X8Y A;  2NZ2 A;  3CXH D;  1YNV X;  1RCL A;  1L0N E;  3BAT A;  1RF1 A;  2XFT A;  1PPJ D;  2E75 C;  3B5N C;  1VDF A;  5BU8 B;  1E3V A;  3MKI A;  3URP A;  4N6T A;  2SPZ A;  1LP1 B;  5IG3 A;  2BMO B;  3M8C A;  3F5H A;  1LQG C;  1X1Y A;  2KLU A;  2GXF A;  1NAY A;  1JB4 A;  4KJM A;  1GU5 A;  1MOL A;  1NTK G;  1SFC A;  3GF3 A;  4I1L A;  2FYU D;  3KYQ A;  3UJM A;  2QJY B;  3PCS A;  1JJ2 2;  1O7W B;  1IFJ A;  1N5P A;  2KCD A;  3MD0 A;  2WPR A;  2D2C D;  2K1A A;  1YQ4 C;  4JYC A;  4FCZ A;  1IC2 A;  3CWB J;  4BXL A;  3A0H H;  4CJN A;  1D6Y A;  2R4I A;  3K5B A;  2K54 A;  1RNB A;  5CBO A;  2OWP A;  3L71 G;  2HMN B;  2H89 C;  3H1J G;  3VN0 A;  3H25 A;  2M5A B;  1Q7Y Q;  3G3Z A;  1SQX D;  3NHX A;  1B27 A;  1FZC B;  2IZ1 A;  3AHW A;  1JBT A;  5LC6 A;  1VQK 3;  1VQ6 3;  3NFQ A;  4L76 A;  1Z56 A;  2QM7 A;  3SFD C;  1FZC C;  3H1H G;  3AHS A;  3DGM A;  1BSH A;  4Z1M H;  1A2P A;  2F86 B;  2QJP C;  3MG1 A;  4WB4 A;  1LXE A;  3SWY A;  1I3I A;  3U1A A;  1NNV A;  3NBJ A;  3O6Q A;  2CFW A;  1MWS A;  2Q1K A;  1UCJ A;  2E2V A;  1BRK A;  4H3U A;  5CCG D;  1EA2 A;  1O7N B;  3NM7 A;  1ZXG A;  1FA3 A;  4JRF A;  2IUJ A;  2BO9 B;  1JUN A;  1PV3 A;  3L73 E;  3GRD A;  3G4S 3;  2XH9 A;  1OXZ A;  1Y47 A;  1LOV A;  1VQM P;  2E43 A;  4CCV A;  3B71 A;  3L73 J;  1R5S A;  5CCH C;  4RZM A;  3KII A;  2N1T B;  3O8Y A;  3F7S A;  1W5C E;  3V2N A;  2AXT H;  1VQP P;  3CC2 3;  1N8Q A;  3UIA A;  1BGS A;  4MJD A;  3R2P A;  3L75 J;  5IW9 A;  2K9J A;  3P8C D;  1BRI A;  2KS1 A;  2N1T C;  3S27 A;  1KN7 A;  3LID A;  1OX3 A;  1N7S D;  1PGJ A;  4HM7 B;  3SOA A;  1M1J C;  3FGA D;  1SIH A;  2XGL A;  5H2F E;  3CXH E;  1NTZ D;  1S4X A;  1ZR2 A;  3MTU E;  1AVK A;  2H0I A;  3WUU A;  3HE5 B;  1D6U A;  2GA1 A;  2KZI A;  6GSP A;  4DZO A;  3L74 D;  3BND A;  4BU4 A;  2F5W A;  5BXQ A;  2QE7 H;  2B89 A;  2O01 J;  5K5G B;  1WQL B;  3HI7 A;  5EEO A;  3DMC A;  1BSA A;  3JC2 2;  2V7Q J;  4OH8 B;  3U1W A;  1SQB D;  1PP9 D;  2OYH B;  1GDT A;  2F98 A;  1NKN A;  1BE3 G;  1BDD A;  2FYU E;  4N6O B;  3PLN A;  2WT7 B;  4YPC A;  1YIJ P;  3Q1M A;  2K0M A;  2BCC D;  1JN5 A;  5GSP A;  3L70 D;  4HKV B;  3MG2 A;  1MZ9 A;  4XA4 A;  3I0Y A;  1UGI A;  1URQ B;  1HYF A;  1OF5 B;  2GU3 A;  3B5N D;  1CYU A;  2FYN C;  1OZH A;  2BAS A;  1FGQ A;  2F56 A;  1XTG B;  2HOH A;  1VQP 3;  2SBL A;  3STD A;  3T97 B;  1KIL A;  1Q81 4;  3HTK B;  3SOY A;  1I2G A;  1JBS A;  4LC1 A;  1VF5 B;  2OTK E;  1VQ5 P;  3EQQ B;  2L5G B;  1LTJ A;  1GOU A;  1W5Z A;  4K1V A;  3B4S A;  3OA7 A;  2Z5I A;  3FCS B;  2ZXE B;  4GIF A;  2GBX B;  1D7M A;  5AW9 B;  1I0V A;  2IYJ A;  4JBZ A;  4R4M A;  3UL6 A;  2GM4 A;  4N6V 0;  5APQ A;  1DEE G;  1HJB A;  1JTH B;  1IQ8 A;  1JZD A;  5B66 E;  1AV1 A;  5KJ7 A;  1LTG C;  5JPP A;  2KIK A;  5FW5 A;  1WMK A;  2B88 A;  3CNM A;  2P1J A;  4J9A A;  4EC6 A;  4I2L C;  1L0L E;  1MNL A;  5AVU B;  1STD A;  1AVL A;  4WVZ A;  1T6A A;  1Q40 B;  5A0O B;  5AW5 B;  1NO4 A;  3A0H E;  2YMY A;  3VMZ A;  1UDI I;  2R41 A;  3L72 G;  1A02 F;  2Q7C A;  4RKU J;  1BSN A;  5APX A;  1YIJ 3;  3NQY A;  1Q9E A;  2Q07 A;  1KQF B;  1NB5 I;  3EFF K;  3VTP C;  3MSO A;  1Y4K A;  1ZO2 A;  1X22 A;  2GSP A;  1T2K C;  1WMP A;  4N6U A;  5D82 A;  1PGP A;  5KTB A;  5CBN A;  4EBG A;  1RGE A;  1UI8 A;  1JCD A;  3J7Y d;  2AEF A;  3AE7 C;  1VQ9 3;  1YBK A;  3CCU P;  1J1E B;  2HPC B;  3KHU A;  5AVR B;  3KSP A;  1NTM E;  2V4H A;  3II6 A;  1FGO A;  2E5T A;  2KUB A;  3GAX A;  1O7H B;  3LH4 A;  1JO5 A;  3S67 A;  1VQ5 3;  1KB9 D;  2KF5 A;  3LTD A;  1SQP D;  2IUK A;  2B87 A;  3H1I D;  4WYK B;  1NTM J;  1P84 D;  2W56 A;  2MF7 A;  1A02 J;  1M56 D;  1SQV D;  1JY3 N;  1YHQ P;  2LKM A;  5CCH D;  3NUV A;  4FCM A;  1OAC A;  1EZV D;  3PXM A;  5LC7 A;  1BNE A;  5KP1 A;  5APS A;  1YTZ T;  2LYX A;  1ZP0 C;  1SQW A;  4HYT B;  2OQE A;  3D5I A;  4KFD A;  1JY3 P;  1I3F A;  1DX7 A;  4WY4 B;  2WPQ A;  3OWY A;  1VQL P;  3S5C A;  1CSB A;  1IT8 A;  4NRE A;  2E76 C;  1KYO I;  3MZW B;  1W2B O;  3H1K D;  4BIR A;  2KYV A;  2ML5 A;  1AVY A;  3NXS A;  4UB8 E;  1PL5 A;  2ZT9 C;  3G9R A;  2JDI H;  3VSY A;  3UB1 A;  5AVZ B;  1BRN L;  2IZ0 A;  2IFN A;  1GK6 A;  1EQ7 A;  3HUS C;  2RCD A;  2VRS A;  3CCU 3;  1W01 A;  2M8R A;  3OWU A;  1UCI A;  2FFD B;  1HGV A;  3MIW A;  3C8V A;  1QVG 2;  2ZHX B;  2OYI C;  4GB5 A;  1L2P A;  1GMR A;  5APT A;  3BNB A;  2Z4E A;  4W7Z A;  3AE8 C;  3GW6 A;  3LOY A;  1LGH B;  2Q3E A;  2OYH A;  3EFG A;  1G1J A;  2C4B A;  2FFD C;  4BWN A;  5AVT B;  2QEX 3;  1BVI A;  2LQV A;  1W6C A;  4H44 B;  3DGN A;  3KPE A;  5KLI B;  1IFI A;  1J2J B;  1WNH A;  2WQY C;  4DOJ A;  1UW1 A;  1GY5 A;  3G8Z A;  4HM4 B;  2P67 A;  5BVB A;  1X9V A;  4BTY A;  4C7R A;  3N7N A;  3VP9 A;  2Y0C A;  5CHX A;  3M91 A;  3JCU E;  4ZNC A;  1T8Z A;  3SYU A;  1JZO A;  2ZYA A;  3E7K A;  3ER7 A;  3BCC J;  2CPB A;  2XNX A;  1S1C X;  2JWD A;  1NTM K;  3I56 P;  3A0B H;  4G1M B;  1Y9B A;  1PPJ G;  3ECF A;  2XRX B;  3KKG A;  1I70 A;  3QRD A;  2FXP A;  3PJS K;  1BSB A;  1Q7Y 4;  3E1I A;  2ZXX A;  1FDI A;  3JSV C;  4IFM A;  3TGU D;  2Q5U A;  4WWI A;  1GL2 C;  1YGW A;  2ML6 A;  1BSE A;  3PGB A;  3DXO A;  2NPS B;  2ZVO B;  2HMM B;  2KSE A;  3D6Y A;  2D2C B;  2Y9Y A;  3JUP A;  2W27 A;  1RF1 C;  1BGY D;  2KNC A;  1IVX A;  3W67 A;  2NPS C;  2FYU G;  3H1H J;  2F4Y A;  1S5L H;  2W9P A;  1JY2 P;  2HG5 D;  1Q40 A;  3WUV A;  5GTI E;  1L0N D;  5DJU B;  2Q3I A;  2R32 A;  1IFN A;  2H88 C;  5AVW B;  1W2E A;  3SSU A;  3WDG B;  4YXD C;  1OW6 A;  1O7P B;  4PD4 I;  3V2Q A;  4IFD K;  3SED A;  1AV4 A;  2FGT A;  1Q7H A;  1SQX G;  3AE6 C;  4DCK A;  1DET A;  1IQY A;  1X1W A;  1BCC E;  4JQ0 D;  1EDL A;  2YFJ B;  1BSC A;  5AW0 B;  1EUI C;  3P7K A;  3ALA A;  3FXD A;  3MUD A;  1VL2 A;  1B2U A;  4WP5 A;  4K3A A;  1S2E A;  3GZB A;  1IK7 A;  1QX8 A;  1FBM A;  2YKQ A;  1N8R Q;  2KF3 A;  1YI2 P;  2RH0 A;  2O1K A;  3GG2 A;  3WOE B;  2YKO A;  1BAO A;  3IJE B;  1U5O A;  4PJ0 H;  5IF6 A;  3DGL A;  3LT9 A;  1RGL A;  1ZR4 A;  1W4N A;  1DVC A;  3VYI A;  3S9O A;  3RK3 E;  1NVO A;  2KRT A;  4J5G A;  5CCG C;  4GDO A;  1L0L G;  5EVH A;  3NXJ A;  1CI6 B;  1WMO A;  3CXH I;  4N6M A;  3C1L A;  3AE2 C;  1K73 Q;  1FE6 A;  4H0L B;  3JVC A;  5KKZ B;  1UUG B;  1BNJ A;  2E76 D;  5HOH A;  5KAF H;  3LML A;  4WY4 A;  1EQK A;  1S3J A;  2CH9 A;  4R80 A;  4HM2 B;  2HMK B;  3AGO A;  4H0L C;  4W80 A;  3TDG A;  3VP8 A;  4DKI A;  2ZT9 D;  3CCR P;  2UGI A;  2L4V A;  3S4R A;  1N7S B;  3Q3D A;  1L4A C;  3H1L E;  1KZU B;  2N9B A;  3ITK A;  4BRY B;  3Q3F A;  1RTU A;  4IPB A;  2KK7 A;  2WSE H;  4GHO A;  5DRE A;  2RGQ A;  1K41 A;  3L73 D;  3H1L J;  2IMJ A;  1MWR A;  3LTA A;  4LEH A;  4D6T E;  1ZS7 A;  2IA7 A;  3EJV A;  1GOV A;  3CNX A;  2XEP A;  2WTY A;  1NTZ G;  3GZY B;  2CWV A;  3FG3 A;  2RFR A;  1VQN 3;  4HM6 B;  1N73 B;  3GZX B;  1HWT C;  1JV2 B;  3L75 D;  2KSJ A;  1HH0 A;  1L5G B;  2O01 N;  4D6T J;  3V4W A;  3KN4 A;  3L74 G;  2CFL A;  1WTH A;  3FWN A;  3GHG A;  3PS8 A;  1VQ8 P;  3HIG A;  1SQB G;  1PP9 G;  1N7L A;  2JJL A;  1LT9 C;  1VQ6 P;  3B5N B;  2JKV A;  1W6Y A;  5IEP A;  4EW5 A;  2AEJ A;  2A15 A;  3HD7 A;  2BCC G;  2ZJS E;  3L70 G;  3KSE D;  1G0T A;  1OGZ A;  5AI1 A;  3D6Z A;  3CU3 A;  1B2M A;  1IZN B;  1FZA A;  1EC5 A;  1GL2 D;  3CCR 3;  3HII A;  4GSP A;  3PH0 A;  1X79 B;  1TUH A;  2P10 A;  4QWT A;  3L72 J;  3G4S P;  2ZYG A;  4HM8 B;  3L36 A;  4XFJ A;  2NPS D;  3MGN A;  2WSF H;  3CWB E;  1JMB A;  4MEI A;  3I5C A;  1NB3 I;  3OJA B;  4C7N B;  2H7H A;  1ROA A;  1ZW0 A;  3CC2 P;  2IDB A;  1IVU A;  1DMQ A;  4TT3 H;  1RE4 A;  1SFC D;  3IF4 A;  4BTW A;  2WMM A;  2Y73 A;  2OOV C;  2RKL A;  4UB6 E;  3EN8 A;  1GW4 A;  4EOT A;  1EXI A;  4L75 A;  4LMI A;  2QIW A;  1VQ8 3;  1H0T A;  2QJP B;  1RNT A;  5TJH A;  5STD A;  1R5L A;  5KJ7 C;  4A7P A;  4I6M C;  1S9K E;  1US1 A;  1BUJ A;  4RO0 A;  5BU5 A;  3EBY A;  3KQG A;  4K90 B;  1YTZ I;  3FWL A;  3ROB A;  1T3U A;  5ELJ A;  1L0L D;  2OTL P;  2J59 M;  2XND H;  5AW6 B;  1EDI A;  4EI2 A;  5D83 A;  1D6Z A;  4O2H A;  3H3H A;  1LTT C;  5IEO A;  1VZZ A;  1M90 4;  1KQS O;  2JO1 A;  3AE4 C;  1FDO A;  1NAF A;  3H32 A;  2HMO B;  1SQP G;  3H1I G;  4XBT A;  1YIT P;  1BUQ A;  2GBW B;  1G2C B;  1SQV G;  2CHC A;  3L75 E;  3Q5S A;  3KZI H;  4Y99 C;  4H0L D;  1EZV G;  1BNR A;  3CI9 A;  2YIU B;  1L4A D;  3AMO A;  5CJ0 A;  3B4O A;  1IFD A;  2YX9 A;  4MMZ B;  1M1J B;  1K05 A;  1M57 D;  1F8N A;  5KAF E;  1NTM D;  1FZG A;  2KXG A;  1U7M A;  4N6L A;  3CL3 D;  2YIU C;  3OW2 O;  1NKZ B;  1NU1 J;  1EEJ A;  1M1K 4;  3X3Z A;  1FOS F;  4EXR A;  4HVN A;  3F14 A;  3FG4 A;  1RF0 A;  1N2D C;  3K7C A;  2G8Y A;  3H1K G;  2PGD A;  9RNT A;  2OQE C;  1S72 P;  1MGW A;  1RE3 C;  4L73 A;  4YTP C;  1PFI A;  3RK3 C;  1U7J A;  2WSE J;  3F7X A;  1DE3 A;  1HVV A;  1S5A A;  2OTL 3;  1TFO A;  1LTA C;  4JF7 A;  5KLV E;  2Y0D A;  2CFD A;  3LYG A;  1FOS E;  2I8D A;  1YJW P;  1SQQ J;  3CX5 E;  2FYN B;  2IBZ D;  2KLV A;  1KWI A;  5KLV J;  4OVM A;  5B5E H;  2FXO A;  5CMZ A;  2OQQ A;  4L8O A;  1GMJ A;  3MHE A;  4CPK A;  2Q6Q A;  4LZI A;  1YIT 3;  3B5N A;  3CCL P;  4U3F E;  4CPG A;  4K61 A;  1JB2 A;  4AEQ A;  2RN0 A;  2JQ5 A;  1SVF A;  1VQ9 P;  4U3F J;  2SAR A;  5APV A;  1RH5 B;  4O9B A;  2JP3 A;  1KB9 I;  4N6J A;  3EF8 A;  3G6E P;  3DGY A;  1LP1 A;  3M06 A;  3CCQ 3;  1BAN A;  4KFE A;  1P84 I;  1GK4 A;  2HOD B;  2PRR A;  1LOY A;  5E79 H;  1OGX A;  2KI7 B;  1M9G A;  4LYL B;  2BEQ D;  5CF2 A;  1I2E A;  1EZV I;  4OVN F;  4I4K A;  2YMK A;  4EYY Q;  3GMA A;  1O7G B;  3EB8 A;  1B20 A;  4OGQ D;  3VMY A;  3K9M C;  3A5T A;  2KOG A;  1BRG A;  1FZF A;  3USS A;  4FMD A;  1S72 3;  4TLF A;  3TGU G;  2FXT A;  3OAK A;  1QVG O;  2FBW C;  3D71 A;  1RMS A;  2IYO A;  1UUV B;  1K9M 4;  4H13 D;  3M0D A;  5KP4 A;  3BCC D;  1DIP A;  2WSF J;  3FF0 A;  4X2O A;  2YFL B;  2WOH A;  1RGF A;  1BGY G;  2M5A A;  1PY3 A;  1N8R 4;  1LOW A;  1H89 A;  1JEK A;  1PYL A;  1YJW 3;  1KB9 H;  1NU1 K;  2I1J A;  1FZC A;  3PRJ A;  2W83 C;  2W8Z A;  2AEM A;  1YVS A;  5KJ7 D;  1EDK A;  2DW3 A;  1P84 H;  2Z5H A;  1K28 A;  3QK9 A;  4KT3 B;  1L0N G;  3TNU B;  2H43 A;  3IFM A;  1EKM A;  3CCL 3;  2MKV A;  1LWU B;  3CPW 2;  3CCV 3;  1IK9 A;  5AEU B;  3P8M C;  4FMB A;  3QH9 A;  5AVV B;  3HE4 B;  1K73 4;  3TSI A;  1LWU C;  1T3B A;  5CJ4 A;  4PV1 C;  3G6E 3;  2E74 C;  1OWA A;  1W7C A;  1SQQ K;  4EV2 A;  3ZG0 A;  2UUG C;  2QEX P;  3WR2 A;  2R3C A;  5KLV K;  3PCR A;  3B8L A;  1J1D C;  1NWQ A;  3L37 A;  3RDE A;  4ASV A;  1KSI A;  4KVH A;  5AVQ B;  3OV4 A;  2N1T A;  2B24 B;  3WMD A;  1GY6 A;  3MUD C;  2P38 A;  3GF7 A;  2E76 B;  4FCJ A;  2KP8 A;  2QA4 3;  5EFW B;  1GMP A;  1BCC D;  1TP6 A;  3KZI E;  1TTO A;  3TF5 A;  3BNC A;  3U97 A;  1M1J A;  2XR8 B;  2AXT E;  1JNQ A;  3AEF C;  3OX9 A;  1MFT A;  2IBZ E;  3K0Z A;  1NTZ J;  2ZT9 B;  3N4X A;  4NPD A;  3WMM 0;  5TIS H;  2RMZ A;  1OW8 A;  1M90 Q;  5DJT B;  5GTH H;  2NRG A;  2BHM A;  3HUS B;  1ZN5 A;  4RBN A;  1JCC A;  2ZVN B;  1B2Z A;  1TIJ A;  2A45 G;  3D9R A;  1TU5 A;  1ULJ B;  2PFX A;  1Q90 D;  3A2A A;  3EX9 A;  2OYI B;  1V57 A;  3HE5 A;  3NV0 B;  4WFO A;  3VOP A;  1HJ0 A;  1SQB J;  3RK3 D;  1W2Z A;  3BAS A;  1PP9 J;  2YFI B;  1TU3 F;  4Q53 A;  5CK6 A;  2BIR A;  3D79 A;  2CKF B;  3X3Y A;  2YNY A;  2BMQ B;  1RKY A;  2O1J A;  2FY8 A;  4KT0 J;  1N9E A;  3L73 G;  3FG1 A;  3JUO A;  1JOC A;  3L70 J;  5CF1 A;  4FMC A;  1DEB A;  2F5M A;  1VQ4 P;  4N78 E;  3MHV A;  2JWA A;  1M1K Q;  2WT7 A;  1KIL E;  3LT8 A;  3MWZ A;  1NTK E;  3L75 G;  3RL0 D;  4R9K A;  1KYO H;  1MFZ A;  1AY7 A;  1URQ A;  1OF5 A;  4R1K A;  1NTK J;  3H1L D;  2FNQ A;  1GD4 A;  2WO0 A;  1IVW A;  2H0H A;  1WRG A;  3BCC E;  3JUN A;  1ZRT E;  3T97 A;  1W00 A;  1RY3 A;  2OAR A;  3HTK A;  2W0Q A;  2BU4 A;  3FKA A;  2IX7 C;  5AII A;  3L71 E;  3H1J E;  4D6T D;  1ROV A;  1GL2 B;  1OHS A;  2BT3 A;  2A06 D;  4AQR D;  3GHG C;  3L71 J;  3G16 A;  1KMI Z;  3H1J J;  3SVA A;  2O3J A;  1FJP A;  1E5W A;  3NTN A;  2CFG A;  1RF1 B;  1AR0 A;  1QL1 A;  1CH0 A;  2UWJ E;  5CLK A;  5EQL A;  1JTH A;  3H1H E;  2C9N Y;  3CLQ A;  2R44 A;  3CPO A;  3N9H A;  2K37 A;  2CC3 A;  4XDV A;  4YXW H;  5AW2 B;  4BTX A;  2IPP A;  1LNH A;  4B86 A;  2HR3 A;  4KZ1 A;  2LXB A;  2WGQ A;  1DH3 A;  1NTZ K;  1B2S A;  1RHZ B;  3CC7 P;  1SFC B;  1LNI A;  1TRQ A;  1VQ4 3;  2E2T A;  1AFO A;  1CZQ A;  4U13 A;  3IAO A;  8CHO A;  3Q5P A;  1OHP A;  4CDL A;  3CD6 P;  1IVV A;  1SFC C;  2B9B A;  3HX8 A;  4HJG H;  5AEW B;  1QVF 2;  1SQB K;  3F9S A;  5D81 A;  2CG1 A;  3EN1 B;  4JPZ B;  3SWF A;  3Q5R A;  4PV1 D;  1SQP J;  1K9M Q;  2E74 D;  2HPC A;  1SJW A;  1RSN A;  1B2X A;  4K35 A; 
#chains in the Genus database with same CATH homology
 4HM8 B;  3F8H A;  2D42 A;  2F98 A;  3GZR A;  2BMR B;  2Z6B A;  3OWS A;  4N6O B;  1IU7 A;  4QMA A;  4MEI A;  4WYK A;  1ISK A;  1NB3 I;  2K0M A;  3PYJ A;  4FMA A;  1JN5 A;  4HKV B;  2CW9 A;  3VGN A;  1ROA A;  2O3O A;  3MG2 A;  5AIF A;  3I0Y A;  1FS0 E;  4RNY A;  1IVU A;  1OPY A;  1DMQ A;  4HBR A;  1OF5 B;  2RSX A;  3Q2P A;  2GU3 A;  1A2K A;  3HZP A;  1CYU A;  1FGQ A;  4BTW A;  1GYB A;  1TFK A;  2OOV C;  2Y73 A;  3EN8 A;  5ELU A;  1NO3 A;  2SBL A;  1VQP 3;  4LMI A;  3STD A;  4HJL B;  1Q81 4;  4J8T A;  3SOY A;  1W6G A;  1VQ8 3;  3PZW A;  1IFP A;  2XFS A;  5STD A;  4XB5 A;  3FF2 A;  3EQQ B;  1FUW A;  4IIA A;  1CYV A;  4AKZ A;  3CC7 3;  4K1V A;  1W5Z A;  3FCS B;  4L8P A;  4XM4 A;  1US1 A;  2GBX B;  1OH0 A;  1STF I;  3EBY A;  3UL6 A;  3WOF B;  2CFK A;  2XF3 A;  4N6V 0;  4K90 B;  1Q42 A;  3CD6 3;  3Q1C A;  3ROB A;  5AYR B;  1IQ8 A;  4EV5 A;  5ELJ A;  3CXC 2;  4HZB B;  5JPP A;  3G0K A;  2XND H;  5FW5 A;  4J9A A;  3FSD A;  3CNM A;  4EC6 A;  2QIY A;  1D6Z A;  4HM0 B;  5D83 A;  1YHQ 3;  3Q90 A;  1MNL A;  4O2H A;  3H3H A;  1STD A;  5IEO A;  1VZZ A;  1M90 4;  1IV9 A;  1IDP A;  1AVL A;  1PU4 A;  1K8A 4;  4WVZ A;  1SPU A;  1N9J A;  1Q40 B;  5A0O B;  2HMO B;  2V1L A;  4HM3 B;  3CCS 3;  1YJ9 3;  1DMN A;  3GWR A;  2C11 A;  3V92 A;  4XBT A;  1BUQ A;  2GBW B;  1VQO 3;  4R9L A;  1LOX A;  1BSN A;  3S29 A;  2CWT A;  1YIJ 3;  3NQY A;  1ULI B;  2CHC A;  1OCV A;  4K1U A;  2Q07 A;  1NB5 I;  3EFF K;  2I9W A;  3MSO A;  1YJN 3;  3NX0 A;  1Y4K A;  1ZO2 A;  1VQL 3;  3BLZ A;  1WMP A;  4N6U A;  5D82 A;  2GEY A;  5AYS C;  1JKG A;  5IER A;  3WOD G;  1DMM A;  3AMO A;  4JF8 A;  4EBG A;  3B4O A;  2YX9 A;  1UI8 A;  1A2V A;  4MMZ B;  1VQ7 3;  3J7Y d;  2ZL8 A;  1F8N A;  1IQX A;  2Z7A A;  1VQ9 3;  3H51 A;  3X40 A;  3JUQ A;  2OTJ 3;  4O02 B;  2KXG A;  3KSP A;  4N6L A;  1E3R A;  1G96 A;  1M1K 4;  1FGO A;  3X42 A;  2E5T A;  3X3Z A;  1Q86 4;  3GAX A;  4EXR A;  1O7H B;  3LH4 A;  3IPT A;  3N54 B;  4LGQ A;  3S67 A;  1VQ5 3;  1OUN A;  3F14 A;  3LTD A;  4HVN A;  3FG4 A;  4WWU C;  2IUK A;  4O8S A;  4ZM8 A;  3K7C A;  4WYK B;  3G71 3;  4RNZ A;  2W56 A;  5JBS A;  1V74 A;  1JN5 B;  1NWW A;  2MF7 A;  4NHF A;  4ORL A;  3SLU A;  3V98 A;  1GY7 A;  1QJG A;  2OQE C;  4FCM A;  3NUV A;  2HML B;  1FGR A;  1OAC A;  3UL5 A;  3FLJ A;  3DZL A;  3PXM A;  5LC7 A;  3LXU X;  1UUW B;  5TGN A;  5KP1 A;  1Q82 4;  2LYX A;  3F7X A;  1HKX A;  1S5A A;  2OTL 3;  1TFO A;  1W2B 2;  2P0M A;  2OCT A;  2W9Q A;  3T8U A;  1SQW A;  1N5H A;  1EG9 B;  2CFD A;  3LYG A;  2OQE A;  1T5Y A;  4KFD A;  3K63 A;  3BB9 A;  2WOF A;  1U8C B;  1KWI A;  2Y74 A;  4OVM A;  2F99 A;  3MYT A;  1NDO B;  3UNL A;  3N8B A;  6STD A;  1FGM A;  3OWY A;  2Z76 A;  4L8O A;  3S5C A;  3MHE A;  1IT8 A;  4NRE A;  3T8N A;  1YIT 3;  4K61 A;  1JB2 A;  1SII A;  2ML5 A;  1IK3 A;  1FGT A;  4AEQ A;  4OK0 A;  2CK3 H;  2JQ5 A;  1GD3 A;  2PZV A;  3JUM A;  3I56 3;  4H61 A;  3L0R A;  2JDI H;  1DVD A;  3VSY A;  1NJI 4;  2CIU A;  1IV7 A;  3UB1 A;  3EF8 A;  3K5T A;  4WHA A;  4N3V A;  2W6J H;  2RCD A;  3CCQ 3;  2QGU A;  4KFE A;  1QAL A;  2XSO B;  5JPU A;  3CCU 3;  3LZA A;  1W01 A;  3OWU A;  2XGN A;  1J2B A;  3RGA A;  2E2U A;  1QVG 2;  4AKY A;  4GB5 A;  1OGX A;  1M9G A;  4EYC A;  2M7O A;  5KP3 A;  3BNB A;  5CF2 A;  3LOY A;  2HMJ B;  1KD1 4;  4I4K A;  3V99 A;  3CME 3;  3EHC A;  1O7G B;  3EB8 A;  3OXA A;  3DY5 A;  2QEX 3;  4HM1 B;  3K9M C;  2LQV A;  1W6C A;  3EBT A;  3USS A;  2CWU A;  2O9U X;  3DGN A;  3E99 A;  4GL6 A;  5FGO A;  4FMD A;  1CQS A;  3NV0 A;  4PEJ A;  4TLF A;  2FXT A;  4FR9 A;  1S72 3;  4XDW A;  1WNH A;  1UUV B;  3AMO B;  4OUQ A;  1K9M 4;  1RRH A;  1UW1 A;  1YGE A;  1GY5 A;  3G8Z A;  3LTC A;  5KP4 A;  4HM4 B;  4L7K A;  3CC4 3;  1KC8 4;  2PNC A;  5BVB A;  3EC9 A;  4BTY A;  3FF0 A;  4X2O A;  2YFL B;  3D3L A;  2WOH A;  5I97 A;  1DYU A;  1N8R 4;  3CCM 3;  1JEK A;  1RRL A;  4MMY B;  1YJW 3;  2E5Y A;  3MG3 A;  1YVB I;  4HZ9 B;  2V7Q H;  4DJG A;  1IT7 A;  3ER7 A;  1QAF A;  1K28 A;  2STD A;  3QK9 A;  3VF1 A;  2W56 B;  2ZDJ A;  2MC8 A;  3DUK A;  2BNG A;  3MPH A;  1EKM A;  3CCL 3;  4G1M B;  2W04 A;  1A67 A;  3ECF A;  2XRX B;  3KKG A;  3QRD A;  3CPW 2;  3CCV 3;  2P05 A;  5AEU B;  3PJS K;  4FMB A;  1Q7Y 4;  3X41 A;  3FZW A;  1E79 H;  2GEX A;  3FGY A;  3T0U A;  3WA2 X;  1YI2 3;  1K73 4;  2ML6 A;  3S28 A;  3PGB A;  5AIH A;  3DXO A;  1ZX2 A;  3KFQ C;  3G6E 3;  2HMM B;  3EE1 A;  4R4K A;  1GS3 A;  1JRQ A;  3A76 A;  2INX A;  5IEN A;  1AQT A;  3JUP A;  4MMX B;  1W7C A;  4EV2 A;  1IVX A;  7STD A;  4N6N B;  3NBB A;  2WGO A;  3PCR A;  2WSS H;  2W9P A;  5CXO A;  3B8L A;  2B1X B;  1RJO A;  3F40 A;  3LTB A;  1Q40 A;  4X2H A;  2GU1 A;  3IMA B;  1R4C A;  2P09 A;  3RDE A;  3NQZ A;  1KSI A;  2Z77 A;  4IT7 A;  2XFT A;  4KVH A;  3OV4 A;  3WDG B;  3B7C A;  3F8X A;  1O7P B;  2B24 B;  5G2G A;  3WMD A;  1E3V A;  1GY6 A;  3MKI A;  4N6T A;  2P38 A;  4FCJ A;  4KFF A;  5IG3 A;  2BMO B;  3M8C A;  2QA4 3;  5HGR A;  3FH1 A;  3SED A;  1TP6 A;  1AV4 A;  5AIG A;  2FGT A;  3BNC A;  3RGR A;  3U97 A;  3B4P A;  2XR8 B;  1A90 A;  1JNQ A;  1IQY A;  2GXF A;  1JB4 A;  3OX9 A;  1O7M B;  2YFJ B;  3K0Z A;  3CCJ 3;  1MOL A;  3SX1 A;  1LVN A;  3ALA A;  1JB5 A;  2BHM A;  3UJM A;  3PCS A;  4WP5 A;  3CCE 3;  4RBN A;  1JJ2 2;  3D9R A;  3GZB A;  1TIJ A;  1O7W B;  1TU5 A;  1ULJ B;  1N5P A;  4HYZ A;  2KCD A;  3WOE B;  3KE7 A;  3EX9 A;  3IJE B;  1U5O A;  3NV0 B;  5IF6 A;  4WFO A;  2P0X A;  3DGL A;  4XBX A;  1W2Z A;  3LT9 A;  1VQM 3;  4FCZ A;  1W4N A;  2YFI B;  1DVC A;  4Q53 A;  1D6Y A;  2R4I A;  5CK6 A;  2K54 A;  2KRT A;  2OWP A;  3SXX A;  5EVH A;  2CKF B;  2HMN B;  3X3Y A;  3NXJ A;  3CMA 3;  2BMQ B;  1RKY A;  1WMO A;  1C7H A;  1N9E A;  3NM2 A;  3NBR A;  3FG1 A;  3JUO A;  4N6M A;  5CF1 A;  4FMC A;  3NHX A;  1NU3 A;  5LC6 A;  3JVC A;  1VQK 3;  3BNE A;  3X3X A;  1VQ6 3;  3LT8 A;  3HK4 A;  1Z1S A;  1M1X B;  3MWZ A;  1UI7 A;  3LML A;  2OOV A;  1EQK A;  1JKG B;  2CH9 A;  1QMA A;  4HM2 B;  4R9K A;  3DGM A;  4R80 A;  2HMK B;  1BSH A;  3TDG A;  1RN7 A;  1OF5 A;  2F86 B;  4R1K A;  3MG1 A;  1KQS 2;  2L4V A;  3DGO A;  2FNQ A;  4LSO A;  1GD4 A;  1LXE A;  2WO0 A;  1IVW A;  4TX4 A;  1HU9 A;  3JUN A;  5IG5 A;  3I55 3;  3DM8 A;  3NBJ A;  2CFW A;  4IPB A;  2UX0 A;  4HM5 B;  4O3V A;  1ASK A;  1W00 A;  2E2V A;  2W0Q A;  4H3U A;  5DRE A;  1EA2 A;  2RGQ A;  3FKA A;  1K41 A;  1O7N B;  5AII A;  3NM7 A;  2IMJ A;  1WMN A;  1FA3 A;  4JRF A;  2IUJ A;  1ROV A;  3LTA A;  1OHS A;  2BT3 A;  2BO9 B;  4LEH A;  2IA7 A;  3GRD A;  3EJV A;  2XH9 A;  3G4S 3;  3CNX A;  2XEP A;  3G16 A;  1W02 A;  3GZY B;  2CWV A;  3FG3 A;  2RFR A;  4STD A;  3SVA A;  4CCV A;  4HM6 B;  1VQN 3;  3GZX B;  1JV2 B;  2CFG A;  2D1W A;  1PFP A;  1L5G B;  1AR0 A;  5IG0 A;  4RZM A;  3KN4 A;  5CLK A;  5EQL A;  3KII A;  3O8Y A;  3OW2 2;  2CFL A;  3F7S A;  1WTH A;  3CC2 3;  3CPO A;  3N9H A;  1N8Q A;  2CC3 A;  3KZT A;  3WA3 A;  4XDV A;  3PS8 A;  4YXW H;  4MJD A;  3HIG A;  5IW9 A;  4BTX A;  1LNH A;  4KZ1 A;  2CG0 A;  1QAK A;  3S27 A;  2WGQ A;  1W6Y A;  5IEP A;  1CEW I;  1VQ4 3;  2A15 A;  2E2T A;  4HM7 B;  3SOA A;  2W2C A;  1SIH A;  3KSE D;  2XGL A;  4U13 A;  8CHO A;  1OHP A;  1OGZ A;  5AI1 A;  4CDL A;  1IVV A;  1AVK A;  3CU3 A;  3HX8 A;  5IG4 A;  1D6U A;  5AEW B;  1QVF 2;  1E97 A;  3BND A;  3F9S A;  5D81 A;  2CG1 A;  3CCR 3;  3EN1 B;  3HII A;  5BXQ A;  2QE7 H;  1WQL B;  3HI7 A;  4XBY A;  5EEO A;  1TUH A;  3DMC A;  5DRV A;  2W03 A;  1SJW A;  2XSH B;  1OHO A;  4QWT A;  3U1W A;  4LZI A;  2C10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...