2CK3H

Azide inhibited bovine f1-atpase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
b'SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title How Azide Inhibits ATP Hydrolysis by the F-Atpases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2ck3H02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ck3H01
1IFPA 3PJSK 4WVZA 2WSSH 1E79H 1AQTA 2CK3H 2JDIH 1JEKA 1FS0E 3EFFK 2E5TA 4YXWH 4QMAA 1BSHA 4DJGA 2E5YA 2W6JH 2XNDH 2V7QH 2QE7H 4TLFA 3USSA 1BSNA
chains in the Genus database with same CATH superfamily
4XA4A 4Y28J 5E79E 3GZYB 1EKMA 2YMKA 3CCL3 1NTME 4B86A 2CIUA 1SQPK 4UB6E 2ZT9C 2PZVA 4K3AA 2ZT9B 4AKZA 2P0MA 1DETA 2W04A 1BDCA 1MWUA 4CJNA 2WO0A 2PAJA 1JZDA 2QE7H 1MFZA 4J5GA 2OTLP 4NPEA 3G0KA 1O7MB 3CCM3 1UIXA 1WMKA 1VQNP 1LTIC 1HZ1A 1V74A 1VDFA 3P7KA 3L71E 5TISE 1KILB 3RNTA 4W7ZA 2KZJA 3WOFB 4BTXA 5A0OB 1AQZA 2H43A 3V98A 3M8CA 4RNYA 2JKVA 1VQL3 1SQBK 1RN1A 3DXOA 1A2KA 2CC3A 2L91A 4PEJA 1S5LH 2KOGA 4EIJA 1BGYD 4HM7B 2FYUJ 3OJAB 1WMPA 5CF2A 4NREA 2YNYA 2WSEH 1LNIA 4WY4D 1RDSA 3VMXA 2INXA 1M8OB 3TDGA 2W6JH 1I2FA 5IW9A 1OZHA 1YJWP 3HIIA 3WMM0 1Q90D 3BVHA 3K5BA 2CFKA 3EX9A 4D6TE 1YBKA 3ALAA 2WSCH 2BT3A 5CK6A 2OARA 1FOSE 5LC7A 1N86A 2QVAA 1JCCA 4GOFA 4EI2A 3S27A 1JO5A 1VQPP 1V58A 1ZLLA 3RBXA 2QJPC 4H0LD 3P8CE 1SQQE 1OW8A 4HJGH 1P84I 2QJPB 1IT8A 1YJN3 3W68A 1UI7A 2CFGA 4AUWA 4LYLB 2A15A 1U7JA 3L75E 3DH2A 3L74D 1Q81Q 3F89A 2D1WA 3VTPC 3TNUB 3U1AA 2XU6A 1T3JA 1M1XB 3HE5B 4GODA 2ZYAA 4DT0A 1RF1A 3X3ZA 5B66H 2KUBA 2ZJSE 1I3IA 3V2QA 3EC9A 3QWOC 1LTBC 3HE4A 2IUJA 1CI6B 3KZTA 1H88A 1G1IA 3DGOA 1YI2P 2IYJA 3CNXA 3CCS3 1LP1B 2YIUB 3VMAA 3WUUA 1RY3A 1GK4A 1NJI4 5IG5A 1IFMA 1SLQA 3H51A 2HMMB 5AW9B 3CC4P 1Q2NA 2L5GB 3UJMA 3RL0g 1KILE 1URQA 3JSVC 1JTHA 3L73G 2LQVA 5KAFE 2WOHA 2QG4A 1NTMD 1AFOA 1NTKK 3LT9A 2R5DA 3CL3D 1T3BA 4XB5A 2F99A 3ABVC 3JCUH 1MGRA 1LGHB 1LTTC 2HR3A 4GIFA 3ZG0A 1PZQA 1LT9B 1UIIA 3KN4A 1TP6A 2RCDA 2BMQB 4GDOA 4G1MB 2IY2A 1KQFB 2CWUA 1LXEA 1RRHA 2LXCB 2B24B 1O7PB 3L71D 1X1UA 2P38A 2Q3IA 3C8VA 3V2RA 3BB9A 3JUOA 4L8OA 3B7CA 1JNMA 1KYOE 3MIWA 1FJPA 1XTGB 2AXCA 1Q42A 2ZVOB 4H13C 1KFMA 1U57A 3X42A 2WPSA 3MG2A 4I6MC 5L8RJ 2RN0A 4AKYA 2L1SA 1UCJA 2V7QJ 3L74J 1BSAA 1ZRTE 2KNCB 2IPPA 3T8UA 5AW0B 1ZS7A 3SOYA 5DJUB 3USSA 4R9KA 1BSNA 1A02F 3H1JJ 5IG0A 3F7XA 1T2KD 4H3UA 2E2UA 4FCJA 2ML5A 3DGYA 5APVA 3DY5A 1NKNA 1G0TA 5AIFA 1L0LJ 2KXGA 4RZMA 2XFTA 3EBTA 1BNEA 3B4OA 4ASVA 1XTCC 2K9YA 3CX5E 1T5YA 2XGLA 1KSIA 2W6BA 4Y99B 4C7NA 1IQYA 4U3FG 4K90B 2CX1A 4NPDA 1AQTA 4KVHA 2KI7B 3LT8A 3L75D 2HPCB 5B5EH 4MMXB 1ZX2A 4HM1B 2W9PA 1JNQA 1NTMJ 2B9BA 3IPTA 2P2UA 1X9VA 1RE3C 1RSNA 3I553 1MFTA 3CD63 4I7ZC 1HF9A 1IU7A 1M57D 3LMLA 4RO0A 4I7ZB 4TLFA 1QLED 3AECC 2Z6BA 4ZNCA 2O01J 1RCLA 1NB5I 2H88C 2RSXA 2JP3A 2NRGA 2HMJB 4IL6E 1G02A 4C46A 1L0NJ 3M0AA 1EEJA 1B3SA 1JY2O 3H1LG 3HI7A 2MC8A 2WGOA 4N6V0 2KB7P 3L71J 2K3DA 3D6ZA 3MHEA 2E5YA 1AV4A 2C11A 1NTZK 1BNJA 1NH4A 4W80A 4HAAA 4HM0B 3KYQA 1KILD 3A5TA 1EDLA 1BCCG 1JB5A 2KSEA 5APSA 3MG1A 1SFCC 4HJLB 3HE5A 2W90A 1SFCB 1KB9H 2ZYGA 1SVFA 1JY2P 1QX8A 1DIPA 1WNHA 2O1JA 2J8XB 2IUKA 2HMLB 4HYTB 2O3OA 3X40A 1CI6A 3L73E 2ZA4A 1NU1G 3A0BH 1RE4C 4YPCA 1AV1A 4YTPC 4AQRD 1PY3A 1LP1A 3M0DC 1A2PA 5JPUA 4H44B 3JUMA 3NMDA 4HM4B 4XBYA 1S5AA 1FUSA 1NB3I 4N6TA 4OH8B 5GTHE 4D6TJ 1MGWA 2OWPA 1I70A 4OVNF 1W6CA 4TX4A 3M9BA 1KYOD 3VOPA 4NHFA 3RK2C 5APXA 3PH0A 2PFXA 1TU5A 1K04A 4BTYA 5HOHA 3RK2B 1IK7A 1DD4A 1SQQJ 3SWYA 2IBZG 2GUSA 1CEWI 3PTZA 1YGWA 3TK1A 1WTHA 5BVBA 2CW9A 4TT3H 1JM0A 3L75J 2BNGA 5G2GA 3VGNA 3CXHH 5AVUB 3T0UA 3D71A 2FYZA 1U5OA 1IFIA 4FMBA 3MHVA 3LTCA 1LQGC 2R41A 2WWWA 1IV7A 1RGAA 3CU3A 4WY4C 2OTJP 4L76A 1S1CX 3L4FA 1GMPA 7GSPA 2GBXB 3MSOA 2Y9ZA 3CX5D 1FZFA 1ZW0A 2QEX3 1STDA 4W7YA 1SIIA 4RNZA 2XSOB 3IF4A 1HGVA 1BSHA 4O02B 1EC5A 1FGRA 4FR9A 4LGDE 4WYKB 3ZFZA 3SWKA 1NJIQ 1G2CA 2JR8A 1FZCC 2G8YA 4H0LC 1MKMA 1FZCB 2GU3A 4IOIH 1R5LA 4H0LB 1Y8AA 2AEJA 3H1IG 3H1HE 5KAIE 3CCQ3 1DH3A 4LMIA 5DREA 3GRDA 2Q5UA 3B8EB 3CCEP 3CWBG 5FW5A 2XSHB 4U3FE 1KB9I 3JUQA 1DYUA 3SX1A 4EV2A 4PJ0H 3BNEA 1S9KE 1A90A 3B5NB 1N5PA 1VQ5P 1GY5A 4KT0J 3E1RA 3BCCD 3CCRP 2M3EA 3E99A 3N54B 2Q6QA 1BSBA 3EB8A 1OF5B 4NPBA 3G71P 3EQQB 2VRSA 1PV3A 3L37A 1RQVA 2OQEC 1FGTA 4STDA 2AXTE 3WMDA 1VF5D 2HPCA 4EV5A 2W27A 3CC23 3I5CA 1LNQA 2LKMA 2KF6A 1VQ63 1DVCA 1EZVG 1AR0A 3H1LE 4L8PA 1RE3A 2P58A 1GMQA 4X2OA 1NYHA 1OWAA 3CXHI 1S72P 3L73D 1F8NA 1BCCE 1PGOA 3G8ZA 4I2LC 3MKIA 6RNTA 1VQM3 4EYCA 2AADA 3MG3A 3A0HH 3AEGC 2UWJE 2F56A 4XBTA 4HOHA 3MGNA 2E2TA 3MYTA 1SPUA 3VSYA 1U7MA 3FLJA 1ULIB 4MMYB 3CCJP 5C39A 1U8CB 1NU1E 2XFSA 1STFI 1SFCA 5FGOA 1Z56A 2Y9YA 3X3XA 1SP4A 3SEDA 3CCVP 2W0QA 2DW3A 4FCMA 1PIXA 1MV8A 4JBZA 3AE5C 2K88A 2P05A 3K63A 6STDA 1YYCA 1M1JC 2YO2A 1NOHA 4DCKA 3BNBA 2Z4EA 4K1VA 1M1JB 4WBAA 2XR8B 2KF4A 1W2EA 1N5HA 1ZP0C 2R4IA 2OTL3 1Y4KA 3II6A 1N7SD 2YO3A 3M0DA 2IBZE 2FYUD 2CH9A 1VQN3 3AEBC 3M9HA 3CMEP 1T2KC 1SQWA 4R4LA 1AVLA 1IYYA 1DEBA 1W2B2 2MF7A 3H1JE 4L73A 3F40A 2KK7A 2JWAA 2K3RA 3L36A 3GSPA 1UUWB 3C9IA 2M0BA 3M9QA 1BNGA 1WRGA 2I1KA 3T97B 2K9JB 1QGKB 3F8XA 4N3VA 1AVOA 3GHGB 2R5BA 1KN7A 3H1HD 3IJEB 2FYUK 3CPW2 1FOSF 1DMMA 4U3FD 1RGLA 3V92A 3PYJA 1RGHA 4XE5B 3LH4A 1SFCD 3OA7A 4KFFA 1GMRA 2L4VA 1YJW3 5TGNA 2QRXA 3H25A 4WVZA 1VQKP 3S4RA 3L73J 3TGUG 1MWRA 2FXMA 1UI8A 3H1IE 4RBNA 1BNSA 4UB8E 4WYKA 5D82A 5AYRB 3CWBE 1GOYA 1KQS2 2WTYA 3ZDMA 1VQP3 2B87A 1AVKA 3GLMA 5TISH 3AMOB 2P09A 4H44D 1K05A 3RGAA 1IQXA 2D2CD 1FZCA 1HJ0A 3CC7P 2BU4A 5ELUA 2OQQA 4ORLA 3D70A 3AE4C 2WZ7A 2QSIA 3PRJA 1L0NE 1DX7A 4KT3B 1SJWA 3NTNA 3H1LD 4R4KA 1KILC 3RBZA 1IZNB 1NNVA 3RK2D 4IIAA 3B5NA 2I1JA 5CBOA 1D6UA 3CCUP 3KFQC 1GU4A 4GT1A 1QAFA 3X41A 1BCCD 3EHCA 1BE3G 5IENA 4ILFA 3E1IA 2AEMA 2H0IA 1FUWA 1EZVE 1NVOA 2FFDB 3CLQA 1GW4A 2OQEA 3RGRA 2H89C 1BSEA 2PNCA 4JF8A 1YI23 2FNQA 3NX0A 5KTBA 3S28A 1KQLA 2OOVA 1X1WA 3OX9A 2J59M 4XDVA 3KQGA 5IG3A 1BGSA 1VQ7P 1QEXA 4N3YB 3WA2X 3CC43 2W2CA 3AEDC 2E75D 3H1KG 3SWFA 5KJ7A 1E5WA 5M19A 1PU4A 3OV4A 1BDDA 1MZ9A 2IX7C 3EJVA 4I5QA 1AQ5A 1N73B 2O01N 1QVF2 2RGQA 4JQ0D 1JY3N 1EDJA 4FMAA 3H1HJ 2Z5IA 1VQ8P 2K0MA 1HUCA 4R9LA 4GL6A 3RK3E 4IFDK 4U3FJ 1FJKA 3AE8C 2GEXA 4O8SA 4HZ9B 4LGQA 3DGMA 1M9GA 3SYUA 1EUIC 1QVG2 5AVYB 1W4NA 1GOUA 1Y47A 3B5ND 2I9WA 3G6EP 3HUSC 2I8DA 1NO4A 3H1JD 1PGJA 2Y74A 2HLOA 2NZ2A 9RNTA 3HUSB 2YKQA 1BOXA 1MWSA 1WQLB 5TJHA 1JB4A 1KWIA 2WGQA 3IFMA 4ZM8A 2ZVNB 5KLVG 1L0LD 1OGXA 3OW2O 2OCTA 1MNLA 3ER7A 3ITKA 4GKGA 3UL5A 1M1JA 2W56A 1C54A 2HMNB 1HU9A 1YJ9P 3GWRA 1M7LA 2H8PD 3BRVB 5STDA 2R3CA 1J1EB 3D3LA 3SFEC 3H1LJ 2KRTA 4J8TA 1OW7A 2YIUC 4MN4C 4YXDC 1ZOYC 2QJYB 5AVXB 1KQGB 1DEEG 2A06G 1RKYA 1WMOA 1GY7A 3CPOA 5KJ7D 3FXEA 3FGAD 1BCCJ 2PRRA 1HWTC 4EBGA 1W02A 3Q3FA 4HKVB 2NPSD 2JO1A 1OVUA 2R32A 4LC1A 1V57A 1B27A 3S29A 4FMDA 1L0LK 2ZXXA 1ZV8A 2XF3A 5EFWB 1LT9C 2Y0CA 3WU2H 3T97A 5CJ4A 2WSSH 1JKGA 2K9JA 2FBWC 5B66E 2UX0A 1UUVB 3GHGA 2KP8A 1EDKA 1YHQP 3D5IA 1KYOH 3TGUE 1ASKA 1S4XA 1NU1J 1VF5C 1L0ND 2P7JA 3B71A 2KS1B 5CCHD 1VF5B 5G1LA 3CI9A 3NQYA 3JUPA 1LTJB 3TSIA 1JOCA 3FF0A 3MZWB 3EQ2A 4CPGA 1NTMK 1PP9G 1J2JB 2E74D 3D4AA 1RGEA 1HBWA 2M7OA 3MTUE 1T6AA 3FKAA 4KFEA 1S3JA 1W00A 1SQXG 4O9BA 3AMOA 1JUNA 3NBJA 5JBSA 4PV1D 5AVQB 4MJDA 1OW6A 2YKPA 1L0NK 2IMJA 2E76B 3KXDA 3L70G 4N6MA 1BE3E 3A3YB 3CX5H 1GL2B 3FGYA 2C4BA 3EN1B 1FZBA 3AE2C 3O8YA 1JN5B 2F98A 1KILA 3CXC2 4HM3B 1TFOA 4D6TD 3FCSB 3M06A 1R8EA 1YITP 3A76A 1LOYA 3FZWA 4Y99C 1GS3A 3NBRA 4WHAA 2FFDA 1FZUA 1KC84 3L72G 2V4HA 3RK3D 3P8CD 1SQQD 3H1KE 1SQPG 5KLIB 3AHSA 2KSJA 2KYVA 3AE1C 1N7SC 2YFLB 1USDA 3WOEB 2Q07A 1B21A 1N7SB 3H1IJ 1HGZA 4IL6H 2WPQA 3M91A 3OAKA 1BAOA 1OGZA 3CWBJ 2LR2A 2PP6A 1RMSA 1DE3A 2Q7CA 3NQZA 2Z7AA 1PGPA 3JVCA 1Q7Y4 3BU4A 3GW6A 3EWKA 3EE1A 1KYOI 4HB1A 3QK9A 1SQQK 1I8VA 1JRQA 1IFJA 1HVVA 3A7OA 1SQBG 2IYOA 5AVZB 2BMOB 1CZQA 5CHXA 5EQLA 3AE3C 1X22A 2A45H 2JWDA 5KLVE 5B5EE 1NWQA 1YTZI 3VYIA 1GD4A 1UCIA 2OTJ3 5BU8B 1CH0A 4Z1MH 2Y0EA 3TNUA 2K54A 3HUSA 1H0TB 5CF1A 3GZXB 1I2EA 3VN0A 3Q90A 4EC6A 2XEPA 2P10A 3FG3A 4N6UA 1FW7A 2OYOA 1R4CA 5GTHH 3TF5A 2A06E 1BUJA 1TTOA 5G1KA 1UUGB 3TGUD 3G3ZA 3JUNA 1FU1A 2CWVA 3NXJA 5AEUB 3CX5I 3FX0A 2QJKB 1GD2E 4H44C 2MKVA 1Q9EA 2D2CC 1BGYG 5IEOA 4WFOA 2D2CB 1Q7HA 1FS0E 2E43A 1SQVG 3CCE3 1EXIA 3H32B 4Q53A 5BIRA 3FF2A 1E97A 2M3BA 2FGTA 1VQ53 2BHMA 2POHA 1BSDA 1UCKA 1KB9E 2C0WA 1FDMA 3CCR3 5IF6A 1LT9A 3KCHA 3G713 1M1K4 1FZEA 1VQOP 2WSEJ 3IR9A 1PP9E 1ZRTD 3GF7A 1UCLA 4GSPA 3Q2YA 1HKXA 2BO9B 3HOHA 3TDKA 1A2VA 4H61A 2KS1A 4HZBB 1S5LX 2W83C 4LZIA 5RNTA 4MMZB 1LTJA 2Q9IA 1SQXE 1YIJP 3N9HA 5KP1A 2F4YA 1QL1A 3LTAA 2E75C 2AAEA 2E75B 2HYNA 1TU3F 5CMZA 4PD4E 2KF3A 2FXOA 3L70E 5KAIH 2RMZA 1FGOA 2E5TA 1KTMA 1JV2B 3C1LA 1KMIZ 1OUNA 3OXAA 1N9EA 1NTKG 1S723 3UIAA 1GYBA 2CWTA 2GU1A 2KLVA 5AW7B 5K5GB 4WP5A 2A45I 1LT1A 4JPZB 2KNCA 2HMKB 3K9MC 3PS8A 3ROBA 3FXDA 3KZIH 4HKZH 1YNVX 5GTIH 1W2BO 4K1UA 4N78E 4X2HA 2GEYA 5EEOA 1G1JA 1JN5A 3L72E 2QIWA 4J5KA 4JRFA 5APTA 1WMNA 1Q864 3CCJ3 1SQPE 5AVWB 3B5NC 5AEWB 2O3JA 3Q5SA 2HOHA 2AXTH 1BANA 3NXSA 3WODG 1YVBI 2YKOA 5IEPA 4IFMA 1PGQA 1FZGA 3CCV3 1JBTA 3MUDC 3TGUJ 2JEEA 3W67A 3G16A 5H2FH 3I0YA 5BU4A 1G96A 4HM6B 2O1KA 1PPJG 5AYSC 2GSPA 4BL2A 3NHXA 2Y73A 1ZO2A 3SFDC 3AE7C 2OOVC 2QGUA 4M3LA 1OHPA 3BNCA 1N7SA 2UGIA 3CME3 1OIPA 2Y0DA 1I3FA 2OYHC 2E2VA 1T3UA 5KP4A 5KJ7C 2OYHB 4XBXA 1SQBE 3STDA 1KQSO 2FXTA 1BIRA 2CG1A 1YGEA 2NPSC 3MPHA 1IV9A 2NPSB 2D42A 1FE6A 2GXFA 5D81A 1BE3J 2O9UX 1IJDB 4RNTA 3NUVA 1OVVA 5KP3A 2E76D 3IMAB 3V5BA 1GL2D 1IT7A 4RJTA 1N9JA 3HD7D 5AIIA 1VQ9P 1JB2A 5CCHC 3PZWA 1O7HB 1VPCA 1N8QA 1JBRA 1H0TA 3D6YA 2FYNC 3PCRA 3Q1CA 1KC8Q 3LIEA 1VQK3 2N1TC 2FYNB 3KDPB 2XV5A 3H1KJ 2E74C 8CHOA 1BGYE 2N1TB 1JB0J 4EXRA 2E74B 5ELJA 4EDFA 4GB5A 1JJ22 1SQVE 2UUGC 1KFNA 2V7QH 1RHZB 1PP9D 3FH1A 2XZRA 4BWNA 4L7KA 2STDA 3I56P 1HTLC 3MWZA 3BASA 1IFNA 3G4SP 4PV1C 1MUUA 1FA3A 3CC73 4ZKPA 2YX9A 4EW5A 3O6QB 3A0HE 4PV1B 3OWUA 1NDOB 1QJGA 1ROAA 3HX8A 3LZAA 3DM8A 3O8ZA 2N9YB 3KKGA 3WUTA 1Q7YQ 1UGHI 1GMJA 1NTZG 4PD4D 4ZMDA 4N6NB 1B2XA 1VQQA 3QRDA 1IDPA 3L70D 3AGOA 2WSFJ 3LW5J 2M8RA 4JYBA 5APUA 3RL0B 6GSPA 1QAKA 5CCGA 2RNTA 2QA4P 1IFPA 2HODB 3GZBA 3NFQA 1L2PA 5KKZB 2CK3H 4OGQB 3GHGC 5KLVJ 4CPKA 3BNDA 1QVGO 1OACA 3RK3C 4KJMA 3OWSA 5E79H 1RGFA 1Q824 3RK3B 1JTHB 1B2ZA 2CX0A 4N78D 4UB6H 1O7NB 1BNRA 3L72D 3AEEC 1NAYA 4UB8H 3LTDA 1NTKE 1VQ73 4K35A 2BCCG 1RF0C 5AW3B 1S9KD 1TRQA 2O01H 1L4AD 2WPVB 2J58A 4XM4A 1K734 3CMAP 3VF1A 1N8R4 2XGNA 3IAOA 3GG2A 1VQ83 3R4YA 2XNXA 4XFJA 3MP7B 1ZR4A 1PL5A 1X8YA 2HMOB 3UNLA 3V99A 5GSPA 5CBNA 1CYUA 3LXUX 1P84E 3G6E3 1SQBD 1PPJE 3V2PA 2IBZI 2LXBA 4QMAA 3WA3A 1SARA 3GAXA 1M1KQ 1HH0A 5CCGD 4HM2B 1PP9J 2OGUA 1LTSC 1B20A 4GOEA 4DKIA 1TUHA 4I4KA 3UL6A 5EVHA 3KHUA 3MUDA 1OHOA 1JMBA 2FFDC 3BATA 5AVVB 1OF5A 3VMZA 4HYZA 3PJSK 1KORA 1YJ93 3NV0B 1SQXJ 2LYXA 2B89A 2OTKE 2WQYC 1QL2A 1GZLA 1DMNA 1IK9A 3CNMA 4KHXA 3L70J 3S5CA 1GD3A 1NU1D 4GHOA 4KFDA 2OYHA 4CDLA 1B2SA 1KZUB 3RDEA 5AI1A 1N73C 4C7NB 3PHLA 1RGGA 1FZAA 4HM8B 3P32A 2XH9A 1SQVD 5M1BA 1BRGA 1USEA 2NPSA 1US1A 1BNIA 1IVUA 2H0GA 2F5MA 1YQ4C 1YHQ3 3L72J 1S5LE 2C9NY 3EN8A 1O7WB 1UW1A 1Q86Q 4K61A 2IBZD 1SQPJ 1VQ4P 3AGNA 4O2HA 7RNTA 1ZGXA 2ITAA 1QALA 1OCVA 3GF3A 4U7JA 3CCLP 4OWFA 2AEFA 2ZXEB 1NU1K 3S9OA 5CCHA 1E79H 5JPPA 4BRYB 2P0XA 2ZYDA 2IFNA 3H3HA 2YXQB 2ZFCA 2N1TA 1YQ3C 1SQVK 1OXZA 1FC2C 4N6OB 3HZPA 3CCMP 3GMAA 3MD0A 2XNDH 1RGCA 1CQSA 1NTZE 3HTKB 5LC6A 3BCCG 5KAFH 1J1EC 3LIDA 2RKLA 2XRXB 1FDOA 1K9M4 3O6QA 1H89A 1PFIA 4BIRA 1DD3A 1NO3A 1EZVI 2QJYC 2BASA 3HIGA 1SQBJ 1NTKD 3L0RA 1LWUC 3EFFK 1I2GA 4RESB 2JQ5A 3NM2A 1CYVA 4RKUJ 1VQLP 1LWUB 3FWNA 4N6JA 1JY2N 1IVVA 1HYFA 1N7LA 2KXPB 1FBMA 1I0XA 3U1CA 3H1ID 2H0HA 3N8BA 1S2EA 1LTGC 2CFLA 4FCZA 1YIT3 1ISKA 1RNBA 2FY8A 2HODA 1EG9B 1GOVA 3CWBD 1W7CA 2BCCE 2A45G 3DGLA 2CFWA 3L35A 2IDBA 3G9RA 3ECFA 3HRNA 2R44A 1BU4A 2JJLA 1NU3A 2N9BA 3F14A 4CCVA 1X1YA 1LTJC 1P84D 1HJBA 1BUQA 1BGYJ 2HG5D 3IN6A 1PPJD 3V4WA 3U1WA 1BRNL 3SXXA 3Q2PA 1RF0A 1SQVJ 2ML6A 2N1TD 3DZLA 1JCDA 3VMYA 1FGMA 2JDIH 2CPBA 2RBIA 2CPSA 1LOXA 4DZOA 1OMIA 7STDA 1YJNP 1EZVD 3K0ZA 1KV4A 1DVDA 3JCUE 3WU2E 1RTUA 2K37A 5BVZA 2CKFB 1FDIA 2KLUA 1BRKA 3TYYA 2WT7B 2E76C 3Q5RA 2IYPA 3AE6C 4BU4A 3X3YA 3SVAA 1GL2C 5AW4B 1W01A 1NHLA 3HD7C 1RRLA 3HD7B 1ZR2A 2H7HA 4ASWA 3FSDA 5APWA 3B4SA 2FYUG 3ZG5A 3RL0D 4H13B 1RQUA 2XKMA 1M904 2Q3EA 3VP8A 3LTBA 5CXOA 1G2CB 3OWYA 4R1KA 2W8ZA 3T8NA 1M56D 4OGQD 1Q82Q 1FUTA 1KD14 1EXJA 3CCSP 5AVTB 1URQD 4JYCA 3JC22 1L5GB 1NTKJ 1JY3O 3NV0A 2YXRB 5KLIC 2J5UA 2KAAA 1DMQA 3SSUA 1OHSA 3B8LA 2OYIC 3F8HA 4IPBA 3LYGA 4HM5B 5AW5B 2ZHXB 2OYIB 2GUVA 4WB4A 2WOFA 5BXQA 1ZXGA 3F5HA 3H1HG 3DGNA 1K28A 1K73Q 1LNHA 1N8RQ 3R2PA 2WSFH 3LW5H 1JZOA 4HBRA 1W5ZA 4EYYQ 1WT6A 2QM7A 3NM7A 4IT7A 4OVMA 1N73A 1RN7A 2V1LA 1GU5A 3OW22 1JY3P 1O7GB 2QIYA 2KIKA 1C7HA 1NTZD 2Z76A 3EF8A 4YXWH 3KIIA 1VQO3 3J7Yd 4XDWA 1IVWA 1LJ2A 1BRHA 1H8AA 1UDII 4A7PA 3S67A 1GK6A 1T2HA 2ZT9D 1GY6A 2KCDA 1D7MA 4BRYA 1Q40B 1YIJ3 1IO4A 3BCCE 1GTWA 1RJOA 3DUKA 4J9AA 5DJTB 3A2AA 3RGUA 3AE9C 1QMAA 1L4AC 1YTZT 1RCKA 3E7KA 5M1AA 1L4AB 3BLZA 2BCCD 1W2ZA 1R5SA 3PCSA 2ZDJA 4BTWA 4EOTA 3U97A 2KZIA 1K8A4 3HTKA 4L74A 3WDGB 2QJKC 2CHCA 1ULJB 4HH2A 1TRPA 3WUVA 5AIHA 1FGQA 1AA0A 5AVRB 1RNTA 2FXPA 1JBSA 1E3RA 3PXMA 2MJZA 1LWUA 3P8MC 4R80A 5APYA 2PGDA 1BNFA 2ZAEB 3EFGA 4HVNA 4C7RA 2ZL8A 1I0VA 5CCGC 1UGIA 1W6GA 5AVSB 1Y9BA 1X0TA 2BMRB 5CJ0A 3EBYA 2B88A 2QM8A 1B2UA 3U59A 1VZZA 3I55P 4PD4H 3CD6P 2C0XA 1BVIA 1BE3D 2RFRA 3A0BE 3S1KA 4ZKUA 1GW3A 3KSPA 2WITA 1X1XA 1ZN5A 2YMYA 2WSCJ 1E3VA 5DRVA 3L74G 4O3VA 1EQKA 4IFFA 1EDIA 1NTZJ 1RLSA 2IFMA 3FWLA 4KZ1A 4OUQA 1FAVA 4WWIA 3H1JG 1K9MQ 3NBBA 4U13A 4AEQA 5IERA 1AVYA 1OPYA 2SPZA 3H1KD 3K7CA 2G3AA 1OX3A 2FYUE 2M5AB 1OH0A 2W6AA 1L0LG 2WT7A 2IZ1A 4WY4B 2W9QA 5AW8B 3CXHE 2KF5A 4NPFX 1SS1A 3HK4A 4LEHA 1GL2A 1VQ93 1TIJA 3H6PA 4FMCA 3HD7A 1PFPA 3Q5PA 3FG1A 2RH0A 3SLUA 3BIRA 2WVRA 3VP9A 3D9RA 2BCCJ 2IA7A 2SBLA 2YFIB 2WPRA 3Q3DA 5D83A 2B87B 1D6YA 2P67A 1K41A 1YVSA 1A67A 1NTMG 1RGKA 1NGMB 4I1LA 3CPWO 1MWTA 1PYLA 3I563 1N2DC 4OK0A 1IK3A 3G4S3 5I97A 5KLVD 2OYIA 3WR2A 3Q1MA 3DMCA 3KZIE 1Q814 5AW1B 1J1DC 3B4PA 3PGBA 5APQA 1BRSA 5GTIE 3PP5A 2GA1A 1L0NG 1J1DB 2F5WA 1TJDA 1MOLA 1EA2A 3L71G 1IVXA 2SARA 4AYCA 3BRTB 3K5TA 4PJ0E 1OVRA 2BIRA 2A06D 1T2IA 2QA43 1CSBA 3LOYA 3F9SA 4PD4I 5H2FE 2HFED 5CLKA 1BRJA 1J2BA 5KLVK 1SIHA 4LSOA 3N7NA 1M90Q 1RN4A 3FG4A 2QEXP 4H13D 1RH5B 1Q40A 1Z1SA 1IC2A 1KD1Q 1LQMB 1BRIA 1IQ8A 3QH9A 3WHOA 1L4AA 1KB9D 1W6YA 3KPEA 3AHWA 3CMA3 5M18A 1TFKA 4D6TG 2R3SA 1LTAC 1D6ZA 3CCQP 2BEZF 4BXLA 2K1AA 1LOVA 4L75A 3GZRA 2B1XB 3AEAC 1X79B 1RHLA 3URPA 3PLNA 8RNTA 1JMMA 5AIGA 1SQQG 2W03A 5BU5A 3AEFC 1AJYA 3F7SA 3H32A 1SQXD 1RF1C 3KSED 2F86B 3L75G 1AY7A 3UB1A 1RF1B 2GM4A 2XDJA 2CG0A 1QVFO 3V6IA 5HGRA 3N4XA 3HE4B 3RL0C 2W56B 3V4QA 3A5EA 3CCU3 5IG4A 1RE4A 2Q1KA 5KKZC 1NKZB 1NAFA 4OGQC 3CC2P 1LOWA 1VQ6P 1ROVA 4N6LA 3CXHD 2GBWB 3L74E 1URQC 4BL3A 1LRAA 4JF7A 1URQB 3BCCJ 4QWTA 1W5CE 2WMMA 1BSCA 2FKWB 1SQXK 1NWWA 1FYSA 3D79A 3KE7A 4DOJA 1SQPD 3D5GA 1ZMEC 2YFJB 4MEIA 3SOAA 1L0LE 2C10A 1JKGB 2Z5HA 1T8ZA 1K8AQ 2BEQD 1JEKA 2P1JA 1VQMP 2E42A 1VL2A 2CFDA 2C9LY 1GSPA 1CW5A 4IL6X 1OFCX 1IFDA 5AW6B 2Z77A 5AW2B 4DJGA 2M5AA 1P84H 1GDTA 1EQ7A 4WWUC 2IZ0A 4WY4A 1R4YA 1A02J 4LLHA 3V2NA 1B2MA 1VQ43 4R4MA 1LVNA
chains in the Genus database with same CATH topology
2OTJ3 2OQEC 3GZYB 1EKMA 1W7CA 2K54A 1FGTA 4STDA 3WMDA 3CCL3 2CIUA 5CF1A 3GZXB 3DGLA 2PZVA 4EV5A 3Q90A 2CFWA 4EC6A 3CC23 3ECFA 2P0MA 2XEPA 4AKZA 1VQ63 1NU3A 2W04A 3FG3A 4N6UA 1R4CA 1DVCA 1AR0A 3F14A 4CCVA 2WO0A 4L8PA 2QE7H 1BUQA 3U1WA 1GD4A 3SXXA 4X2OA 3G0KA 3Q2PA 1O7MB 3JUNA 3CCM3 2CWVA 3NXJA 5AEUB 2ML6A 3DZLA 1V74A 1FGMA 2JDIH 5IEOA 4WFOA 1LOXA 1F8NA 3G8ZA 1FS0E 7STDA 3CCE3 3MKIA 1VQM3 4Q53A 3K0ZA 3WOFB 4EYCA 3FF2A 4BTXA 5A0OB 3MG3A 3V98A 3M8CA 1E97A 1DVDA 4RNYA 1VQL3 2CKFB 2FGTA 4XBTA 2BHMA 1VQ53 3DXOA 1A2KA 2CC3A 2E2TA 4PEJA 3MYTA 1SPUA 3VSYA 3X3YA 3SVAA 4HM7B 1W01A 3FLJA 1ULIB 3CCR3 4MMYB 1WMPA 5CF2A 1RRLA 1U8CB 2XFSA 5IF6A 3G713 1M1K4 1STFI 4NREA 5FGOA 3FSDA 3X3XA 3SEDA 1HKXA 2BO9B 1A2VA 2W0QA 1M904 4H61A 4FCMA 3K63A 2INXA 3LTBA 2P05A 3TDGA 4HZBB 6STDA 5CXOA 3OWYA 2W6JH 4R1KA 4LZIA 5IW9A 4MMZB 3T8NA 3BNBA 3HIIA 4K1VA 1KD14 2XR8B 2CFKA 3EX9A 3N9HA 5KP1A 3ALAA 3LTAA 2BT3A 1N5HA 2R4IA 5CK6A 2OTL3 1Y4KA 5LC7A 1L5GB 3NV0A 2CH9A 1DMQA 1VQN3 3S27A 1FGOA 1OHSA 3B8LA 2E5TA 3F8HA 4IPBA 3LYGA 1JV2B 4HM5B 1SQWA 1OUNA 3OXAA 1N9EA 1S723 1AVLA 2WOFA 5BXQA 1IT8A 1GYBA 2CWTA 1YJN3 3DGNA 2GU1A 1UI7A 1W2B2 1K28A 1LNHA 2CFGA 2MF7A 4WP5A 2A15A 3F40A 3K9MC 2HMKB 4HBRA 3PS8A 3ROBA 1W5ZA 3NM7A 4IT7A 4OVMA 1RN7A 2D1WA 4K1UA 1UUWB 2V1LA 4X2HA 2GEYA 5EEOA 3OW22 1O7GB 2QIYA 3F8XA 1C7HA 1JN5A 1M1XB 4N3VA 4JRFA 1WMNA 1Q864 2Z76A 3CCJ3 3EF8A 4YXWH 5AEWB 3IJEB 3KIIA 1VQO3 3WODG 3X3ZA 1YVBI 3J7Yd 4XDWA 3CPW2 1IVWA 5IEPA 3EC9A 1DMMA 2IUJA 3CCV3 3KZTA 3V92A 3PYJA 3LH4A 3G16A 3S67A 3I0YA 1G96A 4HM6B 3DGOA 4KFFA 1GY6A 2L4VA 1YJW3 2KCDA 5TGNA 4WVZA 5AYSC 1Q40B 3CNXA 3CCS3 1YIJ3 1RJOA 1UI8A 3DUKA 4J9AA 1NJI4 3NHXA 5IG5A 3H51A 2HMMB 2Y73A 4RBNA 1QMAA 1ZO2A 2QGUA 2OOVC 3UJMA 4WYKA 1OHPA 5D82A 3BNCA 5AYRB 1KQS2 2LQVA 3BLZA 2WOHA 3CME3 1VQP3 1W2ZA 3PCSA 1AVKA 2ZDJA 4BTWA 3LT9A 3AMOB 2E2VA 2P09A 3U97A 3RGAA 1IQXA 1K8A4 5KP4A 4XB5A 4XBXA 5ELUA 3STDA 3WDGB 2FXTA 4ORLA 2F99A 2CG1A 2CHCA 1ULJB 1YGEA 1SJWA 5AIHA 3MPHA 1FGQA 4R4KA 1IV9A 2D42A 3KN4A 1TP6A 1E3RA 2RCDA 2BMQB 2GXFA 3PXMA 2O9UX 4IIAA 5D81A 4G1MB 4R80A 3NUVA 5KP3A 1D6UA 2CWUA 1LXEA 3IMAB 3KFQC 1RRHA 1QAFA 2B24B 1O7PB 3X41A 1IT7A 4HVNA 1N9JA 2P38A 3EHCA 5IENA 2ZL8A 5AIIA 3BB9A 1FUWA 3JUOA 1JB2A 4L8OA 3PZWA 1O7HB 1W6GA 3B7CA 1N8QA 2OQEA 3RGRA 2PNCA 4JF8A 3PCRA 3Q1CA 1YI23 1Q42A 2BMRB 2FNQA 3EBYA 3NX0A 1VQK3 3S28A 8CHOA 2OOVA 1VZZA 3OX9A 3MG2A 4XDVA 3X42A 5IG3A 4EXRA 5ELJA 4AKYA 2RFRA 3WA2X 3CC43 4GB5A 1JJ22 2W2CA 2V7QH 3KSPA 3FH1A 4L7KA 2STDA 3T8UA 1PU4A 3OV4A 3MWZA 3SOYA 3USSA 3EJVA 4R9KA 1BSNA 5IG0A 1E3VA 3F7XA 5DRVA 1FA3A 3CC73 4H3UA 2E2UA 2YX9A 4O3VA 4FCJA 1EQKA 2ML5A 1QVF2 3OWUA 1NDOB 1QJGA 1ROAA 2RGQA 3DY5A 4KZ1A 3HX8A 4OUQA 4FMAA 3LZAA 3DM8A 2K0MA 5AIFA 2KXGA 4RZMA 3KKGA 2XFTA 3EBTA 4R9LA 3NBBA 3B4OA 4U13A 4GL6A 4AEQA 5IERA 1OPYA 3K7CA 2GEXA 4N6NB 4O8SA 3QRDA 1OH0A 4HZ9B 1IDPA 1T5YA 2XGLA 4LGQA 3DGMA 1KSIA 1M9GA 2W9QA 1QVG2 1QAKA 1IQYA 1W4NA 4K90B 1IFPA 3HK4A 4LEHA 2I9WA 1VQ93 1TIJA 3GZBA 1AQTA 4FMCA 2CK3H 2Y74A 4KVHA 1PFPA 3LT8A 3FG1A 3BNDA 1OACA 4MMXB 1ZX2A 1WQLB 3SLUA 4HM1B 3OWSA 2W9PA 1JB4A 1Q824 1JNQA 1KWIA 3D9RA 2SBLA 2IA7A 2WGQA 4ZM8A 2YFIB 3IPTA 2OCTA 1OGXA 5D83A 1O7NB 1MNLA 3ER7A 3I553 3UL5A 3CD63 1IU7A 1D6YA 2W56A 3LTDA 1K41A 1VQ73 1A67A 2HMNB 1HU9A 3GWRA 3LMLA 4TLFA 5STDA 2Z6BA 3D3LA 2KRTA 1NB5I 4J8TA 3I563 2RSXA 4OK0A 1IK3A 3G4S3 2HMJB 5I97A 4XM4A 1K734 3VF1A 1N8R4 1RKYA 3HI7A 1WMOA 1GY7A 3CPOA 2XGNA 2WGOA 2MC8A 3DMCA 4N6V0 1Q814 1VQ83 3B4PA 3PGBA 3MHEA 2E5YA 1AV4A 2C11A 4EBGA 1W02A 4HKVB 3S29A 1MOLA 4FMDA 4HM0B 1EA2A 1IVXA 2XF3A 3K5TA 1JKGA 2WSSH 1JB5A 2UX0A 3MG1A 1UUVB 2HMOB 4HJLB 3UNLA 3V99A 2QA43 1CYUA 3LXUX 3LOYA 3G6E3 3F9SA 4QMAA 1ASKA 3WA3A 1WNHA 3GAXA 2IUKA 2HMLB 5CLKA 4HM2B 2O3OA 3X40A 1J2BA 1SIHA 4LSOA 3NQYA 3JUPA 1TUHA 4I4KA 3UL6A 5EVHA 1OHOA 1OF5A 3FF0A 3FG4A 4HYZA 3PJSK 1Q40A 1Z1SA 1YJ93 5JPUA 3JUMA 4HM4B 4XBYA 1S5AA 3NV0B 1NB3I 4N6TA 1IQ8A 2M7OA 2LYXA 2OWPA 3FKAA 1W6CA 4KFEA 4TX4A 1DMNA 1W00A 1W6YA 3CNMA 3CMA3 3AMOA 4NHFA 3S5CA 1TFKA 3NBJA 1GD3A 5JBSA 4KFDA 1D6ZA 1TU5A 4MJDA 4BTYA 4CDLA 3RDEA 5AI1A 2IMJA 3GZRA 2B1XB 1CEWI 4HM8B 4N6MA 1WTHA 2XH9A 5BVBA 2CW9A 3FGYA 5AIGA 2BNGA 3EN1B 1US1A 5G2GA 3VGNA 3O8YA 1IVUA 3T0UA 1JN5B 1U5OA 2F98A 2W03A 3F7SA 3CXC2 3KSED 4FMBA 4HM3B 1TFOA 2F86B 3FCSB 3UB1A 3LTCA 1YHQ3 2CG0A 3EN8A 1O7WB 5HGRA 1UW1A 4K61A 4O2HA 3A76A 1IV7A 3CU3A 3FZWA 1QALA 2W56B 1GS3A 3NBRA 1OCVA 4WHAA 3CCU3 1KC84 5IG4A 2GBXB 3MSOA 1E79H 5JPPA 2P0XA 1ROVA 2QEX3 1STDA 1SIIA 4RNZA 3H3HA 2XSOB 4N6LA 2GBWB 2YFLB 1BSHA 4O02B 4FR9A 1FGRA 3WOEB 2Q07A 4WYKB 4QWTA 4N6OB 3HZPA 2XNDH 1CQSA 1NWWA 3KE7A 1OGZA 2GU3A 5LC6A 2YFJB 2XRXB 3CCQ3 4MEIA 3SOAA 3NQZA 1K9M4 4LMIA 2Z7AA 2C10A 5DREA 3JVCA 3GRDA 1JKGB 1NO3A 1Q7Y4 1JEKA 3HIGA 5FW5A 2XSHB 3JUQA 3L0RA 2CFDA 3EFFK 1DYUA 3EE1A 3SX1A 3QK9A 2JQ5A 4EV2A 3NM2A 1CYVA 1JRQA 3BNEA 1A90A 1N5PA 2Z77A 1GY5A 1IVVA 2BMOB 4DJGA 4WWUC 5EQLA 3N8BA 3E99A 3N54B 2CFLA 3EB8A 1OF5B 4FCZA 1YIT3 1VQ43 1ISKA 3EQQB 1EG9B 1LVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFP A;  3PJS K;  4WVZ A;  2WSS H;  1E79 H;  1AQT A;  2CK3 H;  2JDI H;  1JEK A;  1FS0 E;  3EFF K;  2E5T A;  4YXW H;  4QMA A;  1BSH A;  4DJG A;  2E5Y A;  2W6J H;  2XND H;  2V7Q H;  2QE7 H;  4TLF A;  3USS A;  1BSN A; 
#chains in the Genus database with same CATH topology
 4XA4 A;  4Y28 J;  5E79 E;  3GZY B;  1EKM A;  2YMK A;  3CCL 3;  1NTM E;  4B86 A;  2CIU A;  1SQP K;  4UB6 E;  2ZT9 C;  2PZV A;  4K3A A;  2ZT9 B;  4AKZ A;  2P0M A;  1DET A;  2W04 A;  1BDC A;  1MWU A;  4CJN A;  2WO0 A;  2PAJ A;  1JZD A;  2QE7 H;  1MFZ A;  4J5G A;  2OTL P;  4NPE A;  3G0K A;  1O7M B;  3CCM 3;  1UIX A;  1WMK A;  1VQN P;  1LTI C;  1HZ1 A;  1V74 A;  1VDF A;  3P7K A;  3L71 E;  5TIS E;  1KIL B;  3RNT A;  4W7Z A;  2KZJ A;  3WOF B;  4BTX A;  5A0O B;  1AQZ A;  2H43 A;  3V98 A;  3M8C A;  4RNY A;  2JKV A;  1VQL 3;  1SQB K;  1RN1 A;  3DXO A;  1A2K A;  2CC3 A;  2L91 A;  4PEJ A;  1S5L H;  2KOG A;  4EIJ A;  1BGY D;  4HM7 B;  2FYU J;  3OJA B;  1WMP A;  5CF2 A;  4NRE A;  2YNY A;  2WSE H;  1LNI A;  4WY4 D;  1RDS A;  3VMX A;  2INX A;  1M8O B;  3TDG A;  2W6J H;  1I2F A;  5IW9 A;  1OZH A;  1YJW P;  3HII A;  3WMM 0;  1Q90 D;  3BVH A;  3K5B A;  2CFK A;  3EX9 A;  4D6T E;  1YBK A;  3ALA A;  2WSC H;  2BT3 A;  5CK6 A;  2OAR A;  1FOS E;  5LC7 A;  1N86 A;  2QVA A;  1JCC A;  4GOF A;  4EI2 A;  3S27 A;  1JO5 A;  1VQP P;  1V58 A;  1ZLL A;  3RBX A;  2QJP C;  4H0L D;  3P8C E;  1SQQ E;  1OW8 A;  4HJG H;  1P84 I;  2QJP B;  1IT8 A;  1YJN 3;  3W68 A;  1UI7 A;  2CFG A;  4AUW A;  4LYL B;  2A15 A;  1U7J A;  3L75 E;  3DH2 A;  3L74 D;  1Q81 Q;  3F89 A;  2D1W A;  3VTP C;  3TNU B;  3U1A A;  2XU6 A;  1T3J A;  1M1X B;  3HE5 B;  4GOD A;  2ZYA A;  4DT0 A;  1RF1 A;  3X3Z A;  5B66 H;  2KUB A;  2ZJS E;  1I3I A;  3V2Q A;  3EC9 A;  3QWO C;  1LTB C;  3HE4 A;  2IUJ A;  1CI6 B;  3KZT A;  1H88 A;  1G1I A;  3DGO A;  1YI2 P;  2IYJ A;  3CNX A;  3CCS 3;  1LP1 B;  2YIU B;  3VMA A;  3WUU A;  1RY3 A;  1GK4 A;  1NJI 4;  5IG5 A;  1IFM A;  1SLQ A;  3H51 A;  2HMM B;  5AW9 B;  3CC4 P;  1Q2N A;  2L5G B;  3UJM A;  3RL0 g;  1KIL E;  1URQ A;  3JSV C;  1JTH A;  3L73 G;  2LQV A;  5KAF E;  2WOH A;  2QG4 A;  1NTM D;  1AFO A;  1NTK K;  3LT9 A;  2R5D A;  3CL3 D;  1T3B A;  4XB5 A;  2F99 A;  3ABV C;  3JCU H;  1MGR A;  1LGH B;  1LTT C;  2HR3 A;  4GIF A;  3ZG0 A;  1PZQ A;  1LT9 B;  1UII A;  3KN4 A;  1TP6 A;  2RCD A;  2BMQ B;  4GDO A;  4G1M B;  2IY2 A;  1KQF B;  2CWU A;  1LXE A;  1RRH A;  2LXC B;  2B24 B;  1O7P B;  3L71 D;  1X1U A;  2P38 A;  2Q3I A;  3C8V A;  3V2R A;  3BB9 A;  3JUO A;  4L8O A;  3B7C A;  1JNM A;  1KYO E;  3MIW A;  1FJP A;  1XTG B;  2AXC A;  1Q42 A;  2ZVO B;  4H13 C;  1KFM A;  1U57 A;  3X42 A;  2WPS A;  3MG2 A;  4I6M C;  5L8R J;  2RN0 A;  4AKY A;  2L1S A;  1UCJ A;  2V7Q J;  3L74 J;  1BSA A;  1ZRT E;  2KNC B;  2IPP A;  3T8U A;  5AW0 B;  1ZS7 A;  3SOY A;  5DJU B;  3USS A;  4R9K A;  1BSN A;  1A02 F;  3H1J J;  5IG0 A;  3F7X A;  1T2K D;  4H3U A;  2E2U A;  4FCJ A;  2ML5 A;  3DGY A;  5APV A;  3DY5 A;  1NKN A;  1G0T A;  5AIF A;  1L0L J;  2KXG A;  4RZM A;  2XFT A;  3EBT A;  1BNE A;  3B4O A;  4ASV A;  1XTC C;  2K9Y A;  3CX5 E;  1T5Y A;  2XGL A;  1KSI A;  2W6B A;  4Y99 B;  4C7N A;  1IQY A;  4U3F G;  4K90 B;  2CX1 A;  4NPD A;  1AQT A;  4KVH A;  2KI7 B;  3LT8 A;  3L75 D;  2HPC B;  5B5E H;  4MMX B;  1ZX2 A;  4HM1 B;  2W9P A;  1JNQ A;  1NTM J;  2B9B A;  3IPT A;  2P2U A;  1X9V A;  1RE3 C;  1RSN A;  3I55 3;  1MFT A;  3CD6 3;  4I7Z C;  1HF9 A;  1IU7 A;  1M57 D;  3LML A;  4RO0 A;  4I7Z B;  4TLF A;  1QLE D;  3AEC C;  2Z6B A;  4ZNC A;  2O01 J;  1RCL A;  1NB5 I;  2H88 C;  2RSX A;  2JP3 A;  2NRG A;  2HMJ B;  4IL6 E;  1G02 A;  4C46 A;  1L0N J;  3M0A A;  1EEJ A;  1B3S A;  1JY2 O;  3H1L G;  3HI7 A;  2MC8 A;  2WGO A;  4N6V 0;  2KB7 P;  3L71 J;  2K3D A;  3D6Z A;  3MHE A;  2E5Y A;  1AV4 A;  2C11 A;  1NTZ K;  1BNJ A;  1NH4 A;  4W80 A;  4HAA A;  4HM0 B;  3KYQ A;  1KIL D;  3A5T A;  1EDL A;  1BCC G;  1JB5 A;  2KSE A;  5APS A;  3MG1 A;  1SFC C;  4HJL B;  3HE5 A;  2W90 A;  1SFC B;  1KB9 H;  2ZYG A;  1SVF A;  1JY2 P;  1QX8 A;  1DIP A;  1WNH A;  2O1J A;  2J8X B;  2IUK A;  2HML B;  4HYT B;  2O3O A;  3X40 A;  1CI6 A;  3L73 E;  2ZA4 A;  1NU1 G;  3A0B H;  1RE4 C;  4YPC A;  1AV1 A;  4YTP C;  4AQR D;  1PY3 A;  1LP1 A;  3M0D C;  1A2P A;  5JPU A;  4H44 B;  3JUM A;  3NMD A;  4HM4 B;  4XBY A;  1S5A A;  1FUS A;  1NB3 I;  4N6T A;  4OH8 B;  5GTH E;  4D6T J;  1MGW A;  2OWP A;  1I70 A;  4OVN F;  1W6C A;  4TX4 A;  3M9B A;  1KYO D;  3VOP A;  4NHF A;  3RK2 C;  5APX A;  3PH0 A;  2PFX A;  1TU5 A;  1K04 A;  4BTY A;  5HOH A;  3RK2 B;  1IK7 A;  1DD4 A;  1SQQ J;  3SWY A;  2IBZ G;  2GUS A;  1CEW I;  3PTZ A;  1YGW A;  3TK1 A;  1WTH A;  5BVB A;  2CW9 A;  4TT3 H;  1JM0 A;  3L75 J;  2BNG A;  5G2G A;  3VGN A;  3CXH H;  5AVU B;  3T0U A;  3D71 A;  2FYZ A;  1U5O A;  1IFI A;  4FMB A;  3MHV A;  3LTC A;  1LQG C;  2R41 A;  2WWW A;  1IV7 A;  1RGA A;  3CU3 A;  4WY4 C;  2OTJ P;  4L76 A;  1S1C X;  3L4F A;  1GMP A;  7GSP A;  2GBX B;  3MSO A;  2Y9Z A;  3CX5 D;  1FZF A;  1ZW0 A;  2QEX 3;  1STD A;  4W7Y A;  1SII A;  4RNZ A;  2XSO B;  3IF4 A;  1HGV A;  1BSH A;  4O02 B;  1EC5 A;  1FGR A;  4FR9 A;  4LGD E;  4WYK B;  3ZFZ A;  3SWK A;  1NJI Q;  1G2C A;  2JR8 A;  1FZC C;  2G8Y A;  4H0L C;  1MKM A;  1FZC B;  2GU3 A;  4IOI H;  1R5L A;  4H0L B;  1Y8A A;  2AEJ A;  3H1I G;  3H1H E;  5KAI E;  3CCQ 3;  1DH3 A;  4LMI A;  5DRE A;  3GRD A;  2Q5U A;  3B8E B;  3CCE P;  3CWB G;  5FW5 A;  2XSH B;  4U3F E;  1KB9 I;  3JUQ A;  1DYU A;  3SX1 A;  4EV2 A;  4PJ0 H;  3BNE A;  1S9K E;  1A90 A;  3B5N B;  1N5P A;  1VQ5 P;  1GY5 A;  4KT0 J;  3E1R A;  3BCC D;  3CCR P;  2M3E A;  3E99 A;  3N54 B;  2Q6Q A;  1BSB A;  3EB8 A;  1OF5 B;  4NPB A;  3G71 P;  3EQQ B;  2VRS A;  1PV3 A;  3L37 A;  1RQV A;  2OQE C;  1FGT A;  4STD A;  2AXT E;  3WMD A;  1VF5 D;  2HPC A;  4EV5 A;  2W27 A;  3CC2 3;  3I5C A;  1LNQ A;  2LKM A;  2KF6 A;  1VQ6 3;  1DVC A;  1EZV G;  1AR0 A;  3H1L E;  4L8P A;  1RE3 A;  2P58 A;  1GMQ A;  4X2O A;  1NYH A;  1OWA A;  3CXH I;  1S72 P;  3L73 D;  1F8N A;  1BCC E;  1PGO A;  3G8Z A;  4I2L C;  3MKI A;  6RNT A;  1VQM 3;  4EYC A;  2AAD A;  3MG3 A;  3A0H H;  3AEG C;  2UWJ E;  2F56 A;  4XBT A;  4HOH A;  3MGN A;  2E2T A;  3MYT A;  1SPU A;  3VSY A;  1U7M A;  3FLJ A;  1ULI B;  4MMY B;  3CCJ P;  5C39 A;  1U8C B;  1NU1 E;  2XFS A;  1STF I;  1SFC A;  5FGO A;  1Z56 A;  2Y9Y A;  3X3X A;  1SP4 A;  3SED A;  3CCV P;  2W0Q A;  2DW3 A;  4FCM A;  1PIX A;  1MV8 A;  4JBZ A;  3AE5 C;  2K88 A;  2P05 A;  3K63 A;  6STD A;  1YYC A;  1M1J C;  2YO2 A;  1NOH A;  4DCK A;  3BNB A;  2Z4E A;  4K1V A;  1M1J B;  4WBA A;  2XR8 B;  2KF4 A;  1W2E A;  1N5H A;  1ZP0 C;  2R4I A;  2OTL 3;  1Y4K A;  3II6 A;  1N7S D;  2YO3 A;  3M0D A;  2IBZ E;  2FYU D;  2CH9 A;  1VQN 3;  3AEB C;  3M9H A;  3CME P;  1T2K C;  1SQW A;  4R4L A;  1AVL A;  1IYY A;  1DEB A;  1W2B 2;  2MF7 A;  3H1J E;  4L73 A;  3F40 A;  2KK7 A;  2JWA A;  2K3R A;  3L36 A;  3GSP A;  1UUW B;  3C9I A;  2M0B A;  3M9Q A;  1BNG A;  1WRG A;  2I1K A;  3T97 B;  2K9J B;  1QGK B;  3F8X A;  4N3V A;  1AVO A;  3GHG B;  2R5B A;  1KN7 A;  3H1H D;  3IJE B;  2FYU K;  3CPW 2;  1FOS F;  1DMM A;  4U3F D;  1RGL A;  3V92 A;  3PYJ A;  1RGH A;  4XE5 B;  3LH4 A;  1SFC D;  3OA7 A;  4KFF A;  1GMR A;  2L4V A;  1YJW 3;  5TGN A;  2QRX A;  3H25 A;  4WVZ A;  1VQK P;  3S4R A;  3L73 J;  3TGU G;  1MWR A;  2FXM A;  1UI8 A;  3H1I E;  4RBN A;  1BNS A;  4UB8 E;  4WYK A;  5D82 A;  5AYR B;  3CWB E;  1GOY A;  1KQS 2;  2WTY A;  3ZDM A;  1VQP 3;  2B87 A;  1AVK A;  3GLM A;  5TIS H;  3AMO B;  2P09 A;  4H44 D;  1K05 A;  3RGA A;  1IQX A;  2D2C D;  1FZC A;  1HJ0 A;  3CC7 P;  2BU4 A;  5ELU A;  2OQQ A;  4ORL A;  3D70 A;  3AE4 C;  2WZ7 A;  2QSI A;  3PRJ A;  1L0N E;  1DX7 A;  4KT3 B;  1SJW A;  3NTN A;  3H1L D;  4R4K A;  1KIL C;  3RBZ A;  1IZN B;  1NNV A;  3RK2 D;  4IIA A;  3B5N A;  2I1J A;  5CBO A;  1D6U A;  3CCU P;  3KFQ C;  1GU4 A;  4GT1 A;  1QAF A;  3X41 A;  1BCC D;  3EHC A;  1BE3 G;  5IEN A;  4ILF A;  3E1I A;  2AEM A;  2H0I A;  1FUW A;  1EZV E;  1NVO A;  2FFD B;  3CLQ A;  1GW4 A;  2OQE A;  3RGR A;  2H89 C;  1BSE A;  2PNC A;  4JF8 A;  1YI2 3;  2FNQ A;  3NX0 A;  5KTB A;  3S28 A;  1KQL A;  2OOV A;  1X1W A;  3OX9 A;  2J59 M;  4XDV A;  3KQG A;  5IG3 A;  1BGS A;  1VQ7 P;  1QEX A;  4N3Y B;  3WA2 X;  3CC4 3;  2W2C A;  3AED C;  2E75 D;  3H1K G;  3SWF A;  5KJ7 A;  1E5W A;  5M19 A;  1PU4 A;  3OV4 A;  1BDD A;  1MZ9 A;  2IX7 C;  3EJV A;  4I5Q A;  1AQ5 A;  1N73 B;  2O01 N;  1QVF 2;  2RGQ A;  4JQ0 D;  1JY3 N;  1EDJ A;  4FMA A;  3H1H J;  2Z5I A;  1VQ8 P;  2K0M A;  1HUC A;  4R9L A;  4GL6 A;  3RK3 E;  4IFD K;  4U3F J;  1FJK A;  3AE8 C;  2GEX A;  4O8S A;  4HZ9 B;  4LGQ A;  3DGM A;  1M9G A;  3SYU A;  1EUI C;  1QVG 2;  5AVY B;  1W4N A;  1GOU A;  1Y47 A;  3B5N D;  2I9W A;  3G6E P;  3HUS C;  2I8D A;  1NO4 A;  3H1J D;  1PGJ A;  2Y74 A;  2HLO A;  2NZ2 A;  9RNT A;  3HUS B;  2YKQ A;  1BOX A;  1MWS A;  1WQL B;  5TJH A;  1JB4 A;  1KWI A;  2WGQ A;  3IFM A;  4ZM8 A;  2ZVN B;  5KLV G;  1L0L D;  1OGX A;  3OW2 O;  2OCT A;  1MNL A;  3ER7 A;  3ITK A;  4GKG A;  3UL5 A;  1M1J A;  2W56 A;  1C54 A;  2HMN B;  1HU9 A;  1YJ9 P;  3GWR A;  1M7L A;  2H8P D;  3BRV B;  5STD A;  2R3C A;  1J1E B;  3D3L A;  3SFE C;  3H1L J;  2KRT A;  4J8T A;  1OW7 A;  2YIU C;  4MN4 C;  4YXD C;  1ZOY C;  2QJY B;  5AVX B;  1KQG B;  1DEE G;  2A06 G;  1RKY A;  1WMO A;  1GY7 A;  3CPO A;  5KJ7 D;  3FXE A;  3FGA D;  1BCC J;  2PRR A;  1HWT C;  4EBG A;  1W02 A;  3Q3F A;  4HKV B;  2NPS D;  2JO1 A;  1OVU A;  2R32 A;  4LC1 A;  1V57 A;  1B27 A;  3S29 A;  4FMD A;  1L0L K;  2ZXX A;  1ZV8 A;  2XF3 A;  5EFW B;  1LT9 C;  2Y0C A;  3WU2 H;  3T97 A;  5CJ4 A;  2WSS H;  1JKG A;  2K9J A;  2FBW C;  5B66 E;  2UX0 A;  1UUV B;  3GHG A;  2KP8 A;  1EDK A;  1YHQ P;  3D5I A;  1KYO H;  3TGU E;  1ASK A;  1S4X A;  1NU1 J;  1VF5 C;  1L0N D;  2P7J A;  3B71 A;  2KS1 B;  5CCH D;  1VF5 B;  5G1L A;  3CI9 A;  3NQY A;  3JUP A;  1LTJ B;  3TSI A;  1JOC A;  3FF0 A;  3MZW B;  3EQ2 A;  4CPG A;  1NTM K;  1PP9 G;  1J2J B;  2E74 D;  3D4A A;  1RGE A;  1HBW A;  2M7O A;  3MTU E;  1T6A A;  3FKA A;  4KFE A;  1S3J A;  1W00 A;  1SQX G;  4O9B A;  3AMO A;  1JUN A;  3NBJ A;  5JBS A;  4PV1 D;  5AVQ B;  4MJD A;  1OW6 A;  2YKP A;  1L0N K;  2IMJ A;  2E76 B;  3KXD A;  3L70 G;  4N6M A;  1BE3 E;  3A3Y B;  3CX5 H;  1GL2 B;  3FGY A;  2C4B A;  3EN1 B;  1FZB A;  3AE2 C;  3O8Y A;  1JN5 B;  2F98 A;  1KIL A;  3CXC 2;  4HM3 B;  1TFO A;  4D6T D;  3FCS B;  3M06 A;  1R8E A;  1YIT P;  3A76 A;  1LOY A;  3FZW A;  4Y99 C;  1GS3 A;  3NBR A;  4WHA A;  2FFD A;  1FZU A;  1KC8 4;  3L72 G;  2V4H A;  3RK3 D;  3P8C D;  1SQQ D;  3H1K E;  1SQP G;  5KLI B;  3AHS A;  2KSJ A;  2KYV A;  3AE1 C;  1N7S C;  2YFL B;  1USD A;  3WOE B;  2Q07 A;  1B21 A;  1N7S B;  3H1I J;  1HGZ A;  4IL6 H;  2WPQ A;  3M91 A;  3OAK A;  1BAO A;  1OGZ A;  3CWB J;  2LR2 A;  2PP6 A;  1RMS A;  1DE3 A;  2Q7C A;  3NQZ A;  2Z7A A;  1PGP A;  3JVC A;  1Q7Y 4;  3BU4 A;  3GW6 A;  3EWK A;  3EE1 A;  1KYO I;  4HB1 A;  3QK9 A;  1SQQ K;  1I8V A;  1JRQ A;  1IFJ A;  1HVV A;  3A7O A;  1SQB G;  2IYO A;  5AVZ B;  2BMO B;  1CZQ A;  5CHX A;  5EQL A;  3AE3 C;  1X22 A;  2A45 H;  2JWD A;  5KLV E;  5B5E E;  1NWQ A;  1YTZ I;  3VYI A;  1GD4 A;  1UCI A;  2OTJ 3;  5BU8 B;  1CH0 A;  4Z1M H;  2Y0E A;  3TNU A;  2K54 A;  3HUS A;  1H0T B;  5CF1 A;  3GZX B;  1I2E A;  3VN0 A;  3Q90 A;  4EC6 A;  2XEP A;  2P10 A;  3FG3 A;  4N6U A;  1FW7 A;  2OYO A;  1R4C A;  5GTH H;  3TF5 A;  2A06 E;  1BUJ A;  1TTO A;  5G1K A;  1UUG B;  3TGU D;  3G3Z A;  3JUN A;  1FU1 A;  2CWV A;  3NXJ A;  5AEU B;  3CX5 I;  3FX0 A;  2QJK B;  1GD2 E;  4H44 C;  2MKV A;  1Q9E A;  2D2C C;  1BGY G;  5IEO A;  4WFO A;  2D2C B;  1Q7H A;  1FS0 E;  2E43 A;  1SQV G;  3CCE 3;  1EXI A;  3H32 B;  4Q53 A;  5BIR A;  3FF2 A;  1E97 A;  2M3B A;  2FGT A;  1VQ5 3;  2BHM A;  2POH A;  1BSD A;  1UCK A;  1KB9 E;  2C0W A;  1FDM A;  3CCR 3;  5IF6 A;  1LT9 A;  3KCH A;  3G71 3;  1M1K 4;  1FZE A;  1VQO P;  2WSE J;  3IR9 A;  1PP9 E;  1ZRT D;  3GF7 A;  1UCL A;  4GSP A;  3Q2Y A;  1HKX A;  2BO9 B;  3HOH A;  3TDK A;  1A2V A;  4H61 A;  2KS1 A;  4HZB B;  1S5L X;  2W83 C;  4LZI A;  5RNT A;  4MMZ B;  1LTJ A;  2Q9I A;  1SQX E;  1YIJ P;  3N9H A;  5KP1 A;  2F4Y A;  1QL1 A;  3LTA A;  2E75 C;  2AAE A;  2E75 B;  2HYN A;  1TU3 F;  5CMZ A;  4PD4 E;  2KF3 A;  2FXO A;  3L70 E;  5KAI H;  2RMZ A;  1FGO A;  2E5T A;  1KTM A;  1JV2 B;  3C1L A;  1KMI Z;  1OUN A;  3OXA A;  1N9E A;  1NTK G;  1S72 3;  3UIA A;  1GYB A;  2CWT A;  2GU1 A;  2KLV A;  5AW7 B;  5K5G B;  4WP5 A;  2A45 I;  1LT1 A;  4JPZ B;  2KNC A;  2HMK B;  3K9M C;  3PS8 A;  3ROB A;  3FXD A;  3KZI H;  4HKZ H;  1YNV X;  5GTI H;  1W2B O;  4K1U A;  4N78 E;  4X2H A;  2GEY A;  5EEO A;  1G1J A;  1JN5 A;  3L72 E;  2QIW A;  4J5K A;  4JRF A;  5APT A;  1WMN A;  1Q86 4;  3CCJ 3;  1SQP E;  5AVW B;  3B5N C;  5AEW B;  2O3J A;  3Q5S A;  2HOH A;  2AXT H;  1BAN A;  3NXS A;  3WOD G;  1YVB I;  2YKO A;  5IEP A;  4IFM A;  1PGQ A;  1FZG A;  3CCV 3;  1JBT A;  3MUD C;  3TGU J;  2JEE A;  3W67 A;  3G16 A;  5H2F H;  3I0Y A;  5BU4 A;  1G96 A;  4HM6 B;  2O1K A;  1PPJ G;  5AYS C;  2GSP A;  4BL2 A;  3NHX A;  2Y73 A;  1ZO2 A;  3SFD C;  3AE7 C;  2OOV C;  2QGU A;  4M3L A;  1OHP A;  3BNC A;  1N7S A;  2UGI A;  3CME 3;  1OIP A;  2Y0D A;  1I3F A;  2OYH C;  2E2V A;  1T3U A;  5KP4 A;  5KJ7 C;  2OYH B;  4XBX A;  1SQB E;  3STD A;  1KQS O;  2FXT A;  1BIR A;  2CG1 A;  1YGE A;  2NPS C;  3MPH A;  1IV9 A;  2NPS B;  2D42 A;  1FE6 A;  2GXF A;  5D81 A;  1BE3 J;  2O9U X;  1IJD B;  4RNT A;  3NUV A;  1OVV A;  5KP3 A;  2E76 D;  3IMA B;  3V5B A;  1GL2 D;  1IT7 A;  4RJT A;  1N9J A;  3HD7 D;  5AII A;  1VQ9 P;  1JB2 A;  5CCH C;  3PZW A;  1O7H B;  1VPC A;  1N8Q A;  1JBR A;  1H0T A;  3D6Y A;  2FYN C;  3PCR A;  3Q1C A;  1KC8 Q;  3LIE A;  1VQK 3;  2N1T C;  2FYN B;  3KDP B;  2XV5 A;  3H1K J;  2E74 C;  8CHO A;  1BGY E;  2N1T B;  1JB0 J;  4EXR A;  2E74 B;  5ELJ A;  4EDF A;  4GB5 A;  1JJ2 2;  1SQV E;  2UUG C;  1KFN A;  2V7Q H;  1RHZ B;  1PP9 D;  3FH1 A;  2XZR A;  4BWN A;  4L7K A;  2STD A;  3I56 P;  1HTL C;  3MWZ A;  3BAS A;  1IFN A;  3G4S P;  4PV1 C;  1MUU A;  1FA3 A;  3CC7 3;  4ZKP A;  2YX9 A;  4EW5 A;  3O6Q B;  3A0H E;  4PV1 B;  3OWU A;  1NDO B;  1QJG A;  1ROA A;  3HX8 A;  3LZA A;  3DM8 A;  3O8Z A;  2N9Y B;  3KKG A;  3WUT A;  1Q7Y Q;  1UGH I;  1GMJ A;  1NTZ G;  4PD4 D;  4ZMD A;  4N6N B;  1B2X A;  1VQQ A;  3QRD A;  1IDP A;  3L70 D;  3AGO A;  2WSF J;  3LW5 J;  2M8R A;  4JYB A;  5APU A;  3RL0 B;  6GSP A;  1QAK A;  5CCG A;  2RNT A;  2QA4 P;  1IFP A;  2HOD B;  3GZB A;  3NFQ A;  1L2P A;  5KKZ B;  2CK3 H;  4OGQ B;  3GHG C;  5KLV J;  4CPK A;  3BND A;  1QVG O;  1OAC A;  3RK3 C;  4KJM A;  3OWS A;  5E79 H;  1RGF A;  1Q82 4;  3RK3 B;  1JTH B;  1B2Z A;  2CX0 A;  4N78 D;  4UB6 H;  1O7N B;  1BNR A;  3L72 D;  3AEE C;  1NAY A;  4UB8 H;  3LTD A;  1NTK E;  1VQ7 3;  4K35 A;  2BCC G;  1RF0 C;  5AW3 B;  1S9K D;  1TRQ A;  2O01 H;  1L4A D;  2WPV B;  2J58 A;  4XM4 A;  1K73 4;  3CMA P;  3VF1 A;  1N8R 4;  2XGN A;  3IAO A;  3GG2 A;  1VQ8 3;  3R4Y A;  2XNX A;  4XFJ A;  3MP7 B;  1ZR4 A;  1PL5 A;  1X8Y A;  2HMO B;  3UNL A;  3V99 A;  5GSP A;  5CBN A;  1CYU A;  3LXU X;  1P84 E;  3G6E 3;  1SQB D;  1PPJ E;  3V2P A;  2IBZ I;  2LXB A;  4QMA A;  3WA3 A;  1SAR A;  3GAX A;  1M1K Q;  1HH0 A;  5CCG D;  4HM2 B;  1PP9 J;  2OGU A;  1LTS C;  1B20 A;  4GOE A;  4DKI A;  1TUH A;  4I4K A;  3UL6 A;  5EVH A;  3KHU A;  3MUD A;  1OHO A;  1JMB A;  2FFD C;  3BAT A;  5AVV B;  1OF5 A;  3VMZ A;  4HYZ A;  3PJS K;  1KOR A;  1YJ9 3;  3NV0 B;  1SQX J;  2LYX A;  2B89 A;  2OTK E;  2WQY C;  1QL2 A;  1GZL A;  1DMN A;  1IK9 A;  3CNM A;  4KHX A;  3L70 J;  3S5C A;  1GD3 A;  1NU1 D;  4GHO A;  4KFD A;  2OYH A;  4CDL A;  1B2S A;  1KZU B;  3RDE A;  5AI1 A;  1N73 C;  4C7N B;  3PHL A;  1RGG A;  1FZA A;  4HM8 B;  3P32 A;  2XH9 A;  1SQV D;  5M1B A;  1BRG A;  1USE A;  2NPS A;  1US1 A;  1BNI A;  1IVU A;  2H0G A;  2F5M A;  1YQ4 C;  1YHQ 3;  3L72 J;  1S5L E;  2C9N Y;  3EN8 A;  1O7W B;  1UW1 A;  1Q86 Q;  4K61 A;  2IBZ D;  1SQP J;  1VQ4 P;  3AGN A;  4O2H A;  7RNT A;  1ZGX A;  2ITA A;  1QAL A;  1OCV A;  3GF3 A;  4U7J A;  3CCL P;  4OWF A;  2AEF A;  2ZXE B;  1NU1 K;  3S9O A;  5CCH A;  1E79 H;  5JPP A;  4BRY B;  2P0X A;  2ZYD A;  2IFN A;  3H3H A;  2YXQ B;  2ZFC A;  2N1T A;  1YQ3 C;  1SQV K;  1OXZ A;  1FC2 C;  4N6O B;  3HZP A;  3CCM P;  3GMA A;  3MD0 A;  2XND H;  1RGC A;  1CQS A;  1NTZ E;  3HTK B;  5LC6 A;  3BCC G;  5KAF H;  1J1E C;  3LID A;  2RKL A;  2XRX B;  1FDO A;  1K9M 4;  3O6Q A;  1H89 A;  1PFI A;  4BIR A;  1DD3 A;  1NO3 A;  1EZV I;  2QJY C;  2BAS A;  3HIG A;  1SQB J;  1NTK D;  3L0R A;  1LWU C;  3EFF K;  1I2G A;  4RES B;  2JQ5 A;  3NM2 A;  1CYV A;  4RKU J;  1VQL P;  1LWU B;  3FWN A;  4N6J A;  1JY2 N;  1IVV A;  1HYF A;  1N7L A;  2KXP B;  1FBM A;  1I0X A;  3U1C A;  3H1I D;  2H0H A;  3N8B A;  1S2E A;  1LTG C;  2CFL A;  4FCZ A;  1YIT 3;  1ISK A;  1RNB A;  2FY8 A;  2HOD A;  1EG9 B;  1GOV A;  3CWB D;  1W7C A;  2BCC E;  2A45 G;  3DGL A;  2CFW A;  3L35 A;  2IDB A;  3G9R A;  3ECF A;  3HRN A;  2R44 A;  1BU4 A;  2JJL A;  1NU3 A;  2N9B A;  3F14 A;  4CCV A;  1X1Y A;  1LTJ C;  1P84 D;  1HJB A;  1BUQ A;  1BGY J;  2HG5 D;  3IN6 A;  1PPJ D;  3V4W A;  3U1W A;  1BRN L;  3SXX A;  3Q2P A;  1RF0 A;  1SQV J;  2ML6 A;  2N1T D;  3DZL A;  1JCD A;  3VMY A;  1FGM A;  2JDI H;  2CPB A;  2RBI A;  2CPS A;  1LOX A;  4DZO A;  1OMI A;  7STD A;  1YJN P;  1EZV D;  3K0Z A;  1KV4 A;  1DVD A;  3JCU E;  3WU2 E;  1RTU A;  2K37 A;  5BVZ A;  2CKF B;  1FDI A;  2KLU A;  1BRK A;  3TYY A;  2WT7 B;  2E76 C;  3Q5R A;  2IYP A;  3AE6 C;  4BU4 A;  3X3Y A;  3SVA A;  1GL2 C;  5AW4 B;  1W01 A;  1NHL A;  3HD7 C;  1RRL A;  3HD7 B;  1ZR2 A;  2H7H A;  4ASW A;  3FSD A;  5APW A;  3B4S A;  2FYU G;  3ZG5 A;  3RL0 D;  4H13 B;  1RQU A;  2XKM A;  1M90 4;  2Q3E A;  3VP8 A;  3LTB A;  5CXO A;  1G2C B;  3OWY A;  4R1K A;  2W8Z A;  3T8N A;  1M56 D;  4OGQ D;  1Q82 Q;  1FUT A;  1KD1 4;  1EXJ A;  3CCS P;  5AVT B;  1URQ D;  4JYC A;  3JC2 2;  1L5G B;  1NTK J;  1JY3 O;  3NV0 A;  2YXR B;  5KLI C;  2J5U A;  2KAA A;  1DMQ A;  3SSU A;  1OHS A;  3B8L A;  2OYI C;  3F8H A;  4IPB A;  3LYG A;  4HM5 B;  5AW5 B;  2ZHX B;  2OYI B;  2GUV A;  4WB4 A;  2WOF A;  5BXQ A;  1ZXG A;  3F5H A;  3H1H G;  3DGN A;  1K28 A;  1K73 Q;  1LNH A;  1N8R Q;  3R2P A;  2WSF H;  3LW5 H;  1JZO A;  4HBR A;  1W5Z A;  4EYY Q;  1WT6 A;  2QM7 A;  3NM7 A;  4IT7 A;  4OVM A;  1N73 A;  1RN7 A;  2V1L A;  1GU5 A;  3OW2 2;  1JY3 P;  1O7G B;  2QIY A;  2KIK A;  1C7H A;  1NTZ D;  2Z76 A;  3EF8 A;  4YXW H;  3KII A;  1VQO 3;  3J7Y d;  4XDW A;  1IVW A;  1LJ2 A;  1BRH A;  1H8A A;  1UDI I;  4A7P A;  3S67 A;  1GK6 A;  1T2H A;  2ZT9 D;  1GY6 A;  2KCD A;  1D7M A;  4BRY A;  1Q40 B;  1YIJ 3;  1IO4 A;  3BCC E;  1GTW A;  1RJO A;  3DUK A;  4J9A A;  5DJT B;  3A2A A;  3RGU A;  3AE9 C;  1QMA A;  1L4A C;  1YTZ T;  1RCK A;  3E7K A;  5M1A A;  1L4A B;  3BLZ A;  2BCC D;  1W2Z A;  1R5S A;  3PCS A;  2ZDJ A;  4BTW A;  4EOT A;  3U97 A;  2KZI A;  1K8A 4;  3HTK A;  4L74 A;  3WDG B;  2QJK C;  2CHC A;  1ULJ B;  4HH2 A;  1TRP A;  3WUV A;  5AIH A;  1FGQ A;  1AA0 A;  5AVR B;  1RNT A;  2FXP A;  1JBS A;  1E3R A;  3PXM A;  2MJZ A;  1LWU A;  3P8M C;  4R80 A;  5APY A;  2PGD A;  1BNF A;  2ZAE B;  3EFG A;  4HVN A;  4C7R A;  2ZL8 A;  1I0V A;  5CCG C;  1UGI A;  1W6G A;  5AVS B;  1Y9B A;  1X0T A;  2BMR B;  5CJ0 A;  3EBY A;  2B88 A;  2QM8 A;  1B2U A;  3U59 A;  1VZZ A;  3I55 P;  4PD4 H;  3CD6 P;  2C0X A;  1BVI A;  1BE3 D;  2RFR A;  3A0B E;  3S1K A;  4ZKU A;  1GW3 A;  3KSP A;  2WIT A;  1X1X A;  1ZN5 A;  2YMY A;  2WSC J;  1E3V A;  5DRV A;  3L74 G;  4O3V A;  1EQK A;  4IFF A;  1EDI A;  1NTZ J;  1RLS A;  2IFM A;  3FWL A;  4KZ1 A;  4OUQ A;  1FAV A;  4WWI A;  3H1J G;  1K9M Q;  3NBB A;  4U13 A;  4AEQ A;  5IER A;  1AVY A;  1OPY A;  2SPZ A;  3H1K D;  3K7C A;  2G3A A;  1OX3 A;  2FYU E;  2M5A B;  1OH0 A;  2W6A A;  1L0L G;  2WT7 A;  2IZ1 A;  4WY4 B;  2W9Q A;  5AW8 B;  3CXH E;  2KF5 A;  4NPF X;  1SS1 A;  3HK4 A;  4LEH A;  1GL2 A;  1VQ9 3;  1TIJ A;  3H6P A;  4FMC A;  3HD7 A;  1PFP A;  3Q5P A;  3FG1 A;  2RH0 A;  3SLU A;  3BIR A;  2WVR A;  3VP9 A;  3D9R A;  2BCC J;  2IA7 A;  2SBL A;  2YFI B;  2WPR A;  3Q3D A;  5D83 A;  2B87 B;  1D6Y A;  2P67 A;  1K41 A;  1YVS A;  1A67 A;  1NTM G;  1RGK A;  1NGM B;  4I1L A;  3CPW O;  1MWT A;  1PYL A;  3I56 3;  1N2D C;  4OK0 A;  1IK3 A;  3G4S 3;  5I97 A;  5KLV D;  2OYI A;  3WR2 A;  3Q1M A;  3DMC A;  3KZI E;  1Q81 4;  5AW1 B;  1J1D C;  3B4P A;  3PGB A;  5APQ A;  1BRS A;  5GTI E;  3PP5 A;  2GA1 A;  1L0N G;  1J1D B;  2F5W A;  1TJD A;  1MOL A;  1EA2 A;  3L71 G;  1IVX A;  2SAR A;  4AYC A;  3BRT B;  3K5T A;  4PJ0 E;  1OVR A;  2BIR A;  2A06 D;  1T2I A;  2QA4 3;  1CSB A;  3LOY A;  3F9S A;  4PD4 I;  5H2F E;  2HFE D;  5CLK A;  1BRJ A;  1J2B A;  5KLV K;  1SIH A;  4LSO A;  3N7N A;  1M90 Q;  1RN4 A;  3FG4 A;  2QEX P;  4H13 D;  1RH5 B;  1Q40 A;  1Z1S A;  1IC2 A;  1KD1 Q;  1LQM B;  1BRI A;  1IQ8 A;  3QH9 A;  3WHO A;  1L4A A;  1KB9 D;  1W6Y A;  3KPE A;  3AHW A;  3CMA 3;  5M18 A;  1TFK A;  4D6T G;  2R3S A;  1LTA C;  1D6Z A;  3CCQ P;  2BEZ F;  4BXL A;  2K1A A;  1LOV A;  4L75 A;  3GZR A;  2B1X B;  3AEA C;  1X79 B;  1RHL A;  3URP A;  3PLN A;  8RNT A;  1JMM A;  5AIG A;  1SQQ G;  2W03 A;  5BU5 A;  3AEF C;  1AJY A;  3F7S A;  3H32 A;  1SQX D;  1RF1 C;  3KSE D;  2F86 B;  3L75 G;  1AY7 A;  3UB1 A;  1RF1 B;  2GM4 A;  2XDJ A;  2CG0 A;  1QVF O;  3V6I A;  5HGR A;  3N4X A;  3HE4 B;  3RL0 C;  2W56 B;  3V4Q A;  3A5E A;  3CCU 3;  5IG4 A;  1RE4 A;  2Q1K A;  5KKZ C;  1NKZ B;  1NAF A;  4OGQ C;  3CC2 P;  1LOW A;  1VQ6 P;  1ROV A;  4N6L A;  3CXH D;  2GBW B;  3L74 E;  1URQ C;  4BL3 A;  1LRA A;  4JF7 A;  1URQ B;  3BCC J;  4QWT A;  1W5C E;  2WMM A;  1BSC A;  2FKW B;  1SQX K;  1NWW A;  1FYS A;  3D79 A;  3KE7 A;  4DOJ A;  1SQP D;  3D5G A;  1ZME C;  2YFJ B;  4MEI A;  3SOA A;  1L0L E;  2C10 A;  1JKG B;  2Z5H A;  1T8Z A;  1K8A Q;  2BEQ D;  1JEK A;  2P1J A;  1VQM P;  2E42 A;  1VL2 A;  2CFD A;  2C9L Y;  1GSP A;  1CW5 A;  4IL6 X;  1OFC X;  1IFD A;  5AW6 B;  2Z77 A;  5AW2 B;  4DJG A;  2M5A A;  1P84 H;  1GDT A;  1EQ7 A;  4WWU C;  2IZ0 A;  4WY4 A;  1R4Y A;  1A02 J;  4LLH A;  3V2N A;  1B2M A;  1VQ4 3;  4R4M A;  1LVN A; 
#chains in the Genus database with same CATH homology
 2OTJ 3;  2OQE C;  3GZY B;  1EKM A;  1W7C A;  2K54 A;  1FGT A;  4STD A;  3WMD A;  3CCL 3;  2CIU A;  5CF1 A;  3GZX B;  3DGL A;  2PZV A;  4EV5 A;  3Q90 A;  2CFW A;  4EC6 A;  3CC2 3;  3ECF A;  2P0M A;  2XEP A;  4AKZ A;  1VQ6 3;  1NU3 A;  2W04 A;  3FG3 A;  4N6U A;  1R4C A;  1DVC A;  1AR0 A;  3F14 A;  4CCV A;  2WO0 A;  4L8P A;  2QE7 H;  1BUQ A;  3U1W A;  1GD4 A;  3SXX A;  4X2O A;  3G0K A;  3Q2P A;  1O7M B;  3JUN A;  3CCM 3;  2CWV A;  3NXJ A;  5AEU B;  2ML6 A;  3DZL A;  1V74 A;  1FGM A;  2JDI H;  5IEO A;  4WFO A;  1LOX A;  1F8N A;  3G8Z A;  1FS0 E;  7STD A;  3CCE 3;  3MKI A;  1VQM 3;  4Q53 A;  3K0Z A;  3WOF B;  4EYC A;  3FF2 A;  4BTX A;  5A0O B;  3MG3 A;  3V98 A;  3M8C A;  1E97 A;  1DVD A;  4RNY A;  1VQL 3;  2CKF B;  2FGT A;  4XBT A;  2BHM A;  1VQ5 3;  3DXO A;  1A2K A;  2CC3 A;  2E2T A;  4PEJ A;  3MYT A;  1SPU A;  3VSY A;  3X3Y A;  3SVA A;  4HM7 B;  1W01 A;  3FLJ A;  1ULI B;  3CCR 3;  4MMY B;  1WMP A;  5CF2 A;  1RRL A;  1U8C B;  2XFS A;  5IF6 A;  3G71 3;  1M1K 4;  1STF I;  4NRE A;  5FGO A;  3FSD A;  3X3X A;  3SED A;  1HKX A;  2BO9 B;  1A2V A;  2W0Q A;  1M90 4;  4H61 A;  4FCM A;  3K63 A;  2INX A;  3LTB A;  2P05 A;  3TDG A;  4HZB B;  6STD A;  5CXO A;  3OWY A;  2W6J H;  4R1K A;  4LZI A;  5IW9 A;  4MMZ B;  3T8N A;  3BNB A;  3HII A;  4K1V A;  1KD1 4;  2XR8 B;  2CFK A;  3EX9 A;  3N9H A;  5KP1 A;  3ALA A;  3LTA A;  2BT3 A;  1N5H A;  2R4I A;  5CK6 A;  2OTL 3;  1Y4K A;  5LC7 A;  1L5G B;  3NV0 A;  2CH9 A;  1DMQ A;  1VQN 3;  3S27 A;  1FGO A;  1OHS A;  3B8L A;  2E5T A;  3F8H A;  4IPB A;  3LYG A;  1JV2 B;  4HM5 B;  1SQW A;  1OUN A;  3OXA A;  1N9E A;  1S72 3;  1AVL A;  2WOF A;  5BXQ A;  1IT8 A;  1GYB A;  2CWT A;  1YJN 3;  3DGN A;  2GU1 A;  1UI7 A;  1W2B 2;  1K28 A;  1LNH A;  2CFG A;  2MF7 A;  4WP5 A;  2A15 A;  3F40 A;  3K9M C;  2HMK B;  4HBR A;  3PS8 A;  3ROB A;  1W5Z A;  3NM7 A;  4IT7 A;  4OVM A;  1RN7 A;  2D1W A;  4K1U A;  1UUW B;  2V1L A;  4X2H A;  2GEY A;  5EEO A;  3OW2 2;  1O7G B;  2QIY A;  3F8X A;  1C7H A;  1JN5 A;  1M1X B;  4N3V A;  4JRF A;  1WMN A;  1Q86 4;  2Z76 A;  3CCJ 3;  3EF8 A;  4YXW H;  5AEW B;  3IJE B;  3KII A;  1VQO 3;  3WOD G;  3X3Z A;  1YVB I;  3J7Y d;  4XDW A;  3CPW 2;  1IVW A;  5IEP A;  3EC9 A;  1DMM A;  2IUJ A;  3CCV 3;  3KZT A;  3V92 A;  3PYJ A;  3LH4 A;  3G16 A;  3S67 A;  3I0Y A;  1G96 A;  4HM6 B;  3DGO A;  4KFF A;  1GY6 A;  2L4V A;  1YJW 3;  2KCD A;  5TGN A;  4WVZ A;  5AYS C;  1Q40 B;  3CNX A;  3CCS 3;  1YIJ 3;  1RJO A;  1UI8 A;  3DUK A;  4J9A A;  1NJI 4;  3NHX A;  5IG5 A;  3H51 A;  2HMM B;  2Y73 A;  4RBN A;  1QMA A;  1ZO2 A;  2QGU A;  2OOV C;  3UJM A;  4WYK A;  1OHP A;  5D82 A;  3BNC A;  5AYR B;  1KQS 2;  2LQV A;  3BLZ A;  2WOH A;  3CME 3;  1VQP 3;  1W2Z A;  3PCS A;  1AVK A;  2ZDJ A;  4BTW A;  3LT9 A;  3AMO B;  2E2V A;  2P09 A;  3U97 A;  3RGA A;  1IQX A;  1K8A 4;  5KP4 A;  4XB5 A;  4XBX A;  5ELU A;  3STD A;  3WDG B;  2FXT A;  4ORL A;  2F99 A;  2CG1 A;  2CHC A;  1ULJ B;  1YGE A;  1SJW A;  5AIH A;  3MPH A;  1FGQ A;  4R4K A;  1IV9 A;  2D42 A;  3KN4 A;  1TP6 A;  1E3R A;  2RCD A;  2BMQ B;  2GXF A;  3PXM A;  2O9U X;  4IIA A;  5D81 A;  4G1M B;  4R80 A;  3NUV A;  5KP3 A;  1D6U A;  2CWU A;  1LXE A;  3IMA B;  3KFQ C;  1RRH A;  1QAF A;  2B24 B;  1O7P B;  3X41 A;  1IT7 A;  4HVN A;  1N9J A;  2P38 A;  3EHC A;  5IEN A;  2ZL8 A;  5AII A;  3BB9 A;  1FUW A;  3JUO A;  1JB2 A;  4L8O A;  3PZW A;  1O7H B;  1W6G A;  3B7C A;  1N8Q A;  2OQE A;  3RGR A;  2PNC A;  4JF8 A;  3PCR A;  3Q1C A;  1YI2 3;  1Q42 A;  2BMR B;  2FNQ A;  3EBY A;  3NX0 A;  1VQK 3;  3S28 A;  8CHO A;  2OOV A;  1VZZ A;  3OX9 A;  3MG2 A;  4XDV A;  3X42 A;  5IG3 A;  4EXR A;  5ELJ A;  4AKY A;  2RFR A;  3WA2 X;  3CC4 3;  4GB5 A;  1JJ2 2;  2W2C A;  2V7Q H;  3KSP A;  3FH1 A;  4L7K A;  2STD A;  3T8U A;  1PU4 A;  3OV4 A;  3MWZ A;  3SOY A;  3USS A;  3EJV A;  4R9K A;  1BSN A;  5IG0 A;  1E3V A;  3F7X A;  5DRV A;  1FA3 A;  3CC7 3;  4H3U A;  2E2U A;  2YX9 A;  4O3V A;  4FCJ A;  1EQK A;  2ML5 A;  1QVF 2;  3OWU A;  1NDO B;  1QJG A;  1ROA A;  2RGQ A;  3DY5 A;  4KZ1 A;  3HX8 A;  4OUQ A;  4FMA A;  3LZA A;  3DM8 A;  2K0M A;  5AIF A;  2KXG A;  4RZM A;  3KKG A;  2XFT A;  3EBT A;  4R9L A;  3NBB A;  3B4O A;  4U13 A;  4GL6 A;  4AEQ A;  5IER A;  1OPY A;  3K7C A;  2GEX A;  4N6N B;  4O8S A;  3QRD A;  1OH0 A;  4HZ9 B;  1IDP A;  1T5Y A;  2XGL A;  4LGQ A;  3DGM A;  1KSI A;  1M9G A;  2W9Q A;  1QVG 2;  1QAK A;  1IQY A;  1W4N A;  4K90 B;  1IFP A;  3HK4 A;  4LEH A;  2I9W A;  1VQ9 3;  1TIJ A;  3GZB A;  1AQT A;  4FMC A;  2CK3 H;  2Y74 A;  4KVH A;  1PFP A;  3LT8 A;  3FG1 A;  3BND A;  1OAC A;  4MMX B;  1ZX2 A;  1WQL B;  3SLU A;  4HM1 B;  3OWS A;  2W9P A;  1JB4 A;  1Q82 4;  1JNQ A;  1KWI A;  3D9R A;  2SBL A;  2IA7 A;  2WGQ A;  4ZM8 A;  2YFI B;  3IPT A;  2OCT A;  1OGX A;  5D83 A;  1O7N B;  1MNL A;  3ER7 A;  3I55 3;  3UL5 A;  3CD6 3;  1IU7 A;  1D6Y A;  2W56 A;  3LTD A;  1K41 A;  1VQ7 3;  1A67 A;  2HMN B;  1HU9 A;  3GWR A;  3LML A;  4TLF A;  5STD A;  2Z6B A;  3D3L A;  2KRT A;  1NB5 I;  4J8T A;  3I56 3;  2RSX A;  4OK0 A;  1IK3 A;  3G4S 3;  2HMJ B;  5I97 A;  4XM4 A;  1K73 4;  3VF1 A;  1N8R 4;  1RKY A;  3HI7 A;  1WMO A;  1GY7 A;  3CPO A;  2XGN A;  2WGO A;  2MC8 A;  3DMC A;  4N6V 0;  1Q81 4;  1VQ8 3;  3B4P A;  3PGB A;  3MHE A;  2E5Y A;  1AV4 A;  2C11 A;  4EBG A;  1W02 A;  4HKV B;  3S29 A;  1MOL A;  4FMD A;  4HM0 B;  1EA2 A;  1IVX A;  2XF3 A;  3K5T A;  1JKG A;  2WSS H;  1JB5 A;  2UX0 A;  3MG1 A;  1UUV B;  2HMO B;  4HJL B;  3UNL A;  3V99 A;  2QA4 3;  1CYU A;  3LXU X;  3LOY A;  3G6E 3;  3F9S A;  4QMA A;  1ASK A;  3WA3 A;  1WNH A;  3GAX A;  2IUK A;  2HML B;  5CLK A;  4HM2 B;  2O3O A;  3X40 A;  1J2B A;  1SIH A;  4LSO A;  3NQY A;  3JUP A;  1TUH A;  4I4K A;  3UL6 A;  5EVH A;  1OHO A;  1OF5 A;  3FF0 A;  3FG4 A;  4HYZ A;  3PJS K;  1Q40 A;  1Z1S A;  1YJ9 3;  5JPU A;  3JUM A;  4HM4 B;  4XBY A;  1S5A A;  3NV0 B;  1NB3 I;  4N6T A;  1IQ8 A;  2M7O A;  2LYX A;  2OWP A;  3FKA A;  1W6C A;  4KFE A;  4TX4 A;  1DMN A;  1W00 A;  1W6Y A;  3CNM A;  3CMA 3;  3AMO A;  4NHF A;  3S5C A;  1TFK A;  3NBJ A;  1GD3 A;  5JBS A;  4KFD A;  1D6Z A;  1TU5 A;  4MJD A;  4BTY A;  4CDL A;  3RDE A;  5AI1 A;  2IMJ A;  3GZR A;  2B1X B;  1CEW I;  4HM8 B;  4N6M A;  1WTH A;  2XH9 A;  5BVB A;  2CW9 A;  3FGY A;  5AIG A;  2BNG A;  3EN1 B;  1US1 A;  5G2G A;  3VGN A;  3O8Y A;  1IVU A;  3T0U A;  1JN5 B;  1U5O A;  2F98 A;  2W03 A;  3F7S A;  3CXC 2;  3KSE D;  4FMB A;  4HM3 B;  1TFO A;  2F86 B;  3FCS B;  3UB1 A;  3LTC A;  1YHQ 3;  2CG0 A;  3EN8 A;  1O7W B;  5HGR A;  1UW1 A;  4K61 A;  4O2H A;  3A76 A;  1IV7 A;  3CU3 A;  3FZW A;  1QAL A;  2W56 B;  1GS3 A;  3NBR A;  1OCV A;  4WHA A;  3CCU 3;  1KC8 4;  5IG4 A;  2GBX B;  3MSO A;  1E79 H;  5JPP A;  2P0X A;  1ROV A;  2QEX 3;  1STD A;  1SII A;  4RNZ A;  3H3H A;  2XSO B;  4N6L A;  2GBW B;  2YFL B;  1BSH A;  4O02 B;  4FR9 A;  1FGR A;  3WOE B;  2Q07 A;  4WYK B;  4QWT A;  4N6O B;  3HZP A;  2XND H;  1CQS A;  1NWW A;  3KE7 A;  1OGZ A;  2GU3 A;  5LC6 A;  2YFJ B;  2XRX B;  3CCQ 3;  4MEI A;  3SOA A;  3NQZ A;  1K9M 4;  4LMI A;  2Z7A A;  2C10 A;  5DRE A;  3JVC A;  3GRD A;  1JKG B;  1NO3 A;  1Q7Y 4;  1JEK A;  3HIG A;  5FW5 A;  2XSH B;  3JUQ A;  3L0R A;  2CFD A;  3EFF K;  1DYU A;  3EE1 A;  3SX1 A;  3QK9 A;  2JQ5 A;  4EV2 A;  3NM2 A;  1CYV A;  1JRQ A;  3BNE A;  1A90 A;  1N5P A;  2Z77 A;  1GY5 A;  1IVV A;  2BMO B;  4DJG A;  4WWU C;  5EQL A;  3N8B A;  3E99 A;  3N54 B;  2CFL A;  3EB8 A;  1OF5 B;  4FCZ A;  1YIT 3;  1VQ4 3;  1ISK A;  3EQQ B;  1EG9 B;  1LVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...