2CK3H

Azide inhibited bovine f1-atpase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How Azide Inhibits ATP Hydrolysis by the F-Atpases.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2ck3H02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ck3H01
1AQTA 1E79H 1BSHA 2CK3H 2XNDH 3USSA 2JDIH 2QE7H 4DJGA 2W6JH 3EFFK 4QMAA 1JEKA 3PJSK 1BSNA 2WSSH 4TLFA 2E5TA 2E5YA 1FS0E 1IFPA 4YXWH 4WVZA 2V7QH
chains in the Genus database with same CATH superfamily
3GAXA 1JKGB 1NJI4 2P09A 1PP9E 4K90B 1SQVJ 1PY3A 2KS1B 4HB1A 1X0TA 1QVFO 1NTMD 1SQQJ 1BE3D 3A76A 2Q9IA 1U8CB 4R4MA 2B87B 1BSCA 4QMAA 3HE5A 5IERA 4J5KA 1URQB 2M3BA 3A0HE 3VF1A 1L4AA 1B2ZA 1G1IA 2H89C 1SVFA 2E74C 5APWA 1WMOA 4ORLA 3UNLA 2L5GB 1EXJA 3SX1A 2K88A 1IZNB 3DM8A 4MEIA 2KXGA 2SBLA 1L0NK 3L72G 3KE7A 1ZW0A 2W8ZA 3MG2A 1MWTA 2A45H 3MWZA 2J59M 1Q9EA 4WY4C 2K54A 4JPZB 5AVUB 3CCQ3 1IFPA 5AVYB 1ZX2A 4WB4A 2HMJB 1NO3A 2ZHXB 4K1VA 4H44C 1LOWA 5AIHA 1Z56A 3PLNA 2MJZA 3P7KA 3JUQA 1QVF2 2LXCB 2AXTH 4EV5A 1ZXGA 3L72E 5KKZC 1UDII 2Y74A 1RH5B 1EQKA 1PU4A 1FU1A 5AVXB 1D7MA 4ZM8A 3CNMA 1H88A 5CHXA 8CHOA 5M1BA 3GZXB 4IPBA 1BGYJ 2I8DA 1PYLA 2WMMA 3OWUA 4XBTA 4AKZA 2B88A 3I5CA 3CWBG 5C39A 5KLIB 1JKGA 3D6YA 5G1LA 1ASKA 1Q7YQ 1BSDA 1TFOA 3CCL3 3CWBD 1QL2A 4WFOA 1S9KD 2N1TC 1N8RQ 1YTZT 1PFPA 3X41A 1FS0E 2NZ2A 3RNTA 4RZMA 1PGQA 1FE6A 4EIJA 1JNQA 2AADA 3H3HA 1PIXA 2BCCJ 4JYCA 1RMSA 3RBZA 2PP6A 4FMAA 2R5DA 3F7XA 3RK2C 1BSEA 1IC2A 1FJPA 1JO5A 5AVZB 1T8ZA 3O6QB 4D6TJ 1HF9A 2CC3A 3EFGA 3AHSA 1J1EC 1YI23 2RSXA 2P67A 4OVNF 3SWYA 2IMJA 5AIIA 1LNHA 1TIJA 1ZR2A 1ZP0C 2ZYAA 2W56A 2XGLA 3JUNA 2QJKB 2D1WA 1R4CA 3KSPA 3VSYA 2P1JA 3WOFB 1CQSA 1NTKJ 4H13B 2FXMA 3K7CA 3NTNA 3CC23 3BNEA 4KFDA 1K28A 2JWAA 2RKLA 1JOCA 3EB8A 3KZTA 3L36A 1MFZA 1SFCD 3JCUE 3VYIA 5KLVG 1FYSA 2HMLB 2YX9A 1AVKA 1S1CX 3H1IJ 2KYVA 3SWFA 1N5HA 3BNCA 3CPOA 2KXPB 4PJ0H 2OGUA 2K9YA 3MGNA 2RMZA 1EC5A 1IYYA 4NPBA 2W83C 2OTLP 1GY5A 2XV5A 1FOSF 3AECC 2XEPA 3VMZA 1OH0A 3LXUX 1QAKA 3JUMA 1G02A 3C8VA 4IL6E 4L8PA 1B2UA 1N2DC 1MUUA 1SS1A 1KSIA 1KQFB 5AYSC 3H51A 1FW7A 2E2TA 1GTWA 1A67A 1K04A 1G0TA 1G96A 3G4SP 5AW6B 1RGKA 2P58A 2POHA 2YKQA 2ZXXA 1S72P 3PS8A 2OYIC 2V4HA 1IQXA 1Q2NA 1VQO3 3L4FA 3ZDMA 2YKOA 1PFIA 5E79H 1EKMA 2LYXA 3X3ZA 1KB9I 3H6PA 4FR9A 3EBYA 1N73B 2M5AB 3T97A 3BCCD 1JY3O 1NU1G 5AIFA 2JKVA 1U7JA 2QG4A 2JJLA 1M57D 1SQVE 2L91A 1FGTA 1MGWA 4LSOA 1CH0A 1KQS2 1S3JA 5AEWB 1SQXJ 3NM2A 2RFRA 1NTKD 2HR3A 3LZAA 1YI2P 3CCU3 4U3FG 3L73E 3CMAP 1PGPA 4WWIA 4CPGA 3Q90A 2CWTA 5KLVD 1Y9BA 5BXQA 3CMEP 3FCSB 1AV1A 3OV4A 1JBRA 1HZ1A 5IG4A 2M0BA 2YFIB 1YTZI 3X3YA 1NU1K 1KILB 2OTJ3 3HUSB 3NUVA 4NHFA 3DGMA 2WT7A 1L0LJ 1KFMA 1SP4A 2WVRA 3M9QA 4BXLA 2QEXP 2OOVC 1PP9G 3L74E 3AE7C 1RN1A 1L4AD 3AGNA 3TSIA 2CPBA 2R32A 2MF7A 4XDVA 1B3SA 1PPJD 5CF2A 3Q1CA 2YIUC 3D6ZA 1S5LH 3EFFK 4U7JA 2B89A 1K05A 2E76B 3G0KA 1G2CB 1O7PB 1VF5B 5M19A 1IV9A 2K3DA 3P32A 2GEXA 3BLZA 3S28A 3AE5C 3VGNA 2WZ7A 4G1MB 2IFNA 1VQ4P 1TJDA 3LTBA 4R4KA 4EYCA 1X8YA 3I553 1V57A 1BNGA 3M9BA 2W90A 2PFXA 2GU3A 3CNXA 1LTTC 3NV0A 4WP5A 1YJ9P 5HGRA 1S9KE 2P10A 3L71J 3STDA 1W5CE 2R3SA 1ZRTD 1IV7A 4WYKB 2GBXB 3R4YA 4YXDC 1I0VA 3IF4A 3P8CE 3F14A 4M3LA 3R2PA 4GDOA 1SQBJ 3Q3DA 3AE1C 1EXIA 2MKVA 3MSOA 1PZQA 4KFFA 3PRJA 1FZCC 6RNTA 1KWIA 3GF7A 1RF0A 3L71E 3EQ2A 3HTKB 1A2VA 2FYUG 4EV2A 4TX4A 2FKWB 1OX3A 1I70A 1LWUC 2ML5A 5AW3B 1HUCA 1JCCA 2C10A 1DEBA 2YMYA 2XR8B 1CI6B 2HMNB 5BU8B 5IF6A 3KIIA 1N7LA 1YNVX 1ZR4A 1JCDA 2OYIA 4MN4C 1NTMG 4KT3B 2C11A 3LOYA 4D6TD 1KYOH 1NWQA 5K5GB 1Y4KA 1EEJA 2R41A 1MWRA 1JMBA 3S5CA 2STDA 2LR2A 4HM3B 1H0TA 3CCE3 3H1LD 3WDGB 3CD6P 1NVOA 5GTIH 1JBSA 2OTJP 1CZQA 1L0NG 1IT8A 1DEEG 1GYBA 1RCLA 3DGNA 3JVCA 1BVIA 4JF7A 3L72D 1DD3A 3BIRA 1M56D 1QEXA 3EHCA 3H32A 3UL6A 4UB6E 1RNTA 3FGYA 4X2HA 3LH4A 3SXXA 3B5NC 2AXTE 4R9KA 1KC8Q 2WSEJ 2F56A 3UL5A 3CCMP 2WSFJ 3KYQA 1AQ5A 1W01A 3FF2A 4MMYB 3CX5H 4OWFA 3OW22 4N6MA 1VQ43 4HVNA 2KF3A 4WY4D 3B8LA 4KJMA 3GLMA 3QRDA 2QJPB 1OFCX 2WGOA 4N78E 1LTJC 3BNBA 2ZYDA 4A7PA 2R5BA 3GWRA 3LYGA 3MD0A 4BRYB 2FNQA 1DD4A 3WUTA 2Q7CA 3T0UA 1QALA 1GK4A 1Q864 3H25A 1T5YA 2WO0A 4KZ1A 5KJ7C 1RGEA 3SWKA 2HYNA 1YHQ3 1NTMJ 1OCVA 2DW3A 3U1CA 3BVHA 4IFFA 2N1TA 3FX0A 1ISKA 2Z5HA 2V1LA 4J8TA 5KAFH 1K41A 1VQ9P 4J5GA 2IBZE 3O8ZA 3S27A 4U13A 3IFMA 1Q42A 2YFLB 1SQXD 1T2KC 1LNIA 2BMOB 4XE5B 2JR8A 3MTUE 2Q07A 5BIRA 2BEQD 4FCMA 1KILC 3NFQA 2E76C 4O9BA 3H1HE 2KNCB 3GZBA 1DH3A 1OIPA 4C7NB 1YJNP 1OPYA 1IO4A 4IIAA 3GMAA 1BRJA 3TGUJ 1W6GA 1MKMA 2QA43 1W2EA 3Q3FA 3HTKA 1JB0J 2HG5D 3Q2YA 2YO3A 3L74G 5CLKA 1D6YA 5L8RJ 2LXBA 1JN5B 2UX0A 4LGDE 4KHXA 4WY4A 3MG3A 2H8PD 2HLOA 2WSCH 4H61A 3H1KJ 1K73Q 1RQUA 4EDFA 3V92A 5KTBA 1A2PA 1VQ93 2XFSA 4O3VA 2WSEH 1FDIA 1BOXA 2MC8A 2KP8A 1H0TB 3VP8A 2O01H 4GOEA 4OGQB 5DJUB 1BRIA 2OTKE 1NNVA 1TUHA 3D71A 4HM4B 3PZWA 3L73J 1W6CA 5APUA 1Q40A 1L4AC 2FYZA 3UIAA 5AVWB 3N9HA 1J1EB 3JC22 1RHZB 2CPSA 3G3ZA 3WU2E 3RK2D 3CCLP 5AIGA 3LIEA 3H1IG 1BNFA 4CDLA 4OVMA 1KYOD 2H7HA 3QWOC 1SFCB 2OCTA 3H1ID 3W67A 1ZN5A 4NPEA 3WR2A 3V2PA 1FUWA 3B71A 3H1JG 4IL6X 1R8EA 1SQBG 1IFDA 3X40A 1MNLA 4I7ZC 2NPSB 5H2FE 1OW7A 3F40A 1UCKA 4XA4A 1OXZA 1VQNP 2ZA4A 1GDTA 3NBBA 4EC6A 2RGQA 2LQVA 1FGRA 1JUNA 1KB9D 1NTKG 1S2EA 3USSA 5M18A 2NPSA 4ILFA 2F99A 4R9LA 1BE3E 1TFKA 1U5OA 3UJMA 2FYUE 2HPCA 3IR9A 1YJW3 1MWUA 2GA1A 1USDA 2XSHB 1BUQA 2O3OA 1WRGA 2C9LY 4I2LC 2KUBA 1YHQP 4PV1C 1BNRA 1IFNA 1FZCB 3OXAA 3T97B 1ZOYC 1N7SA 1N86A 2P38A 1SQWA 1PP9D 2B1XB 2GSPA 1UIXA 1RN7A 2R4IA 2Y0EA 3BATA 4HM8B 3K0ZA 3IN6A 3A0BE 4Q53A 1DMNA 2NRGA 1FDMA 2JP3A 3A7OA 4JRFA 1GSPA 3BCCG 3G71P 5KP1A 5CJ0A 2D2CC 3H1LE 1NTZJ 1UI8A 1SQXG 2YNYA 1BRHA 5G1KA 1SQQE 4HJLB 3PH0A 1Q824 5LC6A 3RK2B 1NKZB 4H0LD 4C7NA 2IX7C 1GZLA 1BRGA 4HM0B 1VF5C 1LTJB 1LTAC 2FFDA 1M1KQ 2FXPA 1S5AA 1L0ND 1FZUA 2AEMA 3CU3A 3DH2A 3HD7C 3F7SA 3DXOA 3F89A 2UGIA 2V7QH 1RCKA 1UCJA 2BCCE 2HMOB 1FZEA 3CCJP 1RE4A 3M0DC 1SFCC 3L74D 1BCCE 5IG5A 4DZOA 3CCQP 2C9NY 4MMXB 3D79A 5E79E 1OZHA 1FAVA 4H0LB 5AW1B 1K734 3OWSA 3V6IA 2Q3EA 3BRVB 1YQ4C 1OW6A 3BB9A 4K3AA 5CMZA 2I1KA 1KTMA 1UW1A 1QMAA 5AEUB 4NPFX 1IU7A 3BU4A 3GZYB 1QL1A 3WOEB 2XKMA 1HJBA 3T8NA 5D81A 1N7SD 4KT0J 1ROAA 1LWUB 4IFDK 2OYHB 1VF5D 1EA2A 1YYCA 1CW5A 1IFMA 1JY3N 3H1HD 3KCHA 4TLFA 5KAIH 2XU6A 3EF8A 2V7QJ 1PP9J 3VP9A 2G3AA 2WQYC 2A06G 1M8OB 1Q86Q 1YIT3 7STDA 3JUPA 1L0LE 1GW4A 4JYBA 3RDEA 1SQVK 3V2NA 3D5IA 3RL0g 5CCGA 1VQP3 2E75C 2HMMB 1M1XB 5JBSA 1P84D 3IAOA 1VQN3 2IYOA 2Z4EA 4LEHA 5B66E 2KCDA 5CCHD 1GL2B 4GSPA 1W4NA 5DJTB 1RLSA 4TT3H 3TNUB 4HH2A 2JWDA 3S4RA 3CXHD 4CPKA 3RL0D 4N78D 3BNDA 3F9SA 1DMMA 2HODB 5APXA 1UUGB 2OQEA 3GZRA 3L70E 4OGQC 1JZOA 1SQXK 5KP3A 1YGEA 3U1AA 1EG9B 1X1XA 2F98A 3D70A 3B4PA 4R1KA 7GSPA 3T8UA 4O2HA 3LIDA 1M9GA 2W03A 2RBIA 2ZYGA 2B24B 3A2AA 1RDSA 1JMMA 5DREA 3PTZA 3HI7A 3TGUD 1NTZG 2O1KA 3L37A 1JV2B 4EI2A 4YXWH 1TU3F 5EQLA 3RGAA 1RKYA 2KS1A 2W2CA 1IJDB 2KF6A 2CG0A 5APTA 3M0AA 2LKMA 2E74D 3B5NB 3B8EB 2BT3A 1QGKB 2L4VA 1M1JA 1RTUA 1VDFA 4XBYA 4Y99B 3MPHA 2ZT9C 5EVHA 3G9RA 1RGLA 1KILE 2OWPA 3CCEP 2W6AA 3B7CA 2ML6A 3CXC2 2QSIA 4WVZA 4RBNA 2CH9A 2YFJB 3FWNA 4CJNA 3H1KE 1R5SA 1O7WB 1VQ8P 4I5QA 3Q5SA 4HOHA 3GF3A 4ZMDA 1YBKA 1US1A 1HWTC 2CX1A 1JEKA 1BGYE 5TISH 2IPPA 1VZZA 3GHGC 1X1WA 1BNSA 4HBRA 3G16A 4WBAA 1NO4A 1RRHA 3CD63 2E75D 1BDDA 2ZXEB 3TF5A 2PGDA 1OHOA 1LT9A 1NAFA 1NTZE 4OK0A 3MUDA 1M90Q 1MOLA 1LP1B 3QK9A 1VQ5P 5IEPA 1GW3A 3S29A 3CLQA 1I3FA 1UUVB 1OW8A 3WUVA 1Y47A 1N7SB 1NB3I 1BNIA 2CFGA 4RNTA 1BNEA 4H3UA 3V4WA 3MZWB 1R4YA 3FG1A 3RGRA 1FA3A 1M904 2WPVB 1LJ2A 2WPSA 1NTKE 1LRAA 4LMIA 2OARA 4I7ZB 3P8CD 1C54A 2Z6BA 2BMQB 1BCCD 4O02B 5EFWB 4U3FJ 2QM7A 1SQVD 1NTKK 1RE3C 5HOHA 3L72J 1T3UA 1KB9E 2Z77A 2INXA 3BRTB 1AVOA 2BMRB 2XDJA 1DVCA 3CC7P 2FY8A 2WWWA 3PJSK 3EX9A 3V2QA 3WA3A 3CL3D 2JQ5A 1MV8A 4N6V0 2A06E 2FFDB 2E74B 1SQPJ 3RL0B 2IA7A 2Q5UA 1BGSA 2XH9A 2IYPA 4YTPC 4RJTA 1NDOB 1L0NJ 2HFED 1N73A 1O7GB 2CG1A 2FXOA 4GODA 3DY5A 2ZAEB 2Z5IA 3NHXA 3JCUH 1J1DB 2OYHC 1PPJE 1OUNA 3KDPB 1GY6A 1U7MA 2A45I 2KSJA 2Z76A 2WPQA 1SQBK 2KLUA 5H2FH 5BVZA 1O7NB 4YPCA 3MYTA 5CCGC 1LGHB 2PAJA 3CWBJ 3CME3 1JB2A 1VQQA 4N6OB 4DJGA 2IDBA 4W7ZA 2ZFCA 1VQ83 2O01J 2E75B 2FBWC 1I0XA 1VQKP 3HRNA 2L1SA 3OJAB 3HOHA 4C7RA 5APYA 1OACA 3X42A 4I6MC 4IFMA 3CXHH 2BEZF 3EWKA 1KQLA 2O1JA 1FGQA 3U1WA 4OGQD 3OA7A 4I4KA 1LTIC 2PNCA 1HBWA 3HIIA 1LNQA 4PV1D 2P0XA 5KLIC 5STDA 4LZIA 1RY3A 2FYNB 2KF5A 3G8ZA 3EBTA 2E5TA 1HGVA 1SQQD 1RF1A 3B4SA 3SYUA 2IBZG 1I8VA 3BCCE 3VTPC 3AE9C 2M7OA 1AA0A 2WPRA 2I9WA 1IK7A 4D6TG 3FH1A 4W7YA 2IUJA 3D5GA 3HIGA 4RESB 5AVTB 3BCCJ 1VQ7P 6GSPA 5KLVK 1SQPG 3WMDA 2H88C 1B2XA 1BUJA 3HD7A 1GOVA 1BSNA 1LXEA 1BAOA 1D6ZA 5APSA 5BU4A 3HUSA 3Q2PA 5CCHA 5GTIE 1PL5A 3CC4P 5AVVB 3L75E 1BSHA 2ZVOB 2JO1A 5KAFE 2CHCA 3DGYA 1OWAA 2CFWA 3CXHE 4GB5A 2W56B 1S5LX 3N4XA 5AW5B 3KFQC 3CX5I 2BIRA 2FYNC 4HKVB 4FMBA 3GW6A 1KD14 2F4YA 5CJ4A 3WU2H 3ECFA 4BIRA 2IYJA 1HH0A 3V2RA 3Q5PA 4IT7A 3MHEA 4FCJA 1M1K4 3AMOA 7RNTA 3CCV3 4BTWA 1SLQA 4L8OA 4L7KA 1RGHA 5KLVJ 5JPUA 3CC2P 5FGOA 1NKNA 2WOFA 8RNTA 1L0LD 1NTZK 1TRQA 2Y0DA 2H0GA 2H0HA 4N6TA 1SJWA 4J9AA 5KAIE 3L0RA 4N6LA 1NTZD 4PV1B 1HKXA 3X3XA 1GS3A 3B4OA 3OW2O 1HTLC 3CX5D 3CCS3 1LP1A 2XNDH 4ZNCA 3NBRA 4AYCA 1LT9B 2R44A 2JEEA 3H32B 1SQPE 1HU9A 3EN1B 1GL2A 1FZBA 1DMQA 1IVVA 3I563 5IEOA 2K0MA 4K61A 1Q7Y4 1H8AA 2HMKB 1HYFA 2B9BA 3CCUP 4D6TE 3V5BA 2C4BA 1NU1J 1VQ6P 1KILD 1EZVE 1UIIA 3C9IA 1VQMP 4ASWA 1EDLA 1LVNA 2GUVA 1NTME 1OVUA 3H1JJ 1E97A 1KB9H 1T2KD 3PHLA 4LLHA 3V99A 3AEDC 1Q81Q 1T2IA 3MHVA 1GU4A 5B66H 2IUKA 3A3YB 1DETA 3CCRP 1LOVA 1WMPA 1WTHA 4L75A 2YXRB 1VQ53 3L71D 1Q814 3FSDA 1MGRA 2KF4A 4BRYA 5FW5A 4PD4H 1FZAA 3IJEB 2W0QA 1STFI 5KJ7D 2CK3H 1BU4A 1PGJA 4STDA 1BRNL 1L2PA 4HAAA 2W04A 3KHUA 3AE6C 3H1HG 2KZJA 3GSPA 1WMNA 4CCVA 4DCKA 2Y9ZA 1URQA 5GSPA 3SFEC 4HYZA 3H1KD 3QH9A 2E2UA 2E5YA 1HJ0A 2GM4A 3ZFZA 1MWSA 3CPWO 4BWNA 3WA2X 3J7Yd 2QJYB 3D4AA 3L35A 2HODA 2RNTA 3AGOA 1G1JA 1M7LA 1KZUB 2AEFA 2YIUB 3M8CA 4AQRD 1N9EA 2CIUA 2Q1KA 1VQK3 4WYKA 3JUOA 1QLED 1GL2D 2M3EA 1KD1Q 3NV0B 2C0XA 1YJN3 1RGGA 3DZLA 2FFDC 3B5ND 1VQ73 2D2CB 1EUIC 2GEYA 4OUQA 4HM2B 1PV3A 4NPDA 1LTSC 2F86B 2KZIA 1WQLB 2RCDA 3RK3B 4PEJA 1P84I 1IDPA 2GBWB 1PGOA 3FXEA 2K37A 3S1KA 3F5HA 1AVYA 2SARA 1OGXA 2K9JA 3HE4B 1EZVG 3AMOB 1UI7A 1E3RA 3ER7A 1N8R4 2F5MA 3G4S3 4QWTA 5A0OB 5IG0A 5KJ7A 3MG1A 4XM4A 1GOUA 1N7SC 1TU5A 3A5TA 1SQVG 3W68A 2O9UX 1KQSO 1U57A 1FJKA 1B2MA 5CBNA 3AEFC 1NU1E 2IZ0A 3UB1A 1URQC 1KN7A 3KKGA 4UB6H 2FXTA 1I2EA 1QJGA 1Q7HA 3RBXA 1YJ93 2XZRA 5CF1A 1LTJA 1Q90D 4HM6B 3CC43 4H13C 1YQ3C 5LC7A 1P84E 3F8XA 1SARA 1AQTA 1FBMA 4EYYQ 4BL2A 1JY2O 3H1LJ 1RN4A 1VQPP 4GIFA 1YGWA 2QA4P 2QIWA 2M5AA 2Q6QA 1SQQK 1VPCA 5AYRB 2K1AA 2J8XB 3RK3E 1L4AB 3N8BA 1FDOA 3HX8A 2YKPA 3MIWA 1ZO2A 1T3BA 2WSCJ 2YXQB 4BTXA 3HD7D 1A2KA 2E2VA 1J2BA 2WGQA 1X79B 1ZV8A 3IPTA 3EJVA 1ULJB 1FGMA 1SQBD 2ITAA 3LT8A 1B20A 4JF8A 3AEGC 1I2GA 2QRXA 1UUWB 4RO0A 5IW9A 3LW5H 1LOYA 1NOHA 3VMYA 1YVBI 2FYUD 3U97A 5CBOA 1AVLA 4PD4D 2D2CD 1YJWP 3Q1MA 2WSSH 3NX0A 3L75D 3L71G 1Q40B 1KMIZ 2QEX3 4ZKPA 2IZ1A 3HD7B 1IT7A 2H43A 4H44B 2KOGA 1MFTA 1BDCA 2BCCD 2FYUK 3S9OA 4O8SA 2QIYA 5B5EE 2M8RA 3CCSP 1QAFA 1BGYG 3AEBC 3LTCA 1BIRA 1C7HA 3N54B 1ZS7A 1Y8AA 3L70G 3LT9A 1CSBA 1EZVD 1G2CA 3ALAA 4HZBB 4HJGH 3PCRA 5IG3A 3CPW2 1R5LA 2ZVNB 4N3VA 1LWUA 4BL3A 3LW5J 4R4LA 1BNJA 3CCM3 1FZCA 1GMQA 2UUGC 5AW7B 1K8AQ 4MMZB 5AW2B 3CCR3 3NBJA 3C1LA 3KZIE 1B27A 2P2UA 1KORA 3CXHI 3EN8A 1OGZA 1BSAA 3TDKA 1L0LG 3CX5E 1RHLA 3CC73 3E99A 1A02F 1Q82Q 2GXFA 1SQPD 1KILA 3M9HA 3HK4A 3O8YA 3K5TA 2N9YB 3NXJA 1VQ63 1JBTA 4N6NB 4HKZH 3HUSC 5GTHH 1JB5A 2HOHA 1KC84 1T3JA 3DGLA 5IENA 1IVWA 1KV4A 1M1JB 2YMKA 3SOYA 1NU1D 2ZT9B 3KN4A 5AI1A 2QJKC 2CW9A 4MJDA 3WUUA 3CMA3 3M91A 4XFJA 2D42A 5CXOA 1KYOI 2KSEA 3H1JD 2N9BA 3L73G 1JM0A 1WMKA 2CWVA 3ITKA 5RNTA 1JTHA 3VMXA 3L70D 3TYYA 2Q3IA 3URPA 2J58A 1RF1C 4HM1B 4H13D 3E1IA 1BCCG 1W7CA 3FXDA 1SQPK 2Z7AA 1YIJ3 1OHSA 1FGOA 1URQD 1OMIA 4PJ0E 2BCCG 4GT1A 4WY4B 3AHWA 1I2FA 5ELUA 1OVRA 2KNCA 3NXSA 4XDWA 1ZMEC 3LMLA 3DMCA 2NPSD 2P0MA 1NAYA 1RQVA 1AQZA 3U59A 2BNGA 1SQQG 1W6YA 4K1UA 1SPUA 4NREA 3PP5A 3ABVC 3NQZA 2UWJE 1JN5A 3B5NA 4C46A 3N7NA 1Z1SA 3OX9A 4XB5A 1LT1A 4UB8E 3G6EP 3DUKA 1JJ22 1NYHA 5D83A 5BVBA 1JY2P 2SPZA 2A45G 4EXRA 3II6A 1BRSA 5TJHA 1NTMK 3SFDC 1ZRTE 3CI9A 4B86A 2OYHA 1GL2C 1MZ9A 2KI7B 1W2BO 1N73C 1S5LE 5AVSB 2KIKA 3D9RA 3SVAA 2O3JA 1B21A 2KAAA 1W5ZA 1BGYD 1E5WA 2WTYA 3KSED 3MP7B 2XFTA 3S67A 1EZVI 2RH0A 2ZT9D 3OWYA 3FZWA 5DRVA 1AR0A 5M1AA 1ROVA 4JBZA 5KLVE 1ULIB 1NH4A 4LC1A 1B2SA 2WSFH 1RSNA 2N1TB 3FGAD 1F8NA 3CCVP 3H1HJ 4N3YB 3FG3A 2BO9B 1NGMB 4RKUJ 2W27A 3L70J 1W2B2 2VRSA 1IQ8A 4N6UA 1IVXA 1RE3A 3I0YA 1SQBE 4WHAA 4EW5A 1RF0C 1TP6A 3AE8C 2CX0A 2OTL3 3ZG0A 4PD4I 2CFLA 2KLVA 2CFDA 3SEDA 1NU3A 1FZGA 2KB7P 3E7KA 4AUWA 1A90A 4HYTB 4L73A 3A5EA 1WT6A 3PYJA 2Y0CA 1RGCA 1E3VA 1YITP 3CCJ3 1YVSA 5AW9B 3RL0C 3EE1A 1AY7A 5B5EH 3ZG5A 2GUSA 1LQMB 1AJYA 2AXCA 4K35A 1VQLP 5CCHC 1BE3G 4GOFA 2QJPC 4HM7B 2A06D 1OF5B 2KK7A 3CWBE 4IOIH 3GHGA 3TNUA 4DT0A 1FUTA 4LGQA 1KQGB 5AW0B 4L76A 2W9QA 3TGUE 1FOSE 1GMJA 2IY2A 1OF5A 5CK6A 3FWLA 4PD4E 4R80A 5EEOA 2QJYC 2B87A 3WMM0 3WHOA 3EQQB 5CCGD 3G713 6STDA 2XGNA 1JY2N 3PGBA 3H1JE 3G6E3 3JSVC 1JY3P 1USEA 2YO2A 2HPCB 2FYUJ 4HM5B 1VQM3 3GG2A 1BE3J 3ROBA 2WT7B 2ZDJA 2BU4A 5I97A 1M1JC 1AV4A 2A15A 3L75G 1O7MB 1N8QA 1BRKA 1IFIA 2CKFB 1OVVA 2OOVA 1QVGO 1UGHI 4HZ9B 1J2JB 3KPEA 1DVDA 1GK6A 3OAKA 2RN0A 1UCLA 3MKIA 5G2GA 1K9MQ 3K5BA 1IVUA 3D3LA 3FF0A 1RJOA 5ELJA 2ZL8A 4DKIA 5KKZB 2OYIB 1WNHA 3AEEC 1RGAA 3NQYA 4ASVA 4ZKUA 1L5GB 1GD3A 1DX7A 1JRQA 3M06A 4BU4A 5TISE 3HE5B 3E1RA 3NM7A 3AE4C 2C0WA 1DE3A 1JTHB 2IBZD 3VOPA 2OQEC 1SIIA 1W02A 4EOTA 1S4XA 1CEWI 2GU1A 1KFNA 3KZIH 4I1LA 4GL6A 3P8MC 1K8A4 1RF1B 1CYVA 1HVVA 1NHLA 3AE3C 4H0LC 5AW4B 2IBZI 1GD4A 1GU5A 1EDJA 2W9PA 1GD2E 5TGNA 2QGUA 2N1TD 4WWUC 2AEJA 1IK9A 3NMDA 1A02J 1IQYA 1QVG2 2P05A 4XBXA 2Y9YA 3K63A 1V74A 1W2ZA 4JQ0D 2IFMA 1BCCJ 2E42A 1CYUA 1TRPA 5AVRB 4X2OA 4OH8B 1N9JA 5JPPA 3WODG 1SQXE 3H1LG 3BASA 2PZVA 1HGZA 1DYUA 1N5PA 1FC2C 1LTGC 2PRRA 1X1YA 1STDA 4U3FE 2BASA 1E79H 1IK3A 4DOJA 3K9MC 1ZGXA 2KRTA 2K3RA 1NJIQ 5D82A 1LTBC 1ZLLA 3A0BH 3V4QA 3Q5RA 4H44D 1PPJG 1QX8A 1BANA 1AFOA 1I3IA 1T6AA 2FGTA 1VQOP 3LTDA 2OYOA 2OQQA 5AVQB 4EBGA 4Y99C 2XNXA 5APVA 3L74J 3GRDA 1VQL3 1RRLA 4KVHA 1L0LK 3F8HA 1YIJP 1CI6A 1V58A 2R3CA 1SFCA 1X1UA 1RE4C 3M0DA 3V98A 4AEQA 3MUDC 5APQA 1LT9C 2XRXB 1KYOE 3PCSA 3SOAA 2JDIH 1JZDA 1XTCC 3L75J 3RGUA 1NB5I 1EQ7A 4U3FD 2WITA 1UCIA 3AE2C 1O7HB 4Y28J 2CFKA 1FZFA 3I56P 4W80A 3DGOA 2ZJSE 3HZPA 2E43A 1T2HA 1D6UA 3TGUG 2BHMA 2AAEA 3I55P 4L74A 3L73D 1VL2A 2W6JH 1EDKA 4LYLB 4FMDA 3KQGA 5KP4A 4GHOA 4KFEA 1LOXA 3TDGA 1LQGC 1EDIA 3H1IE 3KXDA 3FLJA 5AW8B 1JNMA 1OHPA 3FKAA 3RK3D 1X22A 1RNBA 2O01N 3SSUA 1L0NE 3HE4A 3A0HH 1W00A 2QE7H 1GY7A 2I1JA 1K9M4 1NWWA 3FG4A 1SIHA 1IFJA 2P7JA 4GKGA 2Y73A 3TK1A 2QVAA 2J5UA 2QM8A 1BSBA 4FMCA 1UGIA 4IL6H 3EC9A 1GMPA 3GHGB 4BTYA 1GMRA 3H1KG 5BU5A 9RNTA 1H89A 2F5WA 2NPSC 2CWUA 1XTGB 4AKYA 3O6QA 2W6BA 4N6JA 3AEAC 4RNYA 2WOHA 3VN0A 2K9JB 2XSOB 2H0IA 1DIPA 1S723 3SLUA 4FCZA 4UB8H 2G8YA 3RK3C 1TTOA 1J1DC 3PXMA 2E76D 5GTHE 2XF3A 1X9VA 1FUSA 3LTAA 1JB4A 3IMAB 1P84H 3VMAA 4Z1MH 1GOYA 4RNZA 1RGFA
chains in the Genus database with same CATH topology
3GAXA 3HK4A 1Q864 2IA7A 3O8YA 3K5TA 1JKGB 1T5YA 2WO0A 2XH9A 4KZ1A 2P09A 1NJI4 4K90B 3NXJA 1VQ63 1NDOB 2CG1A 1O7GB 4N6NB 1YHQ3 1OCVA 3DY5A 3A76A 3NHXA 1JB5A 1U8CB 1KC84 3DGLA 5IENA 4QMAA 1IVWA 1OUNA 1ISKA 5IERA 3SOYA 3VF1A 1GY6A 3KN4A 5AI1A 2V1LA 2Z76A 2CW9A 1K41A 4J8TA 4MJDA 3CMA3 2D42A 5CXOA 4U13A 3S27A 1Q42A 1WMOA 2YFLB 1O7NB 3MYTA 4ORLA 3UNLA 2CWVA 3CME3 3SX1A 1JB2A 2BMOB 3DM8A 4N6OB 4DJGA 4MEIA 2KXGA 2SBLA 2Q07A 1VQ83 4HM1B 3KE7A 4FCMA 3MG2A 3GZBA 1W7CA 2Z7AA 1YIJ3 3MWZA 1OPYA 1OHSA 1FGOA 4IIAA 2K54A 3CCQ3 1IFPA 1OACA 1W6GA 1ZX2A 2HMJB 5ELUA 2QA43 1NO3A 3X42A 4K1VA 4XDWA 5AIHA 1FGQA 3U1WA 3LMLA 4I4KA 3DMCA 5CLKA 1D6YA 2P0MA 2PNCA 3JUQA 3HIIA 1QVF2 1JN5B 2UX0A 4EV5A 2P0XA 2Y74A 3MG3A 5STDA 1EQKA 4H61A 1PU4A 2BNGA 4LZIA 1W6YA 3G8ZA 4K1UA 3V92A 4ZM8A 3CNMA 3EBTA 1SPUA 4NREA 2E5TA 8CHOA 1VQ93 3NQZA 2XFSA 4O3VA 3GZXB 1JN5A 4IPBA 2MC8A 2M7OA 2I9WA 3FH1A 3OWUA 1Z1SA 3OX9A 4XBTA 4XB5A 2IUJA 4AKZA 3HIGA 3DUKA 1TUHA 1JJ22 4HM4B 3PZWA 1JKGA 5D83A 1ASKA 1W6CA 1Q40A 3WMDA 5BVBA 1TFOA 3CCL3 3N9HA 4EXRA 4WFOA 1BSNA 1LXEA 1PFPA 3X41A 1D6ZA 1FS0E 4RZMA 3Q2PA 5AIGA 4CDLA 3D9RA 1JNQA 3H3HA 4OVMA 3SVAA 1BSHA 1W5ZA 2OCTA 4FMAA 3KSED 2CHCA 2XFTA 3S67A 4GB5A 2CFWA 3OWYA 3F7XA 2W56B 3FZWA 1FUWA 5DRVA 1AR0A 3KFQC 1ROVA 1ULIB 2CC3A 1YI23 4HKVB 3X40A 4FMBA 2RSXA 1KD14 2IMJA 1MNLA 5AIIA 1LNHA 1TIJA 2W56A 2XGLA 3ECFA 3JUNA 1F8NA 3F40A 2D1WA 3FG3A 1R4CA 2BO9B 3KSPA 3VSYA 3WOFB 1CQSA 1W2B2 1IQ8A 4IT7A 4N6UA 3K7CA 3MHEA 3NBBA 4EC6A 3CC23 1IVXA 2LQVA 2RGQA 1FGRA 1K28A 3BNEA 4KFDA 4FCJA 1M1K4 3USSA 3EB8A 3I0YA 3AMOA 3KZTA 4WHAA 4BTWA 3CCV3 4L8OA 2HMLB 1TP6A 2YX9A 1AVKA 4L7KA 2F99A 4R9LA 2OTL3 5JPUA 5FGOA 1N5HA 3BNCA 1TFKA 1U5OA 2CFLA 2CFDA 3CPOA 3UJMA 2WOFA 3SEDA 1NU3A 1YJW3 1A90A 4N6TA 1SJWA 4J9AA 3L0RA 3PYJA 2XSHB 4N6LA 1BUQA 2O3OA 1E3VA 1HKXA 3CCJ3 1GY5A 3EE1A 3X3XA 3OXAA 1GS3A 3B4OA 2P38A 2XEPA 1SQWA 3CCS3 2B1XB 2XNDH 3NBRA 1RN7A 1OH0A 3LXUX 2R4IA 1QAKA 4HM8B 1HU9A 3EN1B 3K0ZA 3JUMA 4HM7B 1DMQA 1IVVA 3I563 4Q53A 5IEOA 2K0MA 1DMNA 4K61A 1OF5B 1Q7Y4 4L8PA 2HMKB 4LGQA 4JRFA 2W9QA 1KSIA 5AYSC 3H51A 5KP1A 2E2TA 1OF5A 5CK6A 1LVNA 4R80A 1A67A 5EEOA 1E97A 1G96A 1UI8A 3V99A 3EQQB 3G713 6STDA 2XGNA 3PS8A 3PGBA 4HJLB 2IUKA 3G6E3 1Q824 5LC6A 1IQXA 4HM5B 1VQM3 1VQO3 1WMPA 1WTHA 1VQ53 4HM0B 3ROBA 2ZDJA 1EKMA 1S5AA 2LYXA 5I97A 1Q814 1AV4A 3FSDA 2A15A 1O7MB 3X3ZA 1N8QA 2CKFB 5FW5A 2OOVA 3CU3A 3F7SA 3DXOA 4HZ9B 4FR9A 3EBYA 3IJEB 2V7QH 2W0QA 2HMOB 1DVDA 1STFI 2CK3H 4STDA 5G2GA 3MKIA 3FF0A 1IVUA 3D3LA 5AIFA 1RJOA 2W04A 5ELJA 5IG5A 2ZL8A 1FGTA 1WMNA 4CCVA 1WNHA 4MMXB 1L5GB 3NQYA 4LSOA 1KQS2 5AEWB 4HYZA 1GD3A 3NM2A 1K734 1JRQA 2RFRA 3OWSA 3LZAA 2E2UA 2E5YA 3CCU3 3NM7A 3BB9A 3WA2X 1UW1A 1QMAA 5AEUB 3J7Yd 3Q90A 2OQEC 1SIIA 2CWTA 1IU7A 1W02A 1CEWI 2GU1A 5BXQA 3FCSB 3GZYB 3WOEB 3OV4A 3T8NA 5D81A 3M8CA 1ROAA 2YFIB 4GL6A 5IG4A 3X3YA 1K8A4 1N9EA 1CYVA 2CIUA 2OTJ3 1EA2A 3NUVA 4NHFA 1VQK3 3DGMA 4WYKA 3JUOA 2OOVC 1GD4A 4TLFA 2W9PA 3NV0B 5TGNA 2QGUA 4WWUC 3EF8A 1YJN3 3DZLA 1IQYA 1QVG2 2P05A 4XBXA 3K63A 1V74A 1VQ73 1W2ZA 2MF7A 4XDVA 1YIT3 7STDA 3JUPA 2GEYA 4OUQA 3RDEA 5CF2A 4HM2B 3Q1CA 2F86B 1VQP3 1CYUA 1WQLB 2RCDA 3EFFK 2HMMB 1M1XB 3G0KA 4PEJA 4X2OA 5JBSA 1N9JA 1O7PB 1IDPA 5JPPA 2GBWB 1VQN3 4LEHA 3WODG 2KCDA 1IV9A 1W4NA 2PZVA 2GEXA 3BLZA 1DYUA 1OGXA 1N5PA 3S28A 1STDA 3VGNA 3AMOB 1UI7A 3LTBA 1E3RA 3ER7A 4G1MB 1E79H 3BNDA 4R4KA 4EYCA 1IK3A 3F9SA 3I553 1DMMA 1N8R4 3K9MC 3G4S3 2OQEA 4QWTA 2KRTA 5A0OB 3GZRA 5D82A 5IG0A 3MG1A 2GU3A 4XM4A 3CNXA 5KP3A 1TU5A 1YGEA 1EG9B 2F98A 3NV0A 4WP5A 3B4PA 2O9UX 5HGRA 4R1KA 3STDA 3T8UA 2FGTA 4O2HA 1IV7A 1M9GA 2W03A 4WYKB 2GBXB 3LTDA 3UB1A 2B24B 4EBGA 3KKGA 2FXTA 5DREA 3HI7A 3F14A 1QJGA 3GRDA 1YJ93 1JV2B 5CF1A 4HM6B 1VQL3 4YXWH 3CC43 1RRLA 3MSOA 4KFFA 4KVHA 5EQLA 5LC7A 3F8HA 3F8XA 1KWIA 3RGAA 1AQTA 1RKYA 3V98A 4AEQA 1A2VA 2W2CA 2XRXB 3PCSA 4EV2A 3SOAA 2JDIH 4TX4A 2ML5A 2CG0A 5AYRB 2C10A 2XR8B 2HMNB 2BT3A 2L4VA 1NB5I 5IF6A 3KIIA 3N8BA 3HX8A 4XBYA 1ZO2A 3MPHA 1O7HB 4BTXA 1A2KA 2E2VA 5EVHA 1J2BA 2CFKA 2WGQA 2OWPA 3B7CA 2ML6A 3IPTA 3CXC2 2C11A 4WVZA 4RBNA 3EJVA 1ULJB 2CH9A 3DGOA 3HZPA 2YFJB 3LOYA 1D6UA 1FGMA 2BHMA 1Y4KA 3LT8A 4JF8A 1O7WB 5IW9A 1UUWB 2W6JH 3S5CA 2STDA 4HM3B 3CCE3 3WDGB 4FMDA 1YVBI 1US1A 3U97A 1AVLA 1JEKA 5KP4A 4KFEA 1LOXA 3TDGA 1VZZA 2WSSH 3NX0A 1IT8A 1Q40B 1GYBA 4HBRA 2QEX3 3DGNA 3G16A 3JVCA 1RRHA 3CD63 1IT7A 3FLJA 1OHPA 3FKAA 1OHOA 4OK0A 3EHCA 4O8SA 1MOLA 3QK9A 3UL6A 5IEPA 4X2HA 2QIYA 3FGYA 3S29A 1QAFA 1W00A 2QE7H 1UUVB 1GY7A 3LH4A 3LTCA 3SXXA 1NB3I 1K9M4 1NWWA 2CFGA 3FG4A 1C7HA 3N54B 4H3UA 1SIHA 2Y73A 4R9KA 3FG1A 4FMCA 3RGRA 1FA3A 3EC9A 1M904 4BTYA 3UL5A 4LMIA 3LT9A 3ALAA 4HZBB 2Z6BA 3PCRA 2BMQB 2CWUA 5IG3A 4O02B 3CPW2 4AKYA 1W01A 3FF2A 4MMYB 4N3VA 4RNYA 2WOHA 3OW22 4N6MA 1VQ43 2Z77A 2INXA 4HVNA 2XSOB 3B8LA 1S723 3SLUA 4FCZA 2BMRB 3QRDA 3CCM3 1DVCA 2WGOA 4MMZB 3PXMA 3CCR3 2XF3A 3NBJA 3BNBA 3PJSK 3EX9A 3EN8A 1OGZA 3GWRA 3LYGA 3WA3A 2JQ5A 2FNQA 3LTAA 1JB4A 3IMAB 4N6V0 3CC73 3T0UA 3E99A 4RNZA 1QALA 2GXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQT A;  1E79 H;  1BSH A;  2CK3 H;  2XND H;  3USS A;  2JDI H;  2QE7 H;  4DJG A;  2W6J H;  3EFF K;  4QMA A;  1JEK A;  3PJS K;  1BSN A;  2WSS H;  4TLF A;  2E5T A;  2E5Y A;  1FS0 E;  1IFP A;  4YXW H;  4WVZ A;  2V7Q H; 
#chains in the Genus database with same CATH topology
 3GAX A;  1JKG B;  1NJI 4;  2P09 A;  1PP9 E;  4K90 B;  1SQV J;  1PY3 A;  2KS1 B;  4HB1 A;  1X0T A;  1QVF O;  1NTM D;  1SQQ J;  1BE3 D;  3A76 A;  2Q9I A;  1U8C B;  4R4M A;  2B87 B;  1BSC A;  4QMA A;  3HE5 A;  5IER A;  4J5K A;  1URQ B;  2M3B A;  3A0H E;  3VF1 A;  1L4A A;  1B2Z A;  1G1I A;  2H89 C;  1SVF A;  2E74 C;  5APW A;  1WMO A;  4ORL A;  3UNL A;  2L5G B;  1EXJ A;  3SX1 A;  2K88 A;  1IZN B;  3DM8 A;  4MEI A;  2KXG A;  2SBL A;  1L0N K;  3L72 G;  3KE7 A;  1ZW0 A;  2W8Z A;  3MG2 A;  1MWT A;  2A45 H;  3MWZ A;  2J59 M;  1Q9E A;  4WY4 C;  2K54 A;  4JPZ B;  5AVU B;  3CCQ 3;  1IFP A;  5AVY B;  1ZX2 A;  4WB4 A;  2HMJ B;  1NO3 A;  2ZHX B;  4K1V A;  4H44 C;  1LOW A;  5AIH A;  1Z56 A;  3PLN A;  2MJZ A;  3P7K A;  3JUQ A;  1QVF 2;  2LXC B;  2AXT H;  4EV5 A;  1ZXG A;  3L72 E;  5KKZ C;  1UDI I;  2Y74 A;  1RH5 B;  1EQK A;  1PU4 A;  1FU1 A;  5AVX B;  1D7M A;  4ZM8 A;  3CNM A;  1H88 A;  5CHX A;  8CHO A;  5M1B A;  3GZX B;  4IPB A;  1BGY J;  2I8D A;  1PYL A;  2WMM A;  3OWU A;  4XBT A;  4AKZ A;  2B88 A;  3I5C A;  3CWB G;  5C39 A;  5KLI B;  1JKG A;  3D6Y A;  5G1L A;  1ASK A;  1Q7Y Q;  1BSD A;  1TFO A;  3CCL 3;  3CWB D;  1QL2 A;  4WFO A;  1S9K D;  2N1T C;  1N8R Q;  1YTZ T;  1PFP A;  3X41 A;  1FS0 E;  2NZ2 A;  3RNT A;  4RZM A;  1PGQ A;  1FE6 A;  4EIJ A;  1JNQ A;  2AAD A;  3H3H A;  1PIX A;  2BCC J;  4JYC A;  1RMS A;  3RBZ A;  2PP6 A;  4FMA A;  2R5D A;  3F7X A;  3RK2 C;  1BSE A;  1IC2 A;  1FJP A;  1JO5 A;  5AVZ B;  1T8Z A;  3O6Q B;  4D6T J;  1HF9 A;  2CC3 A;  3EFG A;  3AHS A;  1J1E C;  1YI2 3;  2RSX A;  2P67 A;  4OVN F;  3SWY A;  2IMJ A;  5AII A;  1LNH A;  1TIJ A;  1ZR2 A;  1ZP0 C;  2ZYA A;  2W56 A;  2XGL A;  3JUN A;  2QJK B;  2D1W A;  1R4C A;  3KSP A;  3VSY A;  2P1J A;  3WOF B;  1CQS A;  1NTK J;  4H13 B;  2FXM A;  3K7C A;  3NTN A;  3CC2 3;  3BNE A;  4KFD A;  1K28 A;  2JWA A;  2RKL A;  1JOC A;  3EB8 A;  3KZT A;  3L36 A;  1MFZ A;  1SFC D;  3JCU E;  3VYI A;  5KLV G;  1FYS A;  2HML B;  2YX9 A;  1AVK A;  1S1C X;  3H1I J;  2KYV A;  3SWF A;  1N5H A;  3BNC A;  3CPO A;  2KXP B;  4PJ0 H;  2OGU A;  2K9Y A;  3MGN A;  2RMZ A;  1EC5 A;  1IYY A;  4NPB A;  2W83 C;  2OTL P;  1GY5 A;  2XV5 A;  1FOS F;  3AEC C;  2XEP A;  3VMZ A;  1OH0 A;  3LXU X;  1QAK A;  3JUM A;  1G02 A;  3C8V A;  4IL6 E;  4L8P A;  1B2U A;  1N2D C;  1MUU A;  1SS1 A;  1KSI A;  1KQF B;  5AYS C;  3H51 A;  1FW7 A;  2E2T A;  1GTW A;  1A67 A;  1K04 A;  1G0T A;  1G96 A;  3G4S P;  5AW6 B;  1RGK A;  2P58 A;  2POH A;  2YKQ A;  2ZXX A;  1S72 P;  3PS8 A;  2OYI C;  2V4H A;  1IQX A;  1Q2N A;  1VQO 3;  3L4F A;  3ZDM A;  2YKO A;  1PFI A;  5E79 H;  1EKM A;  2LYX A;  3X3Z A;  1KB9 I;  3H6P A;  4FR9 A;  3EBY A;  1N73 B;  2M5A B;  3T97 A;  3BCC D;  1JY3 O;  1NU1 G;  5AIF A;  2JKV A;  1U7J A;  2QG4 A;  2JJL A;  1M57 D;  1SQV E;  2L91 A;  1FGT A;  1MGW A;  4LSO A;  1CH0 A;  1KQS 2;  1S3J A;  5AEW B;  1SQX J;  3NM2 A;  2RFR A;  1NTK D;  2HR3 A;  3LZA A;  1YI2 P;  3CCU 3;  4U3F G;  3L73 E;  3CMA P;  1PGP A;  4WWI A;  4CPG A;  3Q90 A;  2CWT A;  5KLV D;  1Y9B A;  5BXQ A;  3CME P;  3FCS B;  1AV1 A;  3OV4 A;  1JBR A;  1HZ1 A;  5IG4 A;  2M0B A;  2YFI B;  1YTZ I;  3X3Y A;  1NU1 K;  1KIL B;  2OTJ 3;  3HUS B;  3NUV A;  4NHF A;  3DGM A;  2WT7 A;  1L0L J;  1KFM A;  1SP4 A;  2WVR A;  3M9Q A;  4BXL A;  2QEX P;  2OOV C;  1PP9 G;  3L74 E;  3AE7 C;  1RN1 A;  1L4A D;  3AGN A;  3TSI A;  2CPB A;  2R32 A;  2MF7 A;  4XDV A;  1B3S A;  1PPJ D;  5CF2 A;  3Q1C A;  2YIU C;  3D6Z A;  1S5L H;  3EFF K;  4U7J A;  2B89 A;  1K05 A;  2E76 B;  3G0K A;  1G2C B;  1O7P B;  1VF5 B;  5M19 A;  1IV9 A;  2K3D A;  3P32 A;  2GEX A;  3BLZ A;  3S28 A;  3AE5 C;  3VGN A;  2WZ7 A;  4G1M B;  2IFN A;  1VQ4 P;  1TJD A;  3LTB A;  4R4K A;  4EYC A;  1X8Y A;  3I55 3;  1V57 A;  1BNG A;  3M9B A;  2W90 A;  2PFX A;  2GU3 A;  3CNX A;  1LTT C;  3NV0 A;  4WP5 A;  1YJ9 P;  5HGR A;  1S9K E;  2P10 A;  3L71 J;  3STD A;  1W5C E;  2R3S A;  1ZRT D;  1IV7 A;  4WYK B;  2GBX B;  3R4Y A;  4YXD C;  1I0V A;  3IF4 A;  3P8C E;  3F14 A;  4M3L A;  3R2P A;  4GDO A;  1SQB J;  3Q3D A;  3AE1 C;  1EXI A;  2MKV A;  3MSO A;  1PZQ A;  4KFF A;  3PRJ A;  1FZC C;  6RNT A;  1KWI A;  3GF7 A;  1RF0 A;  3L71 E;  3EQ2 A;  3HTK B;  1A2V A;  2FYU G;  4EV2 A;  4TX4 A;  2FKW B;  1OX3 A;  1I70 A;  1LWU C;  2ML5 A;  5AW3 B;  1HUC A;  1JCC A;  2C10 A;  1DEB A;  2YMY A;  2XR8 B;  1CI6 B;  2HMN B;  5BU8 B;  5IF6 A;  3KII A;  1N7L A;  1YNV X;  1ZR4 A;  1JCD A;  2OYI A;  4MN4 C;  1NTM G;  4KT3 B;  2C11 A;  3LOY A;  4D6T D;  1KYO H;  1NWQ A;  5K5G B;  1Y4K A;  1EEJ A;  2R41 A;  1MWR A;  1JMB A;  3S5C A;  2STD A;  2LR2 A;  4HM3 B;  1H0T A;  3CCE 3;  3H1L D;  3WDG B;  3CD6 P;  1NVO A;  5GTI H;  1JBS A;  2OTJ P;  1CZQ A;  1L0N G;  1IT8 A;  1DEE G;  1GYB A;  1RCL A;  3DGN A;  3JVC A;  1BVI A;  4JF7 A;  3L72 D;  1DD3 A;  3BIR A;  1M56 D;  1QEX A;  3EHC A;  3H32 A;  3UL6 A;  4UB6 E;  1RNT A;  3FGY A;  4X2H A;  3LH4 A;  3SXX A;  3B5N C;  2AXT E;  4R9K A;  1KC8 Q;  2WSE J;  2F56 A;  3UL5 A;  3CCM P;  2WSF J;  3KYQ A;  1AQ5 A;  1W01 A;  3FF2 A;  4MMY B;  3CX5 H;  4OWF A;  3OW2 2;  4N6M A;  1VQ4 3;  4HVN A;  2KF3 A;  4WY4 D;  3B8L A;  4KJM A;  3GLM A;  3QRD A;  2QJP B;  1OFC X;  2WGO A;  4N78 E;  1LTJ C;  3BNB A;  2ZYD A;  4A7P A;  2R5B A;  3GWR A;  3LYG A;  3MD0 A;  4BRY B;  2FNQ A;  1DD4 A;  3WUT A;  2Q7C A;  3T0U A;  1QAL A;  1GK4 A;  1Q86 4;  3H25 A;  1T5Y A;  2WO0 A;  4KZ1 A;  5KJ7 C;  1RGE A;  3SWK A;  2HYN A;  1YHQ 3;  1NTM J;  1OCV A;  2DW3 A;  3U1C A;  3BVH A;  4IFF A;  2N1T A;  3FX0 A;  1ISK A;  2Z5H A;  2V1L A;  4J8T A;  5KAF H;  1K41 A;  1VQ9 P;  4J5G A;  2IBZ E;  3O8Z A;  3S27 A;  4U13 A;  3IFM A;  1Q42 A;  2YFL B;  1SQX D;  1T2K C;  1LNI A;  2BMO B;  4XE5 B;  2JR8 A;  3MTU E;  2Q07 A;  5BIR A;  2BEQ D;  4FCM A;  1KIL C;  3NFQ A;  2E76 C;  4O9B A;  3H1H E;  2KNC B;  3GZB A;  1DH3 A;  1OIP A;  4C7N B;  1YJN P;  1OPY A;  1IO4 A;  4IIA A;  3GMA A;  1BRJ A;  3TGU J;  1W6G A;  1MKM A;  2QA4 3;  1W2E A;  3Q3F A;  3HTK A;  1JB0 J;  2HG5 D;  3Q2Y A;  2YO3 A;  3L74 G;  5CLK A;  1D6Y A;  5L8R J;  2LXB A;  1JN5 B;  2UX0 A;  4LGD E;  4KHX A;  4WY4 A;  3MG3 A;  2H8P D;  2HLO A;  2WSC H;  4H61 A;  3H1K J;  1K73 Q;  1RQU A;  4EDF A;  3V92 A;  5KTB A;  1A2P A;  1VQ9 3;  2XFS A;  4O3V A;  2WSE H;  1FDI A;  1BOX A;  2MC8 A;  2KP8 A;  1H0T B;  3VP8 A;  2O01 H;  4GOE A;  4OGQ B;  5DJU B;  1BRI A;  2OTK E;  1NNV A;  1TUH A;  3D71 A;  4HM4 B;  3PZW A;  3L73 J;  1W6C A;  5APU A;  1Q40 A;  1L4A C;  2FYZ A;  3UIA A;  5AVW B;  3N9H A;  1J1E B;  3JC2 2;  1RHZ B;  2CPS A;  3G3Z A;  3WU2 E;  3RK2 D;  3CCL P;  5AIG A;  3LIE A;  3H1I G;  1BNF A;  4CDL A;  4OVM A;  1KYO D;  2H7H A;  3QWO C;  1SFC B;  2OCT A;  3H1I D;  3W67 A;  1ZN5 A;  4NPE A;  3WR2 A;  3V2P A;  1FUW A;  3B71 A;  3H1J G;  4IL6 X;  1R8E A;  1SQB G;  1IFD A;  3X40 A;  1MNL A;  4I7Z C;  2NPS B;  5H2F E;  1OW7 A;  3F40 A;  1UCK A;  4XA4 A;  1OXZ A;  1VQN P;  2ZA4 A;  1GDT A;  3NBB A;  4EC6 A;  2RGQ A;  2LQV A;  1FGR A;  1JUN A;  1KB9 D;  1NTK G;  1S2E A;  3USS A;  5M18 A;  2NPS A;  4ILF A;  2F99 A;  4R9L A;  1BE3 E;  1TFK A;  1U5O A;  3UJM A;  2FYU E;  2HPC A;  3IR9 A;  1YJW 3;  1MWU A;  2GA1 A;  1USD A;  2XSH B;  1BUQ A;  2O3O A;  1WRG A;  2C9L Y;  4I2L C;  2KUB A;  1YHQ P;  4PV1 C;  1BNR A;  1IFN A;  1FZC B;  3OXA A;  3T97 B;  1ZOY C;  1N7S A;  1N86 A;  2P38 A;  1SQW A;  1PP9 D;  2B1X B;  2GSP A;  1UIX A;  1RN7 A;  2R4I A;  2Y0E A;  3BAT A;  4HM8 B;  3K0Z A;  3IN6 A;  3A0B E;  4Q53 A;  1DMN A;  2NRG A;  1FDM A;  2JP3 A;  3A7O A;  4JRF A;  1GSP A;  3BCC G;  3G71 P;  5KP1 A;  5CJ0 A;  2D2C C;  3H1L E;  1NTZ J;  1UI8 A;  1SQX G;  2YNY A;  1BRH A;  5G1K A;  1SQQ E;  4HJL B;  3PH0 A;  1Q82 4;  5LC6 A;  3RK2 B;  1NKZ B;  4H0L D;  4C7N A;  2IX7 C;  1GZL A;  1BRG A;  4HM0 B;  1VF5 C;  1LTJ B;  1LTA C;  2FFD A;  1M1K Q;  2FXP A;  1S5A A;  1L0N D;  1FZU A;  2AEM A;  3CU3 A;  3DH2 A;  3HD7 C;  3F7S A;  3DXO A;  3F89 A;  2UGI A;  2V7Q H;  1RCK A;  1UCJ A;  2BCC E;  2HMO B;  1FZE A;  3CCJ P;  1RE4 A;  3M0D C;  1SFC C;  3L74 D;  1BCC E;  5IG5 A;  4DZO A;  3CCQ P;  2C9N Y;  4MMX B;  3D79 A;  5E79 E;  1OZH A;  1FAV A;  4H0L B;  5AW1 B;  1K73 4;  3OWS A;  3V6I A;  2Q3E A;  3BRV B;  1YQ4 C;  1OW6 A;  3BB9 A;  4K3A A;  5CMZ A;  2I1K A;  1KTM A;  1UW1 A;  1QMA A;  5AEU B;  4NPF X;  1IU7 A;  3BU4 A;  3GZY B;  1QL1 A;  3WOE B;  2XKM A;  1HJB A;  3T8N A;  5D81 A;  1N7S D;  4KT0 J;  1ROA A;  1LWU B;  4IFD K;  2OYH B;  1VF5 D;  1EA2 A;  1YYC A;  1CW5 A;  1IFM A;  1JY3 N;  3H1H D;  3KCH A;  4TLF A;  5KAI H;  2XU6 A;  3EF8 A;  2V7Q J;  1PP9 J;  3VP9 A;  2G3A A;  2WQY C;  2A06 G;  1M8O B;  1Q86 Q;  1YIT 3;  7STD A;  3JUP A;  1L0L E;  1GW4 A;  4JYB A;  3RDE A;  1SQV K;  3V2N A;  3D5I A;  3RL0 g;  5CCG A;  1VQP 3;  2E75 C;  2HMM B;  1M1X B;  5JBS A;  1P84 D;  3IAO A;  1VQN 3;  2IYO A;  2Z4E A;  4LEH A;  5B66 E;  2KCD A;  5CCH D;  1GL2 B;  4GSP A;  1W4N A;  5DJT B;  1RLS A;  4TT3 H;  3TNU B;  4HH2 A;  2JWD A;  3S4R A;  3CXH D;  4CPK A;  3RL0 D;  4N78 D;  3BND A;  3F9S A;  1DMM A;  2HOD B;  5APX A;  1UUG B;  2OQE A;  3GZR A;  3L70 E;  4OGQ C;  1JZO A;  1SQX K;  5KP3 A;  1YGE A;  3U1A A;  1EG9 B;  1X1X A;  2F98 A;  3D70 A;  3B4P A;  4R1K A;  7GSP A;  3T8U A;  4O2H A;  3LID A;  1M9G A;  2W03 A;  2RBI A;  2ZYG A;  2B24 B;  3A2A A;  1RDS A;  1JMM A;  5DRE A;  3PTZ A;  3HI7 A;  3TGU D;  1NTZ G;  2O1K A;  3L37 A;  1JV2 B;  4EI2 A;  4YXW H;  1TU3 F;  5EQL A;  3RGA A;  1RKY A;  2KS1 A;  2W2C A;  1IJD B;  2KF6 A;  2CG0 A;  5APT A;  3M0A A;  2LKM A;  2E74 D;  3B5N B;  3B8E B;  2BT3 A;  1QGK B;  2L4V A;  1M1J A;  1RTU A;  1VDF A;  4XBY A;  4Y99 B;  3MPH A;  2ZT9 C;  5EVH A;  3G9R A;  1RGL A;  1KIL E;  2OWP A;  3CCE P;  2W6A A;  3B7C A;  2ML6 A;  3CXC 2;  2QSI A;  4WVZ A;  4RBN A;  2CH9 A;  2YFJ B;  3FWN A;  4CJN A;  3H1K E;  1R5S A;  1O7W B;  1VQ8 P;  4I5Q A;  3Q5S A;  4HOH A;  3GF3 A;  4ZMD A;  1YBK A;  1US1 A;  1HWT C;  2CX1 A;  1JEK A;  1BGY E;  5TIS H;  2IPP A;  1VZZ A;  3GHG C;  1X1W A;  1BNS A;  4HBR A;  3G16 A;  4WBA A;  1NO4 A;  1RRH A;  3CD6 3;  2E75 D;  1BDD A;  2ZXE B;  3TF5 A;  2PGD A;  1OHO A;  1LT9 A;  1NAF A;  1NTZ E;  4OK0 A;  3MUD A;  1M90 Q;  1MOL A;  1LP1 B;  3QK9 A;  1VQ5 P;  5IEP A;  1GW3 A;  3S29 A;  3CLQ A;  1I3F A;  1UUV B;  1OW8 A;  3WUV A;  1Y47 A;  1N7S B;  1NB3 I;  1BNI A;  2CFG A;  4RNT A;  1BNE A;  4H3U A;  3V4W A;  3MZW B;  1R4Y A;  3FG1 A;  3RGR A;  1FA3 A;  1M90 4;  2WPV B;  1LJ2 A;  2WPS A;  1NTK E;  1LRA A;  4LMI A;  2OAR A;  4I7Z B;  3P8C D;  1C54 A;  2Z6B A;  2BMQ B;  1BCC D;  4O02 B;  5EFW B;  4U3F J;  2QM7 A;  1SQV D;  1NTK K;  1RE3 C;  5HOH A;  3L72 J;  1T3U A;  1KB9 E;  2Z77 A;  2INX A;  3BRT B;  1AVO A;  2BMR B;  2XDJ A;  1DVC A;  3CC7 P;  2FY8 A;  2WWW A;  3PJS K;  3EX9 A;  3V2Q A;  3WA3 A;  3CL3 D;  2JQ5 A;  1MV8 A;  4N6V 0;  2A06 E;  2FFD B;  2E74 B;  1SQP J;  3RL0 B;  2IA7 A;  2Q5U A;  1BGS A;  2XH9 A;  2IYP A;  4YTP C;  4RJT A;  1NDO B;  1L0N J;  2HFE D;  1N73 A;  1O7G B;  2CG1 A;  2FXO A;  4GOD A;  3DY5 A;  2ZAE B;  2Z5I A;  3NHX A;  3JCU H;  1J1D B;  2OYH C;  1PPJ E;  1OUN A;  3KDP B;  1GY6 A;  1U7M A;  2A45 I;  2KSJ A;  2Z76 A;  2WPQ A;  1SQB K;  2KLU A;  5H2F H;  5BVZ A;  1O7N B;  4YPC A;  3MYT A;  5CCG C;  1LGH B;  2PAJ A;  3CWB J;  3CME 3;  1JB2 A;  1VQQ A;  4N6O B;  4DJG A;  2IDB A;  4W7Z A;  2ZFC A;  1VQ8 3;  2O01 J;  2E75 B;  2FBW C;  1I0X A;  1VQK P;  3HRN A;  2L1S A;  3OJA B;  3HOH A;  4C7R A;  5APY A;  1OAC A;  3X42 A;  4I6M C;  4IFM A;  3CXH H;  2BEZ F;  3EWK A;  1KQL A;  2O1J A;  1FGQ A;  3U1W A;  4OGQ D;  3OA7 A;  4I4K A;  1LTI C;  2PNC A;  1HBW A;  3HII A;  1LNQ A;  4PV1 D;  2P0X A;  5KLI C;  5STD A;  4LZI A;  1RY3 A;  2FYN B;  2KF5 A;  3G8Z A;  3EBT A;  2E5T A;  1HGV A;  1SQQ D;  1RF1 A;  3B4S A;  3SYU A;  2IBZ G;  1I8V A;  3BCC E;  3VTP C;  3AE9 C;  2M7O A;  1AA0 A;  2WPR A;  2I9W A;  1IK7 A;  4D6T G;  3FH1 A;  4W7Y A;  2IUJ A;  3D5G A;  3HIG A;  4RES B;  5AVT B;  3BCC J;  1VQ7 P;  6GSP A;  5KLV K;  1SQP G;  3WMD A;  2H88 C;  1B2X A;  1BUJ A;  3HD7 A;  1GOV A;  1BSN A;  1LXE A;  1BAO A;  1D6Z A;  5APS A;  5BU4 A;  3HUS A;  3Q2P A;  5CCH A;  5GTI E;  1PL5 A;  3CC4 P;  5AVV B;  3L75 E;  1BSH A;  2ZVO B;  2JO1 A;  5KAF E;  2CHC A;  3DGY A;  1OWA A;  2CFW A;  3CXH E;  4GB5 A;  2W56 B;  1S5L X;  3N4X A;  5AW5 B;  3KFQ C;  3CX5 I;  2BIR A;  2FYN C;  4HKV B;  4FMB A;  3GW6 A;  1KD1 4;  2F4Y A;  5CJ4 A;  3WU2 H;  3ECF A;  4BIR A;  2IYJ A;  1HH0 A;  3V2R A;  3Q5P A;  4IT7 A;  3MHE A;  4FCJ A;  1M1K 4;  3AMO A;  7RNT A;  3CCV 3;  4BTW A;  1SLQ A;  4L8O A;  4L7K A;  1RGH A;  5KLV J;  5JPU A;  3CC2 P;  5FGO A;  1NKN A;  2WOF A;  8RNT A;  1L0L D;  1NTZ K;  1TRQ A;  2Y0D A;  2H0G A;  2H0H A;  4N6T A;  1SJW A;  4J9A A;  5KAI E;  3L0R A;  4N6L A;  1NTZ D;  4PV1 B;  1HKX A;  3X3X A;  1GS3 A;  3B4O A;  3OW2 O;  1HTL C;  3CX5 D;  3CCS 3;  1LP1 A;  2XND H;  4ZNC A;  3NBR A;  4AYC A;  1LT9 B;  2R44 A;  2JEE A;  3H32 B;  1SQP E;  1HU9 A;  3EN1 B;  1GL2 A;  1FZB A;  1DMQ A;  1IVV A;  3I56 3;  5IEO A;  2K0M A;  4K61 A;  1Q7Y 4;  1H8A A;  2HMK B;  1HYF A;  2B9B A;  3CCU P;  4D6T E;  3V5B A;  2C4B A;  1NU1 J;  1VQ6 P;  1KIL D;  1EZV E;  1UII A;  3C9I A;  1VQM P;  4ASW A;  1EDL A;  1LVN A;  2GUV A;  1NTM E;  1OVU A;  3H1J J;  1E97 A;  1KB9 H;  1T2K D;  3PHL A;  4LLH A;  3V99 A;  3AED C;  1Q81 Q;  1T2I A;  3MHV A;  1GU4 A;  5B66 H;  2IUK A;  3A3Y B;  1DET A;  3CCR P;  1LOV A;  1WMP A;  1WTH A;  4L75 A;  2YXR B;  1VQ5 3;  3L71 D;  1Q81 4;  3FSD A;  1MGR A;  2KF4 A;  4BRY A;  5FW5 A;  4PD4 H;  1FZA A;  3IJE B;  2W0Q A;  1STF I;  5KJ7 D;  2CK3 H;  1BU4 A;  1PGJ A;  4STD A;  1BRN L;  1L2P A;  4HAA A;  2W04 A;  3KHU A;  3AE6 C;  3H1H G;  2KZJ A;  3GSP A;  1WMN A;  4CCV A;  4DCK A;  2Y9Z A;  1URQ A;  5GSP A;  3SFE C;  4HYZ A;  3H1K D;  3QH9 A;  2E2U A;  2E5Y A;  1HJ0 A;  2GM4 A;  3ZFZ A;  1MWS A;  3CPW O;  4BWN A;  3WA2 X;  3J7Y d;  2QJY B;  3D4A A;  3L35 A;  2HOD A;  2RNT A;  3AGO A;  1G1J A;  1M7L A;  1KZU B;  2AEF A;  2YIU B;  3M8C A;  4AQR D;  1N9E A;  2CIU A;  2Q1K A;  1VQK 3;  4WYK A;  3JUO A;  1QLE D;  1GL2 D;  2M3E A;  1KD1 Q;  3NV0 B;  2C0X A;  1YJN 3;  1RGG A;  3DZL A;  2FFD C;  3B5N D;  1VQ7 3;  2D2C B;  1EUI C;  2GEY A;  4OUQ A;  4HM2 B;  1PV3 A;  4NPD A;  1LTS C;  2F86 B;  2KZI A;  1WQL B;  2RCD A;  3RK3 B;  4PEJ A;  1P84 I;  1IDP A;  2GBW B;  1PGO A;  3FXE A;  2K37 A;  3S1K A;  3F5H A;  1AVY A;  2SAR A;  1OGX A;  2K9J A;  3HE4 B;  1EZV G;  3AMO B;  1UI7 A;  1E3R A;  3ER7 A;  1N8R 4;  2F5M A;  3G4S 3;  4QWT A;  5A0O B;  5IG0 A;  5KJ7 A;  3MG1 A;  4XM4 A;  1GOU A;  1N7S C;  1TU5 A;  3A5T A;  1SQV G;  3W68 A;  2O9U X;  1KQS O;  1U57 A;  1FJK A;  1B2M A;  5CBN A;  3AEF C;  1NU1 E;  2IZ0 A;  3UB1 A;  1URQ C;  1KN7 A;  3KKG A;  4UB6 H;  2FXT A;  1I2E A;  1QJG A;  1Q7H A;  3RBX A;  1YJ9 3;  2XZR A;  5CF1 A;  1LTJ A;  1Q90 D;  4HM6 B;  3CC4 3;  4H13 C;  1YQ3 C;  5LC7 A;  1P84 E;  3F8X A;  1SAR A;  1AQT A;  1FBM A;  4EYY Q;  4BL2 A;  1JY2 O;  3H1L J;  1RN4 A;  1VQP P;  4GIF A;  1YGW A;  2QA4 P;  2QIW A;  2M5A A;  2Q6Q A;  1SQQ K;  1VPC A;  5AYR B;  2K1A A;  2J8X B;  3RK3 E;  1L4A B;  3N8B A;  1FDO A;  3HX8 A;  2YKP A;  3MIW A;  1ZO2 A;  1T3B A;  2WSC J;  2YXQ B;  4BTX A;  3HD7 D;  1A2K A;  2E2V A;  1J2B A;  2WGQ A;  1X79 B;  1ZV8 A;  3IPT A;  3EJV A;  1ULJ B;  1FGM A;  1SQB D;  2ITA A;  3LT8 A;  1B20 A;  4JF8 A;  3AEG C;  1I2G A;  2QRX A;  1UUW B;  4RO0 A;  5IW9 A;  3LW5 H;  1LOY A;  1NOH A;  3VMY A;  1YVB I;  2FYU D;  3U97 A;  5CBO A;  1AVL A;  4PD4 D;  2D2C D;  1YJW P;  3Q1M A;  2WSS H;  3NX0 A;  3L75 D;  3L71 G;  1Q40 B;  1KMI Z;  2QEX 3;  4ZKP A;  2IZ1 A;  3HD7 B;  1IT7 A;  2H43 A;  4H44 B;  2KOG A;  1MFT A;  1BDC A;  2BCC D;  2FYU K;  3S9O A;  4O8S A;  2QIY A;  5B5E E;  2M8R A;  3CCS P;  1QAF A;  1BGY G;  3AEB C;  3LTC A;  1BIR A;  1C7H A;  3N54 B;  1ZS7 A;  1Y8A A;  3L70 G;  3LT9 A;  1CSB A;  1EZV D;  1G2C A;  3ALA A;  4HZB B;  4HJG H;  3PCR A;  5IG3 A;  3CPW 2;  1R5L A;  2ZVN B;  4N3V A;  1LWU A;  4BL3 A;  3LW5 J;  4R4L A;  1BNJ A;  3CCM 3;  1FZC A;  1GMQ A;  2UUG C;  5AW7 B;  1K8A Q;  4MMZ B;  5AW2 B;  3CCR 3;  3NBJ A;  3C1L A;  3KZI E;  1B27 A;  2P2U A;  1KOR A;  3CXH I;  3EN8 A;  1OGZ A;  1BSA A;  3TDK A;  1L0L G;  3CX5 E;  1RHL A;  3CC7 3;  3E99 A;  1A02 F;  1Q82 Q;  2GXF A;  1SQP D;  1KIL A;  3M9H A;  3HK4 A;  3O8Y A;  3K5T A;  2N9Y B;  3NXJ A;  1VQ6 3;  1JBT A;  4N6N B;  4HKZ H;  3HUS C;  5GTH H;  1JB5 A;  2HOH A;  1KC8 4;  1T3J A;  3DGL A;  5IEN A;  1IVW A;  1KV4 A;  1M1J B;  2YMK A;  3SOY A;  1NU1 D;  2ZT9 B;  3KN4 A;  5AI1 A;  2QJK C;  2CW9 A;  4MJD A;  3WUU A;  3CMA 3;  3M91 A;  4XFJ A;  2D42 A;  5CXO A;  1KYO I;  2KSE A;  3H1J D;  2N9B A;  3L73 G;  1JM0 A;  1WMK A;  2CWV A;  3ITK A;  5RNT A;  1JTH A;  3VMX A;  3L70 D;  3TYY A;  2Q3I A;  3URP A;  2J58 A;  1RF1 C;  4HM1 B;  4H13 D;  3E1I A;  1BCC G;  1W7C A;  3FXD A;  1SQP K;  2Z7A A;  1YIJ 3;  1OHS A;  1FGO A;  1URQ D;  1OMI A;  4PJ0 E;  2BCC G;  4GT1 A;  4WY4 B;  3AHW A;  1I2F A;  5ELU A;  1OVR A;  2KNC A;  3NXS A;  4XDW A;  1ZME C;  3LML A;  3DMC A;  2NPS D;  2P0M A;  1NAY A;  1RQV A;  1AQZ A;  3U59 A;  2BNG A;  1SQQ G;  1W6Y A;  4K1U A;  1SPU A;  4NRE A;  3PP5 A;  3ABV C;  3NQZ A;  2UWJ E;  1JN5 A;  3B5N A;  4C46 A;  3N7N A;  1Z1S A;  3OX9 A;  4XB5 A;  1LT1 A;  4UB8 E;  3G6E P;  3DUK A;  1JJ2 2;  1NYH A;  5D83 A;  5BVB A;  1JY2 P;  2SPZ A;  2A45 G;  4EXR A;  3II6 A;  1BRS A;  5TJH A;  1NTM K;  3SFD C;  1ZRT E;  3CI9 A;  4B86 A;  2OYH A;  1GL2 C;  1MZ9 A;  2KI7 B;  1W2B O;  1N73 C;  1S5L E;  5AVS B;  2KIK A;  3D9R A;  3SVA A;  2O3J A;  1B21 A;  2KAA A;  1W5Z A;  1BGY D;  1E5W A;  2WTY A;  3KSE D;  3MP7 B;  2XFT A;  3S67 A;  1EZV I;  2RH0 A;  2ZT9 D;  3OWY A;  3FZW A;  5DRV A;  1AR0 A;  5M1A A;  1ROV A;  4JBZ A;  5KLV E;  1ULI B;  1NH4 A;  4LC1 A;  1B2S A;  2WSF H;  1RSN A;  2N1T B;  3FGA D;  1F8N A;  3CCV P;  3H1H J;  4N3Y B;  3FG3 A;  2BO9 B;  1NGM B;  4RKU J;  2W27 A;  3L70 J;  1W2B 2;  2VRS A;  1IQ8 A;  4N6U A;  1IVX A;  1RE3 A;  3I0Y A;  1SQB E;  4WHA A;  4EW5 A;  1RF0 C;  1TP6 A;  3AE8 C;  2CX0 A;  2OTL 3;  3ZG0 A;  4PD4 I;  2CFL A;  2KLV A;  2CFD A;  3SED A;  1NU3 A;  1FZG A;  2KB7 P;  3E7K A;  4AUW A;  1A90 A;  4HYT B;  4L73 A;  3A5E A;  1WT6 A;  3PYJ A;  2Y0C A;  1RGC A;  1E3V A;  1YIT P;  3CCJ 3;  1YVS A;  5AW9 B;  3RL0 C;  3EE1 A;  1AY7 A;  5B5E H;  3ZG5 A;  2GUS A;  1LQM B;  1AJY A;  2AXC A;  4K35 A;  1VQL P;  5CCH C;  1BE3 G;  4GOF A;  2QJP C;  4HM7 B;  2A06 D;  1OF5 B;  2KK7 A;  3CWB E;  4IOI H;  3GHG A;  3TNU A;  4DT0 A;  1FUT A;  4LGQ A;  1KQG B;  5AW0 B;  4L76 A;  2W9Q A;  3TGU E;  1FOS E;  1GMJ A;  2IY2 A;  1OF5 A;  5CK6 A;  3FWL A;  4PD4 E;  4R80 A;  5EEO A;  2QJY C;  2B87 A;  3WMM 0;  3WHO A;  3EQQ B;  5CCG D;  3G71 3;  6STD A;  2XGN A;  1JY2 N;  3PGB A;  3H1J E;  3G6E 3;  3JSV C;  1JY3 P;  1USE A;  2YO2 A;  2HPC B;  2FYU J;  4HM5 B;  1VQM 3;  3GG2 A;  1BE3 J;  3ROB A;  2WT7 B;  2ZDJ A;  2BU4 A;  5I97 A;  1M1J C;  1AV4 A;  2A15 A;  3L75 G;  1O7M B;  1N8Q A;  1BRK A;  1IFI A;  2CKF B;  1OVV A;  2OOV A;  1QVG O;  1UGH I;  4HZ9 B;  1J2J B;  3KPE A;  1DVD A;  1GK6 A;  3OAK A;  2RN0 A;  1UCL A;  3MKI A;  5G2G A;  1K9M Q;  3K5B A;  1IVU A;  3D3L A;  3FF0 A;  1RJO A;  5ELJ A;  2ZL8 A;  4DKI A;  5KKZ B;  2OYI B;  1WNH A;  3AEE C;  1RGA A;  3NQY A;  4ASV A;  4ZKU A;  1L5G B;  1GD3 A;  1DX7 A;  1JRQ A;  3M06 A;  4BU4 A;  5TIS E;  3HE5 B;  3E1R A;  3NM7 A;  3AE4 C;  2C0W A;  1DE3 A;  1JTH B;  2IBZ D;  3VOP A;  2OQE C;  1SII A;  1W02 A;  4EOT A;  1S4X A;  1CEW I;  2GU1 A;  1KFN A;  3KZI H;  4I1L A;  4GL6 A;  3P8M C;  1K8A 4;  1RF1 B;  1CYV A;  1HVV A;  1NHL A;  3AE3 C;  4H0L C;  5AW4 B;  2IBZ I;  1GD4 A;  1GU5 A;  1EDJ A;  2W9P A;  1GD2 E;  5TGN A;  2QGU A;  2N1T D;  4WWU C;  2AEJ A;  1IK9 A;  3NMD A;  1A02 J;  1IQY A;  1QVG 2;  2P05 A;  4XBX A;  2Y9Y A;  3K63 A;  1V74 A;  1W2Z A;  4JQ0 D;  2IFM A;  1BCC J;  2E42 A;  1CYU A;  1TRP A;  5AVR B;  4X2O A;  4OH8 B;  1N9J A;  5JPP A;  3WOD G;  1SQX E;  3H1L G;  3BAS A;  2PZV A;  1HGZ A;  1DYU A;  1N5P A;  1FC2 C;  1LTG C;  2PRR A;  1X1Y A;  1STD A;  4U3F E;  2BAS A;  1E79 H;  1IK3 A;  4DOJ A;  3K9M C;  1ZGX A;  2KRT A;  2K3R A;  1NJI Q;  5D82 A;  1LTB C;  1ZLL A;  3A0B H;  3V4Q A;  3Q5R A;  4H44 D;  1PPJ G;  1QX8 A;  1BAN A;  1AFO A;  1I3I A;  1T6A A;  2FGT A;  1VQO P;  3LTD A;  2OYO A;  2OQQ A;  5AVQ B;  4EBG A;  4Y99 C;  2XNX A;  5APV A;  3L74 J;  3GRD A;  1VQL 3;  1RRL A;  4KVH A;  1L0L K;  3F8H A;  1YIJ P;  1CI6 A;  1V58 A;  2R3C A;  1SFC A;  1X1U A;  1RE4 C;  3M0D A;  3V98 A;  4AEQ A;  3MUD C;  5APQ A;  1LT9 C;  2XRX B;  1KYO E;  3PCS A;  3SOA A;  2JDI H;  1JZD A;  1XTC C;  3L75 J;  3RGU A;  1NB5 I;  1EQ7 A;  4U3F D;  2WIT A;  1UCI A;  3AE2 C;  1O7H B;  4Y28 J;  2CFK A;  1FZF A;  3I56 P;  4W80 A;  3DGO A;  2ZJS E;  3HZP A;  2E43 A;  1T2H A;  1D6U A;  3TGU G;  2BHM A;  2AAE A;  3I55 P;  4L74 A;  3L73 D;  1VL2 A;  2W6J H;  1EDK A;  4LYL B;  4FMD A;  3KQG A;  5KP4 A;  4GHO A;  4KFE A;  1LOX A;  3TDG A;  1LQG C;  1EDI A;  3H1I E;  3KXD A;  3FLJ A;  5AW8 B;  1JNM A;  1OHP A;  3FKA A;  3RK3 D;  1X22 A;  1RNB A;  2O01 N;  3SSU A;  1L0N E;  3HE4 A;  3A0H H;  1W00 A;  2QE7 H;  1GY7 A;  2I1J A;  1K9M 4;  1NWW A;  3FG4 A;  1SIH A;  1IFJ A;  2P7J A;  4GKG A;  2Y73 A;  3TK1 A;  2QVA A;  2J5U A;  2QM8 A;  1BSB A;  4FMC A;  1UGI A;  4IL6 H;  3EC9 A;  1GMP A;  3GHG B;  4BTY A;  1GMR A;  3H1K G;  5BU5 A;  9RNT A;  1H89 A;  2F5W A;  2NPS C;  2CWU A;  1XTG B;  4AKY A;  3O6Q A;  2W6B A;  4N6J A;  3AEA C;  4RNY A;  2WOH A;  3VN0 A;  2K9J B;  2XSO B;  2H0I A;  1DIP A;  1S72 3;  3SLU A;  4FCZ A;  4UB8 H;  2G8Y A;  3RK3 C;  1TTO A;  1J1D C;  3PXM A;  2E76 D;  5GTH E;  2XF3 A;  1X9V A;  1FUS A;  3LTA A;  1JB4 A;  3IMA B;  1P84 H;  3VMA A;  4Z1M H;  1GOY A;  4RNZ A;  1RGF A; 
#chains in the Genus database with same CATH homology
 3GAX A;  3HK4 A;  1Q86 4;  2IA7 A;  3O8Y A;  3K5T A;  1JKG B;  1T5Y A;  2WO0 A;  2XH9 A;  4KZ1 A;  2P09 A;  1NJI 4;  4K90 B;  3NXJ A;  1VQ6 3;  1NDO B;  2CG1 A;  1O7G B;  4N6N B;  1YHQ 3;  1OCV A;  3DY5 A;  3A76 A;  3NHX A;  1JB5 A;  1U8C B;  1KC8 4;  3DGL A;  5IEN A;  4QMA A;  1IVW A;  1OUN A;  1ISK A;  5IER A;  3SOY A;  3VF1 A;  1GY6 A;  3KN4 A;  5AI1 A;  2V1L A;  2Z76 A;  2CW9 A;  1K41 A;  4J8T A;  4MJD A;  3CMA 3;  2D42 A;  5CXO A;  4U13 A;  3S27 A;  1Q42 A;  1WMO A;  2YFL B;  1O7N B;  3MYT A;  4ORL A;  3UNL A;  2CWV A;  3CME 3;  3SX1 A;  1JB2 A;  2BMO B;  3DM8 A;  4N6O B;  4DJG A;  4MEI A;  2KXG A;  2SBL A;  2Q07 A;  1VQ8 3;  4HM1 B;  3KE7 A;  4FCM A;  3MG2 A;  3GZB A;  1W7C A;  2Z7A A;  1YIJ 3;  3MWZ A;  1OPY A;  1OHS A;  1FGO A;  4IIA A;  2K54 A;  3CCQ 3;  1IFP A;  1OAC A;  1W6G A;  1ZX2 A;  2HMJ B;  5ELU A;  2QA4 3;  1NO3 A;  3X42 A;  4K1V A;  4XDW A;  5AIH A;  1FGQ A;  3U1W A;  3LML A;  4I4K A;  3DMC A;  5CLK A;  1D6Y A;  2P0M A;  2PNC A;  3JUQ A;  3HII A;  1QVF 2;  1JN5 B;  2UX0 A;  4EV5 A;  2P0X A;  2Y74 A;  3MG3 A;  5STD A;  1EQK A;  4H61 A;  1PU4 A;  2BNG A;  4LZI A;  1W6Y A;  3G8Z A;  4K1U A;  3V92 A;  4ZM8 A;  3CNM A;  3EBT A;  1SPU A;  4NRE A;  2E5T A;  8CHO A;  1VQ9 3;  3NQZ A;  2XFS A;  4O3V A;  3GZX B;  1JN5 A;  4IPB A;  2MC8 A;  2M7O A;  2I9W A;  3FH1 A;  3OWU A;  1Z1S A;  3OX9 A;  4XBT A;  4XB5 A;  2IUJ A;  4AKZ A;  3HIG A;  3DUK A;  1TUH A;  1JJ2 2;  4HM4 B;  3PZW A;  1JKG A;  5D83 A;  1ASK A;  1W6C A;  1Q40 A;  3WMD A;  5BVB A;  1TFO A;  3CCL 3;  3N9H A;  4EXR A;  4WFO A;  1BSN A;  1LXE A;  1PFP A;  3X41 A;  1D6Z A;  1FS0 E;  4RZM A;  3Q2P A;  5AIG A;  4CDL A;  3D9R A;  1JNQ A;  3H3H A;  4OVM A;  3SVA A;  1BSH A;  1W5Z A;  2OCT A;  4FMA A;  3KSE D;  2CHC A;  2XFT A;  3S67 A;  4GB5 A;  2CFW A;  3OWY A;  3F7X A;  2W56 B;  3FZW A;  1FUW A;  5DRV A;  1AR0 A;  3KFQ C;  1ROV A;  1ULI B;  2CC3 A;  1YI2 3;  4HKV B;  3X40 A;  4FMB A;  2RSX A;  1KD1 4;  2IMJ A;  1MNL A;  5AII A;  1LNH A;  1TIJ A;  2W56 A;  2XGL A;  3ECF A;  3JUN A;  1F8N A;  3F40 A;  2D1W A;  3FG3 A;  1R4C A;  2BO9 B;  3KSP A;  3VSY A;  3WOF B;  1CQS A;  1W2B 2;  1IQ8 A;  4IT7 A;  4N6U A;  3K7C A;  3MHE A;  3NBB A;  4EC6 A;  3CC2 3;  1IVX A;  2LQV A;  2RGQ A;  1FGR A;  1K28 A;  3BNE A;  4KFD A;  4FCJ A;  1M1K 4;  3USS A;  3EB8 A;  3I0Y A;  3AMO A;  3KZT A;  4WHA A;  4BTW A;  3CCV 3;  4L8O A;  2HML B;  1TP6 A;  2YX9 A;  1AVK A;  4L7K A;  2F99 A;  4R9L A;  2OTL 3;  5JPU A;  5FGO A;  1N5H A;  3BNC A;  1TFK A;  1U5O A;  2CFL A;  2CFD A;  3CPO A;  3UJM A;  2WOF A;  3SED A;  1NU3 A;  1YJW 3;  1A90 A;  4N6T A;  1SJW A;  4J9A A;  3L0R A;  3PYJ A;  2XSH B;  4N6L A;  1BUQ A;  2O3O A;  1E3V A;  1HKX A;  3CCJ 3;  1GY5 A;  3EE1 A;  3X3X A;  3OXA A;  1GS3 A;  3B4O A;  2P38 A;  2XEP A;  1SQW A;  3CCS 3;  2B1X B;  2XND H;  3NBR A;  1RN7 A;  1OH0 A;  3LXU X;  2R4I A;  1QAK A;  4HM8 B;  1HU9 A;  3EN1 B;  3K0Z A;  3JUM A;  4HM7 B;  1DMQ A;  1IVV A;  3I56 3;  4Q53 A;  5IEO A;  2K0M A;  1DMN A;  4K61 A;  1OF5 B;  1Q7Y 4;  4L8P A;  2HMK B;  4LGQ A;  4JRF A;  2W9Q A;  1KSI A;  5AYS C;  3H51 A;  5KP1 A;  2E2T A;  1OF5 A;  5CK6 A;  1LVN A;  4R80 A;  1A67 A;  5EEO A;  1E97 A;  1G96 A;  1UI8 A;  3V99 A;  3EQQ B;  3G71 3;  6STD A;  2XGN A;  3PS8 A;  3PGB A;  4HJL B;  2IUK A;  3G6E 3;  1Q82 4;  5LC6 A;  1IQX A;  4HM5 B;  1VQM 3;  1VQO 3;  1WMP A;  1WTH A;  1VQ5 3;  4HM0 B;  3ROB A;  2ZDJ A;  1EKM A;  1S5A A;  2LYX A;  5I97 A;  1Q81 4;  1AV4 A;  3FSD A;  2A15 A;  1O7M B;  3X3Z A;  1N8Q A;  2CKF B;  5FW5 A;  2OOV A;  3CU3 A;  3F7S A;  3DXO A;  4HZ9 B;  4FR9 A;  3EBY A;  3IJE B;  2V7Q H;  2W0Q A;  2HMO B;  1DVD A;  1STF I;  2CK3 H;  4STD A;  5G2G A;  3MKI A;  3FF0 A;  1IVU A;  3D3L A;  5AIF A;  1RJO A;  2W04 A;  5ELJ A;  5IG5 A;  2ZL8 A;  1FGT A;  1WMN A;  4CCV A;  1WNH A;  4MMX B;  1L5G B;  3NQY A;  4LSO A;  1KQS 2;  5AEW B;  4HYZ A;  1GD3 A;  3NM2 A;  1K73 4;  1JRQ A;  2RFR A;  3OWS A;  3LZA A;  2E2U A;  2E5Y A;  3CCU 3;  3NM7 A;  3BB9 A;  3WA2 X;  1UW1 A;  1QMA A;  5AEU B;  3J7Y d;  3Q90 A;  2OQE C;  1SII A;  2CWT A;  1IU7 A;  1W02 A;  1CEW I;  2GU1 A;  5BXQ A;  3FCS B;  3GZY B;  3WOE B;  3OV4 A;  3T8N A;  5D81 A;  3M8C A;  1ROA A;  2YFI B;  4GL6 A;  5IG4 A;  3X3Y A;  1K8A 4;  1N9E A;  1CYV A;  2CIU A;  2OTJ 3;  1EA2 A;  3NUV A;  4NHF A;  1VQK 3;  3DGM A;  4WYK A;  3JUO A;  2OOV C;  1GD4 A;  4TLF A;  2W9P A;  3NV0 B;  5TGN A;  2QGU A;  4WWU C;  3EF8 A;  1YJN 3;  3DZL A;  1IQY A;  1QVG 2;  2P05 A;  4XBX A;  3K63 A;  1V74 A;  1VQ7 3;  1W2Z A;  2MF7 A;  4XDV A;  1YIT 3;  7STD A;  3JUP A;  2GEY A;  4OUQ A;  3RDE A;  5CF2 A;  4HM2 B;  3Q1C A;  2F86 B;  1VQP 3;  1CYU A;  1WQL B;  2RCD A;  3EFF K;  2HMM B;  1M1X B;  3G0K A;  4PEJ A;  4X2O A;  5JBS A;  1N9J A;  1O7P B;  1IDP A;  5JPP A;  2GBW B;  1VQN 3;  4LEH A;  3WOD G;  2KCD A;  1IV9 A;  1W4N A;  2PZV A;  2GEX A;  3BLZ A;  1DYU A;  1OGX A;  1N5P A;  3S28 A;  1STD A;  3VGN A;  3AMO B;  1UI7 A;  3LTB A;  1E3R A;  3ER7 A;  4G1M B;  1E79 H;  3BND A;  4R4K A;  4EYC A;  1IK3 A;  3F9S A;  3I55 3;  1DMM A;  1N8R 4;  3K9M C;  3G4S 3;  2OQE A;  4QWT A;  2KRT A;  5A0O B;  3GZR A;  5D82 A;  5IG0 A;  3MG1 A;  2GU3 A;  4XM4 A;  3CNX A;  5KP3 A;  1TU5 A;  1YGE A;  1EG9 B;  2F98 A;  3NV0 A;  4WP5 A;  3B4P A;  2O9U X;  5HGR A;  4R1K A;  3STD A;  3T8U A;  2FGT A;  4O2H A;  1IV7 A;  1M9G A;  2W03 A;  4WYK B;  2GBX B;  3LTD A;  3UB1 A;  2B24 B;  4EBG A;  3KKG A;  2FXT A;  5DRE A;  3HI7 A;  3F14 A;  1QJG A;  3GRD A;  1YJ9 3;  1JV2 B;  5CF1 A;  4HM6 B;  1VQL 3;  4YXW H;  3CC4 3;  1RRL A;  3MSO A;  4KFF A;  4KVH A;  5EQL A;  5LC7 A;  3F8H A;  3F8X A;  1KWI A;  3RGA A;  1AQT A;  1RKY A;  3V98 A;  4AEQ A;  1A2V A;  2W2C A;  2XRX B;  3PCS A;  4EV2 A;  3SOA A;  2JDI H;  4TX4 A;  2ML5 A;  2CG0 A;  5AYR B;  2C10 A;  2XR8 B;  2HMN B;  2BT3 A;  2L4V A;  1NB5 I;  5IF6 A;  3KII A;  3N8B A;  3HX8 A;  4XBY A;  1ZO2 A;  3MPH A;  1O7H B;  4BTX A;  1A2K A;  2E2V A;  5EVH A;  1J2B A;  2CFK A;  2WGQ A;  2OWP A;  3B7C A;  2ML6 A;  3IPT A;  3CXC 2;  2C11 A;  4WVZ A;  4RBN A;  3EJV A;  1ULJ B;  2CH9 A;  3DGO A;  3HZP A;  2YFJ B;  3LOY A;  1D6U A;  1FGM A;  2BHM A;  1Y4K A;  3LT8 A;  4JF8 A;  1O7W B;  5IW9 A;  1UUW B;  2W6J H;  3S5C A;  2STD A;  4HM3 B;  3CCE 3;  3WDG B;  4FMD A;  1YVB I;  1US1 A;  3U97 A;  1AVL A;  1JEK A;  5KP4 A;  4KFE A;  1LOX A;  3TDG A;  1VZZ A;  2WSS H;  3NX0 A;  1IT8 A;  1Q40 B;  1GYB A;  4HBR A;  2QEX 3;  3DGN A;  3G16 A;  3JVC A;  1RRH A;  3CD6 3;  1IT7 A;  3FLJ A;  1OHP A;  3FKA A;  1OHO A;  4OK0 A;  3EHC A;  4O8S A;  1MOL A;  3QK9 A;  3UL6 A;  5IEP A;  4X2H A;  2QIY A;  3FGY A;  3S29 A;  1QAF A;  1W00 A;  2QE7 H;  1UUV B;  1GY7 A;  3LH4 A;  3LTC A;  3SXX A;  1NB3 I;  1K9M 4;  1NWW A;  2CFG A;  3FG4 A;  1C7H A;  3N54 B;  4H3U A;  1SIH A;  2Y73 A;  4R9K A;  3FG1 A;  4FMC A;  3RGR A;  1FA3 A;  3EC9 A;  1M90 4;  4BTY A;  3UL5 A;  4LMI A;  3LT9 A;  3ALA A;  4HZB B;  2Z6B A;  3PCR A;  2BMQ B;  2CWU A;  5IG3 A;  4O02 B;  3CPW 2;  4AKY A;  1W01 A;  3FF2 A;  4MMY B;  4N3V A;  4RNY A;  2WOH A;  3OW2 2;  4N6M A;  1VQ4 3;  2Z77 A;  2INX A;  4HVN A;  2XSO B;  3B8L A;  1S72 3;  3SLU A;  4FCZ A;  2BMR B;  3QRD A;  3CCM 3;  1DVC A;  2WGO A;  4MMZ B;  3PXM A;  3CCR 3;  2XF3 A;  3NBJ A;  3BNB A;  3PJS K;  3EX9 A;  3EN8 A;  1OGZ A;  3GWR A;  3LYG A;  3WA3 A;  2JQ5 A;  2FNQ A;  3LTA A;  1JB4 A;  3IMA B;  4N6V 0;  3CC7 3;  3T0U A;  3E99 A;  4RNZ A;  1QAL A;  2GXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...