2CK3H

Azide inhibited bovine f1-atpase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
83
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title How Azide Inhibits ATP Hydrolysis by the F-Atpases.
pubmed doi rcsb
total genus 12
structure length 83
sequence length 124
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2ck3H02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ck3H01
2WSSH 1E79H 2CK3H 1FS0E 3EFFK 1IFPA 4DJGA 4TLFA 2QE7H 2V7QH 4YXWH 2XNDH 1BSHA 2JDIH 1AQTA 4WVZA 1BSNA 3PJSK 4QMAA 2E5YA 2E5TA 3USSA 1JEKA 2W6JH
chains in the Genus database with same CATH superfamily
4XDWA 3HOHA 1RHZB 3D6ZA 3VMAA 1N8QA 3KQGA 1UCIA 3NM7A 1L2PA 5AVXB 1NWWA 4B86A 3RGRA 1ZR2A 4GIFA 1UCLA 3CCS3 5KAIE 1RGKA 3CCQ3 3L36A 1JZDA 3L73E 4DZOA 1PPJD 2YKPA 1BNJA 3DGYA 1H88A 1GU4A 2PP6A 1R8EA 1FDIA 2G8YA 3C8VA 1R5LA 2DW3A 5AI1A 1N8R4 3H25A 2SARA 3O6QB 2WSEJ 5GTIH 3V4WA 4PD4H 3BNCA 2WSSH 4IOIH 5AW7B 1TIJA 3EBYA 1MZ9A 4EIJA 3D79A 1L4AC 4ZMDA 1SQPJ 1E3RA 3OW22 4TLFA 4KFEA 3G4SP 3KZIH 3CCJP 3BRTB 4LMIA 1BGSA 1JCCA 2XFSA 1QAKA 1BGYG 1OVVA 1TFOA 1IYYA 2QJKC 3CCR3 1LNIA 2Z77A 4D6TD 3CCL3 3CPW2 3ITKA 1X79B 3S5CA 1RE3A 1VL2A 3CI9A 2CH9A 3FG3A 1KQFB 1N9JA 2K88A 1I70A 4OVMA 1VQ83 2BEQD 2P58A 1Y9BA 1SFCC 2M3EA 1B21A 1T8ZA 3S29A 3VMXA 3V2PA 2BCCE 4ZM8A 1S5AA 2NZ2A 1EC5A 3KHUA 1GD4A 1FJKA 1T3JA 1AVYA 2W8ZA 1L0ND 4IPBA 5APVA 2JQ5A 3V6IA 1D6YA 2HLOA 3FKAA 3MG1A 1VPCA 4DT0A 1JB2A 2OGUA 2P38A 2Y73A 2FKWB 1ISKA 1JY3N 1SFCD 1EDJA 1KC84 3GRDA 1GL2A 5FW5A 3HTKB 1QLED 4LYLB 1JBTA 1AVKA 1R4YA 3GZBA 4N6JA 1LT9B 3DXOA 1VF5B 3AE9C 2E2UA 1KQS2 1UIXA 3TYYA 1LTGC 4H13C 1YJN3 4HBRA 4JBZA 2V1LA 3UNLA 1JTHB 2GBXB 2WSEH 3A3YB 2F5WA 2WQYC 1YTZT 1L0LD 2HOHA 3U97A 2KF4A 2QGUA 2CPBA 1GMPA 4FCMA 2WPRA 5CCGA 1SQBK 3CC2P 1NU1K 2LR2A 2RGQA 1SQPG 2XGLA 4K3AA 1N73C 2L1SA 1YIJ3 1SQXG 2OQQA 3B8LA 4U3FJ 2ZA4A 4H13D 2C0WA 4UB8E 5CJ0A 2E76B 3AEAC 1N7SA 3D6YA 1IV7A 3O8ZA 3WUTA 1WMPA 2O01J 2ITAA 2P09A 4GODA 3DGLA 1Q7HA 2W56B 1P84E 4XB5A 5AVTB 2KS1A 2R44A 1U7MA 1RNTA 5JPPA 1LOWA 1T2IA 3I553 1TU3F 2F86B 2K1AA 2XRXB 3UIAA 3MYTA 3A5TA 1EUIC 1S72P 1RLSA 5KAFE 3HTKA 2CFWA 5LC7A 1RE3C 1LNHA 2KAAA 3L0RA 2CWTA 1W00A 4JYCA 1KQLA 3MKIA 1BSAA 2GA1A 3H1ID 4RZMA 3HD7C 3N9HA 4H61A 5E79H 1OGZA 2ZDJA 3ZDMA 3KCHA 3PRJA 3EE1A 5BVZA 5DRVA 1L0NJ 3H1HE 1B27A 4N6NB 1PIXA 2W03A 2R32A 1FBMA 1ZRTD 3CWBE 3L70D 4KJMA 1BE3E 5CLKA 3SXXA 1KILC 1GMRA 5AW9B 5H2FE 2C9NY 1N9EA 1YI2P 3HD7D 4OWFA 1EDKA 1OVUA 2HMOB 1GL2C 1GOVA 1KWIA 1J1EB 5AW4B 5JPUA 4RJTA 3RGUA 1LQGC 2NPSB 3AE2C 3CXHE 3EFGA 1KD1Q 4U3FG 2W56A 3BLZA 3GWRA 3K5TA 4HM5B 1L0LJ 1ZR4A 1KILD 2OQEA 1BNIA 4I1LA 1Y4KA 2M5AB 1RY3A 2O01H 2Q3EA 4YPCA 2OWPA 2W83C 1RSNA 4CDLA 2XEPA 3AMOB 2YNYA 3A76A 2H89C 2NRGA 1WT6A 1A2VA 2J8XB 1ZN5A 1KTMA 1HBWA 1YQ3C 5APWA 3CC43 5KLIB 1IFJA 1GK4A 1US1A 1PP9D 1ZV8A 2OYHA 2ZXEB 2WSCJ 2A45H 5FGOA 4N6UA 1N7SC 1KB9E 2WO0A 3G713 2W90A 3H1KD 3B4OA 5BXQA 1BRJA 3SVAA 1SVFA 3C1LA 1WQLB 2N1TC 4HM1B 1IVVA 1W4NA 3LTAA 1FC2C 4HJGH 4JF7A 1KQSO 2AXCA 1OF5B 1QL1A 4BRYB 1N7SD 5GTIE 3PJSK 3CMEP 1LJ2A 1L0NG 5IEOA 4M3LA 3CLQA 1JY2O 1NTME 1F8NA 3L72D 3P8CE 4G1MB 2OYOA 1W6YA 3H1LJ 3H1IJ 1SQBD 2JO1A 3AECC 3L75E 2N1TD 1DX7A 3RL0B 4HM8B 3W67A 3H1JJ 1BNRA 3LW5J 3N7NA 4CCVA 4FR9A 3IF4A 1RGEA 1K04A 5IG0A 2YKQA 4PJ0H 4AYCA 4ZKUA 2OARA 1W2EA 2Q9IA 1IVWA 2YFLB 4L7KA 3AMOA 2P0MA 5EEOA 1DMNA 1JMMA 1TU5A 2HODB 2OYIC 2ZVOB 1DETA 2W6AA 4HAAA 2Y74A 5L8RJ 1KC8Q 3LT9A 3Q5PA 4MJDA 3QH9A 2CX1A 3TDKA 1MGWA 1I2GA 1RRLA 4WY4B 2UX0A 1SS1A 3L74E 1EZVD 2WSCH 1NTZK 3Q5RA 2K54A 4C46A 5GTHE 4EBGA 1AV4A 3TGUD 3FG1A 3HUSC 2QA43 4HM4B 3USSA 2HPCB 2WOFA 4HJLB 1Z56A 2YMYA 4BRYA 4R80A 4PEJA 1HH0A 1Y47A 1V74A 1HGVA 1G1IA 1B2MA 2OYHC 2PFXA 2AADA 5K5GB 2XU6A 4NHFA 2WPQA 4WVZA 1BSNA 3I0YA 3HX8A 1MWUA 3H1KJ 4OUQA 1CEWI 3N4XA 2KK7A 1M7LA 1LTBC 3WODG 2OTJ3 3GSPA 1SQXK 3H1LG 4MMXB 1LOYA 2KF5A 4RO0A 3LW5H 4R4MA 2HODA 1WMOA 3H1JG 1VQO3 2CG1A 5IF6A 5M18A 2IDBA 1LTJB 1ZW0A 1RGAA 5B66H 5APQA 1WNHA 1H89A 1UI8A 1IVXA 4N6OB 3L72J 3FWNA 1DVCA 3PYJA 4EOTA 2IYOA 1SQBJ 1DD3A 1NU1J 1QGKB 1KYOE 4WY4A 3RK2B 1OPYA 3WDGB 2B87B 3VGNA 3CMA3 5AW0B 5KLVK 2FYZA 3V2RA 1NAFA 5STDA 5JBSA 1VQ73 1S2EA 2F99A 4TT3H 4KHXA 1M56D 2KSJA 1S9KD 1IFMA 3II6A 1GZLA 6GSPA 3MHEA 2O9UX 5D82A 2QIYA 1Q864 1OCVA 4BTYA 1MOLA 5E79E 1FOSF 1YVBI 2WGQA 1O7WB 1M1JA 1SQVK 2YMKA 2KZIA 1KN7A 2PZVA 3PS8A 2B89A 1BSCA 2J58A 3PTZA 2YIUB 3H51A 4ORLA 2CX0A 3TGUJ 2XNDH 1U5OA 4WFOA 1KB9I 3Q90A 1C7HA 4MMYB 1BCCE 4KZ1A 5EFWB 1PFIA 3TSIA 4RKUJ 1RNBA 3EJVA 4GSPA 2BCCG 1BGYD 3IFMA 1BNSA 2ZVNB 4JYBA 1QJGA 2Y0CA 3T0UA 1D7MA 5CCHA 2QE7H 4K90B 2E75C 2B87A 1BNGA 3NUVA 2QJPB 1BSHA 1G96A 3PZWA 2FYUE 3DH2A 3W68A 3LIDA 3L72G 3FSDA 5EQLA 1NU1G 2WT7A 1JY2N 2CKFB 4CPGA 2WPVB 3CD63 3U1AA 3RNTA 4D6TE 1QX8A 1YGEA 2XZRA 1PU4A 1TRPA 2GBWB 5CHXA 2D2CD 1NU3A 3EN8A 2FYUK 2AAEA 3HIGA 2N9BA 2QVAA 3WA3A 3BIRA 4DCKA 3NM2A 2HMJB 1JM0A 2RCDA 3TK1A 1VQN3 2IBZE 1H0TB 1IFNA 1AQZA 5AVQB 1BANA 4AKZA 4BL3A 1FZCA 1RE4A 5BU5A 3DM8A 1Q7Y4 5AVUB 2FY8A 3PCSA 2WGOA 1Q814 3B5NC 4YXWH 1DYUA 2CFLA 2K3DA 3TGUG 3OA7A 1SQPD 2R5BA 3AEFC 3NXSA 3UJMA 4W7YA 3PP5A 1SQXD 3L71J 4EYCA 1M1JC 1KQGB 1IT7A 2FXPA 3U1WA 1GU5A 1S5LH 2M7OA 4K1UA 1JNQA 3SWFA 3B5ND 1HJBA 3GG2A 4HKZH 4IFDK 2J59M 1JO5A 5G1LA 3V92A 3JVCA 3A0BH 3AEGC 1ROVA 1D6ZA 1XTCC 1RGCA 4XM4A 5KLVD 1BGYJ 2HR3A 3WU2H 1OX3A 2W27A 1URQB 5KP1A 3M9BA 3CU3A 4ASVA 1GY7A 1M1KQ 1DMMA 5G2GA 4GB5A 1OWAA 2ZJSE 3BCCD 1DVDA 1FS0E 2KI7B 3H1HG 2ZYDA 1PZQA 1AVLA 4HYTB 1FUTA 3OWUA 1ZGXA 2RFRA 3CWBG 2P05A 2YO3A 1X1WA 1H0TA 2F56A 1NOHA 2K9JA 1JV2B 2F5MA 1G0TA 1KYOI 3KE7A 2ZT9C 1EDLA 3E1IA 1RF1A 1SIHA 2AEFA 3ECFA 1Z1SA 1M9GA 1X1UA 2QM7A 1NTZJ 1BRGA 3B7CA 1DEEG 4O3VA 1PY3A 2PAJA 3EX9A 1CH0A 3LIEA 4Y99B 1MWSA 4NPFX 1TUHA 3LT8A 1MFTA 1A2PA 1K28A 3P8MC 2WZ7A 1NAYA 2ZT9D 1BAOA 2JJLA 3FWLA 3KSED 4U13A 2BASA 3CPOA 1BDCA 1OW8A 4H0LB 3L71G 4EC6A 4U3FD 1FZCC 1NDOB 3EN1B 1JBSA 1SLQA 4OGQB 3T97A 1ZRTE 3L70E 1E5WA 1Q40A 4R4LA 1EA2A 4GDOA 1URQA 1ZOYC 2XSHB 5AIFA 2P7JA 2E74C 3OJAB 4HM0B 1OH0A 3BNEA 1SQXJ 2HMKB 5AW5B 4BL2A 1NJIQ 1JY3P 4LGDE 4PV1B 1HVVA 2Q5UA 1USDA 4AUWA 2GU1A 1K05A 3RK3C 3TDGA 2FYNB 2IMJA 3NQYA 1VQMP 1L4AD 2E74D 1U8CB 3L4FA 1UUVB 3CCEP 2BU4A 2W9QA 1NTMG 2XH9A 4O2HA 2CWUA 3ABVC 4AQRD 5KLVJ 3L75G 5I97A 2Z76A 4LC1A 4L73A 1IQ8A 1YJ93 5D81A 3NBRA 4N78D 2Q6QA 1X9VA 4A7PA 1UCJA 1PP9E 3QWOC 3BCCJ 3MUDA 4MEIA 3RK3D 2W6JH 1VQ63 3CCSP 5DJTB 5B5EE 4L75A 3CCQP 2HMNB 1G2CB 1NTZG 4HKVB 3IAOA 2A06G 1X22A 4H44B 3G9RA 2CFDA 2IA7A 3CX5E 1AQ5A 1W6CA 1SQVJ 5CK6A 4RBNA 1W7CA 2INXA 1DIPA 1AQTA 3O6QA 1NTKE 4LEHA 1RF1C 2IBZI 4UB6H 2ZYAA 3V2QA 2KNCB 1B20A 2ML5A 2RN0A 2WVRA 3NTNA 1I0XA 1K9M4 1I0VA 1TRQA 3O8YA 1SJWA 3LMLA 1LQMB 3WOFB 3SOYA 2Q7CA 1LGHB 1W2B2 1IQYA 3OAKA 1IFIA 3SWYA 3BU4A 1J2BA 2O3JA 1OXZA 3CCRP 2MC8A 1NTKK 3AEDC 1UUGB 5AW3B 2WOHA 3CCLP 3DGMA 3FLJA 1N7LA 4HYZA 2P67A 1VQ8P 1GD2E 1V58A 2AXTH 4HB1A 1TP6A 3D70A 3RDEA 1QEXA 1RQVA 3U1CA 2GUSA 3CCV3 2JKVA 3DGNA 1SPUA 2QRXA 1BSBA 4HM7B 1K8AQ 4C7RA 2KP8A 2KCDA 1MNLA 4FMAA 5KKZB 3K63A 1ZXGA 4HM6B 1BVIA 1AVOA 5KLVG 5HOHA 3QK9A 1G2CA 1OIPA 2R3CA 2JWAA 2FXTA 2KRTA 3JUMA 2P2UA 3VSYA 4ZKPA 2C11A 3M0AA 2QJYC 4U7JA 3BCCG 5CJ4A 4L8PA 7RNTA 3SYUA 1IDPA 1LT9A 1LTAC 2GUVA 3H1LD 3CCU3 1YJNP 1N5HA 3NMDA 4IL6E 1JTHA 2ML6A 3KKGA 3H1JD 1SQVG 4EXRA 3HZPA 5TISH 1S5LE 4R1KA 2C0XA 1TTOA 5EVHA 1ZMEC 1FA3A 3MUDC 5ELUA 4ILFA 4J9AA 1NWQA 1STFI 4J8TA 4K61A 1YIJP 3HE4B 2WSFJ 3OW2O 3X3XA 3Q1MA 1GD3A 2O1KA 3L73D 5AIGA 1K41A 2STDA 4TX4A 1QVG2 1AR0A 1JOCA 2Z4EA 4GOEA 1FE6A 1HTLC 2KIKA 2LXBA 5CBOA 3Q3FA 1J1DB 5CMZA 1FZAA 2QM8A 2BMOB 2KOGA 3CPWO 4FMDA 4KVHA 3KN4A 2HMMB 3I55P 1LT1A 4BXLA 1W2ZA 2H0GA 2YFJB 3CCM3 2IZ0A 4EDFA 1BCCG 1GL2D 9RNTA 3FZWA 5CCGC 3SWKA 3EHCA 3S4RA 3GZYB 1OW6A 3TF5A 4XBTA 1UIIA 2KZJA 1N8RQ 2IUKA 1LOXA 2HG5D 2RNTA 1GMQA 3C9IA 3DMCA 1GDTA 1PGJA 1S9KE 3RGAA 3NV0B 2BNGA 2XFTA 4MMZB 4GOFA 2W2CA 4N6MA 4XFJA 3AE7C 4BTWA 1VQK3 1JCDA 2FYUG 3MTUE 5CCGD 2BCCD 1AFOA 4I2LC 3I563 5AVVB 3F8HA 1FUWA 3V4QA 1YHQ3 2KF6A 2WTYA 3VMZA 1ZP0C 3HE4A 4HZ9B 3A5EA 4PD4E 1FGMA 4XA4A 1PV3A 2WWWA 1GY5A 1MFZA 1M8OB 1FGRA 1AY7A 3A0HH 1UI7A 1JB0J 1LT9C 1VF5C 2NPSA 2WSFH 1NU1D 3G8ZA 3KZIE 3P32A 3CX5I 1CZQA 3A2AA 4STDA 2C4BA 3FG4A 1NKNA 2IBZG 1VQ53 2MKVA 1GOUA 1O7GB 2E2VA 3MG3A 2M5AA 1ULIB 3T8UA 1D6UA 2CHCA 3MSOA 1Q90D 1B2XA 2IPPA 1HKXA 2FNQA 3D5IA 2BHMA 4K35A 1SQQE 3JC22 1NTMK 1VF5D 1JEKA 1HZ1A 3CC73 1CW5A 3L73J 3CC4P 1UUWB 1WTHA 2FGTA 3KZTA 2UUGC 2I1JA 2E76C 2D2CB 2JWDA 2HMLB 2OOVA 8CHOA 2YO2A 4X2OA 3G71P 3NV0A 4N6V0 1A02J 3MHVA 3V99A 4Y28J 1LWUB 1VQP3 2RH0A 2M0BA 3I56P 3LTBA 4RNTA 3JCUH 2F4YA 2OQEC 3PGBA 3WA2X 2VRSA 3JUNA 1I2EA 3HIIA 3GW6A 1AV1A 2E76D 2JEEA 1BRIA 4W80A 1OF5A 1P84I 2CWVA 1RGHA 1OUNA 4UB6E 2XGNA 1BNFA 3GHGB 2CIUA 1OGXA 4OK0A 3F8XA 3WMDA 5GSPA 2GSPA 3KDPB 3HK4A 3Q1CA 2FFDB 1VQL3 3BVHA 4NPDA 2XF3A 4CPKA 4RNZA 3OX9A 4IFFA 4R9LA 3P7KA 2BCCJ 3WHOA 1WMNA 1W6GA 2W0QA 3AE6C 5CXOA 3H3HA 3S28A 3H1HD 2W6BA 2AXTE 1PGOA 1O7MB 3OWYA 2LKMA 3CWBD 3JSVC 4YTPC 1J1EC 1NGMB 2Y9YA 3VP9A 4C7NB 3LTCA 3UL6A 5KAIH 2NPSC 2H0HA 1JB5A 1LWUA 1JN5B 1J1DC 4L74A 2KLVA 3L73G 5A0OB 1JZOA 2CK3H 2BT3A 2IYJA 4JRFA 2PNCA 3BB9A 1BIRA 5AVYB 3F89A 3CXHI 2QA4P 2HPCA 2W04A 1NKZB 1IT8A 5KP4A 2POHA 1BOXA 3FX0A 2FXMA 2CPSA 4Z1MH 3HI7A 3GHGA 1KZUB 2LXCB 4NPEA 1IK9A 5KLIC 2CG0A 4N6TA 2IY2A 3NX0A 3L71D 2OOVC 4XE5B 4WWUC 2ZHXB 1JNMA 1VQ93 1JB4A 3WR2A 1HU9A 3NBJA 3CL3D 1KB9D 2YX9A 3AHSA 1T2HA 5TGNA 1RN1A 1UGIA 2UWJE 5BU4A 2OTJP 1JY2P 1YIT3 5APYA 5AIHA 1FUSA 1CQSA 4NREA 1NYHA 1GW4A 1PPJE 1VQOP 4BU4A 3H32B 4R9KA 1LTJA 2IFNA 1CI6B 3N54B 4EV5A 1E3VA 3LH4A 5APTA 4I4KA 5AIIA 4C7NA 1KSIA 1VQQA 3M0DA 4PD4I 2FXOA 2M8RA 3CMAP 5BU8B 1B2ZA 3EBTA 3RL0C 1NTMD 4EW5A 1N5PA 4WHAA 3P8CD 2P1JA 2QEX3 3L75D 3M8CA 1FZGA 1L4AB 1QVF2 3G6E3 1VQ7P 5BIRA 3U59A 1NTKG 3VN0A 1IZNB 4HZBB 1GTWA 3H1HJ 1AA0A 4O8SA 3Q2YA 4EYYQ 1NO4A 1G02A 1NTZD 3CWBJ 1Q2NA 1BE3J 2E75D 2A06D 4H3UA 2Q1KA 3D71A 3RL0D 2QJKB 2PGDA 1VQ43 5C39A 3IPTA 2Z5IA 1YJW3 3GZXB 1IC2A 4RNYA 5AW1B 4WY4C 4GKGA 1UW1A 3QRDA 3ZG0A 3ER7A 1SFCB 1JY3O 3MGNA 1FZFA 2H0IA 3VF1A 5G1KA 4UB8H 1L0NE 3NHXA 3EFFK 3E99A 5M19A 1JJ22 3FCSB 2L91A 4DJGA 1FZUA 1CI6A 1V57A 2IX7C 5DJUB 1BSEA 3ALAA 3EQ2A 4WY4D 1S1CX 2OTL3 3R2PA 1IK7A 2K9YA 3EB8A 5AVZB 4WYKB 4EI2A 4LGQA 2Y9ZA 7STDA 4PJ0E 3K0ZA 1BRKA 3AE8C 3VP8A 1VZZA 2G3AA 3B8EB 5KAFH 1GYBA 1L0LE 4H13B 1EG9B 1RGLA 4I5QA 2YFIB 3CD6P 4JQ0D 2ZXXA 1QAFA 1LTJC 1IJDB 4LSOA 7GSPA 1N73B 3NBBA 1G1JA 3E7KA 5AVWB 3CNMA 3M0DC 5CCHC 3RK2C 3GAXA 1L0LK 3GMAA 4IT7A 1NTMJ 5KTBA 1VQNP 1BU4A 4X2HA 1Q42A 1BE3G 3L37A 1A02F 2XV5A 5H2FH 1U7JA 1B3SA 1EEJA 3B4PA 1R4CA 1LTIC 3L75J 1KYOD 1RDSA 1LNQA 1TFKA 4CJNA 1SQVD 5CF2A 3S9OA 1NH4A 3G4S3 4FCZA 6RNTA 1T5YA 3CCJ3 5AEWB 4WB4A 5CCHD 3RK2D 1GY6A 1BNEA 2BMQB 1YQ4C 2MJZA 3H6PA 5BVBA 5IG5A 4WYKA 5LC6A 1BRHA 2JDIH 3H1LE 3H1IE 3LOYA 2YIUC 4W7ZA 3CNXA 5DREA 1EQ7A 3H1JE 3X3YA 2O1JA 1EDIA 1BUJA 3L74J 3HD7B 2CW9A 1MWRA 1RE4C 1KD14 1KB9H 1QMAA 5B66E 2XDJA 3MD0A 1UCKA 3F7SA 1FYSA 1Q86Q 1IU7A 3VTPC 1BCCD 3AE4C 1RF0A 3AHWA 1GSPA 3PCRA 3F40A 1N73A 1KILB 3DZLA 1QVFO 1KMIZ 2OTKE 4OH8B 1A67A 1GL2B 2QJPC 1CYUA 3FF2A 2M3BA 3UL5A 1HUCA 1KILE 1SP4A 1NVOA 4JPZB 3V98A 2FYUD 1KFMA 4IIAA 2JP3A 1IQXA 3F14A 5KP3A 2WMMA 5RNTA 2RMZA 3CC23 3SSUA 2KXPB 2A45I 3S1KA 1IFDA 3JUOA 3X3ZA 3H1KE 4NPBA 1N7SB 1SQQG 2B1XB 3HD7A 2IBZD 4RESB 5IEPA 2L5GB 2B9BA 3KPEA 2KUBA 2KS1B 2N1TB 5IG4A 3V2NA 3SOAA 3L74G 4QWTA 1R5SA 1KILA 5GTHH 3OWSA 1YTZI 3IMAB 1S723 3L72E 1OVRA 2H43A 2HYNA 1FGQA 1SQBE 1NU1E 1Q824 4KT3B 3L35A 1JKGB 2QIWA 2GU3A 5D83A 3WOEB 2K3RA 4J5GA 1ROAA 4N3YB 1Q7YQ 1RH5B 1GS3A 1SQWA 3G16A 1Q81Q 4LZIA 3N8BA 2K0MA 1X1YA 1BCCJ 3OXAA 2I8DA 1URQC 1YJ9P 1SIIA 1RF0C 2E43A 3LYGA 2OYIB 3EC9A 1VDFA 1MKMA 3NQZA 1VQ6P 2R5DA 1YI23 1I3IA 3RL0g 3IN6A 2KB7P 3PLNA 2R3SA 3SEDA 1EZVE 2CC3A 3B4SA 3BNBA 2W9PA 3TGUE 2FYUJ 4DKIA 2SPZA 1URQD 1ZX2A 1W01A 1HGZA 3GF3A 2YXRB 1KYOH 2N1TA 2KNCA 1N86A 3HUSB 2XKMA 1K734 1HJ0A 1O7PB 4FMBA 1BUQA 1DEBA 4D6TJ 1NHLA 4Y99C 1RHLA 1RGFA 4XBYA 1OZHA 1JKGA 1RCLA 2KYVA 3AGNA 3GZRA 1X1XA 2OYHB 3CXC2 1ULJB 2H8PD 3I5CA 2FBWC 1CYVA 4WP5A 3D3LA 3A0BE 1FW7A 3X42A 4H0LC 2XR8B 3WU2E 1BRSA 5AYSC 4OGQC 2Z6BA 1GK6A 3CCVP 3PHLA 5TJHA 2OYIA 3K9MC 3ZG5A 2XSOB 1RMSA 3FXDA 1EQKA 3CME3 2Y0EA 4GHOA 4AKYA 4H0LD 4KFFA 4HOHA 1Q9EA 1C54A 1YGWA 3SX1A 5AYRB 3LXUX 1STDA 3G3ZA 3F7XA 4PV1C 1PPJG 4OGQD 3RBZA 1ZS7A 4J5KA 2E42A 3MP7B 3VYIA 2FYNC 2Q07A 3JUPA 1IK3A 2BEZF 4KT0J 3Q5SA 3BASA 2C10A 1KV4A 2E5TA 3HUSA 3CCUP 1U57A 4N3VA 2UGIA 1NB3I 1FJPA 3FGYA 5AVRB 1BSDA 4PV1D 4Q53A 4L76A 2YXQB 2RSXA 3L71E 4LLHA 2QSIA 3HRNA 1QALA 2GEYA 2J5UA 4H44C 5AEUB 1X0TA 4HH2A 4XBXA 2A45G 4D6TG 2I1KA 1QL2A 4I7ZB 3ROBA 4GT1A 3BRVB 1W2BO 3M06A 1O7NB 3CX5D 2N9YB 1OHOA 4BIRA 1NTKD 1BGYE 1UDII 8RNTA 3GLMA 4HVNA 2O01N 2BIRA 2XNXA 1KFNA 4H44D 5ELJA 2E2TA 1AJYA 3CCMP 3MIWA 3B71A 4BTXA 4I6MC 3X41A 3EF8A 5IG3A 4IL6X 2E75B 1BRNL 3Q2PA 3M91A 1S5LX 1IFPA 1RN7A 3MZWB 3R4YA 5HGRA 3EWKA 1TJDA 3NXJA 3LTDA 2V7QJ 3G0KA 2JR8A 1NTZE 1VQKP 4L8OA 3L70J 3KIIA 1HF9A 2IFMA 2A06E 3AEBC 3AE1C 1K9MQ 1W02A 1ZO2A 1M904 1LXEA 2F98A 1PL5A 5KKZC 1L0LG 1SQQK 2KSEA 1OHPA 1Q82Q 1YHQP 3UB1A 5CBNA 1S4XA 1P84D 2IZ1A 2B88A 3SFDC 2RBIA 2IYPA 1NO3A 1B2SA 3A7OA 1OW7A 3K7CA 1LTSC 1GOYA 2V4HA 2P10A 2ZFCA 5APUA 1I8VA 3ZFZA 1EZVI 1LP1B 1H8AA 2GM4A 1EKMA 1HWTC 1OMIA 1YYCA 1SQPE 1GMJA 1VQ5P 3B5NB 1USEA 3KXDA 1SQXE 5AW6B 3BATA 1PP9J 1JMBA 1QVGO 3FXEA 1RTUA 1M1K4 5IERA 1M1JB 2B24B 2MF7A 4XDVA 3CC7P 1T6AA 4ASWA 1BE3D 1I3FA 1MWTA 3FH1A 4DOJA 1SQPK 3PXMA 3H1IG 1NTKJ 5KLVE 1K73Q 1VQPP 2RKLA 4ZNCA 2WITA 4K1VA 3NFQA 4WWIA 2L4VA 4FCJA 1M1XB 5AW2B 4O02B 1DD4A 3CXHD 2C9LY 3WUVA 1YVSA 4GL6A 3BCCE 5AW8B 1X8YA 2V7QH 3MPHA 1FU1A 3M9QA 1I2FA 3S67A 2HFED 3FGAD 2BMRB 3L70G 2D1WA 1PFPA 1MV8A 3IJEB 2NPSD 3M9HA 3AE5C 5M1BA 4AEQA 1SQVE 2WPSA 2FFDA 1VQLP 5TISE 3FF0A 3IR9A 1LP1A 1T3UA 2ZT9B 1FGTA 2WT7B 1W5CE 3VMYA 3SLUA 3B5NA 1FZBA 1GW3A 3KSPA 3RBXA 1OFCX 1A90A 1FAVA 2CFKA 2ZYGA 2ZAEB 1MGRA 2KF3A 1ZLLA 5KJ7A 3HE5B 1Y8AA 3E1RA 4MN4C 2KXGA 4YXDC 4I7ZC 1T2KC 1NJI4 4U3FE 1BDDA 2R41A 3X40A 1PP9G 2SBLA 4PD4D 5B5EH 1LVNA 1JN5A 1FZCB 1JUNA 1DE3A 3DY5A 3H1KG 2GXFA 5M1AA 3CX5H 1JBRA 2K37A 1A2KA 1W5ZA 3OV4A 1PGQA 2E74B 1SARA 3T8NA 1FDOA 1T2KD 1PGPA 2CFGA 3MG2A 1B2UA 3F9SA 4OVNF 1FOSE 3LZAA 1SQQD 2D2CC 1LRAA 1MUUA 3TNUB 2A15A 3RK3B 5CF1A 2AEMA 1NNVA 4JF8A 1IVUA 1KORA 1SQBG 4IFMA 1VQ9P 1LWUC 3D9RA 3Q3DA 1FDMA 1NB5I 3AEEC 3AGOA 4N78E 2H88C 2R4IA 3BNDA 3L74D 2IUJA 2Z7AA 1YITP 3KFQC 3RK3E 5APXA 1UGHI 3D5GA 1RKYA 2P0XA 1S3JA 3H32A 3HE5A 4WBAA 4FMCA 1RQUA 1YBKA 3A0HE 1FGOA 4HM2B 2LQVA 3GHGC 1P84H 1OHSA 2LYXA 1LOVA 2E5YA 3JUQA 1M57D 1EXIA 2FFDC 2K9JB 1RJOA 1HYFA 1FZEA 1L0NK 1J2JB 1PYLA 3D4AA 3AE3C 1M90Q 4KFDA 2QEXP 4R4KA 1EZVG 1RF1B 1EXJA 6STDA 1CSBA 1L4AA 5APSA 3PH0A 3G6EP 1RRHA 1K8A4 3J7Yd 2KLUA 4BWNA 4IL6H 5KJ7C 1ASKA 2BO9B 2I9WA 1L5GB 2YKOA 2Q3IA 2ZL8A 1OACA 1VQ4P 1E79H 1LTTC 1XTGB 3TNUA 1YJWP 3URPA 3DUKA 2QG4A 3JCUE 3WMM0 1T3BA 4EV2A 1SFCA 3F5HA 1WRGA 3T97B 1N2DC 1O7HB 2AEJA 5IENA 1Q40B 2PRRA 5KJ7D 1DH3A 3EQQB 2D42A 1WMKA 1IV9A 1DMQA 5IW9A 4N6LA 3SFEC 1IO4A 1RN4A 3V5BA 1JRQA 2Y0DA 3CXHH 3GF7A 3DGOA 2H7HA 2OTLP 1RGGA 1E97A 1SQQJ 2GEXA 3STDA 3WUUA 4HM3B 3VOPA 3KYQA 2O3OA 2OCTA 3K5BA 2QJYB 5AVSB 2Z5HA 4QMAA 4O9BA 3S27A 1YNVX 1VQM3 3CCE3 3MWZA 1RCKA
chains in the Genus database with same CATH topology
1UUWB 1WTHA 2FGTA 4XDWA 3KZTA 1ZX2A 1N8QA 2HMLB 1W01A 1QJGA 2OOVA 3NM7A 8CHOA 1NWWA 4X2OA 3RGRA 3NV0A 4N6V0 3T0UA 2QE7H 4K90B 3V99A 3CCS3 3CCQ3 3NUVA 1VQP3 1K734 1BSHA 1O7PB 4FMBA 1BUQA 1G96A 3PZWA 3LTBA 2OQEC 4XBYA 3FSDA 3PGBA 3WA2X 5EQLA 3CC73 3JUNA 1JKGA 5AI1A 1N8R4 3GZRA 3HIIA 3CXC2 1ULJB 2CKFB 1OF5A 3BNCA 2WSSH 1CYVA 4WP5A 3D3LA 3CD63 2CWVA 1TIJA 3EBYA 3X42A 1YGEA 1PU4A 2XGNA 1OUNA 2GBWB 2CIUA 1E3RA 1OGXA 2XR8B 3F8XA 4TLFA 4OK0A 3WMDA 3OW22 5AYSC 4KFEA 2Z6BA 1NU3A 3EN8A 3HK4A 3HIGA 3Q1CA 1VQL3 3WA3A 4LMIA 2XF3A 2HMJB 2XFSA 1QAKA 3NM2A 2RCDA 4RNZA 3OX9A 1VQN3 4R9LA 1TFOA 3CCR3 3K9MC 2Z77A 2XSOB 1WMNA 4AKZA 1W6GA 3CME3 3CCL3 1EQKA 3CPW2 3S5CA 4AKYA 4KFFA 2CH9A 2W0QA 3DM8A 3FG3A 1N9JA 5AYRB 3SX1A 3LXUX 4OVMA 1Q7Y4 1STDA 1VQ83 3PCSA 3H3HA 5CXOA 3F7XA 3S28A 2WGOA 1Q814 3S29A 4YXWH 1DYUA 2CFLA 1O7MB 4ZM8A 1S5AA 3OWYA 2Q07A 3JUPA 1IK3A 3UJMA 1GD4A 3LTCA 2C10A 4EYCA 2E5TA 3UL6A 4IPBA 1JB5A 2JQ5A 1D6YA 1JN5B 3FKAA 3MG1A 1IT7A 3U1WA 1JB2A 4N3VA 5A0OB 2M7OA 2P38A 4K1UA 2Y73A 2CK3H 1NB3I 3FGYA 2BT3A 1JNQA 4Q53A 1ISKA 4JRFA 2PNCA 3BB9A 1KC84 2RSXA 3GRDA 5FW5A 2W04A 1IT8A 1AVKA 3GZBA 3JVCA 1QALA 3V92A 5KP4A 2GEYA 1ROVA 1D6ZA 3DXOA 2E2UA 5AEUB 4XBXA 4XM4A 1KQS2 3HI7A 1YJN3 4HBRA 5KP1A 3ROBA 2V1LA 2CG0A 3CU3A 4N6TA 3NX0A 3UNLA 1GY7A 2GBXB 1DMMA 5G2GA 4GB5A 1O7NB 2OOVC 4WWUC 1DVDA 1FS0E 3U97A 1VQ93 1AVLA 1JB4A 1OHOA 2QGUA 4FCMA 3OWUA 1HU9A 3NBJA 2RFRA 4HVNA 2P05A 2RGQA 2YX9A 2XGLA 5ELJA 1YIJ3 5TGNA 2E2TA 1JV2B 3B8LA 1YIT3 5AIHA 3KE7A 4BTXA 1CQSA 1IV7A 4NREA 1SIHA 3X41A 1WMPA 4R9KA 3ECFA 3EF8A 1Z1SA 1M9GA 5IG3A 2P09A 3N54B 3B7CA 4EV5A 1E3VA 4O3VA 3LH4A 3DGLA 3Q2PA 4I4KA 1IFPA 1RN7A 2W56B 5AIIA 3EX9A 1KSIA 4XB5A 5HGRA 3NXJA 5JPPA 1TUHA 3LT8A 3LTDA 3I553 1K28A 3EBTA 3G0KA 4L8OA 1N5PA 2F86B 2XRXB 3KIIA 4WHAA 4U13A 1ZO2A 3KSED 3MYTA 1M904 1W02A 3CPOA 2QEX3 1LXEA 2F98A 1OHPA 3M8CA 4EC6A 1NDOB 3EN1B 2CFWA 3UB1A 5LC7A 3G6E3 1QVF2 1LNHA 3L0RA 2CWTA 1W00A 4HZBB 4O8SA 1NO3A 3MKIA 1Q40A 4RZMA 1EA2A 3N9HA 4H61A 2XSHB 5AIFA 1OGZA 2ZDJA 3K7CA 4H3UA 4HM0B 1OH0A 3BNEA 1VQ43 3EE1A 5DRVA 2HMKB 3IPTA 1YJW3 3GZXB 4RNYA 4N6NB 1UW1A 2W03A 3QRDA 3ER7A 1EKMA 3SXXA 5CLKA 2GU1A 3VF1A 3TDGA 1N9EA 3NHXA 3EFFK 2HMOB 3E99A 2IMJA 1JJ22 3FCSB 3NQYA 1U8CB 1KWIA 1UUVB 5JPUA 4DJGA 2W9QA 1M1K4 2XH9A 4O2HA 2CWUA 5IERA 2MF7A 2B24B 4XDVA 5I97A 2Z76A 3ALAA 1IQ8A 1YJ93 3FH1A 5D81A 2W56A 3NBRA 3BLZA 2OTL3 3GWRA 3EB8A 3K5TA 4HM5B 2OQEA 4WYKB 1Y4KA 4LGQA 4MEIA 2W6JH 3PXMA 7STDA 1VQ63 2HMNB 2OWPA 3K0ZA 4HKVB 4K1VA 2L4VA 4FCJA 4CDLA 1M1XB 1VZZA 2XEPA 3AMOB 3A76A 4O02B 1A2VA 2CFDA 2IA7A 1GYBA 4GL6A 3CC43 2V7QH 1W6CA 3MPHA 5CK6A 1EG9B 4RBNA 1W7CA 1US1A 2INXA 1AQTA 3S67A 4LEHA 2BMRB 5FGOA 2YFIB 4N6UA 2D1WA 1PFPA 2WO0A 3G713 1QAFA 3IJEB 4LSOA 3B4OA 5BXQA 4AEQA 2ML5A 3SVAA 1K9M4 3NBBA 3O8YA 1SJWA 3LMLA 1WQLB 3WOFB 3SOYA 3FF0A 4HM1B 3CNMA 1W2B2 3GAXA 1IQYA 1IVVA 1W4NA 4IT7A 4X2HA 3LTAA 1FGTA 1J2BA 1Q42A 2MC8A 3SLUA 3B4PA 1OF5B 1R4CA 3KSPA 3PJSK 2WOHA 3DGMA 3FLJA 1A90A 5IEOA 1TFKA 2CFKA 4HYZA 5CF2A 3G4S3 4FCZA 1F8NA 1T5YA 1TP6A 4G1MB 1W6YA 3RDEA 3CCJ3 5AEWB 3CCV3 2KXGA 1NJI4 3DGNA 1GY6A 4HM8B 1SPUA 2BMQB 4HM7B 3X40A 4CCVA 4FR9A 2SBLA 5BVBA 2KCDA 5IG5A 4WYKA 1MNLA 4FMAA 5IG0A 5LC6A 3K63A 1LVNA 4HM6B 1JN5A 2JDIH 3QK9A 1IVWA 3DY5A 3CNXA 2FXTA 2YFLB 3LOYA 3AMOA 2P0MA 4L7KA 2KRTA 1DMNA 2GXFA 3JUMA 5EEOA 1TU5A 2Y74A 5DREA 3X3YA 3VSYA 2C11A 1A2KA 3LT9A 4MJDA 1W5ZA 2CW9A 4L8PA 3OV4A 3T8NA 1KD14 1IDPA 1QMAA 2CFGA 3F7SA 3MG2A 1IU7A 1RRLA 3F9SA 3CCU3 2UX0A 1N5HA 2ML6A 3KKGA 3LZAA 3PCRA 3F40A 4EXRA 3HZPA 4R1KA 3MWZA 3DZLA 5EVHA 2A15A 2K54A 4EBGA 5CF1A 1AV4A 3FG1A 1FA3A 5ELUA 4J9AA 4JF8A 1IVUA 2QA43 1A67A 3D9RA 4HM4B 3USSA 1STFI 4J8TA 2WOFA 4K61A 1NB5I 4HJLB 1CYUA 3FF2A 2R4IA 4R80A 4PEJA 3UL5A 3BNDA 3X3XA 1GD3A 2IUJA 2Z7AA 3KFQC 3V98A 5AIGA 1V74A 1K41A 1RKYA 4IIAA 2STDA 2P0XA 4TX4A 1QVG2 1AR0A 1IQXA 4NHFA 4FMCA 3F14A 4WVZA 1BSNA 1FGOA 4HM2B 3I0YA 3HX8A 5KP3A 2LQVA 4OUQA 1OHSA 1CEWI 2LYXA 3CC23 2E5YA 3JUQA 2BMOB 4FMDA 4KVHA 3KN4A 1RJOA 2HMMB 3WODG 2OTJ3 1W2ZA 2YFJB 3CCM3 4MMXB 3FZWA 3JUOA 3X3ZA 1WMOA 4KFDA 4R4KA 6STDA 1VQO3 2B1XB 3EHCA 2CG1A 5IF6A 3GZYB 4XBTA 1RRHA 2IUKA 1LOXA 5IEPA 1WNHA 1UI8A 1IVXA 4N6OB 1K8A4 1DVCA 3DMCA 3PYJA 3J7Yd 3RGAA 5IG4A 3NV0B 1ASKA 2BO9B 2I9WA 2BNGA 2XFTA 1OPYA 4MMZB 1L5GB 2W2CA 3SOAA 3VGNA 4N6MA 4QWTA 3WDGB 1VQK3 4BTWA 3CMA3 2ZL8A 1OACA 1E79H 3OWSA 3IMAB 3I563 1S723 3DUKA 3F8HA 1FUWA 1FGQA 5STDA 1YHQ3 5JBSA 1Q824 1VQ73 1JKGB 2GU3A 5D83A 2F99A 3WOEB 4EV2A 4HZ9B 1O7HB 5IENA 3MHEA 2O9UX 1FGMA 1Q40B 5D82A 2QIYA 1Q864 1OCVA 1ROAA 3EQQB 2D42A 1IV9A 1DMQA 4BTYA 1GY5A 4N6LA 5IW9A 1MOLA 1FGRA 1JRQA 1GS3A 1SQWA 1YVBI 2WGQA 3G16A 1O7WB 1UI7A 4LZIA 3N8BA 2K0MA 2PZVA 3PS8A 3G8ZA 3OXAA 3DGOA 1SIIA 4STDA 1E97A 2GEXA 3H51A 3FG4A 3LYGA 3STDA 1VQ53 4HM3B 1O7GB 2E2VA 3EC9A 3MG3A 2O3OA 2OCTA 4ORLA 2XNDH 1U5OA 1ULIB 3NQZA 4WFOA 3T8UA 1YI23 1D6UA 2CHCA 3MSOA 3Q90A 4QMAA 1C7HA 4MMYB 3S27A 1VQM3 1HKXA 2FNQA 4KZ1A 3CCE3 2BHMA 3SEDA 2CC3A 3EJVA 1JEKA 3BNBA 2W9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSS H;  1E79 H;  2CK3 H;  1FS0 E;  3EFF K;  1IFP A;  4DJG A;  4TLF A;  2QE7 H;  2V7Q H;  4YXW H;  2XND H;  1BSH A;  2JDI H;  1AQT A;  4WVZ A;  1BSN A;  3PJS K;  4QMA A;  2E5Y A;  2E5T A;  3USS A;  1JEK A;  2W6J H; 
#chains in the Genus database with same CATH topology
 4XDW A;  3HOH A;  1RHZ B;  3D6Z A;  3VMA A;  1N8Q A;  3KQG A;  1UCI A;  3NM7 A;  1L2P A;  5AVX B;  1NWW A;  4B86 A;  3RGR A;  1ZR2 A;  4GIF A;  1UCL A;  3CCS 3;  5KAI E;  1RGK A;  3CCQ 3;  3L36 A;  1JZD A;  3L73 E;  4DZO A;  1PPJ D;  2YKP A;  1BNJ A;  3DGY A;  1H88 A;  1GU4 A;  2PP6 A;  1R8E A;  1FDI A;  2G8Y A;  3C8V A;  1R5L A;  2DW3 A;  5AI1 A;  1N8R 4;  3H25 A;  2SAR A;  3O6Q B;  2WSE J;  5GTI H;  3V4W A;  4PD4 H;  3BNC A;  2WSS H;  4IOI H;  5AW7 B;  1TIJ A;  3EBY A;  1MZ9 A;  4EIJ A;  3D79 A;  1L4A C;  4ZMD A;  1SQP J;  1E3R A;  3OW2 2;  4TLF A;  4KFE A;  3G4S P;  3KZI H;  3CCJ P;  3BRT B;  4LMI A;  1BGS A;  1JCC A;  2XFS A;  1QAK A;  1BGY G;  1OVV A;  1TFO A;  1IYY A;  2QJK C;  3CCR 3;  1LNI A;  2Z77 A;  4D6T D;  3CCL 3;  3CPW 2;  3ITK A;  1X79 B;  3S5C A;  1RE3 A;  1VL2 A;  3CI9 A;  2CH9 A;  3FG3 A;  1KQF B;  1N9J A;  2K88 A;  1I70 A;  4OVM A;  1VQ8 3;  2BEQ D;  2P58 A;  1Y9B A;  1SFC C;  2M3E A;  1B21 A;  1T8Z A;  3S29 A;  3VMX A;  3V2P A;  2BCC E;  4ZM8 A;  1S5A A;  2NZ2 A;  1EC5 A;  3KHU A;  1GD4 A;  1FJK A;  1T3J A;  1AVY A;  2W8Z A;  1L0N D;  4IPB A;  5APV A;  2JQ5 A;  3V6I A;  1D6Y A;  2HLO A;  3FKA A;  3MG1 A;  1VPC A;  4DT0 A;  1JB2 A;  2OGU A;  2P38 A;  2Y73 A;  2FKW B;  1ISK A;  1JY3 N;  1SFC D;  1EDJ A;  1KC8 4;  3GRD A;  1GL2 A;  5FW5 A;  3HTK B;  1QLE D;  4LYL B;  1JBT A;  1AVK A;  1R4Y A;  3GZB A;  4N6J A;  1LT9 B;  3DXO A;  1VF5 B;  3AE9 C;  2E2U A;  1KQS 2;  1UIX A;  3TYY A;  1LTG C;  4H13 C;  1YJN 3;  4HBR A;  4JBZ A;  2V1L A;  3UNL A;  1JTH B;  2GBX B;  2WSE H;  3A3Y B;  2F5W A;  2WQY C;  1YTZ T;  1L0L D;  2HOH A;  3U97 A;  2KF4 A;  2QGU A;  2CPB A;  1GMP A;  4FCM A;  2WPR A;  5CCG A;  1SQB K;  3CC2 P;  1NU1 K;  2LR2 A;  2RGQ A;  1SQP G;  2XGL A;  4K3A A;  1N73 C;  2L1S A;  1YIJ 3;  1SQX G;  2OQQ A;  3B8L A;  4U3F J;  2ZA4 A;  4H13 D;  2C0W A;  4UB8 E;  5CJ0 A;  2E76 B;  3AEA C;  1N7S A;  3D6Y A;  1IV7 A;  3O8Z A;  3WUT A;  1WMP A;  2O01 J;  2ITA A;  2P09 A;  4GOD A;  3DGL A;  1Q7H A;  2W56 B;  1P84 E;  4XB5 A;  5AVT B;  2KS1 A;  2R44 A;  1U7M A;  1RNT A;  5JPP A;  1LOW A;  1T2I A;  3I55 3;  1TU3 F;  2F86 B;  2K1A A;  2XRX B;  3UIA A;  3MYT A;  3A5T A;  1EUI C;  1S72 P;  1RLS A;  5KAF E;  3HTK A;  2CFW A;  5LC7 A;  1RE3 C;  1LNH A;  2KAA A;  3L0R A;  2CWT A;  1W00 A;  4JYC A;  1KQL A;  3MKI A;  1BSA A;  2GA1 A;  3H1I D;  4RZM A;  3HD7 C;  3N9H A;  4H61 A;  5E79 H;  1OGZ A;  2ZDJ A;  3ZDM A;  3KCH A;  3PRJ A;  3EE1 A;  5BVZ A;  5DRV A;  1L0N J;  3H1H E;  1B27 A;  4N6N B;  1PIX A;  2W03 A;  2R32 A;  1FBM A;  1ZRT D;  3CWB E;  3L70 D;  4KJM A;  1BE3 E;  5CLK A;  3SXX A;  1KIL C;  1GMR A;  5AW9 B;  5H2F E;  2C9N Y;  1N9E A;  1YI2 P;  3HD7 D;  4OWF A;  1EDK A;  1OVU A;  2HMO B;  1GL2 C;  1GOV A;  1KWI A;  1J1E B;  5AW4 B;  5JPU A;  4RJT A;  3RGU A;  1LQG C;  2NPS B;  3AE2 C;  3CXH E;  3EFG A;  1KD1 Q;  4U3F G;  2W56 A;  3BLZ A;  3GWR A;  3K5T A;  4HM5 B;  1L0L J;  1ZR4 A;  1KIL D;  2OQE A;  1BNI A;  4I1L A;  1Y4K A;  2M5A B;  1RY3 A;  2O01 H;  2Q3E A;  4YPC A;  2OWP A;  2W83 C;  1RSN A;  4CDL A;  2XEP A;  3AMO B;  2YNY A;  3A76 A;  2H89 C;  2NRG A;  1WT6 A;  1A2V A;  2J8X B;  1ZN5 A;  1KTM A;  1HBW A;  1YQ3 C;  5APW A;  3CC4 3;  5KLI B;  1IFJ A;  1GK4 A;  1US1 A;  1PP9 D;  1ZV8 A;  2OYH A;  2ZXE B;  2WSC J;  2A45 H;  5FGO A;  4N6U A;  1N7S C;  1KB9 E;  2WO0 A;  3G71 3;  2W90 A;  3H1K D;  3B4O A;  5BXQ A;  1BRJ A;  3SVA A;  1SVF A;  3C1L A;  1WQL B;  2N1T C;  4HM1 B;  1IVV A;  1W4N A;  3LTA A;  1FC2 C;  4HJG H;  4JF7 A;  1KQS O;  2AXC A;  1OF5 B;  1QL1 A;  4BRY B;  1N7S D;  5GTI E;  3PJS K;  3CME P;  1LJ2 A;  1L0N G;  5IEO A;  4M3L A;  3CLQ A;  1JY2 O;  1NTM E;  1F8N A;  3L72 D;  3P8C E;  4G1M B;  2OYO A;  1W6Y A;  3H1L J;  3H1I J;  1SQB D;  2JO1 A;  3AEC C;  3L75 E;  2N1T D;  1DX7 A;  3RL0 B;  4HM8 B;  3W67 A;  3H1J J;  1BNR A;  3LW5 J;  3N7N A;  4CCV A;  4FR9 A;  3IF4 A;  1RGE A;  1K04 A;  5IG0 A;  2YKQ A;  4PJ0 H;  4AYC A;  4ZKU A;  2OAR A;  1W2E A;  2Q9I A;  1IVW A;  2YFL B;  4L7K A;  3AMO A;  2P0M A;  5EEO A;  1DMN A;  1JMM A;  1TU5 A;  2HOD B;  2OYI C;  2ZVO B;  1DET A;  2W6A A;  4HAA A;  2Y74 A;  5L8R J;  1KC8 Q;  3LT9 A;  3Q5P A;  4MJD A;  3QH9 A;  2CX1 A;  3TDK A;  1MGW A;  1I2G A;  1RRL A;  4WY4 B;  2UX0 A;  1SS1 A;  3L74 E;  1EZV D;  2WSC H;  1NTZ K;  3Q5R A;  2K54 A;  4C46 A;  5GTH E;  4EBG A;  1AV4 A;  3TGU D;  3FG1 A;  3HUS C;  2QA4 3;  4HM4 B;  3USS A;  2HPC B;  2WOF A;  4HJL B;  1Z56 A;  2YMY A;  4BRY A;  4R80 A;  4PEJ A;  1HH0 A;  1Y47 A;  1V74 A;  1HGV A;  1G1I A;  1B2M A;  2OYH C;  2PFX A;  2AAD A;  5K5G B;  2XU6 A;  4NHF A;  2WPQ A;  4WVZ A;  1BSN A;  3I0Y A;  3HX8 A;  1MWU A;  3H1K J;  4OUQ A;  1CEW I;  3N4X A;  2KK7 A;  1M7L A;  1LTB C;  3WOD G;  2OTJ 3;  3GSP A;  1SQX K;  3H1L G;  4MMX B;  1LOY A;  2KF5 A;  4RO0 A;  3LW5 H;  4R4M A;  2HOD A;  1WMO A;  3H1J G;  1VQO 3;  2CG1 A;  5IF6 A;  5M18 A;  2IDB A;  1LTJ B;  1ZW0 A;  1RGA A;  5B66 H;  5APQ A;  1WNH A;  1H89 A;  1UI8 A;  1IVX A;  4N6O B;  3L72 J;  3FWN A;  1DVC A;  3PYJ A;  4EOT A;  2IYO A;  1SQB J;  1DD3 A;  1NU1 J;  1QGK B;  1KYO E;  4WY4 A;  3RK2 B;  1OPY A;  3WDG B;  2B87 B;  3VGN A;  3CMA 3;  5AW0 B;  5KLV K;  2FYZ A;  3V2R A;  1NAF A;  5STD A;  5JBS A;  1VQ7 3;  1S2E A;  2F99 A;  4TT3 H;  4KHX A;  1M56 D;  2KSJ A;  1S9K D;  1IFM A;  3II6 A;  1GZL A;  6GSP A;  3MHE A;  2O9U X;  5D82 A;  2QIY A;  1Q86 4;  1OCV A;  4BTY A;  1MOL A;  5E79 E;  1FOS F;  1YVB I;  2WGQ A;  1O7W B;  1M1J A;  1SQV K;  2YMK A;  2KZI A;  1KN7 A;  2PZV A;  3PS8 A;  2B89 A;  1BSC A;  2J58 A;  3PTZ A;  2YIU B;  3H51 A;  4ORL A;  2CX0 A;  3TGU J;  2XND H;  1U5O A;  4WFO A;  1KB9 I;  3Q90 A;  1C7H A;  4MMY B;  1BCC E;  4KZ1 A;  5EFW B;  1PFI A;  3TSI A;  4RKU J;  1RNB A;  3EJV A;  4GSP A;  2BCC G;  1BGY D;  3IFM A;  1BNS A;  2ZVN B;  4JYB A;  1QJG A;  2Y0C A;  3T0U A;  1D7M A;  5CCH A;  2QE7 H;  4K90 B;  2E75 C;  2B87 A;  1BNG A;  3NUV A;  2QJP B;  1BSH A;  1G96 A;  3PZW A;  2FYU E;  3DH2 A;  3W68 A;  3LID A;  3L72 G;  3FSD A;  5EQL A;  1NU1 G;  2WT7 A;  1JY2 N;  2CKF B;  4CPG A;  2WPV B;  3CD6 3;  3U1A A;  3RNT A;  4D6T E;  1QX8 A;  1YGE A;  2XZR A;  1PU4 A;  1TRP A;  2GBW B;  5CHX A;  2D2C D;  1NU3 A;  3EN8 A;  2FYU K;  2AAE A;  3HIG A;  2N9B A;  2QVA A;  3WA3 A;  3BIR A;  4DCK A;  3NM2 A;  2HMJ B;  1JM0 A;  2RCD A;  3TK1 A;  1VQN 3;  2IBZ E;  1H0T B;  1IFN A;  1AQZ A;  5AVQ B;  1BAN A;  4AKZ A;  4BL3 A;  1FZC A;  1RE4 A;  5BU5 A;  3DM8 A;  1Q7Y 4;  5AVU B;  2FY8 A;  3PCS A;  2WGO A;  1Q81 4;  3B5N C;  4YXW H;  1DYU A;  2CFL A;  2K3D A;  3TGU G;  3OA7 A;  1SQP D;  2R5B A;  3AEF C;  3NXS A;  3UJM A;  4W7Y A;  3PP5 A;  1SQX D;  3L71 J;  4EYC A;  1M1J C;  1KQG B;  1IT7 A;  2FXP A;  3U1W A;  1GU5 A;  1S5L H;  2M7O A;  4K1U A;  1JNQ A;  3SWF A;  3B5N D;  1HJB A;  3GG2 A;  4HKZ H;  4IFD K;  2J59 M;  1JO5 A;  5G1L A;  3V92 A;  3JVC A;  3A0B H;  3AEG C;  1ROV A;  1D6Z A;  1XTC C;  1RGC A;  4XM4 A;  5KLV D;  1BGY J;  2HR3 A;  3WU2 H;  1OX3 A;  2W27 A;  1URQ B;  5KP1 A;  3M9B A;  3CU3 A;  4ASV A;  1GY7 A;  1M1K Q;  1DMM A;  5G2G A;  4GB5 A;  1OWA A;  2ZJS E;  3BCC D;  1DVD A;  1FS0 E;  2KI7 B;  3H1H G;  2ZYD A;  1PZQ A;  1AVL A;  4HYT B;  1FUT A;  3OWU A;  1ZGX A;  2RFR A;  3CWB G;  2P05 A;  2YO3 A;  1X1W A;  1H0T A;  2F56 A;  1NOH A;  2K9J A;  1JV2 B;  2F5M A;  1G0T A;  1KYO I;  3KE7 A;  2ZT9 C;  1EDL A;  3E1I A;  1RF1 A;  1SIH A;  2AEF A;  3ECF A;  1Z1S A;  1M9G A;  1X1U A;  2QM7 A;  1NTZ J;  1BRG A;  3B7C A;  1DEE G;  4O3V A;  1PY3 A;  2PAJ A;  3EX9 A;  1CH0 A;  3LIE A;  4Y99 B;  1MWS A;  4NPF X;  1TUH A;  3LT8 A;  1MFT A;  1A2P A;  1K28 A;  3P8M C;  2WZ7 A;  1NAY A;  2ZT9 D;  1BAO A;  2JJL A;  3FWL A;  3KSE D;  4U13 A;  2BAS A;  3CPO A;  1BDC A;  1OW8 A;  4H0L B;  3L71 G;  4EC6 A;  4U3F D;  1FZC C;  1NDO B;  3EN1 B;  1JBS A;  1SLQ A;  4OGQ B;  3T97 A;  1ZRT E;  3L70 E;  1E5W A;  1Q40 A;  4R4L A;  1EA2 A;  4GDO A;  1URQ A;  1ZOY C;  2XSH B;  5AIF A;  2P7J A;  2E74 C;  3OJA B;  4HM0 B;  1OH0 A;  3BNE A;  1SQX J;  2HMK B;  5AW5 B;  4BL2 A;  1NJI Q;  1JY3 P;  4LGD E;  4PV1 B;  1HVV A;  2Q5U A;  1USD A;  4AUW A;  2GU1 A;  1K05 A;  3RK3 C;  3TDG A;  2FYN B;  2IMJ A;  3NQY A;  1VQM P;  1L4A D;  2E74 D;  1U8C B;  3L4F A;  1UUV B;  3CCE P;  2BU4 A;  2W9Q A;  1NTM G;  2XH9 A;  4O2H A;  2CWU A;  3ABV C;  4AQR D;  5KLV J;  3L75 G;  5I97 A;  2Z76 A;  4LC1 A;  4L73 A;  1IQ8 A;  1YJ9 3;  5D81 A;  3NBR A;  4N78 D;  2Q6Q A;  1X9V A;  4A7P A;  1UCJ A;  1PP9 E;  3QWO C;  3BCC J;  3MUD A;  4MEI A;  3RK3 D;  2W6J H;  1VQ6 3;  3CCS P;  5DJT B;  5B5E E;  4L75 A;  3CCQ P;  2HMN B;  1G2C B;  1NTZ G;  4HKV B;  3IAO A;  2A06 G;  1X22 A;  4H44 B;  3G9R A;  2CFD A;  2IA7 A;  3CX5 E;  1AQ5 A;  1W6C A;  1SQV J;  5CK6 A;  4RBN A;  1W7C A;  2INX A;  1DIP A;  1AQT A;  3O6Q A;  1NTK E;  4LEH A;  1RF1 C;  2IBZ I;  4UB6 H;  2ZYA A;  3V2Q A;  2KNC B;  1B20 A;  2ML5 A;  2RN0 A;  2WVR A;  3NTN A;  1I0X A;  1K9M 4;  1I0V A;  1TRQ A;  3O8Y A;  1SJW A;  3LML A;  1LQM B;  3WOF B;  3SOY A;  2Q7C A;  1LGH B;  1W2B 2;  1IQY A;  3OAK A;  1IFI A;  3SWY A;  3BU4 A;  1J2B A;  2O3J A;  1OXZ A;  3CCR P;  2MC8 A;  1NTK K;  3AED C;  1UUG B;  5AW3 B;  2WOH A;  3CCL P;  3DGM A;  3FLJ A;  1N7L A;  4HYZ A;  2P67 A;  1VQ8 P;  1GD2 E;  1V58 A;  2AXT H;  4HB1 A;  1TP6 A;  3D70 A;  3RDE A;  1QEX A;  1RQV A;  3U1C A;  2GUS A;  3CCV 3;  2JKV A;  3DGN A;  1SPU A;  2QRX A;  1BSB A;  4HM7 B;  1K8A Q;  4C7R A;  2KP8 A;  2KCD A;  1MNL A;  4FMA A;  5KKZ B;  3K63 A;  1ZXG A;  4HM6 B;  1BVI A;  1AVO A;  5KLV G;  5HOH A;  3QK9 A;  1G2C A;  1OIP A;  2R3C A;  2JWA A;  2FXT A;  2KRT A;  3JUM A;  2P2U A;  3VSY A;  4ZKP A;  2C11 A;  3M0A A;  2QJY C;  4U7J A;  3BCC G;  5CJ4 A;  4L8P A;  7RNT A;  3SYU A;  1IDP A;  1LT9 A;  1LTA C;  2GUV A;  3H1L D;  3CCU 3;  1YJN P;  1N5H A;  3NMD A;  4IL6 E;  1JTH A;  2ML6 A;  3KKG A;  3H1J D;  1SQV G;  4EXR A;  3HZP A;  5TIS H;  1S5L E;  4R1K A;  2C0X A;  1TTO A;  5EVH A;  1ZME C;  1FA3 A;  3MUD C;  5ELU A;  4ILF A;  4J9A A;  1NWQ A;  1STF I;  4J8T A;  4K61 A;  1YIJ P;  3HE4 B;  2WSF J;  3OW2 O;  3X3X A;  3Q1M A;  1GD3 A;  2O1K A;  3L73 D;  5AIG A;  1K41 A;  2STD A;  4TX4 A;  1QVG 2;  1AR0 A;  1JOC A;  2Z4E A;  4GOE A;  1FE6 A;  1HTL C;  2KIK A;  2LXB A;  5CBO A;  3Q3F A;  1J1D B;  5CMZ A;  1FZA A;  2QM8 A;  2BMO B;  2KOG A;  3CPW O;  4FMD A;  4KVH A;  3KN4 A;  2HMM B;  3I55 P;  1LT1 A;  4BXL A;  1W2Z A;  2H0G A;  2YFJ B;  3CCM 3;  2IZ0 A;  4EDF A;  1BCC G;  1GL2 D;  9RNT A;  3FZW A;  5CCG C;  3SWK A;  3EHC A;  3S4R A;  3GZY B;  1OW6 A;  3TF5 A;  4XBT A;  1UII A;  2KZJ A;  1N8R Q;  2IUK A;  1LOX A;  2HG5 D;  2RNT A;  1GMQ A;  3C9I A;  3DMC A;  1GDT A;  1PGJ A;  1S9K E;  3RGA A;  3NV0 B;  2BNG A;  2XFT A;  4MMZ B;  4GOF A;  2W2C A;  4N6M A;  4XFJ A;  3AE7 C;  4BTW A;  1VQK 3;  1JCD A;  2FYU G;  3MTU E;  5CCG D;  2BCC D;  1AFO A;  4I2L C;  3I56 3;  5AVV B;  3F8H A;  1FUW A;  3V4Q A;  1YHQ 3;  2KF6 A;  2WTY A;  3VMZ A;  1ZP0 C;  3HE4 A;  4HZ9 B;  3A5E A;  4PD4 E;  1FGM A;  4XA4 A;  1PV3 A;  2WWW A;  1GY5 A;  1MFZ A;  1M8O B;  1FGR A;  1AY7 A;  3A0H H;  1UI7 A;  1JB0 J;  1LT9 C;  1VF5 C;  2NPS A;  2WSF H;  1NU1 D;  3G8Z A;  3KZI E;  3P32 A;  3CX5 I;  1CZQ A;  3A2A A;  4STD A;  2C4B A;  3FG4 A;  1NKN A;  2IBZ G;  1VQ5 3;  2MKV A;  1GOU A;  1O7G B;  2E2V A;  3MG3 A;  2M5A A;  1ULI B;  3T8U A;  1D6U A;  2CHC A;  3MSO A;  1Q90 D;  1B2X A;  2IPP A;  1HKX A;  2FNQ A;  3D5I A;  2BHM A;  4K35 A;  1SQQ E;  3JC2 2;  1NTM K;  1VF5 D;  1JEK A;  1HZ1 A;  3CC7 3;  1CW5 A;  3L73 J;  3CC4 P;  1UUW B;  1WTH A;  2FGT A;  3KZT A;  2UUG C;  2I1J A;  2E76 C;  2D2C B;  2JWD A;  2HML B;  2OOV A;  8CHO A;  2YO2 A;  4X2O A;  3G71 P;  3NV0 A;  4N6V 0;  1A02 J;  3MHV A;  3V99 A;  4Y28 J;  1LWU B;  1VQP 3;  2RH0 A;  2M0B A;  3I56 P;  3LTB A;  4RNT A;  3JCU H;  2F4Y A;  2OQE C;  3PGB A;  3WA2 X;  2VRS A;  3JUN A;  1I2E A;  3HII A;  3GW6 A;  1AV1 A;  2E76 D;  2JEE A;  1BRI A;  4W80 A;  1OF5 A;  1P84 I;  2CWV A;  1RGH A;  1OUN A;  4UB6 E;  2XGN A;  1BNF A;  3GHG B;  2CIU A;  1OGX A;  4OK0 A;  3F8X A;  3WMD A;  5GSP A;  2GSP A;  3KDP B;  3HK4 A;  3Q1C A;  2FFD B;  1VQL 3;  3BVH A;  4NPD A;  2XF3 A;  4CPK A;  4RNZ A;  3OX9 A;  4IFF A;  4R9L A;  3P7K A;  2BCC J;  3WHO A;  1WMN A;  1W6G A;  2W0Q A;  3AE6 C;  5CXO A;  3H3H A;  3S28 A;  3H1H D;  2W6B A;  2AXT E;  1PGO A;  1O7M B;  3OWY A;  2LKM A;  3CWB D;  3JSV C;  4YTP C;  1J1E C;  1NGM B;  2Y9Y A;  3VP9 A;  4C7N B;  3LTC A;  3UL6 A;  5KAI H;  2NPS C;  2H0H A;  1JB5 A;  1LWU A;  1JN5 B;  1J1D C;  4L74 A;  2KLV A;  3L73 G;  5A0O B;  1JZO A;  2CK3 H;  2BT3 A;  2IYJ A;  4JRF A;  2PNC A;  3BB9 A;  1BIR A;  5AVY B;  3F89 A;  3CXH I;  2QA4 P;  2HPC A;  2W04 A;  1NKZ B;  1IT8 A;  5KP4 A;  2POH A;  1BOX A;  3FX0 A;  2FXM A;  2CPS A;  4Z1M H;  3HI7 A;  3GHG A;  1KZU B;  2LXC B;  4NPE A;  1IK9 A;  5KLI C;  2CG0 A;  4N6T A;  2IY2 A;  3NX0 A;  3L71 D;  2OOV C;  4XE5 B;  4WWU C;  2ZHX B;  1JNM A;  1VQ9 3;  1JB4 A;  3WR2 A;  1HU9 A;  3NBJ A;  3CL3 D;  1KB9 D;  2YX9 A;  3AHS A;  1T2H A;  5TGN A;  1RN1 A;  1UGI A;  2UWJ E;  5BU4 A;  2OTJ P;  1JY2 P;  1YIT 3;  5APY A;  5AIH A;  1FUS A;  1CQS A;  4NRE A;  1NYH A;  1GW4 A;  1PPJ E;  1VQO P;  4BU4 A;  3H32 B;  4R9K A;  1LTJ A;  2IFN A;  1CI6 B;  3N54 B;  4EV5 A;  1E3V A;  3LH4 A;  5APT A;  4I4K A;  5AII A;  4C7N A;  1KSI A;  1VQQ A;  3M0D A;  4PD4 I;  2FXO A;  2M8R A;  3CMA P;  5BU8 B;  1B2Z A;  3EBT A;  3RL0 C;  1NTM D;  4EW5 A;  1N5P A;  4WHA A;  3P8C D;  2P1J A;  2QEX 3;  3L75 D;  3M8C A;  1FZG A;  1L4A B;  1QVF 2;  3G6E 3;  1VQ7 P;  5BIR A;  3U59 A;  1NTK G;  3VN0 A;  1IZN B;  4HZB B;  1GTW A;  3H1H J;  1AA0 A;  4O8S A;  3Q2Y A;  4EYY Q;  1NO4 A;  1G02 A;  1NTZ D;  3CWB J;  1Q2N A;  1BE3 J;  2E75 D;  2A06 D;  4H3U A;  2Q1K A;  3D71 A;  3RL0 D;  2QJK B;  2PGD A;  1VQ4 3;  5C39 A;  3IPT A;  2Z5I A;  1YJW 3;  3GZX B;  1IC2 A;  4RNY A;  5AW1 B;  4WY4 C;  4GKG A;  1UW1 A;  3QRD A;  3ZG0 A;  3ER7 A;  1SFC B;  1JY3 O;  3MGN A;  1FZF A;  2H0I A;  3VF1 A;  5G1K A;  4UB8 H;  1L0N E;  3NHX A;  3EFF K;  3E99 A;  5M19 A;  1JJ2 2;  3FCS B;  2L91 A;  4DJG A;  1FZU A;  1CI6 A;  1V57 A;  2IX7 C;  5DJU B;  1BSE A;  3ALA A;  3EQ2 A;  4WY4 D;  1S1C X;  2OTL 3;  3R2P A;  1IK7 A;  2K9Y A;  3EB8 A;  5AVZ B;  4WYK B;  4EI2 A;  4LGQ A;  2Y9Z A;  7STD A;  4PJ0 E;  3K0Z A;  1BRK A;  3AE8 C;  3VP8 A;  1VZZ A;  2G3A A;  3B8E B;  5KAF H;  1GYB A;  1L0L E;  4H13 B;  1EG9 B;  1RGL A;  4I5Q A;  2YFI B;  3CD6 P;  4JQ0 D;  2ZXX A;  1QAF A;  1LTJ C;  1IJD B;  4LSO A;  7GSP A;  1N73 B;  3NBB A;  1G1J A;  3E7K A;  5AVW B;  3CNM A;  3M0D C;  5CCH C;  3RK2 C;  3GAX A;  1L0L K;  3GMA A;  4IT7 A;  1NTM J;  5KTB A;  1VQN P;  1BU4 A;  4X2H A;  1Q42 A;  1BE3 G;  3L37 A;  1A02 F;  2XV5 A;  5H2F H;  1U7J A;  1B3S A;  1EEJ A;  3B4P A;  1R4C A;  1LTI C;  3L75 J;  1KYO D;  1RDS A;  1LNQ A;  1TFK A;  4CJN A;  1SQV D;  5CF2 A;  3S9O A;  1NH4 A;  3G4S 3;  4FCZ A;  6RNT A;  1T5Y A;  3CCJ 3;  5AEW B;  4WB4 A;  5CCH D;  3RK2 D;  1GY6 A;  1BNE A;  2BMQ B;  1YQ4 C;  2MJZ A;  3H6P A;  5BVB A;  5IG5 A;  4WYK A;  5LC6 A;  1BRH A;  2JDI H;  3H1L E;  3H1I E;  3LOY A;  2YIU C;  4W7Z A;  3CNX A;  5DRE A;  1EQ7 A;  3H1J E;  3X3Y A;  2O1J A;  1EDI A;  1BUJ A;  3L74 J;  3HD7 B;  2CW9 A;  1MWR A;  1RE4 C;  1KD1 4;  1KB9 H;  1QMA A;  5B66 E;  2XDJ A;  3MD0 A;  1UCK A;  3F7S A;  1FYS A;  1Q86 Q;  1IU7 A;  3VTP C;  1BCC D;  3AE4 C;  1RF0 A;  3AHW A;  1GSP A;  3PCR A;  3F40 A;  1N73 A;  1KIL B;  3DZL A;  1QVF O;  1KMI Z;  2OTK E;  4OH8 B;  1A67 A;  1GL2 B;  2QJP C;  1CYU A;  3FF2 A;  2M3B A;  3UL5 A;  1HUC A;  1KIL E;  1SP4 A;  1NVO A;  4JPZ B;  3V98 A;  2FYU D;  1KFM A;  4IIA A;  2JP3 A;  1IQX A;  3F14 A;  5KP3 A;  2WMM A;  5RNT A;  2RMZ A;  3CC2 3;  3SSU A;  2KXP B;  2A45 I;  3S1K A;  1IFD A;  3JUO A;  3X3Z A;  3H1K E;  4NPB A;  1N7S B;  1SQQ G;  2B1X B;  3HD7 A;  2IBZ D;  4RES B;  5IEP A;  2L5G B;  2B9B A;  3KPE A;  2KUB A;  2KS1 B;  2N1T B;  5IG4 A;  3V2N A;  3SOA A;  3L74 G;  4QWT A;  1R5S A;  1KIL A;  5GTH H;  3OWS A;  1YTZ I;  3IMA B;  1S72 3;  3L72 E;  1OVR A;  2H43 A;  2HYN A;  1FGQ A;  1SQB E;  1NU1 E;  1Q82 4;  4KT3 B;  3L35 A;  1JKG B;  2QIW A;  2GU3 A;  5D83 A;  3WOE B;  2K3R A;  4J5G A;  1ROA A;  4N3Y B;  1Q7Y Q;  1RH5 B;  1GS3 A;  1SQW A;  3G16 A;  1Q81 Q;  4LZI A;  3N8B A;  2K0M A;  1X1Y A;  1BCC J;  3OXA A;  2I8D A;  1URQ C;  1YJ9 P;  1SII A;  1RF0 C;  2E43 A;  3LYG A;  2OYI B;  3EC9 A;  1VDF A;  1MKM A;  3NQZ A;  1VQ6 P;  2R5D A;  1YI2 3;  1I3I A;  3RL0 g;  3IN6 A;  2KB7 P;  3PLN A;  2R3S A;  3SED A;  1EZV E;  2CC3 A;  3B4S A;  3BNB A;  2W9P A;  3TGU E;  2FYU J;  4DKI A;  2SPZ A;  1URQ D;  1ZX2 A;  1W01 A;  1HGZ A;  3GF3 A;  2YXR B;  1KYO H;  2N1T A;  2KNC A;  1N86 A;  3HUS B;  2XKM A;  1K73 4;  1HJ0 A;  1O7P B;  4FMB A;  1BUQ A;  1DEB A;  4D6T J;  1NHL A;  4Y99 C;  1RHL A;  1RGF A;  4XBY A;  1OZH A;  1JKG A;  1RCL A;  2KYV A;  3AGN A;  3GZR A;  1X1X A;  2OYH B;  3CXC 2;  1ULJ B;  2H8P D;  3I5C A;  2FBW C;  1CYV A;  4WP5 A;  3D3L A;  3A0B E;  1FW7 A;  3X42 A;  4H0L C;  2XR8 B;  3WU2 E;  1BRS A;  5AYS C;  4OGQ C;  2Z6B A;  1GK6 A;  3CCV P;  3PHL A;  5TJH A;  2OYI A;  3K9M C;  3ZG5 A;  2XSO B;  1RMS A;  3FXD A;  1EQK A;  3CME 3;  2Y0E A;  4GHO A;  4AKY A;  4H0L D;  4KFF A;  4HOH A;  1Q9E A;  1C54 A;  1YGW A;  3SX1 A;  5AYR B;  3LXU X;  1STD A;  3G3Z A;  3F7X A;  4PV1 C;  1PPJ G;  4OGQ D;  3RBZ A;  1ZS7 A;  4J5K A;  2E42 A;  3MP7 B;  3VYI A;  2FYN C;  2Q07 A;  3JUP A;  1IK3 A;  2BEZ F;  4KT0 J;  3Q5S A;  3BAS A;  2C10 A;  1KV4 A;  2E5T A;  3HUS A;  3CCU P;  1U57 A;  4N3V A;  2UGI A;  1NB3 I;  1FJP A;  3FGY A;  5AVR B;  1BSD A;  4PV1 D;  4Q53 A;  4L76 A;  2YXQ B;  2RSX A;  3L71 E;  4LLH A;  2QSI A;  3HRN A;  1QAL A;  2GEY A;  2J5U A;  4H44 C;  5AEU B;  1X0T A;  4HH2 A;  4XBX A;  2A45 G;  4D6T G;  2I1K A;  1QL2 A;  4I7Z B;  3ROB A;  4GT1 A;  3BRV B;  1W2B O;  3M06 A;  1O7N B;  3CX5 D;  2N9Y B;  1OHO A;  4BIR A;  1NTK D;  1BGY E;  1UDI I;  8RNT A;  3GLM A;  4HVN A;  2O01 N;  2BIR A;  2XNX A;  1KFN A;  4H44 D;  5ELJ A;  2E2T A;  1AJY A;  3CCM P;  3MIW A;  3B71 A;  4BTX A;  4I6M C;  3X41 A;  3EF8 A;  5IG3 A;  4IL6 X;  2E75 B;  1BRN L;  3Q2P A;  3M91 A;  1S5L X;  1IFP A;  1RN7 A;  3MZW B;  3R4Y A;  5HGR A;  3EWK A;  1TJD A;  3NXJ A;  3LTD A;  2V7Q J;  3G0K A;  2JR8 A;  1NTZ E;  1VQK P;  4L8O A;  3L70 J;  3KII A;  1HF9 A;  2IFM A;  2A06 E;  3AEB C;  3AE1 C;  1K9M Q;  1W02 A;  1ZO2 A;  1M90 4;  1LXE A;  2F98 A;  1PL5 A;  5KKZ C;  1L0L G;  1SQQ K;  2KSE A;  1OHP A;  1Q82 Q;  1YHQ P;  3UB1 A;  5CBN A;  1S4X A;  1P84 D;  2IZ1 A;  2B88 A;  3SFD C;  2RBI A;  2IYP A;  1NO3 A;  1B2S A;  3A7O A;  1OW7 A;  3K7C A;  1LTS C;  1GOY A;  2V4H A;  2P10 A;  2ZFC A;  5APU A;  1I8V A;  3ZFZ A;  1EZV I;  1LP1 B;  1H8A A;  2GM4 A;  1EKM A;  1HWT C;  1OMI A;  1YYC A;  1SQP E;  1GMJ A;  1VQ5 P;  3B5N B;  1USE A;  3KXD A;  1SQX E;  5AW6 B;  3BAT A;  1PP9 J;  1JMB A;  1QVG O;  3FXE A;  1RTU A;  1M1K 4;  5IER A;  1M1J B;  2B24 B;  2MF7 A;  4XDV A;  3CC7 P;  1T6A A;  4ASW A;  1BE3 D;  1I3F A;  1MWT A;  3FH1 A;  4DOJ A;  1SQP K;  3PXM A;  3H1I G;  1NTK J;  5KLV E;  1K73 Q;  1VQP P;  2RKL A;  4ZNC A;  2WIT A;  4K1V A;  3NFQ A;  4WWI A;  2L4V A;  4FCJ A;  1M1X B;  5AW2 B;  4O02 B;  1DD4 A;  3CXH D;  2C9L Y;  3WUV A;  1YVS A;  4GL6 A;  3BCC E;  5AW8 B;  1X8Y A;  2V7Q H;  3MPH A;  1FU1 A;  3M9Q A;  1I2F A;  3S67 A;  2HFE D;  3FGA D;  2BMR B;  3L70 G;  2D1W A;  1PFP A;  1MV8 A;  3IJE B;  2NPS D;  3M9H A;  3AE5 C;  5M1B A;  4AEQ A;  1SQV E;  2WPS A;  2FFD A;  1VQL P;  5TIS E;  3FF0 A;  3IR9 A;  1LP1 A;  1T3U A;  2ZT9 B;  1FGT A;  2WT7 B;  1W5C E;  3VMY A;  3SLU A;  3B5N A;  1FZB A;  1GW3 A;  3KSP A;  3RBX A;  1OFC X;  1A90 A;  1FAV A;  2CFK A;  2ZYG A;  2ZAE B;  1MGR A;  2KF3 A;  1ZLL A;  5KJ7 A;  3HE5 B;  1Y8A A;  3E1R A;  4MN4 C;  2KXG A;  4YXD C;  4I7Z C;  1T2K C;  1NJI 4;  4U3F E;  1BDD A;  2R41 A;  3X40 A;  1PP9 G;  2SBL A;  4PD4 D;  5B5E H;  1LVN A;  1JN5 A;  1FZC B;  1JUN A;  1DE3 A;  3DY5 A;  3H1K G;  2GXF A;  5M1A A;  3CX5 H;  1JBR A;  2K37 A;  1A2K A;  1W5Z A;  3OV4 A;  1PGQ A;  2E74 B;  1SAR A;  3T8N A;  1FDO A;  1T2K D;  1PGP A;  2CFG A;  3MG2 A;  1B2U A;  3F9S A;  4OVN F;  1FOS E;  3LZA A;  1SQQ D;  2D2C C;  1LRA A;  1MUU A;  3TNU B;  2A15 A;  3RK3 B;  5CF1 A;  2AEM A;  1NNV A;  4JF8 A;  1IVU A;  1KOR A;  1SQB G;  4IFM A;  1VQ9 P;  1LWU C;  3D9R A;  3Q3D A;  1FDM A;  1NB5 I;  3AEE C;  3AGO A;  4N78 E;  2H88 C;  2R4I A;  3BND A;  3L74 D;  2IUJ A;  2Z7A A;  1YIT P;  3KFQ C;  3RK3 E;  5APX A;  1UGH I;  3D5G A;  1RKY A;  2P0X A;  1S3J A;  3H32 A;  3HE5 A;  4WBA A;  4FMC A;  1RQU A;  1YBK A;  3A0H E;  1FGO A;  4HM2 B;  2LQV A;  3GHG C;  1P84 H;  1OHS A;  2LYX A;  1LOV A;  2E5Y A;  3JUQ A;  1M57 D;  1EXI A;  2FFD C;  2K9J B;  1RJO A;  1HYF A;  1FZE A;  1L0N K;  1J2J B;  1PYL A;  3D4A A;  3AE3 C;  1M90 Q;  4KFD A;  2QEX P;  4R4K A;  1EZV G;  1RF1 B;  1EXJ A;  6STD A;  1CSB A;  1L4A A;  5APS A;  3PH0 A;  3G6E P;  1RRH A;  1K8A 4;  3J7Y d;  2KLU A;  4BWN A;  4IL6 H;  5KJ7 C;  1ASK A;  2BO9 B;  2I9W A;  1L5G B;  2YKO A;  2Q3I A;  2ZL8 A;  1OAC A;  1VQ4 P;  1E79 H;  1LTT C;  1XTG B;  3TNU A;  1YJW P;  3URP A;  3DUK A;  2QG4 A;  3JCU E;  3WMM 0;  1T3B A;  4EV2 A;  1SFC A;  3F5H A;  1WRG A;  3T97 B;  1N2D C;  1O7H B;  2AEJ A;  5IEN A;  1Q40 B;  2PRR A;  5KJ7 D;  1DH3 A;  3EQQ B;  2D42 A;  1WMK A;  1IV9 A;  1DMQ A;  5IW9 A;  4N6L A;  3SFE C;  1IO4 A;  1RN4 A;  3V5B A;  1JRQ A;  2Y0D A;  3CXH H;  3GF7 A;  3DGO A;  2H7H A;  2OTL P;  1RGG A;  1E97 A;  1SQQ J;  2GEX A;  3STD A;  3WUU A;  4HM3 B;  3VOP A;  3KYQ A;  2O3O A;  2OCT A;  3K5B A;  2QJY B;  5AVS B;  2Z5H A;  4QMA A;  4O9B A;  3S27 A;  1YNV X;  1VQM 3;  3CCE 3;  3MWZ A;  1RCK A; 
#chains in the Genus database with same CATH homology
 1UUW B;  1WTH A;  2FGT A;  4XDW A;  3KZT A;  1ZX2 A;  1N8Q A;  2HML B;  1W01 A;  1QJG A;  2OOV A;  3NM7 A;  8CHO A;  1NWW A;  4X2O A;  3RGR A;  3NV0 A;  4N6V 0;  3T0U A;  2QE7 H;  4K90 B;  3V99 A;  3CCS 3;  3CCQ 3;  3NUV A;  1VQP 3;  1K73 4;  1BSH A;  1O7P B;  4FMB A;  1BUQ A;  1G96 A;  3PZW A;  3LTB A;  2OQE C;  4XBY A;  3FSD A;  3PGB A;  3WA2 X;  5EQL A;  3CC7 3;  3JUN A;  1JKG A;  5AI1 A;  1N8R 4;  3GZR A;  3HII A;  3CXC 2;  1ULJ B;  2CKF B;  1OF5 A;  3BNC A;  2WSS H;  1CYV A;  4WP5 A;  3D3L A;  3CD6 3;  2CWV A;  1TIJ A;  3EBY A;  3X42 A;  1YGE A;  1PU4 A;  2XGN A;  1OUN A;  2GBW B;  2CIU A;  1E3R A;  1OGX A;  2XR8 B;  3F8X A;  4TLF A;  4OK0 A;  3WMD A;  3OW2 2;  5AYS C;  4KFE A;  2Z6B A;  1NU3 A;  3EN8 A;  3HK4 A;  3HIG A;  3Q1C A;  1VQL 3;  3WA3 A;  4LMI A;  2XF3 A;  2HMJ B;  2XFS A;  1QAK A;  3NM2 A;  2RCD A;  4RNZ A;  3OX9 A;  1VQN 3;  4R9L A;  1TFO A;  3CCR 3;  3K9M C;  2Z77 A;  2XSO B;  1WMN A;  4AKZ A;  1W6G A;  3CME 3;  3CCL 3;  1EQK A;  3CPW 2;  3S5C A;  4AKY A;  4KFF A;  2CH9 A;  2W0Q A;  3DM8 A;  3FG3 A;  1N9J A;  5AYR B;  3SX1 A;  3LXU X;  4OVM A;  1Q7Y 4;  1STD A;  1VQ8 3;  3PCS A;  3H3H A;  5CXO A;  3F7X A;  3S28 A;  2WGO A;  1Q81 4;  3S29 A;  4YXW H;  1DYU A;  2CFL A;  1O7M B;  4ZM8 A;  1S5A A;  3OWY A;  2Q07 A;  3JUP A;  1IK3 A;  3UJM A;  1GD4 A;  3LTC A;  2C10 A;  4EYC A;  2E5T A;  3UL6 A;  4IPB A;  1JB5 A;  2JQ5 A;  1D6Y A;  1JN5 B;  3FKA A;  3MG1 A;  1IT7 A;  3U1W A;  1JB2 A;  4N3V A;  5A0O B;  2M7O A;  2P38 A;  4K1U A;  2Y73 A;  2CK3 H;  1NB3 I;  3FGY A;  2BT3 A;  1JNQ A;  4Q53 A;  1ISK A;  4JRF A;  2PNC A;  3BB9 A;  1KC8 4;  2RSX A;  3GRD A;  5FW5 A;  2W04 A;  1IT8 A;  1AVK A;  3GZB A;  3JVC A;  1QAL A;  3V92 A;  5KP4 A;  2GEY A;  1ROV A;  1D6Z A;  3DXO A;  2E2U A;  5AEU B;  4XBX A;  4XM4 A;  1KQS 2;  3HI7 A;  1YJN 3;  4HBR A;  5KP1 A;  3ROB A;  2V1L A;  2CG0 A;  3CU3 A;  4N6T A;  3NX0 A;  3UNL A;  1GY7 A;  2GBX B;  1DMM A;  5G2G A;  4GB5 A;  1O7N B;  2OOV C;  4WWU C;  1DVD A;  1FS0 E;  3U97 A;  1VQ9 3;  1AVL A;  1JB4 A;  1OHO A;  2QGU A;  4FCM A;  3OWU A;  1HU9 A;  3NBJ A;  2RFR A;  4HVN A;  2P05 A;  2RGQ A;  2YX9 A;  2XGL A;  5ELJ A;  1YIJ 3;  5TGN A;  2E2T A;  1JV2 B;  3B8L A;  1YIT 3;  5AIH A;  3KE7 A;  4BTX A;  1CQS A;  1IV7 A;  4NRE A;  1SIH A;  3X41 A;  1WMP A;  4R9K A;  3ECF A;  3EF8 A;  1Z1S A;  1M9G A;  5IG3 A;  2P09 A;  3N54 B;  3B7C A;  4EV5 A;  1E3V A;  4O3V A;  3LH4 A;  3DGL A;  3Q2P A;  4I4K A;  1IFP A;  1RN7 A;  2W56 B;  5AII A;  3EX9 A;  1KSI A;  4XB5 A;  5HGR A;  3NXJ A;  5JPP A;  1TUH A;  3LT8 A;  3LTD A;  3I55 3;  1K28 A;  3EBT A;  3G0K A;  4L8O A;  1N5P A;  2F86 B;  2XRX B;  3KII A;  4WHA A;  4U13 A;  1ZO2 A;  3KSE D;  3MYT A;  1M90 4;  1W02 A;  3CPO A;  2QEX 3;  1LXE A;  2F98 A;  1OHP A;  3M8C A;  4EC6 A;  1NDO B;  3EN1 B;  2CFW A;  3UB1 A;  5LC7 A;  3G6E 3;  1QVF 2;  1LNH A;  3L0R A;  2CWT A;  1W00 A;  4HZB B;  4O8S A;  1NO3 A;  3MKI A;  1Q40 A;  4RZM A;  1EA2 A;  3N9H A;  4H61 A;  2XSH B;  5AIF A;  1OGZ A;  2ZDJ A;  3K7C A;  4H3U A;  4HM0 B;  1OH0 A;  3BNE A;  1VQ4 3;  3EE1 A;  5DRV A;  2HMK B;  3IPT A;  1YJW 3;  3GZX B;  4RNY A;  4N6N B;  1UW1 A;  2W03 A;  3QRD A;  3ER7 A;  1EKM A;  3SXX A;  5CLK A;  2GU1 A;  3VF1 A;  3TDG A;  1N9E A;  3NHX A;  3EFF K;  2HMO B;  3E99 A;  2IMJ A;  1JJ2 2;  3FCS B;  3NQY A;  1U8C B;  1KWI A;  1UUV B;  5JPU A;  4DJG A;  2W9Q A;  1M1K 4;  2XH9 A;  4O2H A;  2CWU A;  5IER A;  2MF7 A;  2B24 B;  4XDV A;  5I97 A;  2Z76 A;  3ALA A;  1IQ8 A;  1YJ9 3;  3FH1 A;  5D81 A;  2W56 A;  3NBR A;  3BLZ A;  2OTL 3;  3GWR A;  3EB8 A;  3K5T A;  4HM5 B;  2OQE A;  4WYK B;  1Y4K A;  4LGQ A;  4MEI A;  2W6J H;  3PXM A;  7STD A;  1VQ6 3;  2HMN B;  2OWP A;  3K0Z A;  4HKV B;  4K1V A;  2L4V A;  4FCJ A;  4CDL A;  1M1X B;  1VZZ A;  2XEP A;  3AMO B;  3A76 A;  4O02 B;  1A2V A;  2CFD A;  2IA7 A;  1GYB A;  4GL6 A;  3CC4 3;  2V7Q H;  1W6C A;  3MPH A;  5CK6 A;  1EG9 B;  4RBN A;  1W7C A;  1US1 A;  2INX A;  1AQT A;  3S67 A;  4LEH A;  2BMR B;  5FGO A;  2YFI B;  4N6U A;  2D1W A;  1PFP A;  2WO0 A;  3G71 3;  1QAF A;  3IJE B;  4LSO A;  3B4O A;  5BXQ A;  4AEQ A;  2ML5 A;  3SVA A;  1K9M 4;  3NBB A;  3O8Y A;  1SJW A;  3LML A;  1WQL B;  3WOF B;  3SOY A;  3FF0 A;  4HM1 B;  3CNM A;  1W2B 2;  3GAX A;  1IQY A;  1IVV A;  1W4N A;  4IT7 A;  4X2H A;  3LTA A;  1FGT A;  1J2B A;  1Q42 A;  2MC8 A;  3SLU A;  3B4P A;  1OF5 B;  1R4C A;  3KSP A;  3PJS K;  2WOH A;  3DGM A;  3FLJ A;  1A90 A;  5IEO A;  1TFK A;  2CFK A;  4HYZ A;  5CF2 A;  3G4S 3;  4FCZ A;  1F8N A;  1T5Y A;  1TP6 A;  4G1M B;  1W6Y A;  3RDE A;  3CCJ 3;  5AEW B;  3CCV 3;  2KXG A;  1NJI 4;  3DGN A;  1GY6 A;  4HM8 B;  1SPU A;  2BMQ B;  4HM7 B;  3X40 A;  4CCV A;  4FR9 A;  2SBL A;  5BVB A;  2KCD A;  5IG5 A;  4WYK A;  1MNL A;  4FMA A;  5IG0 A;  5LC6 A;  3K63 A;  1LVN A;  4HM6 B;  1JN5 A;  2JDI H;  3QK9 A;  1IVW A;  3DY5 A;  3CNX A;  2FXT A;  2YFL B;  3LOY A;  3AMO A;  2P0M A;  4L7K A;  2KRT A;  1DMN A;  2GXF A;  3JUM A;  5EEO A;  1TU5 A;  2Y74 A;  5DRE A;  3X3Y A;  3VSY A;  2C11 A;  1A2K A;  3LT9 A;  4MJD A;  1W5Z A;  2CW9 A;  4L8P A;  3OV4 A;  3T8N A;  1KD1 4;  1IDP A;  1QMA A;  2CFG A;  3F7S A;  3MG2 A;  1IU7 A;  1RRL A;  3F9S A;  3CCU 3;  2UX0 A;  1N5H A;  2ML6 A;  3KKG A;  3LZA A;  3PCR A;  3F40 A;  4EXR A;  3HZP A;  4R1K A;  3MWZ A;  3DZL A;  5EVH A;  2A15 A;  2K54 A;  4EBG A;  5CF1 A;  1AV4 A;  3FG1 A;  1FA3 A;  5ELU A;  4J9A A;  4JF8 A;  1IVU A;  2QA4 3;  1A67 A;  3D9R A;  4HM4 B;  3USS A;  1STF I;  4J8T A;  2WOF A;  4K61 A;  1NB5 I;  4HJL B;  1CYU A;  3FF2 A;  2R4I A;  4R80 A;  4PEJ A;  3UL5 A;  3BND A;  3X3X A;  1GD3 A;  2IUJ A;  2Z7A A;  3KFQ C;  3V98 A;  5AIG A;  1V74 A;  1K41 A;  1RKY A;  4IIA A;  2STD A;  2P0X A;  4TX4 A;  1QVG 2;  1AR0 A;  1IQX A;  4NHF A;  4FMC A;  3F14 A;  4WVZ A;  1BSN A;  1FGO A;  4HM2 B;  3I0Y A;  3HX8 A;  5KP3 A;  2LQV A;  4OUQ A;  1OHS A;  1CEW I;  2LYX A;  3CC2 3;  2E5Y A;  3JUQ A;  2BMO B;  4FMD A;  4KVH A;  3KN4 A;  1RJO A;  2HMM B;  3WOD G;  2OTJ 3;  1W2Z A;  2YFJ B;  3CCM 3;  4MMX B;  3FZW A;  3JUO A;  3X3Z A;  1WMO A;  4KFD A;  4R4K A;  6STD A;  1VQO 3;  2B1X B;  3EHC A;  2CG1 A;  5IF6 A;  3GZY B;  4XBT A;  1RRH A;  2IUK A;  1LOX A;  5IEP A;  1WNH A;  1UI8 A;  1IVX A;  4N6O B;  1K8A 4;  1DVC A;  3DMC A;  3PYJ A;  3J7Y d;  3RGA A;  5IG4 A;  3NV0 B;  1ASK A;  2BO9 B;  2I9W A;  2BNG A;  2XFT A;  1OPY A;  4MMZ B;  1L5G B;  2W2C A;  3SOA A;  3VGN A;  4N6M A;  4QWT A;  3WDG B;  1VQK 3;  4BTW A;  3CMA 3;  2ZL8 A;  1OAC A;  1E79 H;  3OWS A;  3IMA B;  3I56 3;  1S72 3;  3DUK A;  3F8H A;  1FUW A;  1FGQ A;  5STD A;  1YHQ 3;  5JBS A;  1Q82 4;  1VQ7 3;  1JKG B;  2GU3 A;  5D83 A;  2F99 A;  3WOE B;  4EV2 A;  4HZ9 B;  1O7H B;  5IEN A;  3MHE A;  2O9U X;  1FGM A;  1Q40 B;  5D82 A;  2QIY A;  1Q86 4;  1OCV A;  1ROA A;  3EQQ B;  2D42 A;  1IV9 A;  1DMQ A;  4BTY A;  1GY5 A;  4N6L A;  5IW9 A;  1MOL A;  1FGR A;  1JRQ A;  1GS3 A;  1SQW A;  1YVB I;  2WGQ A;  3G16 A;  1O7W B;  1UI7 A;  4LZI A;  3N8B A;  2K0M A;  2PZV A;  3PS8 A;  3G8Z A;  3OXA A;  3DGO A;  1SII A;  4STD A;  1E97 A;  2GEX A;  3H51 A;  3FG4 A;  3LYG A;  3STD A;  1VQ5 3;  4HM3 B;  1O7G B;  2E2V A;  3EC9 A;  3MG3 A;  2O3O A;  2OCT A;  4ORL A;  2XND H;  1U5O A;  1ULI B;  3NQZ A;  4WFO A;  3T8U A;  1YI2 3;  1D6U A;  2CHC A;  3MSO A;  3Q90 A;  4QMA A;  1C7H A;  4MMY B;  3S27 A;  1VQM 3;  1HKX A;  2FNQ A;  4KZ1 A;  3CCE 3;  2BHM A;  3SED A;  2CC3 A;  3EJV A;  1JEK A;  3BNB A;  2W9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...