1KC84

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 19
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kc8400
3I563 3CCM3 1QVF2 1M1K4 2OTJ3 1YI23 1VQM3 3CCJ3 3CXC2 3I553 3CC73 3CCE3 3G713 1VQ53 1VQ73 3CCR3 1YJN3 1QVG2 1VQO3 1VQK3 1K8A4 1KD14 1VQL3 3CMA3 3CCQ3 1Q864 1NJI4 3OW22 1YIJ3 3G6E3 2QEX3 1YJ93 3G4S3 3CCU3 1YJW3 1YHQ3 1Q7Y4 3CCS3 1W2B2 3CC43 1VQ63 1Q824 3CCV3 1YIT3 1VQ43 1S723 1K9M4 2QA43 1VQP3 1Q814 1K734 3CC23 3CCL3 1KQS2 1VQ83 3CPW2 1M904 1KC84 1JJ22 3CME3 2OTL3 3CD63 1N8R4 1VQ93 1VQN3
chains in the Genus database with same CATH superfamily
1B2XA 1NB3I 4GHOA 5BIRA 1EEJA 2D42A 3X3YA 5FW5A 3B4OA 1RGLA 1RN7A 3CNXA 2ML6A 3GZYB 3UB1A 1VQM3 1S5AA 4AEQA 2P09A 1TP6A 3AMOB 2CG1A 4N6LA 2CX1A 1IT7A 1FZUA 3SOYA 1BVIA 1W6YA 3U1WA 5BXQA 4MMYB 4DKIA 1OH0A 1TFOA 2BHMA 3DGNA 2E2UA 4U13A 4BTXA 4RNZA 3CCS3 4STDA 3S27A 1I0VA 1BNRA 1SJWA 1UI8A 1MWTA 7STDA 1YIT3 4EW5A 4J5KA 5FGOA 3PXMA 2F98A 1BNEA 3CPOA 3HI7A 1I8VA 3D79A 4K1VA 3HOHA 1T2HA 3B7CA 3RGAA 3A5EA 3MHEA 3GZRA 5RNTA 1STFI 4ZM8A 1B3SA 2BO9B 2KRTA 3S67A 1MGRA 4HM4B 5D81A 1VQ53 1DYUA 3UL5A 3NBRA 1RGFA 3Q1CA 5IEOA 1IK3A 1LQGC 4J9AA 3ZG0A 1QVG2 5STDA 3ZFZA 1EA2A 5IG3A 3CCQ3 2D1WA 2OQEC 4KZ1A 3D9RA 1ASKA 1BAOA 1WMOA 2FXTA 3LXUX 3BNDA 3GWRA 1UGHI 3LT9A 1RN4A 4ILFA 3VF1A 1FA3A 3EQQB 4HOHA 1LXEA 4WP5A 1K734 2GBWB 4HM0B 2BIRA 1B2ZA 4LMIA 1C54A 1CYUA 8RNTA 1Q40A 3PCRA 2OQEA 1CYVA 5IG5A 3PGBA 1JB5A 1RCLA 1KWIA 3K0ZA 4N3VA 4QWTA 3X3ZA 1AR0A 2OTJ3 1GOVA 4WHAA 1SQWA 3FG1A 1OGXA 3NX0A 1LOVA 4H61A 4HYZA 1UUWB 1KSIA 1RGGA 1VQK3 4LSOA 4HM1B 4AKZA 1WNHA 5BVBA 5IG0A 2P38A 1DVDA 4FMBA 4XBXA 3SXXA 3KKGA 3AHSA 2XF3A 3KSPA 1JKGB 2Z77A 4LEHA 1K9M4 1W7CA 1YVBI 1UI7A 2GU3A 1CEWI 3PYJA 2WOFA 4OUQA 1KQS2 1UCJA 3JUQA 4IIAA 1BSAA 1ROAA 2F56A 3NQYA 4HAAA 4X2HA 8CHOA 3S28A 1GMQA 3MG3A 1DMQA 1ROVA 1YGWA 4O8SA 3J7Yd 1N8R4 4HM3B 4OVMA 2OTL3 2OOVC 2HOHA 3N9HA 1TU5A 4CCVA 2KF6A 1IVUA 3NQZA 5AYRB 5JBSA 1RGAA 1YJN3 1I3IA 1F8NA 1OF5B 3GRDA 2CFKA 2K54A 4HVNA 3PZWA 2AADA 1Y4KA 4KT3B 1OPYA 1MWSA 3G6E3 1UGIA 2RBIA 4JF8A 3WA2X 1B2SA 3FZWA 1UUVB 1YHQ3 1J2BA 3HIIA 2K0MA 3NV0A 4HM6B 1N5PA 3S29A 6GSPA 1W02A 3F9SA 3DH2A 1TFKA 1NO3A 1SIIA 2CW9A 7RNTA 2HMOB 1NNVA 1OACA 2Q07A 1W6CA 3JUOA 1BRHA 5M1AA 1BIRA 1QALA 1LNIA 2M7OA 4KFEA 4R9KA 3LTBA 3LTAA 3F8XA 1FGQA 2HMNB 1SPUA 2H0HA 5G1LA 4HM7B 2CFDA 3STDA 3E99A 3RGRA 3KZTA 1OGZA 3KCHA 1W2ZA 1L5GB 2AAEA 3FH1A 4RNTA 1E97A 2GSPA 1VZZA 2V1LA 2CG0A 2O9UX 3D5IA 3G8ZA 3EHCA 3CME3 2JQ5A 1QAFA 4K90B 3PCSA 4GL6A 1M1K4 3JUMA 1ULIB 1RJOA 2BT3A 2C4BA 2W56B 1AY7A 3O8YA 1I3FA 4RZMA 3MSOA 3SX1A 3D4AA 2XH9A 2W0QA 3VGNA 2CWTA 2LYXA 3ALAA 1IT8A 1BNJA 2CKFB 3BNCA 3EN1B 2Z6BA 3KSED 5ELUA 3NXJA 2O3OA 4GB5A 5JPUA 1KD14 3NBJA 3WDGB 4JRFA 5EVHA 5EEOA 3CMA3 3JUNA 1IYYA 3DY5A 1NJI4 1X1WA 1Q7Y4 4NPBA 3G4S3 1YJW3 1LVNA 1GMPA 1RNTA 1I2FA 1HKXA 1MWRA 1SARA 1FGMA 3D3LA 3FKAA 5DRVA 4EXRA 1DVCA 3CCL3 1IDPA 1LOYA 3CPW2 1GSPA 3A76A 3ER7A 1YNVX 3T8UA 5JPPA 3F7SA 5LC7A 1V57A 3UL6A 3CD63 3SVAA 4HM8B 1RMSA 5AEUB 5ELJA 3CU3A 4FMCA 3UNLA 1RCKA 4X2OA 3EBYA 1EQKA 1JN5B 1K28A 4ORLA 4BL3A 1GY5A 2F86B 2F4YA 2OCTA 1ZS7A 1B2UA 4K1UA 5IW9A 4TX4A 1R4CA 1TTOA 2H0IA 2PZVA 3DGMA 4CDLA 4CJNA 1O7NB 1YJ93 4FMAA 2JDIH 4MMXB 3SYUA 1BSDA 1OCVA 1RKYA 3X3XA 2F99A 2GBXB 1RTUA 2K3DA 2ZDJA 1FYSA 3OWSA 1IQXA 3RNTA 1AV4A 1I2GA 4H3UA 1W4NA 4N6OB 3EJVA 1E3RA 2A15A 3CXC2 1K41A 3G713 4R1KA 3K5TA 4XBYA 3LMLA 2XRXB 4G1MB 2STDA 1VQO3 1A90A 1VQQA 3EC9A 4FR9A 3WOFB 2CIUA 3GZXB 1YGEA 3URPA 3HX8A 1B20A 1FUTA 2ZHXB 4PEJA 1N5HA 2XR8B 3S5CA 3FCSB 1I2EA 1IVVA 3Q3FA 1WTHA 1E3VA 2GXFA 2IYJA 3EF8A 3EX9A 1MOLA 1BSBA 1W00A 2IUKA 3G0KA 2W9QA 4MMZB 1VQ83 1X1XA 3ROBA 5M19A 1M904 2PNCA 3HZPA 4J8TA 3Q90A 2YX9A 4GSPA 2BMOB 3FF0A 2ZL8A 3CCM3 1QVF2 2INXA 2KAAA 2GEYA 3EBTA 2IMJA 1ZO2A 1BRIA 2RFRA 4N6V0 1CQSA 3QK9A 4EC6A 1V58A 3PS8A 2KF4A 3F7XA 4BTWA 3L0RA 1PU4A 2WOHA 1N9EA 1BOXA 1GY6A 4XM4A 2I9WA 1VQL3 1YVSA 3AGOA 1Q7HA 5AIIA 4O02B 4Q53A 3G16A 4WYKA 5CXOA 1STDA 2QEX3 2CWVA 1W6GA 3KIIA 2OOVA 1T5YA 1Q42A 2BU4A 2P0XA 3RDEA 1EKMA 3EB8A 4LYLB 5AI1A 3LYGA 3EE1A 1VQ43 1Q40B 2R4IA 4EYCA 5D83A 1LRAA 3CC23 1LOWA 2CFLA 1JZOA 1BNGA 2XGNA 2ML5A 1IVXA 2W03A 1BRJA 1WMNA 1B27A 1UCKA 3FF2A 2W6JH 1BRNL 3ZG5A 1B21A 3WODG 4R4KA 4LZIA 2CH9A 2YFIB 3FG4A 1GOYA 5G2GA 1RSNA 2B1XB 2UX0A 1SIHA 1QAKA 1JRQA 3F14A 2H0GA 3AMOA 1C7HA 1D6YA 1RLSA 3D5GA 2YFJB 2CK3H 1Q824 4KFFA 3B8LA 1IV9A 4NREA 1RGEA 3V92A 3CCV3 1FUWA 1VQP3 2W2CA 1Z1SA 1RRHA 1G0TA 5HGRA 1W5ZA 3JUPA 2GU1A 2UUGC 1NB5I 5LC6A 4XDVA 3LT8A 1JNQA 1V74A 5AIHA 1VQN3 2KF3A 3JVCA 1T2IA 1FUSA 1I0XA 1BRGA 4L7KA 4HM2B 3FG3A 3CC73 2WGQA 4HZ9B 1IQYA 1ULJB 3MWZA 2F5MA 2IUJA 1X1UA 1HU9A 1OHOA 1M1XB 1FGOA 4XBTA 4OK0A 3U97A 2HMJB 3KN4A 1RHLA 2SARA 3AHWA 1N8QA 3WMDA 3NV0B 3OW22 3VSYA 1IU7A 4J5GA 4IT7A 3CNMA 1RN1A 4N6MA 3N8BA 3OWUA 3IPTA 1N9JA 5GSPA 1PY3A 2Y73A 2QA43 1BNFA 4KVHA 3MG1A 5AIFA 5G1KA 5AYSC 3B4PA 5KP3A 1RGKA 2ZA4A 3IJEB 2F5WA 3F40A 1RRLA 1UUGB 3BB9A 2MC8A 3BU4A 2FNQA 1CH0A 3IMAB 1U5OA 2RGQA 2XEPA 4I4KA 3X42A 1JBTA 2SBLA 2YFLB 3MYTA 6STDA 3KE7A 2E2VA 4FCMA 4FCJA 4HBRA 2C11A 1MNLA 2CFWA 1BANA 2WGOA 2XFTA 3I0YA 4BIRA 4IPBA 5KP4A 1ZX2A 5A0OB 3LTDA 1W01A 1RGCA 1JB4A 1AVKA 3CC43 5CLKA 1HYFA 3BLZA 4FMDA 1HZ1A 1IQ8A 2R41A 4EV5A 1O7GB 3NUVA 1BNSA 3SLUA 5I97A 3HK4A 1AQZA 2P05A 3OXAA 3FGYA 1FW7A 1BGSA 5IENA 5IF6A 5M18A 1JKGA 1ZGXA 2RSXA 3WHOA 1O7PB 5KP1A 1TUHA 3NM2A 4N6UA 2B24B 1JB2A 2HMKB 1G02A 1AVLA 1RNBA 3I563 4BTYA 1IV7A 4N6TA 3H51A 2C10A 1BU4A 2L1SA 3NM7A 4HKVB 3DM8A 3NHXA 4R80A 2P0MA 3CCR3 1RDSA 1JZDA 1U8CB 2FGTA 1BSCA 4L8PA 1QJGA 4FCZA 1K8A4 1DE3A 2HMMB 1OHPA 2Y74A 3EN8A 3WR2A 1OF5A 2XGLA 3DGOA 3FLJA 2RCDA 1M9GA 2Z76A 4EBGA 1EG9B 2QGUA 3OWYA 1DMMA 4KFDA 4HJLB 1TIJA 2KF5A 4HZBB 2CX0A 5BU4A 4K61A 9RNTA 5EQLA 5IERA 3WA3A 5HOHA 1MGWA 2BNGA 5IEPA 3N54B 1VQ93 2L4VA 3BIRA 2J8XB 2MF7A 4MEIA 3SEDA 1MWUA 1LOXA 2LQVA 3WOEB 2OWPA 1BRSA 1OHSA 2IY2A 1GD4A 4N6NB 3QRDA 5IG4A 3GAXA 4LGQA 4O2HA 2XFSA 1BNIA 1TRPA 4R9LA 1GD3A 3H3HA 1G96A 3K9MC 3X40A 2E2TA 3LOYA 4O3VA 1YIJ3 3DXOA 5D82A 1BRKA 3K63A 1WMPA 1O7MB 3LTCA 1FGRA 1VQ63 2CWUA 3KFQC 3Q2PA 3SOAA 1BUQA 3BNBA 5AEWB 1LNHA 1A2PA 1A2KA 1B2MA 1NDOB 2RNTA 2BMRB 3MKIA 3V99A 2KXGA 1ISKA 2XSOB 4XDWA 1X1YA 3T8NA 1YI23 3CCJ3 5CK6A 1JBRA 1R4YA 5DREA 2XSHB 2W56A 3DZLA 1PFPA 3UJMA 4L8OA 1JBSA 1GS3A 3LH4A 3OX9A 4RNYA 3OV4A 5CF1A 4HM5B 1DETA 1DMNA 4CPKA 3CCU3 2CFGA 3LZAA 3K7CA 3DUKA 1RGHA 2CC3A 1S723 2QIYA 1NWWA 1Q9EA 1O7WB 1WQLB 1I70A 4I5QA 2GEXA 1BUJA 3BNEA 1EUIC 2BMQB 1JJ22 1T3BA 1PYLA 1UCIA 3MG2A 1UCLA 1UW1A 3GZBA 4RBNA 1GYBA 4EV2A 2HMLB 3X41A 1QMAA 3AGNA 2WO0A 3F8HA 3MPHA 4BL2A 1O7HB 3CCE3 1LQMB 3I553 1US1A 4WWUC 1VQ73 5CF2A 2KCDA 4WYKB 1GMRA 1TJDA 2UGIA 4NHFA 1A67A 3FSDA 1Q864 1FGTA 1GOUA 1OUNA 3DMCA 1JN5A 1TRQA 4AKYA 4MJDA 5TGNA 3GSPA 2IA7A 3M8CA 5AIGA 4WFOA 3T0UA 3V98A 4BU4A 1W2B2 1GY7A 2W9PA 1D6UA 1UDII 2W04A 3HIGA 1NU3A 7GSPA 2Z7AA 1Q814 2CHCA 4XB5A 1JV2B 3DGLA 3ECFA 1KC84 1IVWA 1D6ZA 3NBBA 1A2VA 3DGYA 6RNTA 3TDGA 1BSEA
chains in the Genus database with same CATH topology
1NB3I 2D42A 3X3YA 5FW5A 3B4OA 1RN7A 3CNXA 3GZYB 2ML6A 3UB1A 1VQM3 1S5AA 4AEQA 2P09A 1TP6A 3AMOB 2CG1A 4N6LA 1IT7A 3SOYA 1W6YA 3U1WA 5BXQA 4MMYB 1OH0A 1TFOA 2BHMA 3DGNA 2E2UA 4U13A 4BTXA 4RNZA 3CCS3 4STDA 3S27A 1SJWA 1UI8A 7STDA 1YIT3 5FGOA 3PXMA 2F98A 3HI7A 3CPOA 4K1VA 3B7CA 3RGAA 3MHEA 3GZRA 1STFI 4ZM8A 2BO9B 2KRTA 3S67A 4HM4B 5D81A 1VQ53 1DYUA 3UL5A 3NBRA 3Q1CA 5IEOA 1IK3A 1QVG2 4J9AA 1EA2A 5IG3A 3CCQ3 2D1WA 2OQEC 4KZ1A 3D9RA 1ASKA 1WMOA 2FXTA 3LXUX 3BNDA 3GWRA 3LT9A 3VF1A 1FA3A 3EQQB 1K734 1LXEA 4WP5A 2GBWB 4HM0B 4LMIA 1Q40A 3PCRA 2OQEA 1CYVA 5IG5A 3PGBA 1JB5A 4N3VA 1KWIA 3K0ZA 4QWTA 3X3ZA 2OTJ3 1AR0A 4WHAA 1SQWA 3FG1A 1OGXA 3NX0A 4H61A 4HYZA 1UUWB 1KSIA 1VQK3 4LSOA 4HM1B 4AKZA 1WNHA 5BVBA 5IG0A 2P38A 1DVDA 4FMBA 4XBXA 3SXXA 3KKGA 2XF3A 3KSPA 1JKGB 2Z77A 4LEHA 1K9M4 1W7CA 1YVBI 1UI7A 2GU3A 1CEWI 3PYJA 2WOFA 4OUQA 1KQS2 3JUQA 4IIAA 1ROAA 3NQYA 4X2HA 8CHOA 3S28A 3MG3A 1DMQA 1ROVA 4O8SA 3J7Yd 2OTL3 1N8R4 4HM3B 4OVMA 2OOVC 3N9HA 1TU5A 4CCVA 1IVUA 3NQZA 5AYRB 5JBSA 1YJN3 1F8NA 1OF5B 3GRDA 2CFKA 2K54A 4HVNA 3PZWA 1Y4KA 1OPYA 3G6E3 4JF8A 3WA2X 1YHQ3 3FZWA 1UUVB 1J2BA 3HIIA 2K0MA 3NV0A 4HM6B 1N5PA 3S29A 1W02A 3F9SA 1TFKA 1NO3A 1SIIA 2CW9A 2HMOB 1OACA 2Q07A 1W6CA 3JUOA 1QALA 4R9KA 2M7OA 4KFEA 3LTBA 3LTAA 3F8XA 1FGQA 2HMNB 1SPUA 4HM7B 2CFDA 3STDA 3E99A 3RGRA 3KZTA 1OGZA 1W2ZA 1L5GB 3FH1A 1E97A 1VZZA 2V1LA 2CG0A 2O9UX 3G8ZA 3EHCA 3CME3 2JQ5A 1QAFA 4K90B 3PCSA 4GL6A 1M1K4 3JUMA 1ULIB 1RJOA 2BT3A 2W56B 3O8YA 4RZMA 3MSOA 3SX1A 2XH9A 2W0QA 3VGNA 2CWTA 2LYXA 3ALAA 1IT8A 2CKFB 3BNCA 3EN1B 3KSED 2Z6BA 5ELUA 5JPUA 3NXJA 2O3OA 4GB5A 1KD14 3CMA3 3NBJA 3WDGB 4JRFA 5EVHA 5EEOA 3JUNA 3DY5A 1NJI4 1Q7Y4 3G4S3 1YJW3 1LVNA 1HKXA 3D3LA 1FGMA 5DRVA 3FKAA 4EXRA 1DVCA 3CCL3 1IDPA 3CPW2 3A76A 3ER7A 3T8UA 5JPPA 3F7SA 5LC7A 3UL6A 3CD63 3SVAA 4HM8B 5AEUB 5ELJA 3CU3A 4FMCA 3UNLA 4X2OA 3EBYA 1EQKA 1JN5B 1K28A 4ORLA 1GY5A 2F86B 2OCTA 4K1UA 5IW9A 4TX4A 1R4CA 2PZVA 3DGMA 4CDLA 1O7NB 1YJ93 4FMAA 2JDIH 4MMXB 1OCVA 1RKYA 3X3XA 2F99A 2GBXB 2ZDJA 3OWSA 1IQXA 1AV4A 4H3UA 1W4NA 4N6OB 3EJVA 1E3RA 2A15A 3CXC2 1K41A 3G713 4R1KA 3K5TA 4XBYA 3LMLA 2XRXB 4G1MB 2STDA 1VQO3 1A90A 3EC9A 4FR9A 3WOFB 2CIUA 3GZXB 1YGEA 3HX8A 4PEJA 1N5HA 2XR8B 3S5CA 3FCSB 1IVVA 1WTHA 1E3VA 2GXFA 5STDA 3EF8A 3EX9A 1MOLA 1W00A 3G0KA 2IUKA 1CYUA 2W9QA 4MMZB 1VQ83 3ROBA 1M904 2PNCA 3HZPA 4J8TA 3Q90A 2YX9A 2BMOB 3FF0A 2ZL8A 3CCM3 1QVF2 2INXA 2GEYA 3EBTA 2IMJA 1ZO2A 2RFRA 4N6V0 1CQSA 3QK9A 4EC6A 3PS8A 3F7XA 4BTWA 3L0RA 1PU4A 2WOHA 1N9EA 4XM4A 1GY6A 1VQL3 2I9WA 5AIIA 4O02B 4Q53A 3G16A 4WYKA 5CXOA 1STDA 2QEX3 2CWVA 1W6GA 3KIIA 2OOVA 1T5YA 1Q42A 2P0XA 3RDEA 1EKMA 3EB8A 5AI1A 3LYGA 3EE1A 1VQ43 1Q40B 2R4IA 4EYCA 5D83A 3CC23 2CFLA 2XGNA 2ML5A 1IVXA 2W03A 1WMNA 3FF2A 2W6JH 3WODG 4R4KA 4LZIA 2CH9A 2YFIB 3FG4A 5G2GA 2B1XB 2UX0A 1SIHA 1QAKA 1JRQA 3F14A 3AMOA 1C7HA 1D6YA 2YFJB 2CK3H 1Q824 4KFFA 3B8LA 1IV9A 4NREA 3V92A 3CCV3 1FUWA 1VQP3 2W2CA 1Z1SA 1RRHA 5HGRA 1W5ZA 3JUPA 2GU1A 1NB5I 5LC6A 4XDVA 3LT8A 1JNQA 1V74A 5AIHA 1VQN3 3JVCA 4L7KA 4HM2B 3FG3A 3CC73 2WGQA 4HZ9B 1IQYA 1ULJB 3MWZA 2IUJA 1HU9A 1OHOA 1M1XB 1FGOA 4XBTA 4OK0A 3U97A 2HMJB 3KN4A 3WMDA 1N8QA 3NV0B 3OW22 3VSYA 1IU7A 4IT7A 3CNMA 4N6MA 3N8BA 3OWUA 3IPTA 1N9JA 2Y73A 2QA43 5AIFA 4KVHA 3MG1A 5AYSC 3B4PA 5KP3A 3IJEB 3F40A 1RRLA 3BB9A 2MC8A 2FNQA 3IMAB 1U5OA 2RGQA 2XEPA 4I4KA 3X42A 2SBLA 2YFLB 3MYTA 6STDA 3KE7A 2E2VA 4FCMA 4FCJA 4HBRA 2C11A 1MNLA 2CFWA 2WGOA 2XFTA 3I0YA 4IPBA 5KP4A 1ZX2A 5A0OB 3LTDA 1W01A 1JB4A 1AVKA 3CC43 5CLKA 4FMDA 3BLZA 1IQ8A 4EV5A 1O7GB 3NUVA 3SLUA 5I97A 3HK4A 2P05A 3OXAA 3FGYA 5IENA 5IF6A 1JKGA 2RSXA 1O7PB 5KP1A 1TUHA 3NM2A 4N6UA 2B24B 1JB2A 2HMKB 1AVLA 3I563 4BTYA 1IV7A 4N6TA 3H51A 2C10A 3NM7A 4HKVB 3DM8A 3NHXA 4R80A 2P0MA 3CCR3 2FGTA 1U8CB 4L8PA 1K8A4 1QJGA 4FCZA 2HMMB 1OHPA 2Y74A 3EN8A 1OF5A 2XGLA 3DGOA 3FLJA 2RCDA 1M9GA 2Z76A 4EBGA 1EG9B 2QGUA 3OWYA 1DMMA 4KFDA 4HJLB 1TIJA 4HZBB 4K61A 5EQLA 5IERA 3WA3A 2BNGA 5IEPA 3N54B 1VQ93 2L4VA 3SEDA 2MF7A 4MEIA 1LOXA 2LQVA 3WOEB 2OWPA 1OHSA 1GD4A 4N6NB 3QRDA 5IG4A 3GAXA 4LGQA 4O2HA 2XFSA 4R9LA 1GD3A 3H3HA 1G96A 3K9MC 3X40A 2E2TA 3LOYA 4O3VA 1YIJ3 3DXOA 5D82A 3K63A 1WMPA 1O7MB 3LTCA 1FGRA 1VQ63 2CWUA 3KFQC 3Q2PA 3SOAA 1BUQA 3BNBA 5AEWB 1LNHA 1A2KA 1NDOB 2BMRB 3MKIA 3V99A 2KXGA 1ISKA 2XSOB 4XDWA 3T8NA 1YI23 3CCJ3 5CK6A 5DREA 2XSHB 2W56A 3DZLA 1PFPA 3UJMA 4L8OA 1GS3A 3LH4A 3OX9A 4RNYA 3OV4A 5CF1A 4HM5B 1DMNA 3CCU3 2CFGA 3LZAA 3K7CA 3DUKA 2CC3A 1S723 2QIYA 1NWWA 1O7WB 1WQLB 2GEXA 3BNEA 2BMQB 1JJ22 3MG2A 1UW1A 3GZBA 4RBNA 4EV2A 1GYBA 2HMLB 3X41A 1QMAA 3F8HA 2WO0A 3MPHA 1O7HB 3CCE3 3I553 1US1A 4WWUC 1VQ73 5CF2A 2KCDA 4WYKB 4NHFA 1A67A 3FSDA 1Q864 1FGTA 3DMCA 1OUNA 1JN5A 4AKYA 4MJDA 5TGNA 2IA7A 3M8CA 5AIGA 4WFOA 3T0UA 3V98A 1W2B2 1GY7A 2W9PA 1D6UA 2W04A 3HIGA 1NU3A 2Z7AA 1Q814 2CHCA 4XB5A 1JV2B 3DGLA 3ECFA 1KC84 1IVWA 1D6ZA 3NBBA 1A2VA 3TDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 3;  3CCM 3;  1QVF 2;  1M1K 4;  2OTJ 3;  1YI2 3;  1VQM 3;  3CCJ 3;  3CXC 2;  3I55 3;  3CC7 3;  3CCE 3;  3G71 3;  1VQ5 3;  1VQ7 3;  3CCR 3;  1YJN 3;  1QVG 2;  1VQO 3;  1VQK 3;  1K8A 4;  1KD1 4;  1VQL 3;  3CMA 3;  3CCQ 3;  1Q86 4;  1NJI 4;  3OW2 2;  1YIJ 3;  3G6E 3;  2QEX 3;  1YJ9 3;  3G4S 3;  3CCU 3;  1YJW 3;  1YHQ 3;  1Q7Y 4;  3CCS 3;  1W2B 2;  3CC4 3;  1VQ6 3;  1Q82 4;  3CCV 3;  1YIT 3;  1VQ4 3;  1S72 3;  1K9M 4;  2QA4 3;  1VQP 3;  1Q81 4;  1K73 4;  3CC2 3;  3CCL 3;  1KQS 2;  1VQ8 3;  3CPW 2;  1M90 4;  1KC8 4;  1JJ2 2;  3CME 3;  2OTL 3;  3CD6 3;  1N8R 4;  1VQ9 3;  1VQN 3; 
#chains in the Genus database with same CATH topology
 1B2X A;  1NB3 I;  4GHO A;  5BIR A;  1EEJ A;  2D42 A;  3X3Y A;  5FW5 A;  3B4O A;  1RGL A;  1RN7 A;  3CNX A;  2ML6 A;  3GZY B;  3UB1 A;  1VQM 3;  1S5A A;  4AEQ A;  2P09 A;  1TP6 A;  3AMO B;  2CG1 A;  4N6L A;  2CX1 A;  1IT7 A;  1FZU A;  3SOY A;  1BVI A;  1W6Y A;  3U1W A;  5BXQ A;  4MMY B;  4DKI A;  1OH0 A;  1TFO A;  2BHM A;  3DGN A;  2E2U A;  4U13 A;  4BTX A;  4RNZ A;  3CCS 3;  4STD A;  3S27 A;  1I0V A;  1BNR A;  1SJW A;  1UI8 A;  1MWT A;  7STD A;  1YIT 3;  4EW5 A;  4J5K A;  5FGO A;  3PXM A;  2F98 A;  1BNE A;  3CPO A;  3HI7 A;  1I8V A;  3D79 A;  4K1V A;  3HOH A;  1T2H A;  3B7C A;  3RGA A;  3A5E A;  3MHE A;  3GZR A;  5RNT A;  1STF I;  4ZM8 A;  1B3S A;  2BO9 B;  2KRT A;  3S67 A;  1MGR A;  4HM4 B;  5D81 A;  1VQ5 3;  1DYU A;  3UL5 A;  3NBR A;  1RGF A;  3Q1C A;  5IEO A;  1IK3 A;  1LQG C;  4J9A A;  3ZG0 A;  1QVG 2;  5STD A;  3ZFZ A;  1EA2 A;  5IG3 A;  3CCQ 3;  2D1W A;  2OQE C;  4KZ1 A;  3D9R A;  1ASK A;  1BAO A;  1WMO A;  2FXT A;  3LXU X;  3BND A;  3GWR A;  1UGH I;  3LT9 A;  1RN4 A;  4ILF A;  3VF1 A;  1FA3 A;  3EQQ B;  4HOH A;  1LXE A;  4WP5 A;  1K73 4;  2GBW B;  4HM0 B;  2BIR A;  1B2Z A;  4LMI A;  1C54 A;  1CYU A;  8RNT A;  1Q40 A;  3PCR A;  2OQE A;  1CYV A;  5IG5 A;  3PGB A;  1JB5 A;  1RCL A;  1KWI A;  3K0Z A;  4N3V A;  4QWT A;  3X3Z A;  1AR0 A;  2OTJ 3;  1GOV A;  4WHA A;  1SQW A;  3FG1 A;  1OGX A;  3NX0 A;  1LOV A;  4H61 A;  4HYZ A;  1UUW B;  1KSI A;  1RGG A;  1VQK 3;  4LSO A;  4HM1 B;  4AKZ A;  1WNH A;  5BVB A;  5IG0 A;  2P38 A;  1DVD A;  4FMB A;  4XBX A;  3SXX A;  3KKG A;  3AHS A;  2XF3 A;  3KSP A;  1JKG B;  2Z77 A;  4LEH A;  1K9M 4;  1W7C A;  1YVB I;  1UI7 A;  2GU3 A;  1CEW I;  3PYJ A;  2WOF A;  4OUQ A;  1KQS 2;  1UCJ A;  3JUQ A;  4IIA A;  1BSA A;  1ROA A;  2F56 A;  3NQY A;  4HAA A;  4X2H A;  8CHO A;  3S28 A;  1GMQ A;  3MG3 A;  1DMQ A;  1ROV A;  1YGW A;  4O8S A;  3J7Y d;  1N8R 4;  4HM3 B;  4OVM A;  2OTL 3;  2OOV C;  2HOH A;  3N9H A;  1TU5 A;  4CCV A;  2KF6 A;  1IVU A;  3NQZ A;  5AYR B;  5JBS A;  1RGA A;  1YJN 3;  1I3I A;  1F8N A;  1OF5 B;  3GRD A;  2CFK A;  2K54 A;  4HVN A;  3PZW A;  2AAD A;  1Y4K A;  4KT3 B;  1OPY A;  1MWS A;  3G6E 3;  1UGI A;  2RBI A;  4JF8 A;  3WA2 X;  1B2S A;  3FZW A;  1UUV B;  1YHQ 3;  1J2B A;  3HII A;  2K0M A;  3NV0 A;  4HM6 B;  1N5P A;  3S29 A;  6GSP A;  1W02 A;  3F9S A;  3DH2 A;  1TFK A;  1NO3 A;  1SII A;  2CW9 A;  7RNT A;  2HMO B;  1NNV A;  1OAC A;  2Q07 A;  1W6C A;  3JUO A;  1BRH A;  5M1A A;  1BIR A;  1QAL A;  1LNI A;  2M7O A;  4KFE A;  4R9K A;  3LTB A;  3LTA A;  3F8X A;  1FGQ A;  2HMN B;  1SPU A;  2H0H A;  5G1L A;  4HM7 B;  2CFD A;  3STD A;  3E99 A;  3RGR A;  3KZT A;  1OGZ A;  3KCH A;  1W2Z A;  1L5G B;  2AAE A;  3FH1 A;  4RNT A;  1E97 A;  2GSP A;  1VZZ A;  2V1L A;  2CG0 A;  2O9U X;  3D5I A;  3G8Z A;  3EHC A;  3CME 3;  2JQ5 A;  1QAF A;  4K90 B;  3PCS A;  4GL6 A;  1M1K 4;  3JUM A;  1ULI B;  1RJO A;  2BT3 A;  2C4B A;  2W56 B;  1AY7 A;  3O8Y A;  1I3F A;  4RZM A;  3MSO A;  3SX1 A;  3D4A A;  2XH9 A;  2W0Q A;  3VGN A;  2CWT A;  2LYX A;  3ALA A;  1IT8 A;  1BNJ A;  2CKF B;  3BNC A;  3EN1 B;  2Z6B A;  3KSE D;  5ELU A;  3NXJ A;  2O3O A;  4GB5 A;  5JPU A;  1KD1 4;  3NBJ A;  3WDG B;  4JRF A;  5EVH A;  5EEO A;  3CMA 3;  3JUN A;  1IYY A;  3DY5 A;  1NJI 4;  1X1W A;  1Q7Y 4;  4NPB A;  3G4S 3;  1YJW 3;  1LVN A;  1GMP A;  1RNT A;  1I2F A;  1HKX A;  1MWR A;  1SAR A;  1FGM A;  3D3L A;  3FKA A;  5DRV A;  4EXR A;  1DVC A;  3CCL 3;  1IDP A;  1LOY A;  3CPW 2;  1GSP A;  3A76 A;  3ER7 A;  1YNV X;  3T8U A;  5JPP A;  3F7S A;  5LC7 A;  1V57 A;  3UL6 A;  3CD6 3;  3SVA A;  4HM8 B;  1RMS A;  5AEU B;  5ELJ A;  3CU3 A;  4FMC A;  3UNL A;  1RCK A;  4X2O A;  3EBY A;  1EQK A;  1JN5 B;  1K28 A;  4ORL A;  4BL3 A;  1GY5 A;  2F86 B;  2F4Y A;  2OCT A;  1ZS7 A;  1B2U A;  4K1U A;  5IW9 A;  4TX4 A;  1R4C A;  1TTO A;  2H0I A;  2PZV A;  3DGM A;  4CDL A;  4CJN A;  1O7N B;  1YJ9 3;  4FMA A;  2JDI H;  4MMX B;  3SYU A;  1BSD A;  1OCV A;  1RKY A;  3X3X A;  2F99 A;  2GBX B;  1RTU A;  2K3D A;  2ZDJ A;  1FYS A;  3OWS A;  1IQX A;  3RNT A;  1AV4 A;  1I2G A;  4H3U A;  1W4N A;  4N6O B;  3EJV A;  1E3R A;  2A15 A;  3CXC 2;  1K41 A;  3G71 3;  4R1K A;  3K5T A;  4XBY A;  3LML A;  2XRX B;  4G1M B;  2STD A;  1VQO 3;  1A90 A;  1VQQ A;  3EC9 A;  4FR9 A;  3WOF B;  2CIU A;  3GZX B;  1YGE A;  3URP A;  3HX8 A;  1B20 A;  1FUT A;  2ZHX B;  4PEJ A;  1N5H A;  2XR8 B;  3S5C A;  3FCS B;  1I2E A;  1IVV A;  3Q3F A;  1WTH A;  1E3V A;  2GXF A;  2IYJ A;  3EF8 A;  3EX9 A;  1MOL A;  1BSB A;  1W00 A;  2IUK A;  3G0K A;  2W9Q A;  4MMZ B;  1VQ8 3;  1X1X A;  3ROB A;  5M19 A;  1M90 4;  2PNC A;  3HZP A;  4J8T A;  3Q90 A;  2YX9 A;  4GSP A;  2BMO B;  3FF0 A;  2ZL8 A;  3CCM 3;  1QVF 2;  2INX A;  2KAA A;  2GEY A;  3EBT A;  2IMJ A;  1ZO2 A;  1BRI A;  2RFR A;  4N6V 0;  1CQS A;  3QK9 A;  4EC6 A;  1V58 A;  3PS8 A;  2KF4 A;  3F7X A;  4BTW A;  3L0R A;  1PU4 A;  2WOH A;  1N9E A;  1BOX A;  1GY6 A;  4XM4 A;  2I9W A;  1VQL 3;  1YVS A;  3AGO A;  1Q7H A;  5AII A;  4O02 B;  4Q53 A;  3G16 A;  4WYK A;  5CXO A;  1STD A;  2QEX 3;  2CWV A;  1W6G A;  3KII A;  2OOV A;  1T5Y A;  1Q42 A;  2BU4 A;  2P0X A;  3RDE A;  1EKM A;  3EB8 A;  4LYL B;  5AI1 A;  3LYG A;  3EE1 A;  1VQ4 3;  1Q40 B;  2R4I A;  4EYC A;  5D83 A;  1LRA A;  3CC2 3;  1LOW A;  2CFL A;  1JZO A;  1BNG A;  2XGN A;  2ML5 A;  1IVX A;  2W03 A;  1BRJ A;  1WMN A;  1B27 A;  1UCK A;  3FF2 A;  2W6J H;  1BRN L;  3ZG5 A;  1B21 A;  3WOD G;  4R4K A;  4LZI A;  2CH9 A;  2YFI B;  3FG4 A;  1GOY A;  5G2G A;  1RSN A;  2B1X B;  2UX0 A;  1SIH A;  1QAK A;  1JRQ A;  3F14 A;  2H0G A;  3AMO A;  1C7H A;  1D6Y A;  1RLS A;  3D5G A;  2YFJ B;  2CK3 H;  1Q82 4;  4KFF A;  3B8L A;  1IV9 A;  4NRE A;  1RGE A;  3V92 A;  3CCV 3;  1FUW A;  1VQP 3;  2W2C A;  1Z1S A;  1RRH A;  1G0T A;  5HGR A;  1W5Z A;  3JUP A;  2GU1 A;  2UUG C;  1NB5 I;  5LC6 A;  4XDV A;  3LT8 A;  1JNQ A;  1V74 A;  5AIH A;  1VQN 3;  2KF3 A;  3JVC A;  1T2I A;  1FUS A;  1I0X A;  1BRG A;  4L7K A;  4HM2 B;  3FG3 A;  3CC7 3;  2WGQ A;  4HZ9 B;  1IQY A;  1ULJ B;  3MWZ A;  2F5M A;  2IUJ A;  1X1U A;  1HU9 A;  1OHO A;  1M1X B;  1FGO A;  4XBT A;  4OK0 A;  3U97 A;  2HMJ B;  3KN4 A;  1RHL A;  2SAR A;  3AHW A;  1N8Q A;  3WMD A;  3NV0 B;  3OW2 2;  3VSY A;  1IU7 A;  4J5G A;  4IT7 A;  3CNM A;  1RN1 A;  4N6M A;  3N8B A;  3OWU A;  3IPT A;  1N9J A;  5GSP A;  1PY3 A;  2Y73 A;  2QA4 3;  1BNF A;  4KVH A;  3MG1 A;  5AIF A;  5G1K A;  5AYS C;  3B4P A;  5KP3 A;  1RGK A;  2ZA4 A;  3IJE B;  2F5W A;  3F40 A;  1RRL A;  1UUG B;  3BB9 A;  2MC8 A;  3BU4 A;  2FNQ A;  1CH0 A;  3IMA B;  1U5O A;  2RGQ A;  2XEP A;  4I4K A;  3X42 A;  1JBT A;  2SBL A;  2YFL B;  3MYT A;  6STD A;  3KE7 A;  2E2V A;  4FCM A;  4FCJ A;  4HBR A;  2C11 A;  1MNL A;  2CFW A;  1BAN A;  2WGO A;  2XFT A;  3I0Y A;  4BIR A;  4IPB A;  5KP4 A;  1ZX2 A;  5A0O B;  3LTD A;  1W01 A;  1RGC A;  1JB4 A;  1AVK A;  3CC4 3;  5CLK A;  1HYF A;  3BLZ A;  4FMD A;  1HZ1 A;  1IQ8 A;  2R41 A;  4EV5 A;  1O7G B;  3NUV A;  1BNS A;  3SLU A;  5I97 A;  3HK4 A;  1AQZ A;  2P05 A;  3OXA A;  3FGY A;  1FW7 A;  1BGS A;  5IEN A;  5IF6 A;  5M18 A;  1JKG A;  1ZGX A;  2RSX A;  3WHO A;  1O7P B;  5KP1 A;  1TUH A;  3NM2 A;  4N6U A;  2B24 B;  1JB2 A;  2HMK B;  1G02 A;  1AVL A;  1RNB A;  3I56 3;  4BTY A;  1IV7 A;  4N6T A;  3H51 A;  2C10 A;  1BU4 A;  2L1S A;  3NM7 A;  4HKV B;  3DM8 A;  3NHX A;  4R80 A;  2P0M A;  3CCR 3;  1RDS A;  1JZD A;  1U8C B;  2FGT A;  1BSC A;  4L8P A;  1QJG A;  4FCZ A;  1K8A 4;  1DE3 A;  2HMM B;  1OHP A;  2Y74 A;  3EN8 A;  3WR2 A;  1OF5 A;  2XGL A;  3DGO A;  3FLJ A;  2RCD A;  1M9G A;  2Z76 A;  4EBG A;  1EG9 B;  2QGU A;  3OWY A;  1DMM A;  4KFD A;  4HJL B;  1TIJ A;  2KF5 A;  4HZB B;  2CX0 A;  5BU4 A;  4K61 A;  9RNT A;  5EQL A;  5IER A;  3WA3 A;  5HOH A;  1MGW A;  2BNG A;  5IEP A;  3N54 B;  1VQ9 3;  2L4V A;  3BIR A;  2J8X B;  2MF7 A;  4MEI A;  3SED A;  1MWU A;  1LOX A;  2LQV A;  3WOE B;  2OWP A;  1BRS A;  1OHS A;  2IY2 A;  1GD4 A;  4N6N B;  3QRD A;  5IG4 A;  3GAX A;  4LGQ A;  4O2H A;  2XFS A;  1BNI A;  1TRP A;  4R9L A;  1GD3 A;  3H3H A;  1G96 A;  3K9M C;  3X40 A;  2E2T A;  3LOY A;  4O3V A;  1YIJ 3;  3DXO A;  5D82 A;  1BRK A;  3K63 A;  1WMP A;  1O7M B;  3LTC A;  1FGR A;  1VQ6 3;  2CWU A;  3KFQ C;  3Q2P A;  3SOA A;  1BUQ A;  3BNB A;  5AEW B;  1LNH A;  1A2P A;  1A2K A;  1B2M A;  1NDO B;  2RNT A;  2BMR B;  3MKI A;  3V99 A;  2KXG A;  1ISK A;  2XSO B;  4XDW A;  1X1Y A;  3T8N A;  1YI2 3;  3CCJ 3;  5CK6 A;  1JBR A;  1R4Y A;  5DRE A;  2XSH B;  2W56 A;  3DZL A;  1PFP A;  3UJM A;  4L8O A;  1JBS A;  1GS3 A;  3LH4 A;  3OX9 A;  4RNY A;  3OV4 A;  5CF1 A;  4HM5 B;  1DET A;  1DMN A;  4CPK A;  3CCU 3;  2CFG A;  3LZA A;  3K7C A;  3DUK A;  1RGH A;  2CC3 A;  1S72 3;  2QIY A;  1NWW A;  1Q9E A;  1O7W B;  1WQL B;  1I70 A;  4I5Q A;  2GEX A;  1BUJ A;  3BNE A;  1EUI C;  2BMQ B;  1JJ2 2;  1T3B A;  1PYL A;  1UCI A;  3MG2 A;  1UCL A;  1UW1 A;  3GZB A;  4RBN A;  1GYB A;  4EV2 A;  2HML B;  3X41 A;  1QMA A;  3AGN A;  2WO0 A;  3F8H A;  3MPH A;  4BL2 A;  1O7H B;  3CCE 3;  1LQM B;  3I55 3;  1US1 A;  4WWU C;  1VQ7 3;  5CF2 A;  2KCD A;  4WYK B;  1GMR A;  1TJD A;  2UGI A;  4NHF A;  1A67 A;  3FSD A;  1Q86 4;  1FGT A;  1GOU A;  1OUN A;  3DMC A;  1JN5 A;  1TRQ A;  4AKY A;  4MJD A;  5TGN A;  3GSP A;  2IA7 A;  3M8C A;  5AIG A;  4WFO A;  3T0U A;  3V98 A;  4BU4 A;  1W2B 2;  1GY7 A;  2W9P A;  1D6U A;  1UDI I;  2W04 A;  3HIG A;  1NU3 A;  7GSP A;  2Z7A A;  1Q81 4;  2CHC A;  4XB5 A;  1JV2 B;  3DGL A;  3ECF A;  1KC8 4;  1IVW A;  1D6Z A;  3NBB A;  1A2V A;  3DGY A;  6RNT A;  3TDG A;  1BSE A; 
#chains in the Genus database with same CATH homology
 1NB3 I;  2D42 A;  3X3Y A;  5FW5 A;  3B4O A;  1RN7 A;  3CNX A;  3GZY B;  2ML6 A;  3UB1 A;  1VQM 3;  1S5A A;  4AEQ A;  2P09 A;  1TP6 A;  3AMO B;  2CG1 A;  4N6L A;  1IT7 A;  3SOY A;  1W6Y A;  3U1W A;  5BXQ A;  4MMY B;  1OH0 A;  1TFO A;  2BHM A;  3DGN A;  2E2U A;  4U13 A;  4BTX A;  4RNZ A;  3CCS 3;  4STD A;  3S27 A;  1SJW A;  1UI8 A;  7STD A;  1YIT 3;  5FGO A;  3PXM A;  2F98 A;  3HI7 A;  3CPO A;  4K1V A;  3B7C A;  3RGA A;  3MHE A;  3GZR A;  1STF I;  4ZM8 A;  2BO9 B;  2KRT A;  3S67 A;  4HM4 B;  5D81 A;  1VQ5 3;  1DYU A;  3UL5 A;  3NBR A;  3Q1C A;  5IEO A;  1IK3 A;  1QVG 2;  4J9A A;  1EA2 A;  5IG3 A;  3CCQ 3;  2D1W A;  2OQE C;  4KZ1 A;  3D9R A;  1ASK A;  1WMO A;  2FXT A;  3LXU X;  3BND A;  3GWR A;  3LT9 A;  3VF1 A;  1FA3 A;  3EQQ B;  1K73 4;  1LXE A;  4WP5 A;  2GBW B;  4HM0 B;  4LMI A;  1Q40 A;  3PCR A;  2OQE A;  1CYV A;  5IG5 A;  3PGB A;  1JB5 A;  4N3V A;  1KWI A;  3K0Z A;  4QWT A;  3X3Z A;  2OTJ 3;  1AR0 A;  4WHA A;  1SQW A;  3FG1 A;  1OGX A;  3NX0 A;  4H61 A;  4HYZ A;  1UUW B;  1KSI A;  1VQK 3;  4LSO A;  4HM1 B;  4AKZ A;  1WNH A;  5BVB A;  5IG0 A;  2P38 A;  1DVD A;  4FMB A;  4XBX A;  3SXX A;  3KKG A;  2XF3 A;  3KSP A;  1JKG B;  2Z77 A;  4LEH A;  1K9M 4;  1W7C A;  1YVB I;  1UI7 A;  2GU3 A;  1CEW I;  3PYJ A;  2WOF A;  4OUQ A;  1KQS 2;  3JUQ A;  4IIA A;  1ROA A;  3NQY A;  4X2H A;  8CHO A;  3S28 A;  3MG3 A;  1DMQ A;  1ROV A;  4O8S A;  3J7Y d;  2OTL 3;  1N8R 4;  4HM3 B;  4OVM A;  2OOV C;  3N9H A;  1TU5 A;  4CCV A;  1IVU A;  3NQZ A;  5AYR B;  5JBS A;  1YJN 3;  1F8N A;  1OF5 B;  3GRD A;  2CFK A;  2K54 A;  4HVN A;  3PZW A;  1Y4K A;  1OPY A;  3G6E 3;  4JF8 A;  3WA2 X;  1YHQ 3;  3FZW A;  1UUV B;  1J2B A;  3HII A;  2K0M A;  3NV0 A;  4HM6 B;  1N5P A;  3S29 A;  1W02 A;  3F9S A;  1TFK A;  1NO3 A;  1SII A;  2CW9 A;  2HMO B;  1OAC A;  2Q07 A;  1W6C A;  3JUO A;  1QAL A;  4R9K A;  2M7O A;  4KFE A;  3LTB A;  3LTA A;  3F8X A;  1FGQ A;  2HMN B;  1SPU A;  4HM7 B;  2CFD A;  3STD A;  3E99 A;  3RGR A;  3KZT A;  1OGZ A;  1W2Z A;  1L5G B;  3FH1 A;  1E97 A;  1VZZ A;  2V1L A;  2CG0 A;  2O9U X;  3G8Z A;  3EHC A;  3CME 3;  2JQ5 A;  1QAF A;  4K90 B;  3PCS A;  4GL6 A;  1M1K 4;  3JUM A;  1ULI B;  1RJO A;  2BT3 A;  2W56 B;  3O8Y A;  4RZM A;  3MSO A;  3SX1 A;  2XH9 A;  2W0Q A;  3VGN A;  2CWT A;  2LYX A;  3ALA A;  1IT8 A;  2CKF B;  3BNC A;  3EN1 B;  3KSE D;  2Z6B A;  5ELU A;  5JPU A;  3NXJ A;  2O3O A;  4GB5 A;  1KD1 4;  3CMA 3;  3NBJ A;  3WDG B;  4JRF A;  5EVH A;  5EEO A;  3JUN A;  3DY5 A;  1NJI 4;  1Q7Y 4;  3G4S 3;  1YJW 3;  1LVN A;  1HKX A;  3D3L A;  1FGM A;  5DRV A;  3FKA A;  4EXR A;  1DVC A;  3CCL 3;  1IDP A;  3CPW 2;  3A76 A;  3ER7 A;  3T8U A;  5JPP A;  3F7S A;  5LC7 A;  3UL6 A;  3CD6 3;  3SVA A;  4HM8 B;  5AEU B;  5ELJ A;  3CU3 A;  4FMC A;  3UNL A;  4X2O A;  3EBY A;  1EQK A;  1JN5 B;  1K28 A;  4ORL A;  1GY5 A;  2F86 B;  2OCT A;  4K1U A;  5IW9 A;  4TX4 A;  1R4C A;  2PZV A;  3DGM A;  4CDL A;  1O7N B;  1YJ9 3;  4FMA A;  2JDI H;  4MMX B;  1OCV A;  1RKY A;  3X3X A;  2F99 A;  2GBX B;  2ZDJ A;  3OWS A;  1IQX A;  1AV4 A;  4H3U A;  1W4N A;  4N6O B;  3EJV A;  1E3R A;  2A15 A;  3CXC 2;  1K41 A;  3G71 3;  4R1K A;  3K5T A;  4XBY A;  3LML A;  2XRX B;  4G1M B;  2STD A;  1VQO 3;  1A90 A;  3EC9 A;  4FR9 A;  3WOF B;  2CIU A;  3GZX B;  1YGE A;  3HX8 A;  4PEJ A;  1N5H A;  2XR8 B;  3S5C A;  3FCS B;  1IVV A;  1WTH A;  1E3V A;  2GXF A;  5STD A;  3EF8 A;  3EX9 A;  1MOL A;  1W00 A;  3G0K A;  2IUK A;  1CYU A;  2W9Q A;  4MMZ B;  1VQ8 3;  3ROB A;  1M90 4;  2PNC A;  3HZP A;  4J8T A;  3Q90 A;  2YX9 A;  2BMO B;  3FF0 A;  2ZL8 A;  3CCM 3;  1QVF 2;  2INX A;  2GEY A;  3EBT A;  2IMJ A;  1ZO2 A;  2RFR A;  4N6V 0;  1CQS A;  3QK9 A;  4EC6 A;  3PS8 A;  3F7X A;  4BTW A;  3L0R A;  1PU4 A;  2WOH A;  1N9E A;  4XM4 A;  1GY6 A;  1VQL 3;  2I9W A;  5AII A;  4O02 B;  4Q53 A;  3G16 A;  4WYK A;  5CXO A;  1STD A;  2QEX 3;  2CWV A;  1W6G A;  3KII A;  2OOV A;  1T5Y A;  1Q42 A;  2P0X A;  3RDE A;  1EKM A;  3EB8 A;  5AI1 A;  3LYG A;  3EE1 A;  1VQ4 3;  1Q40 B;  2R4I A;  4EYC A;  5D83 A;  3CC2 3;  2CFL A;  2XGN A;  2ML5 A;  1IVX A;  2W03 A;  1WMN A;  3FF2 A;  2W6J H;  3WOD G;  4R4K A;  4LZI A;  2CH9 A;  2YFI B;  3FG4 A;  5G2G A;  2B1X B;  2UX0 A;  1SIH A;  1QAK A;  1JRQ A;  3F14 A;  3AMO A;  1C7H A;  1D6Y A;  2YFJ B;  2CK3 H;  1Q82 4;  4KFF A;  3B8L A;  1IV9 A;  4NRE A;  3V92 A;  3CCV 3;  1FUW A;  1VQP 3;  2W2C A;  1Z1S A;  1RRH A;  5HGR A;  1W5Z A;  3JUP A;  2GU1 A;  1NB5 I;  5LC6 A;  4XDV A;  3LT8 A;  1JNQ A;  1V74 A;  5AIH A;  1VQN 3;  3JVC A;  4L7K A;  4HM2 B;  3FG3 A;  3CC7 3;  2WGQ A;  4HZ9 B;  1IQY A;  1ULJ B;  3MWZ A;  2IUJ A;  1HU9 A;  1OHO A;  1M1X B;  1FGO A;  4XBT A;  4OK0 A;  3U97 A;  2HMJ B;  3KN4 A;  3WMD A;  1N8Q A;  3NV0 B;  3OW2 2;  3VSY A;  1IU7 A;  4IT7 A;  3CNM A;  4N6M A;  3N8B A;  3OWU A;  3IPT A;  1N9J A;  2Y73 A;  2QA4 3;  5AIF A;  4KVH A;  3MG1 A;  5AYS C;  3B4P A;  5KP3 A;  3IJE B;  3F40 A;  1RRL A;  3BB9 A;  2MC8 A;  2FNQ A;  3IMA B;  1U5O A;  2RGQ A;  2XEP A;  4I4K A;  3X42 A;  2SBL A;  2YFL B;  3MYT A;  6STD A;  3KE7 A;  2E2V A;  4FCM A;  4FCJ A;  4HBR A;  2C11 A;  1MNL A;  2CFW A;  2WGO A;  2XFT A;  3I0Y A;  4IPB A;  5KP4 A;  1ZX2 A;  5A0O B;  3LTD A;  1W01 A;  1JB4 A;  1AVK A;  3CC4 3;  5CLK A;  4FMD A;  3BLZ A;  1IQ8 A;  4EV5 A;  1O7G B;  3NUV A;  3SLU A;  5I97 A;  3HK4 A;  2P05 A;  3OXA A;  3FGY A;  5IEN A;  5IF6 A;  1JKG A;  2RSX A;  1O7P B;  5KP1 A;  1TUH A;  3NM2 A;  4N6U A;  2B24 B;  1JB2 A;  2HMK B;  1AVL A;  3I56 3;  4BTY A;  1IV7 A;  4N6T A;  3H51 A;  2C10 A;  3NM7 A;  4HKV B;  3DM8 A;  3NHX A;  4R80 A;  2P0M A;  3CCR 3;  2FGT A;  1U8C B;  4L8P A;  1K8A 4;  1QJG A;  4FCZ A;  2HMM B;  1OHP A;  2Y74 A;  3EN8 A;  1OF5 A;  2XGL A;  3DGO A;  3FLJ A;  2RCD A;  1M9G A;  2Z76 A;  4EBG A;  1EG9 B;  2QGU A;  3OWY A;  1DMM A;  4KFD A;  4HJL B;  1TIJ A;  4HZB B;  4K61 A;  5EQL A;  5IER A;  3WA3 A;  2BNG A;  5IEP A;  3N54 B;  1VQ9 3;  2L4V A;  3SED A;  2MF7 A;  4MEI A;  1LOX A;  2LQV A;  3WOE B;  2OWP A;  1OHS A;  1GD4 A;  4N6N B;  3QRD A;  5IG4 A;  3GAX A;  4LGQ A;  4O2H A;  2XFS A;  4R9L A;  1GD3 A;  3H3H A;  1G96 A;  3K9M C;  3X40 A;  2E2T A;  3LOY A;  4O3V A;  1YIJ 3;  3DXO A;  5D82 A;  3K63 A;  1WMP A;  1O7M B;  3LTC A;  1FGR A;  1VQ6 3;  2CWU A;  3KFQ C;  3Q2P A;  3SOA A;  1BUQ A;  3BNB A;  5AEW B;  1LNH A;  1A2K A;  1NDO B;  2BMR B;  3MKI A;  3V99 A;  2KXG A;  1ISK A;  2XSO B;  4XDW A;  3T8N A;  1YI2 3;  3CCJ 3;  5CK6 A;  5DRE A;  2XSH B;  2W56 A;  3DZL A;  1PFP A;  3UJM A;  4L8O A;  1GS3 A;  3LH4 A;  3OX9 A;  4RNY A;  3OV4 A;  5CF1 A;  4HM5 B;  1DMN A;  3CCU 3;  2CFG A;  3LZA A;  3K7C A;  3DUK A;  2CC3 A;  1S72 3;  2QIY A;  1NWW A;  1O7W B;  1WQL B;  2GEX A;  3BNE A;  2BMQ B;  1JJ2 2;  3MG2 A;  1UW1 A;  3GZB A;  4RBN A;  4EV2 A;  1GYB A;  2HML B;  3X41 A;  1QMA A;  3F8H A;  2WO0 A;  3MPH A;  1O7H B;  3CCE 3;  3I55 3;  1US1 A;  4WWU C;  1VQ7 3;  5CF2 A;  2KCD A;  4WYK B;  4NHF A;  1A67 A;  3FSD A;  1Q86 4;  1FGT A;  3DMC A;  1OUN A;  1JN5 A;  4AKY A;  4MJD A;  5TGN A;  2IA7 A;  3M8C A;  5AIG A;  4WFO A;  3T0U A;  3V98 A;  1W2B 2;  1GY7 A;  2W9P A;  1D6U A;  2W04 A;  3HIG A;  1NU3 A;  2Z7A A;  1Q81 4;  2CHC A;  4XB5 A;  1JV2 B;  3DGL A;  3ECF A;  1KC8 4;  1IVW A;  1D6Z A;  3NBB A;  1A2V A;  3TDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...