1Q824

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q82400
1VQ63 1K734 2OTL3 1VQ73 3CCV3 1YI23 1VQ43 3CCL3 3CCR3 3I553 1NJI4 1K8A4 1VQ53 1Q864 1QVG2 1K9M4 1KD14 3CME3 1VQK3 3CCJ3 1Q824 1YJN3 1W2B2 3CC23 1YIT3 1KQS2 2OTJ3 1YHQ3 1M904 1VQL3 3CCS3 1Q814 3CCE3 1N8R4 1S723 1VQ83 1VQN3 3CC73 1YJ93 3CMA3 3CXC2 3G713 2QEX3 3CCM3 1JJ22 3CC43 1QVF2 3OW22 3G6E3 1VQO3 3CCU3 1VQ93 2QA43 3I563 3CCQ3 3G4S3 1YIJ3 1KC84 1M1K4 3CD63 1VQP3 1Q7Y4 1VQM3 1YJW3 3CPW2
chains in the Genus database with same CATH superfamily
1PYLA 1K734 2INXA 3FG4A 1BU4A 5AIIA 3EN1B 1B2UA 2P0XA 2KF3A 3MG1A 1RGFA 3B7CA 1T5YA 4MJDA 3NV0A 4N6LA 1A2VA 1LOWA 2SARA 4NPBA 1EA2A 1C54A 3NUVA 3NXJA 2CX1A 3F8XA 3WMDA 1ZGXA 1Y4KA 5HGRA 4K61A 3RDEA 5TGNA 2D42A 3EHCA 3CC73 3BU4A 1STDA 1JJ22 5FW5A 3MG3A 1VZZA 1OGXA 5M1AA 4KVHA 1W02A 3Q90A 5ELUA 2XH9A 1YIJ3 2Y73A 1M1K4 1D6YA 4CJNA 1YGEA 2HOHA 2YFJB 4J5GA 4GB5A 1VQ73 1GSPA 5LC6A 1BAOA 1IVUA 1DMMA 3LZAA 1IT8A 3UL6A 1FA3A 1YGWA 1T3BA 1YVBI 5AIFA 2RNTA 4J8TA 3MPHA 1NU3A 3U97A 2Z7AA 1S5AA 3F40A 1BNFA 1IV9A 1K28A 1BVIA 1TIJA 2WOHA 3EBTA 3EF8A 3KN4A 1BNIA 2W9PA 3FLJA 4N6MA 4LEHA 1LOXA 3V98A 3CCJ3 3SX1A 1DMQA 1OH0A 4WFOA 1YHQ3 5HOHA 1BNJA 1UGHI 2BO9B 1OHSA 1JNQA 1N8R4 1MOLA 2QGUA 3CNMA 1ISKA 1MGWA 2ZDJA 3ECFA 3CCM3 1TP6A 4LYLB 1IU7A 1B27A 3X3ZA 1FGQA 1ZX2A 3H51A 4FMCA 3S29A 1OGZA 3LT8A 1O7GB 4N6OB 5G2GA 1CYVA 1IDPA 2L4VA 1LNHA 4H3UA 3NV0B 1RCKA 1PY3A 1WTHA 3DXOA 1WMPA 2GU1A 3D4AA 3WDGB 3LOYA 1MWUA 3I553 1F8NA 3IPTA 1R4YA 5STDA 4EC6A 1CH0A 3UL5A 5ELJA 1GOYA 4EW5A 4BTWA 3G16A 1FUSA 4HBRA 4J9AA 1KQS2 3JVCA 3FH1A 3AMOA 3L0RA 3N9HA 3D79A 1RN7A 2PNCA 1GMQA 4O2HA 1UUVB 1W2ZA 1TJDA 1UCKA 1V58A 1X1YA 1RGAA 3QRDA 3IJEB 1JN5A 2BMOB 1UW1A 1EG9B 1D6UA 3K63A 1GY7A 1V57A 3VF1A 3CCQ3 3DM8A 3PCRA 2XFTA 2XSHB 4IIAA 1NDOB 2W6JH 2J8XB 1VQM3 3GZRA 2OTL3 2P0MA 4XBTA 3K7CA 1JZDA 1NWWA 4O02B 1SPUA 4HM0B 5AYRB 5IF6A 4EYCA 3BNEA 5G1KA 4I5QA 3EQQB 2KRTA 3FCSB 3EE1A 4N6UA 4L8OA 1JB5A 1YJN3 1AQZA 1BRNL 3WOEB 1D6ZA 3K9MC 2HMJB 2XGLA 3SVAA 5BVBA 5JPUA 1RJOA 3PS8A 4R9LA 3LTBA 3NBJA 1AY7A 1IT7A 2QEX3 2GU3A 4N6NB 4FCZA 1W01A 2FXTA 2P09A 1FGRA 1Q42A 2KF6A 1Q40A 4LGQA 3CNXA 5IEPA 2FNQA 1JV2B 2RCDA 4HVNA 3J7Yd 2E2VA 3H3HA 1U5OA 1R4CA 3M8CA 2XFSA 5BU4A 3T0UA 3AMOB 2ML5A 1QMAA 1LOVA 4ILFA 1RN1A 4ZM8A 1RKYA 3AGOA 4XDWA 2MC8A 3SLUA 3F14A 1Q9EA 3NQYA 1Q824 1SQWA 4JRFA 2WGQA 1JKGA 2CHCA 3SXXA 1JZOA 1GMPA 4STDA 1W7CA 1NO3A 3ZFZA 3EX9A 1RTUA 2Y74A 2F5WA 4FCJA 4ORLA 1QAFA 4RBNA 1IVXA 2C11A 2F98A 2K0MA 1E97A 1BNSA 2YFLB 3G8ZA 4O8SA 4AEQA 3FKAA 4LZIA 2CG0A 5IERA 1O7PB 3HZPA 3N8BA 1VQP3 4RNYA 1RCLA 2GBXB 1BSDA 3A5EA 2UX0A 3D5IA 5CF2A 3X3XA 6GSPA 3RGAA 1I0VA 3B4PA 4EBGA 3AGNA 1T2HA 2HMKB 2CFGA 1B2SA 2CFDA 3S27A 5LC7A 4BL2A 1G0TA 1LNIA 2O3OA 1RGKA 3DZLA 3HX8A 3RNTA 1Q7HA 5CF1A 4GHOA 2HMNB 1OF5B 2CH9A 5IG3A 4XB5A 3GAXA 1X1UA 3BNBA 3CC43 1IVVA 1M9GA 1BUQA 2Z76A 5IG0A 3EB8A 2IUJA 3AHWA 4CCVA 1T2IA 3N54B 3S5CA 1A67A 3MKIA 1FGTA 2OOVC 1IQYA 2OQEC 2KXGA 3TDGA 5G1LA 1YJW3 4HKVB 3LTDA 3KCHA 1JRQA 2KF4A 1ZO2A 1VQ43 1N8QA 1HZ1A 4G1MB 5DREA 1BSAA 2OCTA 1HKXA 3PYJA 4OK0A 4HM1B 2OQEA 2OOVA 2XGNA 1CQSA 1W6GA 1JBRA 1BRHA 1RN4A 4FMDA 4H61A 2RGQA 3CME3 1I8VA 1JBSA 1UI8A 2W56A 1TFOA 1MWTA 2C10A 2F4YA 2JDIH 4HM2B 1AVKA 5D82A 3CU3A 1QAKA 1SIHA 3VSYA 3RGRA 8RNTA 3DGYA 1W4NA 1IQXA 2BU4A 3G6E3 5IENA 1O7MB 2Z6BA 4BIRA 2CFKA 5IW9A 4XBXA 3D5GA 1TRQA 1KSIA 1STFI 1LOYA 2V1LA 4RNTA 3GWRA 4K1VA 1YVSA 1JN5B 4CPKA 3MHEA 1KC84 1BGSA 2YX9A 1X1XA 3PGBA 4HM8B 1OCVA 2FGTA 1FZUA 4DKIA 1U8CB 4AKZA 1W00A 5AYSC 2Z77A 3X3YA 5EEOA 5CXOA 1ULJB 1B2ZA 1RGLA 2F86B 2CFWA 3HIGA 1Q864 2F99A 2GSPA 3LH4A 1BSBA 3NM7A 3ZG0A 1I0XA 1MWRA 2CWTA 2W2CA 3NBBA 1EUIC 3EC9A 4KZ1A 4XM4A 1YIT3 5IEOA 1W2B2 5AIHA 3FGYA 3HOHA 4HM3B 3OWUA 3SOAA 3CCS3 3DGOA 5CK6A 2XRXB 3K5TA 8CHOA 4KFDA 3DGLA 1SARA 3CXC2 1PFPA 3WR2A 4EXRA 1US1A 1RGEA 4O3VA 3F8HA 2CW9A 2QIYA 4XDVA 4MMZB 1Q7Y4 2WGOA 3WA2X 5JBSA 4OUQA 1MGRA 3LTCA 2YFIB 1WMNA 3JUQA 2W56B 1UDII 4MMYB 3CCR3 1CEWI 6RNTA 2CC3A 3DUKA 2RFRA 3GZYB 3B4OA 3I0YA 4TX4A 2XF3A 2IMJA 3GZBA 1LXEA 3V92A 4BTXA 3KZTA 3UB1A 3CC23 1IQ8A 1UI7A 3JUPA 4R80A 3DMCA 3LXUX 3OWSA 3JUNA 2MF7A 3NX0A 3ROBA 4HM7B 3EBYA 2HMLB 1RGHA 2CK3H 5JPPA 1GMRA 5A0OB 1OHOA 2E2UA 4HZBB 1W6YA 1W5ZA 2P38A 2GEYA 2BMRB 1GYBA 2IUKA 1BOXA 2BMQB 5M19A 1QJGA 1MWSA 3UNLA 4K1UA 3CCL3 1V74A 1JB4A 1RLSA 2RBIA 2C4BA 1LQGC 1O7HB 2IA7A 2R4IA 3IMAB 1CYUA 1VQ53 1ROAA 1X1WA 4MMXB 2KAAA 4KFEA 4RZMA 4WHAA 1N5PA 2CKFB 3O8YA 2KF5A 1RNBA 2H0HA 1FUTA 2OTJ3 3OXAA 1TU5A 3BB9A 3QK9A 3CCE3 1WMOA 1AVLA 1OF5A 1IYYA 3OW22 1RNTA 1BUJA 1UUGB 3HK4A 5BIRA 3VGNA 2CWUA 2CFLA 3G4S3 1WNHA 2XSOB 4HAAA 3EJVA 1BNEA 2P05A 4N3VA 4N6V0 1DMNA 1YNVX 3Q2PA 2JQ5A 3FF2A 4HZ9B 3ER7A 3G0KA 1NJI4 1K8A4 1G96A 4NHFA 3UJMA 2XEPA 1QVG2 1I2FA 2CG1A 3SEDA 4N6TA 4R4KA 5D81A 2IY2A 2D1WA 1E3VA 3BIRA 1TRPA 2LQVA 3WHOA 2Q07A 3OV4A 2GXFA 4QWTA 3CMA3 1ZS7A 4HYZA 1K41A 5GSPA 5BXQA 1EEJA 3WA3A 3CCU3 1TFKA 1WQLB 4K90B 4CDLA 1RDSA 2RSXA 7GSPA 2W0QA 1GOUA 4X2OA 1AR0A 1OPYA 1UCLA 4R1KA 4JF8A 1B21A 5CLKA 4GSPA 1IVWA 3CPW2 4FCMA 4EV2A 1BANA 4BL3A 1LRAA 3LTAA 1J2BA 2IYJA 4KT3B 1W6CA 1MNLA 3GSPA 1DVDA 3B8LA 4BU4A 1BRSA 5RNTA 2AADA 3CPOA 3MG2A 3OWYA 5FGOA 6STDA 4L7KA 1EQKA 1LQMB 3MSOA 3V99A 1EKMA 1NNVA 1GY6A 5AEUB 3HIIA 3KSPA 1QVF2 1I2EA 1VQO3 3T8NA 3F9SA 4WYKA 1ASKA 2F5MA 2QA43 3E99A 4WWUC 1BSEA 1RRHA 1A90A 3FG3A 1GY5A 2K54A 5IG4A 2O9UX 1RSNA 2WOFA 3HI7A 4L8PA 1E3RA 3BNDA 3FG1A 3WODG 1BNGA 4FR9A 5AI1A 2BT3A 2H0IA 2ZL8A 4J5KA 3WOFB 2CWVA 5I97A 5IG5A 1PU4A 1IV7A 1OUNA 3K0ZA 1RGGA 1I2GA 3FF0A 4IPBA 1JKGB 3BLZA 1NB3I 1M1XB 4HOHA 2F56A 1M904 4HM4B 5EQLA 3OX9A 3Q1CA 1BSCA 3JUMA 1SIIA 2BHMA 1YJ93 3SYUA 1RRLA 5AEWB 3F7XA 1SJWA 1JBTA 1VQ93 2BNGA 3CD63 1ROVA 4HJLB 2CIUA 2STDA 3JUOA 7STDA 1VQ63 2H0GA 3CCV3 1DE3A 4FMBA 2UUGC 2WO0A 3FZWA 3X40A 3NQZA 1DETA 2CX0A 3S67A 1K9M4 1KD14 4HM5B 1C7HA 4Q53A 1FYSA 3A76A 2GBWB 1I3IA 3ZG5A 1O7NB 1TTOA 3NHXA 5M18A 4IT7A 4XBYA 1RGCA 2UGIA 1Q814 1DVCA 5KP3A 1VQ83 2ZHXB 1IK3A 1VQN3 3URPA 2GEXA 4MEIA 1FUWA 3Q3FA 2PZVA 3KE7A 1QALA 3PZWA 1FGOA 1UCJA 1N5HA 4FMAA 4U13A 1L5GB 2BIRA 2K3DA 1VQQA 2AAEA 3U1WA 3D9RA 3GZXB 4GL6A 1N9EA 4LMIA 1BRIA 3BNCA 3MWZA 1BRJA 1YI23 3KFQC 2A15A 1FW7A 5AIGA 1ULIB 2ZA4A 3KSED 2W04A 4RNZA 4WP5A 2R41A 9RNTA 1B20A 1G02A 3FSDA 2E2TA 3NM2A 2HMMB 1VQK3 3ALAA 1O7WB 4LSOA 1AV4A 2M7OA 3PCSA 1BNRA 3S28A 3GRDA 3X42A 2XR8B 1I70A 3EN8A 4R9KA 1NB5I 7RNTA 1VQL3 2W03A 2B1XB 1GOVA 1DYUA 1RHLA 2I9WA 1OHPA 1LVNA 2OWPA 2HMOB 1B2MA 3DH2A 1BRGA 4AKYA 1B2XA 1HYFA 2LYXA 4PEJA 2B24B 1B3SA 3DGMA 3X41A 1BRKA 2W9QA 3LMLA 1N9JA 1A2PA 5D83A 3SOYA 4KFFA 3D3LA 1I3FA 4I4KA 1FGMA 3DY5A 2KCDA 3MYTA 1HU9A 1GD4A 4OVMA 1JB2A 4BTYA 1OACA 1UUWB 2L1SA 5DRVA 4X2HA 1TUHA 3AHSA 3F7SA 3LT9A 1GD3A 1RMSA 1S723 3PXMA 5EVHA 3NBRA 3KKGA 3G713 3T8UA 4HM6B 1Q40B 3DGNA 4EV5A 2SBLA 1Z1SA 3STDA 3LYGA 5KP1A 3KIIA 4NREA 3I563 1A2KA 1KWIA 5KP4A 2ML6A 4WYKB 1BIRA 1UCIA 1UGIA 1GS3A
chains in the Genus database with same CATH topology
1K734 2INXA 3FG4A 5AIIA 3EN1B 2P0XA 3MG1A 3B7CA 1T5YA 4MJDA 3NV0A 4N6LA 1A2VA 1EA2A 3NUVA 3NXJA 3F8XA 3WMDA 1Y4KA 5HGRA 4K61A 3RDEA 5TGNA 2D42A 3EHCA 3CC73 1STDA 1JJ22 5FW5A 3MG3A 1VZZA 1OGXA 4KVHA 1W02A 3Q90A 5ELUA 2XH9A 1YIJ3 2Y73A 1M1K4 1D6YA 1YGEA 2YFJB 4GB5A 1VQ73 5LC6A 1IVUA 1DMMA 3LZAA 1IT8A 3UL6A 1FA3A 1YVBI 5AIFA 4J8TA 3MPHA 1NU3A 3U97A 2Z7AA 1S5AA 3F40A 1IV9A 1K28A 1TIJA 2WOHA 3EBTA 3EF8A 3KN4A 2W9PA 3FLJA 4N6MA 4LEHA 1LOXA 3V98A 3CCJ3 3SX1A 1DMQA 1OH0A 4WFOA 1YHQ3 2BO9B 1OHSA 1JNQA 1N8R4 1MOLA 2QGUA 3CNMA 1ISKA 2ZDJA 3ECFA 3CCM3 1TP6A 1IU7A 3X3ZA 1FGQA 1ZX2A 3H51A 4FMCA 3S29A 1OGZA 3LT8A 1O7GB 4N6OB 5G2GA 1IDPA 1CYVA 2L4VA 1LNHA 4H3UA 3NV0B 1WTHA 3DXOA 1WMPA 2GU1A 3WDGB 3LOYA 3I553 1F8NA 3IPTA 5STDA 4EC6A 3UL5A 5ELJA 4BTWA 3G16A 4HBRA 4J9AA 1KQS2 3JVCA 3FH1A 3AMOA 3L0RA 3N9HA 1RN7A 2PNCA 4O2HA 1UUVB 1W2ZA 3QRDA 3IJEB 1JN5A 2BMOB 1EG9B 1UW1A 1D6UA 3K63A 1GY7A 3VF1A 3CCQ3 3DM8A 3PCRA 2XFTA 2XSHB 4IIAA 1NDOB 2W6JH 1VQM3 3GZRA 2OTL3 2P0MA 4XBTA 3K7CA 1NWWA 4O02B 1SPUA 4HM0B 5AYRB 5IF6A 4EYCA 3BNEA 3EQQB 2KRTA 3FCSB 3EE1A 4N6UA 4L8OA 1JB5A 1YJN3 3WOEB 1D6ZA 3K9MC 2HMJB 2XGLA 3SVAA 5BVBA 5JPUA 1RJOA 3PS8A 4R9LA 3LTBA 3NBJA 1IT7A 2QEX3 2GU3A 4N6NB 4FCZA 1W01A 2FXTA 2P09A 1FGRA 1Q42A 1Q40A 4LGQA 3CNXA 5IEPA 2FNQA 1JV2B 2RCDA 4HVNA 3J7Yd 2E2VA 3H3HA 1U5OA 1R4CA 3M8CA 2XFSA 3T0UA 3AMOB 2ML5A 1QMAA 4ZM8A 1RKYA 4XDWA 2MC8A 3SLUA 3F14A 3NQYA 1Q824 1SQWA 4JRFA 2WGQA 1JKGA 2CHCA 3SXXA 4STDA 1W7CA 1NO3A 3EX9A 2Y74A 4FCJA 4ORLA 1QAFA 4RBNA 1IVXA 2C11A 2F98A 2K0MA 1E97A 2YFLB 3G8ZA 4O8SA 4AEQA 3FKAA 4LZIA 2CG0A 5IERA 1O7PB 3HZPA 3N8BA 1VQP3 4RNYA 5CF2A 2GBXB 2UX0A 3X3XA 3RGAA 3B4PA 4EBGA 2HMKB 2CFGA 2CFDA 3S27A 5LC7A 2O3OA 3DZLA 3HX8A 5CF1A 2HMNB 1OF5B 2CH9A 5IG3A 4XB5A 3GAXA 3BNBA 3CC43 1IVVA 1M9GA 1BUQA 2Z76A 5IG0A 3EB8A 2IUJA 4CCVA 3N54B 3S5CA 3MKIA 1FGTA 2OOVC 1IQYA 2OQEC 2KXGA 3TDGA 1YJW3 4HKVB 3LTDA 1JRQA 1ZO2A 1VQ43 1N8QA 4G1MB 5DREA 2OCTA 1HKXA 3PYJA 4OK0A 4HM1B 2OQEA 2OOVA 2XGNA 1CQSA 1W6GA 3CME3 4H61A 4FMDA 2RGQA 1UI8A 2W56A 1TFOA 2C10A 2JDIH 4HM2B 5D82A 1AVKA 3CU3A 1QAKA 1SIHA 3VSYA 3RGRA 1W4NA 1IQXA 3G6E3 5IENA 1O7MB 2Z6BA 2CFKA 5IW9A 4XBXA 1A67A 1KSIA 1STFI 2V1LA 1KC84 3GWRA 4K1VA 1JN5B 3MHEA 2YX9A 4HM8B 3PGBA 1OCVA 2FGTA 1U8CB 4AKZA 1W00A 5AYSC 2Z77A 3X3YA 5EEOA 5CXOA 1ULJB 2F86B 2CFWA 3HIGA 1Q864 2F99A 3LH4A 3NM7A 2CWTA 2W2CA 3NBBA 4KZ1A 3EC9A 4XM4A 1W2B2 1YIT3 5IEOA 5AIHA 3FGYA 4HM3B 3OWUA 3SOAA 3CCS3 3DGOA 5CK6A 2XRXB 3K5TA 8CHOA 4KFDA 3DGLA 3CXC2 1PFPA 4EXRA 1US1A 4O3VA 3F8HA 2CW9A 2QIYA 4XDVA 4MMZB 1Q7Y4 2WGOA 3WA2X 5JBSA 4OUQA 3LTCA 2YFIB 1WMNA 3JUQA 2W56B 4MMYB 3CCR3 1CEWI 2CC3A 3DUKA 2RFRA 3GZYB 3B4OA 3I0YA 4TX4A 2XF3A 2IMJA 3GZBA 1LXEA 3V92A 4BTXA 3KZTA 3UB1A 3CC23 1IQ8A 1UI7A 3JUPA 4R80A 3DMCA 3LXUX 3OWSA 3JUNA 2MF7A 3NX0A 3ROBA 4HM7B 3EBYA 2HMLB 2CK3H 5JPPA 5A0OB 1OHOA 2E2UA 4HZBB 1W6YA 1W5ZA 2P38A 2GEYA 2BMRB 1GYBA 2IUKA 2BMQB 1QJGA 3UNLA 4K1UA 3CCL3 1V74A 1JB4A 1O7HB 2IA7A 2R4IA 3IMAB 1CYUA 1VQ53 1ROAA 4MMXB 4KFEA 4RZMA 4WHAA 1N5PA 2CKFB 3O8YA 2OTJ3 3OXAA 1TU5A 3BB9A 3QK9A 3CCE3 1WMOA 1AVLA 1OF5A 3OW22 3HK4A 3VGNA 2CWUA 2CFLA 3G4S3 1WNHA 2XSOB 3EJVA 2P05A 4N3VA 4N6V0 1DMNA 3Q2PA 2JQ5A 3FF2A 4HZ9B 3ER7A 3G0KA 1NJI4 1K8A4 1G96A 4NHFA 3UJMA 2XEPA 1QVG2 2CG1A 3SEDA 4N6TA 4R4KA 5D81A 2D1WA 1E3VA 2LQVA 2Q07A 3OV4A 2GXFA 4QWTA 3CMA3 4HYZA 1K41A 5BXQA 3WA3A 3CCU3 1TFKA 1WQLB 4K90B 4CDLA 2RSXA 2W0QA 4X2OA 1AR0A 1OPYA 4R1KA 3CPW2 4JF8A 5CLKA 1IVWA 4FCMA 4EV2A 3LTAA 1J2BA 1W6CA 1MNLA 1DVDA 3B8LA 3CPOA 3MG2A 3OWYA 5FGOA 6STDA 4L7KA 1EQKA 3MSOA 3V99A 1EKMA 1GY6A 5AEUB 3HIIA 3KSPA 1QVF2 1VQO3 3T8NA 3F9SA 4WYKA 1ASKA 2QA43 3E99A 4WWUC 1RRHA 1A90A 3FG3A 1GY5A 2K54A 5IG4A 2O9UX 2WOFA 3HI7A 4L8PA 1E3RA 3BNDA 3FG1A 3WODG 4FR9A 5AI1A 2BT3A 2ZL8A 3WOFB 5I97A 2CWVA 5IG5A 1PU4A 1IV7A 1OUNA 3K0ZA 4IPBA 3FF0A 1JKGB 3BLZA 1NB3I 1M1XB 1M904 4HM4B 5EQLA 3OX9A 3Q1CA 3JUMA 1SIIA 2BHMA 1YJ93 1RRLA 5AEWB 3F7XA 1SJWA 1VQ93 2BNGA 3CD63 1ROVA 4HJLB 2CIUA 2STDA 3JUOA 7STDA 1VQ63 3CCV3 4FMBA 2WO0A 3FZWA 3X40A 3NQZA 3S67A 1K9M4 1KD14 4HM5B 1C7HA 4Q53A 3A76A 2GBWB 1O7NB 3NHXA 4IT7A 4XBYA 1Q814 1DVCA 5KP3A 1VQ83 1VQN3 1IK3A 4MEIA 1FUWA 2PZVA 3KE7A 1QALA 3PZWA 1FGOA 1N5HA 4FMAA 4U13A 1L5GB 3U1WA 3D9RA 3GZXB 4GL6A 1N9EA 4LMIA 3MWZA 3BNCA 1YI23 3KFQC 2A15A 5AIGA 1ULIB 3KSED 2W04A 4RNZA 4WP5A 3FSDA 2E2TA 3NM2A 2HMMB 1VQK3 3ALAA 1O7WB 4LSOA 1AV4A 2M7OA 3PCSA 3S28A 3GRDA 3X42A 2XR8B 3EN8A 4R9KA 1NB5I 1VQL3 2W03A 2B1XB 1DYUA 2OWPA 2I9WA 1OHPA 1LVNA 2HMOB 4AKYA 4PEJA 2LYXA 3X41A 2B24B 3DGMA 2W9QA 3LMLA 1N9JA 5D83A 3SOYA 4KFFA 3D3LA 4I4KA 1FGMA 3DY5A 2KCDA 3MYTA 1HU9A 1GD4A 4OVMA 1JB2A 4BTYA 1OACA 1UUWB 5DRVA 4X2HA 1TUHA 3F7SA 3LT9A 1GD3A 1S723 3PXMA 5EVHA 3NBRA 3KKGA 3G713 3T8UA 4HM6B 1Q40B 3DGNA 4EV5A 2SBLA 1Z1SA 3STDA 3LYGA 5KP1A 3KIIA 4NREA 3I563 1A2KA 1KWIA 5KP4A 2ML6A 4WYKB 2GEXA 1GS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 3;  1K73 4;  2OTL 3;  1VQ7 3;  3CCV 3;  1YI2 3;  1VQ4 3;  3CCL 3;  3CCR 3;  3I55 3;  1NJI 4;  1K8A 4;  1VQ5 3;  1Q86 4;  1QVG 2;  1K9M 4;  1KD1 4;  3CME 3;  1VQK 3;  3CCJ 3;  1Q82 4;  1YJN 3;  1W2B 2;  3CC2 3;  1YIT 3;  1KQS 2;  2OTJ 3;  1YHQ 3;  1M90 4;  1VQL 3;  3CCS 3;  1Q81 4;  3CCE 3;  1N8R 4;  1S72 3;  1VQ8 3;  1VQN 3;  3CC7 3;  1YJ9 3;  3CMA 3;  3CXC 2;  3G71 3;  2QEX 3;  3CCM 3;  1JJ2 2;  3CC4 3;  1QVF 2;  3OW2 2;  3G6E 3;  1VQO 3;  3CCU 3;  1VQ9 3;  2QA4 3;  3I56 3;  3CCQ 3;  3G4S 3;  1YIJ 3;  1KC8 4;  1M1K 4;  3CD6 3;  1VQP 3;  1Q7Y 4;  1VQM 3;  1YJW 3;  3CPW 2; 
#chains in the Genus database with same CATH topology
 1PYL A;  1K73 4;  2INX A;  3FG4 A;  1BU4 A;  5AII A;  3EN1 B;  1B2U A;  2P0X A;  2KF3 A;  3MG1 A;  1RGF A;  3B7C A;  1T5Y A;  4MJD A;  3NV0 A;  4N6L A;  1A2V A;  1LOW A;  2SAR A;  4NPB A;  1EA2 A;  1C54 A;  3NUV A;  3NXJ A;  2CX1 A;  3F8X A;  3WMD A;  1ZGX A;  1Y4K A;  5HGR A;  4K61 A;  3RDE A;  5TGN A;  2D42 A;  3EHC A;  3CC7 3;  3BU4 A;  1STD A;  1JJ2 2;  5FW5 A;  3MG3 A;  1VZZ A;  1OGX A;  5M1A A;  4KVH A;  1W02 A;  3Q90 A;  5ELU A;  2XH9 A;  1YIJ 3;  2Y73 A;  1M1K 4;  1D6Y A;  4CJN A;  1YGE A;  2HOH A;  2YFJ B;  4J5G A;  4GB5 A;  1VQ7 3;  1GSP A;  5LC6 A;  1BAO A;  1IVU A;  1DMM A;  3LZA A;  1IT8 A;  3UL6 A;  1FA3 A;  1YGW A;  1T3B A;  1YVB I;  5AIF A;  2RNT A;  4J8T A;  3MPH A;  1NU3 A;  3U97 A;  2Z7A A;  1S5A A;  3F40 A;  1BNF A;  1IV9 A;  1K28 A;  1BVI A;  1TIJ A;  2WOH A;  3EBT A;  3EF8 A;  3KN4 A;  1BNI A;  2W9P A;  3FLJ A;  4N6M A;  4LEH A;  1LOX A;  3V98 A;  3CCJ 3;  3SX1 A;  1DMQ A;  1OH0 A;  4WFO A;  1YHQ 3;  5HOH A;  1BNJ A;  1UGH I;  2BO9 B;  1OHS A;  1JNQ A;  1N8R 4;  1MOL A;  2QGU A;  3CNM A;  1ISK A;  1MGW A;  2ZDJ A;  3ECF A;  3CCM 3;  1TP6 A;  4LYL B;  1IU7 A;  1B27 A;  3X3Z A;  1FGQ A;  1ZX2 A;  3H51 A;  4FMC A;  3S29 A;  1OGZ A;  3LT8 A;  1O7G B;  4N6O B;  5G2G A;  1CYV A;  1IDP A;  2L4V A;  1LNH A;  4H3U A;  3NV0 B;  1RCK A;  1PY3 A;  1WTH A;  3DXO A;  1WMP A;  2GU1 A;  3D4A A;  3WDG B;  3LOY A;  1MWU A;  3I55 3;  1F8N A;  3IPT A;  1R4Y A;  5STD A;  4EC6 A;  1CH0 A;  3UL5 A;  5ELJ A;  1GOY A;  4EW5 A;  4BTW A;  3G16 A;  1FUS A;  4HBR A;  4J9A A;  1KQS 2;  3JVC A;  3FH1 A;  3AMO A;  3L0R A;  3N9H A;  3D79 A;  1RN7 A;  2PNC A;  1GMQ A;  4O2H A;  1UUV B;  1W2Z A;  1TJD A;  1UCK A;  1V58 A;  1X1Y A;  1RGA A;  3QRD A;  3IJE B;  1JN5 A;  2BMO B;  1UW1 A;  1EG9 B;  1D6U A;  3K63 A;  1GY7 A;  1V57 A;  3VF1 A;  3CCQ 3;  3DM8 A;  3PCR A;  2XFT A;  2XSH B;  4IIA A;  1NDO B;  2W6J H;  2J8X B;  1VQM 3;  3GZR A;  2OTL 3;  2P0M A;  4XBT A;  3K7C A;  1JZD A;  1NWW A;  4O02 B;  1SPU A;  4HM0 B;  5AYR B;  5IF6 A;  4EYC A;  3BNE A;  5G1K A;  4I5Q A;  3EQQ B;  2KRT A;  3FCS B;  3EE1 A;  4N6U A;  4L8O A;  1JB5 A;  1YJN 3;  1AQZ A;  1BRN L;  3WOE B;  1D6Z A;  3K9M C;  2HMJ B;  2XGL A;  3SVA A;  5BVB A;  5JPU A;  1RJO A;  3PS8 A;  4R9L A;  3LTB A;  3NBJ A;  1AY7 A;  1IT7 A;  2QEX 3;  2GU3 A;  4N6N B;  4FCZ A;  1W01 A;  2FXT A;  2P09 A;  1FGR A;  1Q42 A;  2KF6 A;  1Q40 A;  4LGQ A;  3CNX A;  5IEP A;  2FNQ A;  1JV2 B;  2RCD A;  4HVN A;  3J7Y d;  2E2V A;  3H3H A;  1U5O A;  1R4C A;  3M8C A;  2XFS A;  5BU4 A;  3T0U A;  3AMO B;  2ML5 A;  1QMA A;  1LOV A;  4ILF A;  1RN1 A;  4ZM8 A;  1RKY A;  3AGO A;  4XDW A;  2MC8 A;  3SLU A;  3F14 A;  1Q9E A;  3NQY A;  1Q82 4;  1SQW A;  4JRF A;  2WGQ A;  1JKG A;  2CHC A;  3SXX A;  1JZO A;  1GMP A;  4STD A;  1W7C A;  1NO3 A;  3ZFZ A;  3EX9 A;  1RTU A;  2Y74 A;  2F5W A;  4FCJ A;  4ORL A;  1QAF A;  4RBN A;  1IVX A;  2C11 A;  2F98 A;  2K0M A;  1E97 A;  1BNS A;  2YFL B;  3G8Z A;  4O8S A;  4AEQ A;  3FKA A;  4LZI A;  2CG0 A;  5IER A;  1O7P B;  3HZP A;  3N8B A;  1VQP 3;  4RNY A;  1RCL A;  2GBX B;  1BSD A;  3A5E A;  2UX0 A;  3D5I A;  5CF2 A;  3X3X A;  6GSP A;  3RGA A;  1I0V A;  3B4P A;  4EBG A;  3AGN A;  1T2H A;  2HMK B;  2CFG A;  1B2S A;  2CFD A;  3S27 A;  5LC7 A;  4BL2 A;  1G0T A;  1LNI A;  2O3O A;  1RGK A;  3DZL A;  3HX8 A;  3RNT A;  1Q7H A;  5CF1 A;  4GHO A;  2HMN B;  1OF5 B;  2CH9 A;  5IG3 A;  4XB5 A;  3GAX A;  1X1U A;  3BNB A;  3CC4 3;  1IVV A;  1M9G A;  1BUQ A;  2Z76 A;  5IG0 A;  3EB8 A;  2IUJ A;  3AHW A;  4CCV A;  1T2I A;  3N54 B;  3S5C A;  1A67 A;  3MKI A;  1FGT A;  2OOV C;  1IQY A;  2OQE C;  2KXG A;  3TDG A;  5G1L A;  1YJW 3;  4HKV B;  3LTD A;  3KCH A;  1JRQ A;  2KF4 A;  1ZO2 A;  1VQ4 3;  1N8Q A;  1HZ1 A;  4G1M B;  5DRE A;  1BSA A;  2OCT A;  1HKX A;  3PYJ A;  4OK0 A;  4HM1 B;  2OQE A;  2OOV A;  2XGN A;  1CQS A;  1W6G A;  1JBR A;  1BRH A;  1RN4 A;  4FMD A;  4H61 A;  2RGQ A;  3CME 3;  1I8V A;  1JBS A;  1UI8 A;  2W56 A;  1TFO A;  1MWT A;  2C10 A;  2F4Y A;  2JDI H;  4HM2 B;  1AVK A;  5D82 A;  3CU3 A;  1QAK A;  1SIH A;  3VSY A;  3RGR A;  8RNT A;  3DGY A;  1W4N A;  1IQX A;  2BU4 A;  3G6E 3;  5IEN A;  1O7M B;  2Z6B A;  4BIR A;  2CFK A;  5IW9 A;  4XBX A;  3D5G A;  1TRQ A;  1KSI A;  1STF I;  1LOY A;  2V1L A;  4RNT A;  3GWR A;  4K1V A;  1YVS A;  1JN5 B;  4CPK A;  3MHE A;  1KC8 4;  1BGS A;  2YX9 A;  1X1X A;  3PGB A;  4HM8 B;  1OCV A;  2FGT A;  1FZU A;  4DKI A;  1U8C B;  4AKZ A;  1W00 A;  5AYS C;  2Z77 A;  3X3Y A;  5EEO A;  5CXO A;  1ULJ B;  1B2Z A;  1RGL A;  2F86 B;  2CFW A;  3HIG A;  1Q86 4;  2F99 A;  2GSP A;  3LH4 A;  1BSB A;  3NM7 A;  3ZG0 A;  1I0X A;  1MWR A;  2CWT A;  2W2C A;  3NBB A;  1EUI C;  3EC9 A;  4KZ1 A;  4XM4 A;  1YIT 3;  5IEO A;  1W2B 2;  5AIH A;  3FGY A;  3HOH A;  4HM3 B;  3OWU A;  3SOA A;  3CCS 3;  3DGO A;  5CK6 A;  2XRX B;  3K5T A;  8CHO A;  4KFD A;  3DGL A;  1SAR A;  3CXC 2;  1PFP A;  3WR2 A;  4EXR A;  1US1 A;  1RGE A;  4O3V A;  3F8H A;  2CW9 A;  2QIY A;  4XDV A;  4MMZ B;  1Q7Y 4;  2WGO A;  3WA2 X;  5JBS A;  4OUQ A;  1MGR A;  3LTC A;  2YFI B;  1WMN A;  3JUQ A;  2W56 B;  1UDI I;  4MMY B;  3CCR 3;  1CEW I;  6RNT A;  2CC3 A;  3DUK A;  2RFR A;  3GZY B;  3B4O A;  3I0Y A;  4TX4 A;  2XF3 A;  2IMJ A;  3GZB A;  1LXE A;  3V92 A;  4BTX A;  3KZT A;  3UB1 A;  3CC2 3;  1IQ8 A;  1UI7 A;  3JUP A;  4R80 A;  3DMC A;  3LXU X;  3OWS A;  3JUN A;  2MF7 A;  3NX0 A;  3ROB A;  4HM7 B;  3EBY A;  2HML B;  1RGH A;  2CK3 H;  5JPP A;  1GMR A;  5A0O B;  1OHO A;  2E2U A;  4HZB B;  1W6Y A;  1W5Z A;  2P38 A;  2GEY A;  2BMR B;  1GYB A;  2IUK A;  1BOX A;  2BMQ B;  5M19 A;  1QJG A;  1MWS A;  3UNL A;  4K1U A;  3CCL 3;  1V74 A;  1JB4 A;  1RLS A;  2RBI A;  2C4B A;  1LQG C;  1O7H B;  2IA7 A;  2R4I A;  3IMA B;  1CYU A;  1VQ5 3;  1ROA A;  1X1W A;  4MMX B;  2KAA A;  4KFE A;  4RZM A;  4WHA A;  1N5P A;  2CKF B;  3O8Y A;  2KF5 A;  1RNB A;  2H0H A;  1FUT A;  2OTJ 3;  3OXA A;  1TU5 A;  3BB9 A;  3QK9 A;  3CCE 3;  1WMO A;  1AVL A;  1OF5 A;  1IYY A;  3OW2 2;  1RNT A;  1BUJ A;  1UUG B;  3HK4 A;  5BIR A;  3VGN A;  2CWU A;  2CFL A;  3G4S 3;  1WNH A;  2XSO B;  4HAA A;  3EJV A;  1BNE A;  2P05 A;  4N3V A;  4N6V 0;  1DMN A;  1YNV X;  3Q2P A;  2JQ5 A;  3FF2 A;  4HZ9 B;  3ER7 A;  3G0K A;  1NJI 4;  1K8A 4;  1G96 A;  4NHF A;  3UJM A;  2XEP A;  1QVG 2;  1I2F A;  2CG1 A;  3SED A;  4N6T A;  4R4K A;  5D81 A;  2IY2 A;  2D1W A;  1E3V A;  3BIR A;  1TRP A;  2LQV A;  3WHO A;  2Q07 A;  3OV4 A;  2GXF A;  4QWT A;  3CMA 3;  1ZS7 A;  4HYZ A;  1K41 A;  5GSP A;  5BXQ A;  1EEJ A;  3WA3 A;  3CCU 3;  1TFK A;  1WQL B;  4K90 B;  4CDL A;  1RDS A;  2RSX A;  7GSP A;  2W0Q A;  1GOU A;  4X2O A;  1AR0 A;  1OPY A;  1UCL A;  4R1K A;  4JF8 A;  1B21 A;  5CLK A;  4GSP A;  1IVW A;  3CPW 2;  4FCM A;  4EV2 A;  1BAN A;  4BL3 A;  1LRA A;  3LTA A;  1J2B A;  2IYJ A;  4KT3 B;  1W6C A;  1MNL A;  3GSP A;  1DVD A;  3B8L A;  4BU4 A;  1BRS A;  5RNT A;  2AAD A;  3CPO A;  3MG2 A;  3OWY A;  5FGO A;  6STD A;  4L7K A;  1EQK A;  1LQM B;  3MSO A;  3V99 A;  1EKM A;  1NNV A;  1GY6 A;  5AEU B;  3HII A;  3KSP A;  1QVF 2;  1I2E A;  1VQO 3;  3T8N A;  3F9S A;  4WYK A;  1ASK A;  2F5M A;  2QA4 3;  3E99 A;  4WWU C;  1BSE A;  1RRH A;  1A90 A;  3FG3 A;  1GY5 A;  2K54 A;  5IG4 A;  2O9U X;  1RSN A;  2WOF A;  3HI7 A;  4L8P A;  1E3R A;  3BND A;  3FG1 A;  3WOD G;  1BNG A;  4FR9 A;  5AI1 A;  2BT3 A;  2H0I A;  2ZL8 A;  4J5K A;  3WOF B;  2CWV A;  5I97 A;  5IG5 A;  1PU4 A;  1IV7 A;  1OUN A;  3K0Z A;  1RGG A;  1I2G A;  3FF0 A;  4IPB A;  1JKG B;  3BLZ A;  1NB3 I;  1M1X B;  4HOH A;  2F56 A;  1M90 4;  4HM4 B;  5EQL A;  3OX9 A;  3Q1C A;  1BSC A;  3JUM A;  1SII A;  2BHM A;  1YJ9 3;  3SYU A;  1RRL A;  5AEW B;  3F7X A;  1SJW A;  1JBT A;  1VQ9 3;  2BNG A;  3CD6 3;  1ROV A;  4HJL B;  2CIU A;  2STD A;  3JUO A;  7STD A;  1VQ6 3;  2H0G A;  3CCV 3;  1DE3 A;  4FMB A;  2UUG C;  2WO0 A;  3FZW A;  3X40 A;  3NQZ A;  1DET A;  2CX0 A;  3S67 A;  1K9M 4;  1KD1 4;  4HM5 B;  1C7H A;  4Q53 A;  1FYS A;  3A76 A;  2GBW B;  1I3I A;  3ZG5 A;  1O7N B;  1TTO A;  3NHX A;  5M18 A;  4IT7 A;  4XBY A;  1RGC A;  2UGI A;  1Q81 4;  1DVC A;  5KP3 A;  1VQ8 3;  2ZHX B;  1IK3 A;  1VQN 3;  3URP A;  2GEX A;  4MEI A;  1FUW A;  3Q3F A;  2PZV A;  3KE7 A;  1QAL A;  3PZW A;  1FGO A;  1UCJ A;  1N5H A;  4FMA A;  4U13 A;  1L5G B;  2BIR A;  2K3D A;  1VQQ A;  2AAE A;  3U1W A;  3D9R A;  3GZX B;  4GL6 A;  1N9E A;  4LMI A;  1BRI A;  3BNC A;  3MWZ A;  1BRJ A;  1YI2 3;  3KFQ C;  2A15 A;  1FW7 A;  5AIG A;  1ULI B;  2ZA4 A;  3KSE D;  2W04 A;  4RNZ A;  4WP5 A;  2R41 A;  9RNT A;  1B20 A;  1G02 A;  3FSD A;  2E2T A;  3NM2 A;  2HMM B;  1VQK 3;  3ALA A;  1O7W B;  4LSO A;  1AV4 A;  2M7O A;  3PCS A;  1BNR A;  3S28 A;  3GRD A;  3X42 A;  2XR8 B;  1I70 A;  3EN8 A;  4R9K A;  1NB5 I;  7RNT A;  1VQL 3;  2W03 A;  2B1X B;  1GOV A;  1DYU A;  1RHL A;  2I9W A;  1OHP A;  1LVN A;  2OWP A;  2HMO B;  1B2M A;  3DH2 A;  1BRG A;  4AKY A;  1B2X A;  1HYF A;  2LYX A;  4PEJ A;  2B24 B;  1B3S A;  3DGM A;  3X41 A;  1BRK A;  2W9Q A;  3LML A;  1N9J A;  1A2P A;  5D83 A;  3SOY A;  4KFF A;  3D3L A;  1I3F A;  4I4K A;  1FGM A;  3DY5 A;  2KCD A;  3MYT A;  1HU9 A;  1GD4 A;  4OVM A;  1JB2 A;  4BTY A;  1OAC A;  1UUW B;  2L1S A;  5DRV A;  4X2H A;  1TUH A;  3AHS A;  3F7S A;  3LT9 A;  1GD3 A;  1RMS A;  1S72 3;  3PXM A;  5EVH A;  3NBR A;  3KKG A;  3G71 3;  3T8U A;  4HM6 B;  1Q40 B;  3DGN A;  4EV5 A;  2SBL A;  1Z1S A;  3STD A;  3LYG A;  5KP1 A;  3KII A;  4NRE A;  3I56 3;  1A2K A;  1KWI A;  5KP4 A;  2ML6 A;  4WYK B;  1BIR A;  1UCI A;  1UGI A;  1GS3 A; 
#chains in the Genus database with same CATH homology
 1K73 4;  2INX A;  3FG4 A;  5AII A;  3EN1 B;  2P0X A;  3MG1 A;  3B7C A;  1T5Y A;  4MJD A;  3NV0 A;  4N6L A;  1A2V A;  1EA2 A;  3NUV A;  3NXJ A;  3F8X A;  3WMD A;  1Y4K A;  5HGR A;  4K61 A;  3RDE A;  5TGN A;  2D42 A;  3EHC A;  3CC7 3;  1STD A;  1JJ2 2;  5FW5 A;  3MG3 A;  1VZZ A;  1OGX A;  4KVH A;  1W02 A;  3Q90 A;  5ELU A;  2XH9 A;  1YIJ 3;  2Y73 A;  1M1K 4;  1D6Y A;  1YGE A;  2YFJ B;  4GB5 A;  1VQ7 3;  5LC6 A;  1IVU A;  1DMM A;  3LZA A;  1IT8 A;  3UL6 A;  1FA3 A;  1YVB I;  5AIF A;  4J8T A;  3MPH A;  1NU3 A;  3U97 A;  2Z7A A;  1S5A A;  3F40 A;  1IV9 A;  1K28 A;  1TIJ A;  2WOH A;  3EBT A;  3EF8 A;  3KN4 A;  2W9P A;  3FLJ A;  4N6M A;  4LEH A;  1LOX A;  3V98 A;  3CCJ 3;  3SX1 A;  1DMQ A;  1OH0 A;  4WFO A;  1YHQ 3;  2BO9 B;  1OHS A;  1JNQ A;  1N8R 4;  1MOL A;  2QGU A;  3CNM A;  1ISK A;  2ZDJ A;  3ECF A;  3CCM 3;  1TP6 A;  1IU7 A;  3X3Z A;  1FGQ A;  1ZX2 A;  3H51 A;  4FMC A;  3S29 A;  1OGZ A;  3LT8 A;  1O7G B;  4N6O B;  5G2G A;  1IDP A;  1CYV A;  2L4V A;  1LNH A;  4H3U A;  3NV0 B;  1WTH A;  3DXO A;  1WMP A;  2GU1 A;  3WDG B;  3LOY A;  3I55 3;  1F8N A;  3IPT A;  5STD A;  4EC6 A;  3UL5 A;  5ELJ A;  4BTW A;  3G16 A;  4HBR A;  4J9A A;  1KQS 2;  3JVC A;  3FH1 A;  3AMO A;  3L0R A;  3N9H A;  1RN7 A;  2PNC A;  4O2H A;  1UUV B;  1W2Z A;  3QRD A;  3IJE B;  1JN5 A;  2BMO B;  1EG9 B;  1UW1 A;  1D6U A;  3K63 A;  1GY7 A;  3VF1 A;  3CCQ 3;  3DM8 A;  3PCR A;  2XFT A;  2XSH B;  4IIA A;  1NDO B;  2W6J H;  1VQM 3;  3GZR A;  2OTL 3;  2P0M A;  4XBT A;  3K7C A;  1NWW A;  4O02 B;  1SPU A;  4HM0 B;  5AYR B;  5IF6 A;  4EYC A;  3BNE A;  3EQQ B;  2KRT A;  3FCS B;  3EE1 A;  4N6U A;  4L8O A;  1JB5 A;  1YJN 3;  3WOE B;  1D6Z A;  3K9M C;  2HMJ B;  2XGL A;  3SVA A;  5BVB A;  5JPU A;  1RJO A;  3PS8 A;  4R9L A;  3LTB A;  3NBJ A;  1IT7 A;  2QEX 3;  2GU3 A;  4N6N B;  4FCZ A;  1W01 A;  2FXT A;  2P09 A;  1FGR A;  1Q42 A;  1Q40 A;  4LGQ A;  3CNX A;  5IEP A;  2FNQ A;  1JV2 B;  2RCD A;  4HVN A;  3J7Y d;  2E2V A;  3H3H A;  1U5O A;  1R4C A;  3M8C A;  2XFS A;  3T0U A;  3AMO B;  2ML5 A;  1QMA A;  4ZM8 A;  1RKY A;  4XDW A;  2MC8 A;  3SLU A;  3F14 A;  3NQY A;  1Q82 4;  1SQW A;  4JRF A;  2WGQ A;  1JKG A;  2CHC A;  3SXX A;  4STD A;  1W7C A;  1NO3 A;  3EX9 A;  2Y74 A;  4FCJ A;  4ORL A;  1QAF A;  4RBN A;  1IVX A;  2C11 A;  2F98 A;  2K0M A;  1E97 A;  2YFL B;  3G8Z A;  4O8S A;  4AEQ A;  3FKA A;  4LZI A;  2CG0 A;  5IER A;  1O7P B;  3HZP A;  3N8B A;  1VQP 3;  4RNY A;  5CF2 A;  2GBX B;  2UX0 A;  3X3X A;  3RGA A;  3B4P A;  4EBG A;  2HMK B;  2CFG A;  2CFD A;  3S27 A;  5LC7 A;  2O3O A;  3DZL A;  3HX8 A;  5CF1 A;  2HMN B;  1OF5 B;  2CH9 A;  5IG3 A;  4XB5 A;  3GAX A;  3BNB A;  3CC4 3;  1IVV A;  1M9G A;  1BUQ A;  2Z76 A;  5IG0 A;  3EB8 A;  2IUJ A;  4CCV A;  3N54 B;  3S5C A;  3MKI A;  1FGT A;  2OOV C;  1IQY A;  2OQE C;  2KXG A;  3TDG A;  1YJW 3;  4HKV B;  3LTD A;  1JRQ A;  1ZO2 A;  1VQ4 3;  1N8Q A;  4G1M B;  5DRE A;  2OCT A;  1HKX A;  3PYJ A;  4OK0 A;  4HM1 B;  2OQE A;  2OOV A;  2XGN A;  1CQS A;  1W6G A;  3CME 3;  4H61 A;  4FMD A;  2RGQ A;  1UI8 A;  2W56 A;  1TFO A;  2C10 A;  2JDI H;  4HM2 B;  5D82 A;  1AVK A;  3CU3 A;  1QAK A;  1SIH A;  3VSY A;  3RGR A;  1W4N A;  1IQX A;  3G6E 3;  5IEN A;  1O7M B;  2Z6B A;  2CFK A;  5IW9 A;  4XBX A;  1A67 A;  1KSI A;  1STF I;  2V1L A;  1KC8 4;  3GWR A;  4K1V A;  1JN5 B;  3MHE A;  2YX9 A;  4HM8 B;  3PGB A;  1OCV A;  2FGT A;  1U8C B;  4AKZ A;  1W00 A;  5AYS C;  2Z77 A;  3X3Y A;  5EEO A;  5CXO A;  1ULJ B;  2F86 B;  2CFW A;  3HIG A;  1Q86 4;  2F99 A;  3LH4 A;  3NM7 A;  2CWT A;  2W2C A;  3NBB A;  4KZ1 A;  3EC9 A;  4XM4 A;  1W2B 2;  1YIT 3;  5IEO A;  5AIH A;  3FGY A;  4HM3 B;  3OWU A;  3SOA A;  3CCS 3;  3DGO A;  5CK6 A;  2XRX B;  3K5T A;  8CHO A;  4KFD A;  3DGL A;  3CXC 2;  1PFP A;  4EXR A;  1US1 A;  4O3V A;  3F8H A;  2CW9 A;  2QIY A;  4XDV A;  4MMZ B;  1Q7Y 4;  2WGO A;  3WA2 X;  5JBS A;  4OUQ A;  3LTC A;  2YFI B;  1WMN A;  3JUQ A;  2W56 B;  4MMY B;  3CCR 3;  1CEW I;  2CC3 A;  3DUK A;  2RFR A;  3GZY B;  3B4O A;  3I0Y A;  4TX4 A;  2XF3 A;  2IMJ A;  3GZB A;  1LXE A;  3V92 A;  4BTX A;  3KZT A;  3UB1 A;  3CC2 3;  1IQ8 A;  1UI7 A;  3JUP A;  4R80 A;  3DMC A;  3LXU X;  3OWS A;  3JUN A;  2MF7 A;  3NX0 A;  3ROB A;  4HM7 B;  3EBY A;  2HML B;  2CK3 H;  5JPP A;  5A0O B;  1OHO A;  2E2U A;  4HZB B;  1W6Y A;  1W5Z A;  2P38 A;  2GEY A;  2BMR B;  1GYB A;  2IUK A;  2BMQ B;  1QJG A;  3UNL A;  4K1U A;  3CCL 3;  1V74 A;  1JB4 A;  1O7H B;  2IA7 A;  2R4I A;  3IMA B;  1CYU A;  1VQ5 3;  1ROA A;  4MMX B;  4KFE A;  4RZM A;  4WHA A;  1N5P A;  2CKF B;  3O8Y A;  2OTJ 3;  3OXA A;  1TU5 A;  3BB9 A;  3QK9 A;  3CCE 3;  1WMO A;  1AVL A;  1OF5 A;  3OW2 2;  3HK4 A;  3VGN A;  2CWU A;  2CFL A;  3G4S 3;  1WNH A;  2XSO B;  3EJV A;  2P05 A;  4N3V A;  4N6V 0;  1DMN A;  3Q2P A;  2JQ5 A;  3FF2 A;  4HZ9 B;  3ER7 A;  3G0K A;  1NJI 4;  1K8A 4;  1G96 A;  4NHF A;  3UJM A;  2XEP A;  1QVG 2;  2CG1 A;  3SED A;  4N6T A;  4R4K A;  5D81 A;  2D1W A;  1E3V A;  2LQV A;  2Q07 A;  3OV4 A;  2GXF A;  4QWT A;  3CMA 3;  4HYZ A;  1K41 A;  5BXQ A;  3WA3 A;  3CCU 3;  1TFK A;  1WQL B;  4K90 B;  4CDL A;  2RSX A;  2W0Q A;  4X2O A;  1AR0 A;  1OPY A;  4R1K A;  3CPW 2;  4JF8 A;  5CLK A;  1IVW A;  4FCM A;  4EV2 A;  3LTA A;  1J2B A;  1W6C A;  1MNL A;  1DVD A;  3B8L A;  3CPO A;  3MG2 A;  3OWY A;  5FGO A;  6STD A;  4L7K A;  1EQK A;  3MSO A;  3V99 A;  1EKM A;  1GY6 A;  5AEU B;  3HII A;  3KSP A;  1QVF 2;  1VQO 3;  3T8N A;  3F9S A;  4WYK A;  1ASK A;  2QA4 3;  3E99 A;  4WWU C;  1RRH A;  1A90 A;  3FG3 A;  1GY5 A;  2K54 A;  5IG4 A;  2O9U X;  2WOF A;  3HI7 A;  4L8P A;  1E3R A;  3BND A;  3FG1 A;  3WOD G;  4FR9 A;  5AI1 A;  2BT3 A;  2ZL8 A;  3WOF B;  5I97 A;  2CWV A;  5IG5 A;  1PU4 A;  1IV7 A;  1OUN A;  3K0Z A;  4IPB A;  3FF0 A;  1JKG B;  3BLZ A;  1NB3 I;  1M1X B;  1M90 4;  4HM4 B;  5EQL A;  3OX9 A;  3Q1C A;  3JUM A;  1SII A;  2BHM A;  1YJ9 3;  1RRL A;  5AEW B;  3F7X A;  1SJW A;  1VQ9 3;  2BNG A;  3CD6 3;  1ROV A;  4HJL B;  2CIU A;  2STD A;  3JUO A;  7STD A;  1VQ6 3;  3CCV 3;  4FMB A;  2WO0 A;  3FZW A;  3X40 A;  3NQZ A;  3S67 A;  1K9M 4;  1KD1 4;  4HM5 B;  1C7H A;  4Q53 A;  3A76 A;  2GBW B;  1O7N B;  3NHX A;  4IT7 A;  4XBY A;  1Q81 4;  1DVC A;  5KP3 A;  1VQ8 3;  1VQN 3;  1IK3 A;  4MEI A;  1FUW A;  2PZV A;  3KE7 A;  1QAL A;  3PZW A;  1FGO A;  1N5H A;  4FMA A;  4U13 A;  1L5G B;  3U1W A;  3D9R A;  3GZX B;  4GL6 A;  1N9E A;  4LMI A;  3MWZ A;  3BNC A;  1YI2 3;  3KFQ C;  2A15 A;  5AIG A;  1ULI B;  3KSE D;  2W04 A;  4RNZ A;  4WP5 A;  3FSD A;  2E2T A;  3NM2 A;  2HMM B;  1VQK 3;  3ALA A;  1O7W B;  4LSO A;  1AV4 A;  2M7O A;  3PCS A;  3S28 A;  3GRD A;  3X42 A;  2XR8 B;  3EN8 A;  4R9K A;  1NB5 I;  1VQL 3;  2W03 A;  2B1X B;  1DYU A;  2OWP A;  2I9W A;  1OHP A;  1LVN A;  2HMO B;  4AKY A;  4PEJ A;  2LYX A;  3X41 A;  2B24 B;  3DGM A;  2W9Q A;  3LML A;  1N9J A;  5D83 A;  3SOY A;  4KFF A;  3D3L A;  4I4K A;  1FGM A;  3DY5 A;  2KCD A;  3MYT A;  1HU9 A;  1GD4 A;  4OVM A;  1JB2 A;  4BTY A;  1OAC A;  1UUW B;  5DRV A;  4X2H A;  1TUH A;  3F7S A;  3LT9 A;  1GD3 A;  1S72 3;  3PXM A;  5EVH A;  3NBR A;  3KKG A;  3G71 3;  3T8U A;  4HM6 B;  1Q40 B;  3DGN A;  4EV5 A;  2SBL A;  1Z1S A;  3STD A;  3LYG A;  5KP1 A;  3KII A;  4NRE A;  3I56 3;  1A2K A;  1KWI A;  5KP4 A;  2ML6 A;  4WYK B;  2GEX A;  1GS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...