1Q824

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q82400
1VQM3 3CCJ3 1YJ93 1K9M4 1M1K4 3CD63 1KC84 3CPW2 3G713 1W2B2 1VQL3 1Q814 1YIT3 2QEX3 1NJI4 1N8R4 1VQK3 3CCR3 2QA43 1YHQ3 2OTJ3 1S723 3CCM3 1KD14 1VQ93 2OTL3 3OW22 1QVF2 3CC73 1JJ22 1YJN3 1K8A4 1VQ83 3CMA3 3CC23 1YJW3 1VQ53 1Q7Y4 1VQO3 1VQ63 1Q824 1KQS2 3CCE3 3CXC2 3CCQ3 3CCL3 3G4S3 1VQ73 3CCU3 1M904 1YI23 3I553 3CCS3 1Q864 1K734 1YIJ3 1VQN3 3CCV3 1VQP3 1VQ43 1QVG2 3G6E3 3CC43 3CME3 3I563
chains in the Genus database with same CATH superfamily
2GU1A 1UUVB 3KE7A 1M1K4 5BVBA 3EN8A 3MSOA 1NDOB 1GMPA 3BNBA 1A2VA 1QAFA 3CCR3 3LYGA 4XBYA 2KF3A 4CPKA 1TU5A 4AKYA 1JJ22 3DUKA 5HGRA 6GSPA 1QJGA 1OCVA 1UCKA 3HIIA 3JUNA 1YJW3 1QALA 4EYCA 3IPTA 3J7Yd 3PCSA 1RCLA 2BMOB 4XBTA 4N6NB 1US1A 1ZGXA 3D3LA 3WA2X 4BIRA 1Q7HA 3WMDA 5IG4A 2AADA 2Y74A 2YFIB 4QWTA 4X2OA 3SXXA 5D81A 1GY6A 3MWZA 2SBLA 2OQEC 1D6ZA 2WGOA 1JBRA 1UDII 1LNIA 3D5GA 1VQM3 1YJ93 3S5CA 3NV0B 3CD63 1OF5B 1RN7A 1FUWA 1A2PA 1Q9EA 1MNLA 2CFWA 2RNTA 1AV4A 1EUIC 3MG1A 1V57A 3JUPA 3LTCA 5LC6A 1AVKA 5TGNA 2W9QA 3PXMA 3PYJA 4J5KA 1KD14 6RNTA 4BTWA 2L4VA 1I2EA 3SOYA 1RGEA 1YVBI 4HYZA 1RJOA 3EC9A 2CIUA 4HAAA 5CLKA 1SARA 3A5EA 1DVDA 1EG9B 1B21A 1EA2A 4R9KA 1KQS2 2W6JH 1NB5I 5DREA 1T3BA 5JBSA 3UL5A 5IEOA 1A90A 1FGOA 1K734 5AYSC 4EBGA 1LQGC 1GYBA 1U5OA 4XDVA 1ULIB 2Z76A 3PZWA 2F5MA 2HMKB 2K0MA 5AEUB 2XR8B 3WDGB 1BSDA 1B20A 2KF6A 3NBBA 3UL6A 2OCTA 3D79A 5M1AA 3MHEA 3ECFA 1TFOA 1VQK3 4LSOA 3AGOA 4NREA 1U8CB 4R9LA 7GSPA 1RGLA 1LQMB 1RMSA 3G8ZA 2B24B 3LXUX 2IUKA 1FUTA 1BRGA 3JVCA 5KP4A 5AIGA 1WTHA 3V99A 1MGWA 3NHXA 4JF8A 1B2MA 4EXRA 3EN1B 3F7SA 2KCDA 3S67A 3CCL3 5BIRA 3WOFB 1N9JA 1RGHA 3I553 2JQ5A 1WMNA 1RCKA 3GZRA 2ZA4A 2HMOB 3K7CA 4FMCA 3KSED 3H51A 3ZG5A 1BGSA 2OOVC 3X3XA 1MWRA 1X1YA 1OACA 1JV2B 1W6GA 1I8VA 1KC84 3NXJA 3HZPA 2W56B 8RNTA 5AI1A 2RBIA 5EEOA 2XFTA 1BUQA 3HIGA 4IPBA 2CKFB 3BIRA 1IT8A 1W01A 4KZ1A 1RGCA 4LGQA 1RGFA 2R41A 4OK0A 4PEJA 4EV5A 5IEPA 1VQ83 1D6UA 1UW1A 1RGAA 4FMAA 3B4OA 1MWTA 2BMQB 3PS8A 1E97A 4AKZA 5IG0A 3KCHA 2INXA 1LRAA 1I3FA 1TFKA 1TP6A 4LZIA 3IJEB 4HKVB 3CNMA 3SVAA 1WMOA 4HM2B 4HM6B 1OGZA 4JRFA 3F9SA 3DGMA 3X3YA 1VQ43 4KFFA 3U1WA 3CC43 1LOXA 2H0GA 1OHPA 3K0ZA 5ELUA 5A0OB 1EQKA 9RNTA 1BNIA 4J5GA 3LTDA 1LNHA 2E2VA 2F98A 4X2HA 1Z1SA 1QAKA 2CG1A 1B2XA 3AHSA 1SJWA 3DGOA 3EE1A 1FGMA 2KAAA 5AYRB 1WQLB 1G02A 1NO3A 3EX9A 3AMOB 4ORLA 3F40A 4FCMA 3IMAB 1ZX2A 5IENA 4GSPA 1G96A 3FSDA 2BMRB 3FG1A 5CK6A 5AIFA 3K63A 4FMDA 4WYKB 4FMBA 1BRNL 1Q42A 4NPBA 1I0VA 1YNVX 3FH1A 4K61A 3X3ZA 4CCVA 1VQN3 2MF7A 3LH4A 4OVMA 4U13A 2QGUA 5JPPA 1IQ8A 1M9GA 1N5HA 4L8OA 5BXQA 4MMXB 5IERA 3S28A 1LVNA 2C11A 4ILFA 3QK9A 3F8HA 5G2GA 2CWTA 3WOEB 5IW9A 1MGRA 2XFSA 1IQXA 1UUGB 3M8CA 1ZS7A 5HOHA 1RRHA 3MKIA 1W5ZA 2QIYA 1OPYA 3OXAA 3BB9A 3SX1A 2IY2A 2RGQA 2F5WA 4H3UA 2K3DA 1C54A 2GU3A 1FZUA 1LOYA 4XM4A 1MOLA 1VQQA 4N6OB 1CYVA 3LT9A 4BL2A 1PY3A 1W4NA 4MEIA 3NBJA 3LMLA 2YFLB 3AHWA 2F86B 3N54B 3KFQC 4XBXA 3UJMA 1O7HB 1BNEA 3I563 3BU4A 1GSPA 2Z77A 4IIAA 1GY7A 1SPUA 2W56A 4O8SA 1Q814 2WO0A 2QEX3 3WODG 1S723 2GBWB 5DRVA 1F8NA 3K5TA 4IT7A 1UI8A 1WMPA 1R4YA 2P0MA 5GSPA 1T2HA 2GEYA 3LOYA 4L7KA 2CW9A 1QMAA 3Q2PA 1BUJA 4GB5A 1JKGB 1KSIA 5AIIA 3MG2A 4HJLB 1YI23 3ZFZA 1X1XA 1B3SA 2R4IA 4H61A 7STDA 2C4BA 2KXGA 3G6E3 2RSXA 1UCLA 1TIJA 3B7CA 3FZWA 3OV4A 4HM8B 2CX0A 2ML5A 1OUNA 3FG3A 5AEWB 3CPW2 1Q40A 2UX0A 3HOHA 3OWYA 1PFPA 2HMJB 2D1WA 3JUMA 3PCRA 2IYJA 3F7XA 1GOVA 3UB1A 1JN5A 1CH0A 4HM1B 2RCDA 2CH9A 1VQ93 3S27A 3BLZA 3X40A 5IG5A 2CFDA 2CG0A 3NBRA 4I5QA 3LZAA 5CF1A 1W02A 2HMMB 2GXFA 2Z7AA 4KVHA 5EVHA 3KN4A 3G0KA 3O8YA 1HU9A 3MG3A 2Q07A 4RZMA 4AEQA 1D6YA 1LOVA 2M7OA 2YX9A 3QRDA 2XGLA 1DE3A 4KT3B 5D83A 1IU7A 4RBNA 6STDA 1FGTA 1UI7A 1W2ZA 4N6TA 1SIHA 5AIHA 4R4KA 1AR0A 2W03A 2XEPA 3CPOA 3GZXB 4OUQA 1BIRA 3EHCA 4KFDA 2OTL3 4CJNA 4FR9A 1RN4A 1BSAA 1ZO2A 3B4PA 4FCZA 1YJN3 3CMA3 4WWUC 2UUGC 3CC23 4N6LA 1TTOA 1AY7A 2STDA 3LT8A 3DZLA 4O2HA 2F56A 3U97A 1VQ63 1RN1A 1AQZA 1X1UA 1NB3I 1EKMA 5M19A 2W04A 3CCU3 3N8BA 3KKGA 3WR2A 3DGYA 4ZM8A 1YIJ3 3JUOA 4O02B 1BVIA 3Q90A 1OHSA 3S29A 3OWSA 4N3VA 3X42A 1HYFA 1RLSA 2ZL8A 1JZOA 3FLJA 1W2B2 3NV0A 1BRSA 1OF5A 1V74A 3ROBA 2BIRA 3NUVA 1IT7A 2W0QA 1B2SA 1J2BA 1GD3A 1BNFA 1R4CA 3NQZA 4K1VA 1STFI 2RFRA 2Z6BA 1I70A 4STDA 3RNTA 5IF6A 1QVF2 3BNCA 1CEWI 4WHAA 4HZBB 4XB5A 1EEJA 3KZTA 3GZBA 4EC6A 4LEHA 3CXC2 1BRJA 1UGIA 2V1LA 4MMYB 3MYTA 1RRLA 2JDIH 2P0XA 4MJDA 1IV7A 1VQ73 1M904 1BAOA 1I2GA 4HM3B 5G1KA 2GBXB 1T2IA 1TRPA 4R80A 7RNTA 3NM2A 5D82A 1JB5A 1FGRA 2AAEA 3EJVA 5FW5A 1TRQA 3TDGA 2F99A 1PYLA 1IVUA 3NX0A 2FXTA 1YVSA 4LMIA 4Q53A 4N6MA 3G16A 1PU4A 3WA3A 2WOFA 4KFEA 1O7WB 1S5AA 1ROVA 1JZDA 2UGIA 1B2UA 2E2TA 3FKAA 5G1LA 5LC7A 1VZZA 2MC8A 1W00A 3X41A 1FA3A 2YFJB 4GHOA 1FYSA 2CWVA 1Q7Y4 1E3RA 5CXOA 1YGWA 3FG4A 2XSOB 3DGNA 3SYUA 1BU4A 3CCE3 1K41A 3GAXA 1IVWA 2XH9A 3KSPA 2WGQA 4J9AA 2WOHA 1GMRA 2B1XB 2P38A 3OX9A 4RNYA 2LYXA 2A15A 1JNQA 1ISKA 1O7NB 1I0XA 2O9UX 3T8UA 1QVG2 2BO9B 3D5IA 2PNCA 3B8LA 1B27A 3CME3 3CNXA 3CCJ3 1BRIA 1RTUA 4RNZA 1HZ1A 1JBSA 3D4AA 1RNTA 2XGNA 1YIT3 1I2FA 1MWSA 1A67A 4HOHA 2KF5A 1I3IA 5FGOA 1Y4KA 3Q1CA 5IG3A 3E99A 2FGTA 2P09A 4BTYA 3AGNA 1GOYA 3GWRA 4LYLB 4BL3A 1KWIA 1N9EA 4XDWA 4J8TA 3BNDA 5RNTA 2O3OA 1N5PA 1SIIA 3KIIA 2CX1A 4HM7B 1JB2A 4MMZB 1IVVA 2IUJA 1BOXA 1W6CA 1IQYA 1ASKA 2CHCA 3DH2A 3JUQA 4RNTA 3CCV3 3MPHA 4DKIA 4TX4A 3HI7A 1JB4A 3VSYA 1IDPA 2F4YA 3A76A 3EBTA 3GZYB 1M1XB 3STDA 1K9M4 3EB8A 1B2ZA 3VGNA 3FCSB 4K90B 2OQEA 3DXOA 1FW7A 2GSPA 1NJI4 4EV2A 1IVXA 1YHQ3 1RHLA 1UUWB 2ZDJA 4HVNA 2H0IA 3FF0A 1STDA 1BNRA 3D9RA 5M18A 3HK4A 1RGGA 3WHOA 2W9PA 1FUSA 1T5YA 3RGAA 3AMOA 1Q824 4WFOA 1ULJB 1GMQA 1RSNA 2IMJA 3G4S3 5CF2A 3LTAA 3SOAA 3LTBA 3NQYA 2H0HA 3FGYA 4HM0B 4N6V0 1E3VA 4WYKA 3ZG0A 1V58A 3H3HA 2ML6A 5ELJA 1NWWA 1VQP3 1RNBA 3DY5A 1K28A 3L0RA 1RDSA 1WNHA 2XF3A 1IYYA 1NU3A 1OGXA 4L8PA 2PZVA 2Y73A 3SLUA 3EQQB 3OWUA 3NM7A 1UCIA 3RDEA 1YGEA 2BT3A 2QA43 1N8R4 3ALAA 3UNLA 1DETA 1JRQA 1UCJA 1RKYA 1DMNA 3BNEA 1K8A4 4NHFA 4R1KA 4HBRA 1VQO3 4K1UA 1CYUA 2CFGA 2SARA 3EBYA 3CCQ3 4CDLA 1LXEA 1A2KA 3T8NA 1BNJA 3I0YA 1BANA 4BTXA 1GD4A 3CCS3 2OWPA 3RGRA 4FCJA 5EQLA 1IK3A 1SQWA 3Q3FA 2HMNB 2BU4A 3F14A 4HM5B 2C10A 1OHOA 5KP3A 2CFKA 2OOVA 2BNGA 4HM4B 3K9MC 4I4KA 1BSCA 1FGQA 4HZ9B 1BSBA 1G0TA 3EF8A 2L1SA 2OTJ3 3VF1A 1W7CA 4O3VA 2IA7A 3GRDA 4WP5A 1JBTA 3GSPA 2I9WA 4EW5A 5BU4A 1JKGA 1LOWA 3V98A 2LQVA 2CFLA 1Q864 2BHMA 2ZHXB 4GL6A 1UGHI 2J8XB 1O7PB 1DMMA 1N8QA 3ER7A 1Q40B 2E2UA 3DMCA 2GEXA 2HOHA 3SEDA 5JPUA 1BRKA 2HMLB 1AVLA 3URPA 3G713 1VQL3 3V92A 4BU4A 1JN5B 2XSHB 2XRXB 1O7MB 1NNVA 3DGLA 1BNSA 2FNQA 1L5GB 4N6UA 3CCM3 1BNGA 3OW22 3PGBA 3DM8A 3CC73 1TUHA 8CHOA 1O7GB 2CWUA 1BSEA 1BRHA 5I97A 1DVCA 1GY5A 1C7HA 1RGKA 1VQ53 3HX8A 2KRTA 1DMQA 1W6YA 3FF2A 2K54A 2P05A 1DYUA 5KP1A 1X1WA 1ROAA 5STDA 3N9HA 1IV9A 1GS3A 2W2CA 2CK3H 1TJDA 1MWUA 1CQSA 1HKXA 3T0UA 1OH0A 3F8XA 2KF4A 1GOUA 2D42A 4G1MB 3CU3A 2CC3A
chains in the Genus database with same CATH topology
2GU1A 1UUVB 3KE7A 1M1K4 5BVBA 3EN8A 3MSOA 1NDOB 3BNBA 1A2VA 1QAFA 3CCR3 3LYGA 4XBYA 1TU5A 4AKYA 1JJ22 3DUKA 5HGRA 1QJGA 1OCVA 3HIIA 3JUNA 1YJW3 1QALA 4EYCA 3IPTA 3J7Yd 3PCSA 2BMOB 4XBTA 4N6NB 1US1A 3D3LA 3WA2X 5IG4A 3WMDA 2Y74A 2YFIB 4QWTA 4X2OA 3SXXA 5D81A 1GY6A 3MWZA 2SBLA 2OQEC 1D6ZA 2WGOA 1VQM3 1YJ93 3S5CA 3NV0B 3CD63 1OF5B 1RN7A 1FUWA 1MNLA 2CFWA 3MG1A 1AV4A 5LC6A 5TGNA 3JUPA 3LTCA 4EV2A 1AVKA 2W9QA 3PXMA 3PYJA 1KD14 4BTWA 2L4VA 3SOYA 1YVBI 4HYZA 1RJOA 3EC9A 2CIUA 5CLKA 1DVDA 1EG9B 1EA2A 4R9KA 1KQS2 2W6JH 1NB5I 5DREA 5JBSA 3UL5A 5IEOA 1A90A 1FGOA 1K734 5AYSC 4EBGA 1GYBA 1U5OA 4XDVA 1ULIB 2Z76A 3PZWA 2HMKB 2K0MA 5AEUB 2XR8B 3WDGB 3NBBA 3UL6A 2OCTA 3MHEA 3ECFA 1TFOA 1VQK3 4LSOA 4NREA 1U8CB 4R9LA 3G8ZA 2B24B 3LXUX 2IUKA 3JVCA 5KP4A 5AIGA 1WTHA 3V99A 3NHXA 4JF8A 4EXRA 3EN1B 3F7SA 2KCDA 3S67A 3CCL3 3WOFB 1N9JA 3I553 2JQ5A 1WMNA 3GZRA 2HMOB 3K7CA 4FMCA 3KSED 3H51A 2OOVC 3X3XA 1OACA 1JV2B 1W6GA 1KC84 3NXJA 3HZPA 2W56B 5AI1A 5EEOA 2XFTA 1BUQA 3HIGA 4IPBA 2CKFB 4KZ1A 1IT8A 1W01A 4OK0A 4LGQA 4EV5A 1VQ83 4PEJA 5IEPA 1D6UA 1UW1A 4FMAA 3B4OA 2BMQB 3PS8A 1E97A 4AKZA 5IG0A 2INXA 1TFKA 1TP6A 4LZIA 3IJEB 4HKVB 3CNMA 3SVAA 1WMOA 4HM2B 4HM6B 1OGZA 4JRFA 3F9SA 3DGMA 3X3YA 1VQ43 4KFFA 3U1WA 3CC43 1LOXA 1OHPA 3K0ZA 5ELUA 5A0OB 1EQKA 3LTDA 1LNHA 2E2VA 2F98A 4X2HA 1Z1SA 1QAKA 2CG1A 1SJWA 3DGOA 3EE1A 1FGMA 5AYRB 1WQLB 1NO3A 3EX9A 3AMOB 4ORLA 3F40A 4FCMA 3IMAB 1ZX2A 5IENA 1G96A 3FSDA 2BMRB 3FG1A 5CK6A 5AIFA 3K63A 4FMDA 4WYKB 4FMBA 1Q42A 3FH1A 4K61A 3X3ZA 4CCVA 1VQN3 2MF7A 3LH4A 4OVMA 4U13A 2QGUA 5JPPA 1IQ8A 1N5HA 1M9GA 4L8OA 5BXQA 4MMXB 5IERA 3S28A 1LVNA 2C11A 5G2GA 3QK9A 3F8HA 3WOEB 2CWTA 5IW9A 2XFSA 1IQXA 3M8CA 1RRHA 3MKIA 1W5ZA 2QIYA 1OPYA 3OXAA 3BB9A 3SX1A 2RGQA 4H3UA 2GU3A 4XM4A 1MOLA 4N6OB 1CYVA 3LT9A 1W4NA 4MEIA 2D42A 3NBJA 3LMLA 2YFLB 4XBXA 2F86B 3N54B 3KFQC 3UJMA 1O7HB 3I563 2Z77A 4IIAA 1GY7A 1SPUA 2W56A 4O8SA 1Q814 2WO0A 2QEX3 3WODG 1S723 2GBWB 5DRVA 1F8NA 3K5TA 4IT7A 1UI8A 1WMPA 2P0MA 2GEYA 3LOYA 4L7KA 2CW9A 1QMAA 3Q2PA 4GB5A 1JKGB 1KSIA 5AIIA 3MG2A 4HJLB 1YI23 4H61A 7STDA 2KXGA 3G6E3 2RSXA 3B7CA 1TIJA 3OV4A 3FZWA 4HM8B 2ML5A 1OUNA 3FG3A 5AEWB 3CPW2 1Q40A 2UX0A 3OWYA 1PFPA 2HMJB 2D1WA 3JUMA 3PCRA 3F7XA 3UB1A 1JN5A 4HM1B 2RCDA 2CH9A 1VQ93 3S27A 3BLZA 3X40A 5IG5A 2CFDA 2CG0A 3NBRA 3LZAA 5CF1A 1W02A 2HMMB 2GXFA 2Z7AA 4KVHA 5EVHA 3KN4A 3G0KA 3O8YA 1HU9A 3MG3A 2Q07A 4RZMA 4AEQA 1D6YA 2M7OA 2YX9A 3QRDA 2XGLA 5D83A 1IU7A 4RBNA 6STDA 1FGTA 1UI7A 1W2ZA 4N6TA 1SIHA 5AIHA 4R4KA 1AR0A 2W03A 2XEPA 3CPOA 3GZXB 4OUQA 3EHCA 4KFDA 2OTL3 4FR9A 1ZO2A 3B4PA 4FCZA 1YJN3 3CMA3 4WWUC 3CC23 4N6LA 2STDA 3LT8A 3DZLA 4O2HA 3U97A 1VQ63 1NB3I 1EKMA 2W04A 3CCU3 3N8BA 3KKGA 1YIJ3 4ZM8A 3JUOA 4O02B 3Q90A 1OHSA 3S29A 3OWSA 4N3VA 3X42A 2ZL8A 3FLJA 1W2B2 3NV0A 1OF5A 1V74A 3ROBA 3NUVA 1IT7A 2W0QA 1J2BA 1GD3A 3NQZA 1R4CA 4K1VA 1STFI 2RFRA 2Z6BA 4STDA 5IF6A 1QVF2 3BNCA 1CEWI 4WHAA 4HZBB 4XB5A 3KZTA 3GZBA 4EC6A 4LEHA 3CXC2 4MMYB 2V1LA 3MYTA 1RRLA 2JDIH 2P0XA 4MJDA 1IV7A 1VQ73 1M904 4HM3B 2GBXB 4R80A 3NM2A 5D82A 1FGRA 1JB5A 3EJVA 5FW5A 3TDGA 2F99A 1IVUA 3NX0A 2FXTA 4LMIA 4Q53A 4N6MA 3G16A 1PU4A 3WA3A 2WOFA 4KFEA 1O7WB 1S5AA 1ROVA 3FKAA 2E2TA 5LC7A 2MC8A 1VZZA 1W00A 3X41A 1FA3A 2YFJB 2CWVA 1Q7Y4 1E3RA 5CXOA 3FG4A 2XSOB 3DGNA 3CCE3 1K41A 3GAXA 1IVWA 2XH9A 3KSPA 2WGQA 4J9AA 2WOHA 2B1XB 2P38A 3OX9A 4RNYA 2LYXA 2A15A 1JNQA 1ISKA 1O7NB 2O9UX 1QVG2 3T8UA 2BO9B 2PNCA 3B8LA 3CME3 3CNXA 3CCJ3 4RNZA 1YIT3 2XGNA 1A67A 5FGOA 1Y4KA 3Q1CA 5IG3A 3E99A 2FGTA 2P09A 4BTYA 3GWRA 1KWIA 1N9EA 4XDWA 4J8TA 3BNDA 2O3OA 1N5PA 1SIIA 3KIIA 4MMZB 4HM7B 1JB2A 1IVVA 2IUJA 1W6CA 1IQYA 1ASKA 2CHCA 3JUQA 3CCV3 3MPHA 4TX4A 3HI7A 1JB4A 3VSYA 1IDPA 3A76A 3EBTA 3GZYB 1M1XB 3STDA 1K9M4 3EB8A 3VGNA 3FCSB 4K90B 2OQEA 3DXOA 1NJI4 1IVXA 1YHQ3 1UUWB 2ZDJA 4HVNA 3FF0A 1STDA 3D9RA 3HK4A 2W9PA 1T5YA 3RGAA 3AMOA 1Q824 4WFOA 1ULJB 2IMJA 3G4S3 5CF2A 3LTAA 3SOAA 3LTBA 3NQYA 4HM0B 3FGYA 4N6V0 4WYKA 1E3VA 3H3HA 2ML6A 5ELJA 1NWWA 1VQP3 3DY5A 1K28A 3L0RA 1WNHA 2XF3A 1NU3A 1OGXA 4L8PA 2PZVA 2Y73A 3SLUA 3EQQB 3OWUA 3NM7A 1N8R4 3RDEA 1YGEA 2BT3A 2QA43 3ALAA 3UNLA 1JRQA 1RKYA 1DMNA 3BNEA 1K8A4 4NHFA 4R1KA 4HBRA 1VQO3 4K1UA 1CYUA 2CFGA 3EBYA 3CCQ3 4CDLA 1LXEA 1A2KA 3T8NA 3I0YA 4BTXA 1GD4A 3CCS3 2OWPA 3RGRA 4FCJA 5EQLA 1IK3A 1SQWA 2HMNB 3F14A 4HM5B 2C10A 1OHOA 5KP3A 2CFKA 2OOVA 2BNGA 4HM4B 3K9MC 4I4KA 1FGQA 4HZ9B 3EF8A 2OTJ3 3VF1A 1W7CA 4O3VA 2IA7A 3GRDA 4WP5A 2I9WA 1JKGA 3V98A 2LQVA 2CFLA 1Q864 2BHMA 4GL6A 1O7PB 1DMMA 1N8QA 3ER7A 1Q40B 2E2UA 3DMCA 2GEXA 3SEDA 5JPUA 2HMLB 1AVLA 3G713 1VQL3 3V92A 1JN5B 2XSHB 2XRXB 1O7MB 3DGLA 2FNQA 1L5GB 4N6UA 3CCM3 3OW22 3PGBA 3DM8A 3CC73 1TUHA 8CHOA 1O7GB 2CWUA 5I97A 1DVCA 1GY5A 1C7HA 1VQ53 3HX8A 2KRTA 1DMQA 1W6YA 3FF2A 2K54A 2P05A 1DYUA 5KP1A 1ROAA 5STDA 3N9HA 1IV9A 2W2CA 1GS3A 2CK3H 1CQSA 1HKXA 3T0UA 1OH0A 3F8XA 2R4IA 4G1MB 3CU3A 2CC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM 3;  3CCJ 3;  1YJ9 3;  1K9M 4;  1M1K 4;  3CD6 3;  1KC8 4;  3CPW 2;  3G71 3;  1W2B 2;  1VQL 3;  1Q81 4;  1YIT 3;  2QEX 3;  1NJI 4;  1N8R 4;  1VQK 3;  3CCR 3;  2QA4 3;  1YHQ 3;  2OTJ 3;  1S72 3;  3CCM 3;  1KD1 4;  1VQ9 3;  2OTL 3;  3OW2 2;  1QVF 2;  3CC7 3;  1JJ2 2;  1YJN 3;  1K8A 4;  1VQ8 3;  3CMA 3;  3CC2 3;  1YJW 3;  1VQ5 3;  1Q7Y 4;  1VQO 3;  1VQ6 3;  1Q82 4;  1KQS 2;  3CCE 3;  3CXC 2;  3CCQ 3;  3CCL 3;  3G4S 3;  1VQ7 3;  3CCU 3;  1M90 4;  1YI2 3;  3I55 3;  3CCS 3;  1Q86 4;  1K73 4;  1YIJ 3;  1VQN 3;  3CCV 3;  1VQP 3;  1VQ4 3;  1QVG 2;  3G6E 3;  3CC4 3;  3CME 3;  3I56 3; 
#chains in the Genus database with same CATH topology
 2GU1 A;  1UUV B;  3KE7 A;  1M1K 4;  5BVB A;  3EN8 A;  3MSO A;  1NDO B;  1GMP A;  3BNB A;  1A2V A;  1QAF A;  3CCR 3;  3LYG A;  4XBY A;  2KF3 A;  4CPK A;  1TU5 A;  4AKY A;  1JJ2 2;  3DUK A;  5HGR A;  6GSP A;  1QJG A;  1OCV A;  1UCK A;  3HII A;  3JUN A;  1YJW 3;  1QAL A;  4EYC A;  3IPT A;  3J7Y d;  3PCS A;  1RCL A;  2BMO B;  4XBT A;  4N6N B;  1US1 A;  1ZGX A;  3D3L A;  3WA2 X;  4BIR A;  1Q7H A;  3WMD A;  5IG4 A;  2AAD A;  2Y74 A;  2YFI B;  4QWT A;  4X2O A;  3SXX A;  5D81 A;  1GY6 A;  3MWZ A;  2SBL A;  2OQE C;  1D6Z A;  2WGO A;  1JBR A;  1UDI I;  1LNI A;  3D5G A;  1VQM 3;  1YJ9 3;  3S5C A;  3NV0 B;  3CD6 3;  1OF5 B;  1RN7 A;  1FUW A;  1A2P A;  1Q9E A;  1MNL A;  2CFW A;  2RNT A;  1AV4 A;  1EUI C;  3MG1 A;  1V57 A;  3JUP A;  3LTC A;  5LC6 A;  1AVK A;  5TGN A;  2W9Q A;  3PXM A;  3PYJ A;  4J5K A;  1KD1 4;  6RNT A;  4BTW A;  2L4V A;  1I2E A;  3SOY A;  1RGE A;  1YVB I;  4HYZ A;  1RJO A;  3EC9 A;  2CIU A;  4HAA A;  5CLK A;  1SAR A;  3A5E A;  1DVD A;  1EG9 B;  1B21 A;  1EA2 A;  4R9K A;  1KQS 2;  2W6J H;  1NB5 I;  5DRE A;  1T3B A;  5JBS A;  3UL5 A;  5IEO A;  1A90 A;  1FGO A;  1K73 4;  5AYS C;  4EBG A;  1LQG C;  1GYB A;  1U5O A;  4XDV A;  1ULI B;  2Z76 A;  3PZW A;  2F5M A;  2HMK B;  2K0M A;  5AEU B;  2XR8 B;  3WDG B;  1BSD A;  1B20 A;  2KF6 A;  3NBB A;  3UL6 A;  2OCT A;  3D79 A;  5M1A A;  3MHE A;  3ECF A;  1TFO A;  1VQK 3;  4LSO A;  3AGO A;  4NRE A;  1U8C B;  4R9L A;  7GSP A;  1RGL A;  1LQM B;  1RMS A;  3G8Z A;  2B24 B;  3LXU X;  2IUK A;  1FUT A;  1BRG A;  3JVC A;  5KP4 A;  5AIG A;  1WTH A;  3V99 A;  1MGW A;  3NHX A;  4JF8 A;  1B2M A;  4EXR A;  3EN1 B;  3F7S A;  2KCD A;  3S67 A;  3CCL 3;  5BIR A;  3WOF B;  1N9J A;  1RGH A;  3I55 3;  2JQ5 A;  1WMN A;  1RCK A;  3GZR A;  2ZA4 A;  2HMO B;  3K7C A;  4FMC A;  3KSE D;  3H51 A;  3ZG5 A;  1BGS A;  2OOV C;  3X3X A;  1MWR A;  1X1Y A;  1OAC A;  1JV2 B;  1W6G A;  1I8V A;  1KC8 4;  3NXJ A;  3HZP A;  2W56 B;  8RNT A;  5AI1 A;  2RBI A;  5EEO A;  2XFT A;  1BUQ A;  3HIG A;  4IPB A;  2CKF B;  3BIR A;  1IT8 A;  1W01 A;  4KZ1 A;  1RGC A;  4LGQ A;  1RGF A;  2R41 A;  4OK0 A;  4PEJ A;  4EV5 A;  5IEP A;  1VQ8 3;  1D6U A;  1UW1 A;  1RGA A;  4FMA A;  3B4O A;  1MWT A;  2BMQ B;  3PS8 A;  1E97 A;  4AKZ A;  5IG0 A;  3KCH A;  2INX A;  1LRA A;  1I3F A;  1TFK A;  1TP6 A;  4LZI A;  3IJE B;  4HKV B;  3CNM A;  3SVA A;  1WMO A;  4HM2 B;  4HM6 B;  1OGZ A;  4JRF A;  3F9S A;  3DGM A;  3X3Y A;  1VQ4 3;  4KFF A;  3U1W A;  3CC4 3;  1LOX A;  2H0G A;  1OHP A;  3K0Z A;  5ELU A;  5A0O B;  1EQK A;  9RNT A;  1BNI A;  4J5G A;  3LTD A;  1LNH A;  2E2V A;  2F98 A;  4X2H A;  1Z1S A;  1QAK A;  2CG1 A;  1B2X A;  3AHS A;  1SJW A;  3DGO A;  3EE1 A;  1FGM A;  2KAA A;  5AYR B;  1WQL B;  1G02 A;  1NO3 A;  3EX9 A;  3AMO B;  4ORL A;  3F40 A;  4FCM A;  3IMA B;  1ZX2 A;  5IEN A;  4GSP A;  1G96 A;  3FSD A;  2BMR B;  3FG1 A;  5CK6 A;  5AIF A;  3K63 A;  4FMD A;  4WYK B;  4FMB A;  1BRN L;  1Q42 A;  4NPB A;  1I0V A;  1YNV X;  3FH1 A;  4K61 A;  3X3Z A;  4CCV A;  1VQN 3;  2MF7 A;  3LH4 A;  4OVM A;  4U13 A;  2QGU A;  5JPP A;  1IQ8 A;  1M9G A;  1N5H A;  4L8O A;  5BXQ A;  4MMX B;  5IER A;  3S28 A;  1LVN A;  2C11 A;  4ILF A;  3QK9 A;  3F8H A;  5G2G A;  2CWT A;  3WOE B;  5IW9 A;  1MGR A;  2XFS A;  1IQX A;  1UUG B;  3M8C A;  1ZS7 A;  5HOH A;  1RRH A;  3MKI A;  1W5Z A;  2QIY A;  1OPY A;  3OXA A;  3BB9 A;  3SX1 A;  2IY2 A;  2RGQ A;  2F5W A;  4H3U A;  2K3D A;  1C54 A;  2GU3 A;  1FZU A;  1LOY A;  4XM4 A;  1MOL A;  1VQQ A;  4N6O B;  1CYV A;  3LT9 A;  4BL2 A;  1PY3 A;  1W4N A;  4MEI A;  3NBJ A;  3LML A;  2YFL B;  3AHW A;  2F86 B;  3N54 B;  3KFQ C;  4XBX A;  3UJM A;  1O7H B;  1BNE A;  3I56 3;  3BU4 A;  1GSP A;  2Z77 A;  4IIA A;  1GY7 A;  1SPU A;  2W56 A;  4O8S A;  1Q81 4;  2WO0 A;  2QEX 3;  3WOD G;  1S72 3;  2GBW B;  5DRV A;  1F8N A;  3K5T A;  4IT7 A;  1UI8 A;  1WMP A;  1R4Y A;  2P0M A;  5GSP A;  1T2H A;  2GEY A;  3LOY A;  4L7K A;  2CW9 A;  1QMA A;  3Q2P A;  1BUJ A;  4GB5 A;  1JKG B;  1KSI A;  5AII A;  3MG2 A;  4HJL B;  1YI2 3;  3ZFZ A;  1X1X A;  1B3S A;  2R4I A;  4H61 A;  7STD A;  2C4B A;  2KXG A;  3G6E 3;  2RSX A;  1UCL A;  1TIJ A;  3B7C A;  3FZW A;  3OV4 A;  4HM8 B;  2CX0 A;  2ML5 A;  1OUN A;  3FG3 A;  5AEW B;  3CPW 2;  1Q40 A;  2UX0 A;  3HOH A;  3OWY A;  1PFP A;  2HMJ B;  2D1W A;  3JUM A;  3PCR A;  2IYJ A;  3F7X A;  1GOV A;  3UB1 A;  1JN5 A;  1CH0 A;  4HM1 B;  2RCD A;  2CH9 A;  1VQ9 3;  3S27 A;  3BLZ A;  3X40 A;  5IG5 A;  2CFD A;  2CG0 A;  3NBR A;  4I5Q A;  3LZA A;  5CF1 A;  1W02 A;  2HMM B;  2GXF A;  2Z7A A;  4KVH A;  5EVH A;  3KN4 A;  3G0K A;  3O8Y A;  1HU9 A;  3MG3 A;  2Q07 A;  4RZM A;  4AEQ A;  1D6Y A;  1LOV A;  2M7O A;  2YX9 A;  3QRD A;  2XGL A;  1DE3 A;  4KT3 B;  5D83 A;  1IU7 A;  4RBN A;  6STD A;  1FGT A;  1UI7 A;  1W2Z A;  4N6T A;  1SIH A;  5AIH A;  4R4K A;  1AR0 A;  2W03 A;  2XEP A;  3CPO A;  3GZX B;  4OUQ A;  1BIR A;  3EHC A;  4KFD A;  2OTL 3;  4CJN A;  4FR9 A;  1RN4 A;  1BSA A;  1ZO2 A;  3B4P A;  4FCZ A;  1YJN 3;  3CMA 3;  4WWU C;  2UUG C;  3CC2 3;  4N6L A;  1TTO A;  1AY7 A;  2STD A;  3LT8 A;  3DZL A;  4O2H A;  2F56 A;  3U97 A;  1VQ6 3;  1RN1 A;  1AQZ A;  1X1U A;  1NB3 I;  1EKM A;  5M19 A;  2W04 A;  3CCU 3;  3N8B A;  3KKG A;  3WR2 A;  3DGY A;  4ZM8 A;  1YIJ 3;  3JUO A;  4O02 B;  1BVI A;  3Q90 A;  1OHS A;  3S29 A;  3OWS A;  4N3V A;  3X42 A;  1HYF A;  1RLS A;  2ZL8 A;  1JZO A;  3FLJ A;  1W2B 2;  3NV0 A;  1BRS A;  1OF5 A;  1V74 A;  3ROB A;  2BIR A;  3NUV A;  1IT7 A;  2W0Q A;  1B2S A;  1J2B A;  1GD3 A;  1BNF A;  1R4C A;  3NQZ A;  4K1V A;  1STF I;  2RFR A;  2Z6B A;  1I70 A;  4STD A;  3RNT A;  5IF6 A;  1QVF 2;  3BNC A;  1CEW I;  4WHA A;  4HZB B;  4XB5 A;  1EEJ A;  3KZT A;  3GZB A;  4EC6 A;  4LEH A;  3CXC 2;  1BRJ A;  1UGI A;  2V1L A;  4MMY B;  3MYT A;  1RRL A;  2JDI H;  2P0X A;  4MJD A;  1IV7 A;  1VQ7 3;  1M90 4;  1BAO A;  1I2G A;  4HM3 B;  5G1K A;  2GBX B;  1T2I A;  1TRP A;  4R80 A;  7RNT A;  3NM2 A;  5D82 A;  1JB5 A;  1FGR A;  2AAE A;  3EJV A;  5FW5 A;  1TRQ A;  3TDG A;  2F99 A;  1PYL A;  1IVU A;  3NX0 A;  2FXT A;  1YVS A;  4LMI A;  4Q53 A;  4N6M A;  3G16 A;  1PU4 A;  3WA3 A;  2WOF A;  4KFE A;  1O7W B;  1S5A A;  1ROV A;  1JZD A;  2UGI A;  1B2U A;  2E2T A;  3FKA A;  5G1L A;  5LC7 A;  1VZZ A;  2MC8 A;  1W00 A;  3X41 A;  1FA3 A;  2YFJ B;  4GHO A;  1FYS A;  2CWV A;  1Q7Y 4;  1E3R A;  5CXO A;  1YGW A;  3FG4 A;  2XSO B;  3DGN A;  3SYU A;  1BU4 A;  3CCE 3;  1K41 A;  3GAX A;  1IVW A;  2XH9 A;  3KSP A;  2WGQ A;  4J9A A;  2WOH A;  1GMR A;  2B1X B;  2P38 A;  3OX9 A;  4RNY A;  2LYX A;  2A15 A;  1JNQ A;  1ISK A;  1O7N B;  1I0X A;  2O9U X;  3T8U A;  1QVG 2;  2BO9 B;  3D5I A;  2PNC A;  3B8L A;  1B27 A;  3CME 3;  3CNX A;  3CCJ 3;  1BRI A;  1RTU A;  4RNZ A;  1HZ1 A;  1JBS A;  3D4A A;  1RNT A;  2XGN A;  1YIT 3;  1I2F A;  1MWS A;  1A67 A;  4HOH A;  2KF5 A;  1I3I A;  5FGO A;  1Y4K A;  3Q1C A;  5IG3 A;  3E99 A;  2FGT A;  2P09 A;  4BTY A;  3AGN A;  1GOY A;  3GWR A;  4LYL B;  4BL3 A;  1KWI A;  1N9E A;  4XDW A;  4J8T A;  3BND A;  5RNT A;  2O3O A;  1N5P A;  1SII A;  3KII A;  2CX1 A;  4HM7 B;  1JB2 A;  4MMZ B;  1IVV A;  2IUJ A;  1BOX A;  1W6C A;  1IQY A;  1ASK A;  2CHC A;  3DH2 A;  3JUQ A;  4RNT A;  3CCV 3;  3MPH A;  4DKI A;  4TX4 A;  3HI7 A;  1JB4 A;  3VSY A;  1IDP A;  2F4Y A;  3A76 A;  3EBT A;  3GZY B;  1M1X B;  3STD A;  1K9M 4;  3EB8 A;  1B2Z A;  3VGN A;  3FCS B;  4K90 B;  2OQE A;  3DXO A;  1FW7 A;  2GSP A;  1NJI 4;  4EV2 A;  1IVX A;  1YHQ 3;  1RHL A;  1UUW B;  2ZDJ A;  4HVN A;  2H0I A;  3FF0 A;  1STD A;  1BNR A;  3D9R A;  5M18 A;  3HK4 A;  1RGG A;  3WHO A;  2W9P A;  1FUS A;  1T5Y A;  3RGA A;  3AMO A;  1Q82 4;  4WFO A;  1ULJ B;  1GMQ A;  1RSN A;  2IMJ A;  3G4S 3;  5CF2 A;  3LTA A;  3SOA A;  3LTB A;  3NQY A;  2H0H A;  3FGY A;  4HM0 B;  4N6V 0;  1E3V A;  4WYK A;  3ZG0 A;  1V58 A;  3H3H A;  2ML6 A;  5ELJ A;  1NWW A;  1VQP 3;  1RNB A;  3DY5 A;  1K28 A;  3L0R A;  1RDS A;  1WNH A;  2XF3 A;  1IYY A;  1NU3 A;  1OGX A;  4L8P A;  2PZV A;  2Y73 A;  3SLU A;  3EQQ B;  3OWU A;  3NM7 A;  1UCI A;  3RDE A;  1YGE A;  2BT3 A;  2QA4 3;  1N8R 4;  3ALA A;  3UNL A;  1DET A;  1JRQ A;  1UCJ A;  1RKY A;  1DMN A;  3BNE A;  1K8A 4;  4NHF A;  4R1K A;  4HBR A;  1VQO 3;  4K1U A;  1CYU A;  2CFG A;  2SAR A;  3EBY A;  3CCQ 3;  4CDL A;  1LXE A;  1A2K A;  3T8N A;  1BNJ A;  3I0Y A;  1BAN A;  4BTX A;  1GD4 A;  3CCS 3;  2OWP A;  3RGR A;  4FCJ A;  5EQL A;  1IK3 A;  1SQW A;  3Q3F A;  2HMN B;  2BU4 A;  3F14 A;  4HM5 B;  2C10 A;  1OHO A;  5KP3 A;  2CFK A;  2OOV A;  2BNG A;  4HM4 B;  3K9M C;  4I4K A;  1BSC A;  1FGQ A;  4HZ9 B;  1BSB A;  1G0T A;  3EF8 A;  2L1S A;  2OTJ 3;  3VF1 A;  1W7C A;  4O3V A;  2IA7 A;  3GRD A;  4WP5 A;  1JBT A;  3GSP A;  2I9W A;  4EW5 A;  5BU4 A;  1JKG A;  1LOW A;  3V98 A;  2LQV A;  2CFL A;  1Q86 4;  2BHM A;  2ZHX B;  4GL6 A;  1UGH I;  2J8X B;  1O7P B;  1DMM A;  1N8Q A;  3ER7 A;  1Q40 B;  2E2U A;  3DMC A;  2GEX A;  2HOH A;  3SED A;  5JPU A;  1BRK A;  2HML B;  1AVL A;  3URP A;  3G71 3;  1VQL 3;  3V92 A;  4BU4 A;  1JN5 B;  2XSH B;  2XRX B;  1O7M B;  1NNV A;  3DGL A;  1BNS A;  2FNQ A;  1L5G B;  4N6U A;  3CCM 3;  1BNG A;  3OW2 2;  3PGB A;  3DM8 A;  3CC7 3;  1TUH A;  8CHO A;  1O7G B;  2CWU A;  1BSE A;  1BRH A;  5I97 A;  1DVC A;  1GY5 A;  1C7H A;  1RGK A;  1VQ5 3;  3HX8 A;  2KRT A;  1DMQ A;  1W6Y A;  3FF2 A;  2K54 A;  2P05 A;  1DYU A;  5KP1 A;  1X1W A;  1ROA A;  5STD A;  3N9H A;  1IV9 A;  1GS3 A;  2W2C A;  2CK3 H;  1TJD A;  1MWU A;  1CQS A;  1HKX A;  3T0U A;  1OH0 A;  3F8X A;  2KF4 A;  1GOU A;  2D42 A;  4G1M B;  3CU3 A;  2CC3 A; 
#chains in the Genus database with same CATH homology
 2GU1 A;  1UUV B;  3KE7 A;  1M1K 4;  5BVB A;  3EN8 A;  3MSO A;  1NDO B;  3BNB A;  1A2V A;  1QAF A;  3CCR 3;  3LYG A;  4XBY A;  1TU5 A;  4AKY A;  1JJ2 2;  3DUK A;  5HGR A;  1QJG A;  1OCV A;  3HII A;  3JUN A;  1YJW 3;  1QAL A;  4EYC A;  3IPT A;  3J7Y d;  3PCS A;  2BMO B;  4XBT A;  4N6N B;  1US1 A;  3D3L A;  3WA2 X;  5IG4 A;  3WMD A;  2Y74 A;  2YFI B;  4QWT A;  4X2O A;  3SXX A;  5D81 A;  1GY6 A;  3MWZ A;  2SBL A;  2OQE C;  1D6Z A;  2WGO A;  1VQM 3;  1YJ9 3;  3S5C A;  3NV0 B;  3CD6 3;  1OF5 B;  1RN7 A;  1FUW A;  1MNL A;  2CFW A;  3MG1 A;  1AV4 A;  5LC6 A;  5TGN A;  3JUP A;  3LTC A;  4EV2 A;  1AVK A;  2W9Q A;  3PXM A;  3PYJ A;  1KD1 4;  4BTW A;  2L4V A;  3SOY A;  1YVB I;  4HYZ A;  1RJO A;  3EC9 A;  2CIU A;  5CLK A;  1DVD A;  1EG9 B;  1EA2 A;  4R9K A;  1KQS 2;  2W6J H;  1NB5 I;  5DRE A;  5JBS A;  3UL5 A;  5IEO A;  1A90 A;  1FGO A;  1K73 4;  5AYS C;  4EBG A;  1GYB A;  1U5O A;  4XDV A;  1ULI B;  2Z76 A;  3PZW A;  2HMK B;  2K0M A;  5AEU B;  2XR8 B;  3WDG B;  3NBB A;  3UL6 A;  2OCT A;  3MHE A;  3ECF A;  1TFO A;  1VQK 3;  4LSO A;  4NRE A;  1U8C B;  4R9L A;  3G8Z A;  2B24 B;  3LXU X;  2IUK A;  3JVC A;  5KP4 A;  5AIG A;  1WTH A;  3V99 A;  3NHX A;  4JF8 A;  4EXR A;  3EN1 B;  3F7S A;  2KCD A;  3S67 A;  3CCL 3;  3WOF B;  1N9J A;  3I55 3;  2JQ5 A;  1WMN A;  3GZR A;  2HMO B;  3K7C A;  4FMC A;  3KSE D;  3H51 A;  2OOV C;  3X3X A;  1OAC A;  1JV2 B;  1W6G A;  1KC8 4;  3NXJ A;  3HZP A;  2W56 B;  5AI1 A;  5EEO A;  2XFT A;  1BUQ A;  3HIG A;  4IPB A;  2CKF B;  4KZ1 A;  1IT8 A;  1W01 A;  4OK0 A;  4LGQ A;  4EV5 A;  1VQ8 3;  4PEJ A;  5IEP A;  1D6U A;  1UW1 A;  4FMA A;  3B4O A;  2BMQ B;  3PS8 A;  1E97 A;  4AKZ A;  5IG0 A;  2INX A;  1TFK A;  1TP6 A;  4LZI A;  3IJE B;  4HKV B;  3CNM A;  3SVA A;  1WMO A;  4HM2 B;  4HM6 B;  1OGZ A;  4JRF A;  3F9S A;  3DGM A;  3X3Y A;  1VQ4 3;  4KFF A;  3U1W A;  3CC4 3;  1LOX A;  1OHP A;  3K0Z A;  5ELU A;  5A0O B;  1EQK A;  3LTD A;  1LNH A;  2E2V A;  2F98 A;  4X2H A;  1Z1S A;  1QAK A;  2CG1 A;  1SJW A;  3DGO A;  3EE1 A;  1FGM A;  5AYR B;  1WQL B;  1NO3 A;  3EX9 A;  3AMO B;  4ORL A;  3F40 A;  4FCM A;  3IMA B;  1ZX2 A;  5IEN A;  1G96 A;  3FSD A;  2BMR B;  3FG1 A;  5CK6 A;  5AIF A;  3K63 A;  4FMD A;  4WYK B;  4FMB A;  1Q42 A;  3FH1 A;  4K61 A;  3X3Z A;  4CCV A;  1VQN 3;  2MF7 A;  3LH4 A;  4OVM A;  4U13 A;  2QGU A;  5JPP A;  1IQ8 A;  1N5H A;  1M9G A;  4L8O A;  5BXQ A;  4MMX B;  5IER A;  3S28 A;  1LVN A;  2C11 A;  5G2G A;  3QK9 A;  3F8H A;  3WOE B;  2CWT A;  5IW9 A;  2XFS A;  1IQX A;  3M8C A;  1RRH A;  3MKI A;  1W5Z A;  2QIY A;  1OPY A;  3OXA A;  3BB9 A;  3SX1 A;  2RGQ A;  4H3U A;  2GU3 A;  4XM4 A;  1MOL A;  4N6O B;  1CYV A;  3LT9 A;  1W4N A;  4MEI A;  2D42 A;  3NBJ A;  3LML A;  2YFL B;  4XBX A;  2F86 B;  3N54 B;  3KFQ C;  3UJM A;  1O7H B;  3I56 3;  2Z77 A;  4IIA A;  1GY7 A;  1SPU A;  2W56 A;  4O8S A;  1Q81 4;  2WO0 A;  2QEX 3;  3WOD G;  1S72 3;  2GBW B;  5DRV A;  1F8N A;  3K5T A;  4IT7 A;  1UI8 A;  1WMP A;  2P0M A;  2GEY A;  3LOY A;  4L7K A;  2CW9 A;  1QMA A;  3Q2P A;  4GB5 A;  1JKG B;  1KSI A;  5AII A;  3MG2 A;  4HJL B;  1YI2 3;  4H61 A;  7STD A;  2KXG A;  3G6E 3;  2RSX A;  3B7C A;  1TIJ A;  3OV4 A;  3FZW A;  4HM8 B;  2ML5 A;  1OUN A;  3FG3 A;  5AEW B;  3CPW 2;  1Q40 A;  2UX0 A;  3OWY A;  1PFP A;  2HMJ B;  2D1W A;  3JUM A;  3PCR A;  3F7X A;  3UB1 A;  1JN5 A;  4HM1 B;  2RCD A;  2CH9 A;  1VQ9 3;  3S27 A;  3BLZ A;  3X40 A;  5IG5 A;  2CFD A;  2CG0 A;  3NBR A;  3LZA A;  5CF1 A;  1W02 A;  2HMM B;  2GXF A;  2Z7A A;  4KVH A;  5EVH A;  3KN4 A;  3G0K A;  3O8Y A;  1HU9 A;  3MG3 A;  2Q07 A;  4RZM A;  4AEQ A;  1D6Y A;  2M7O A;  2YX9 A;  3QRD A;  2XGL A;  5D83 A;  1IU7 A;  4RBN A;  6STD A;  1FGT A;  1UI7 A;  1W2Z A;  4N6T A;  1SIH A;  5AIH A;  4R4K A;  1AR0 A;  2W03 A;  2XEP A;  3CPO A;  3GZX B;  4OUQ A;  3EHC A;  4KFD A;  2OTL 3;  4FR9 A;  1ZO2 A;  3B4P A;  4FCZ A;  1YJN 3;  3CMA 3;  4WWU C;  3CC2 3;  4N6L A;  2STD A;  3LT8 A;  3DZL A;  4O2H A;  3U97 A;  1VQ6 3;  1NB3 I;  1EKM A;  2W04 A;  3CCU 3;  3N8B A;  3KKG A;  1YIJ 3;  4ZM8 A;  3JUO A;  4O02 B;  3Q90 A;  1OHS A;  3S29 A;  3OWS A;  4N3V A;  3X42 A;  2ZL8 A;  3FLJ A;  1W2B 2;  3NV0 A;  1OF5 A;  1V74 A;  3ROB A;  3NUV A;  1IT7 A;  2W0Q A;  1J2B A;  1GD3 A;  3NQZ A;  1R4C A;  4K1V A;  1STF I;  2RFR A;  2Z6B A;  4STD A;  5IF6 A;  1QVF 2;  3BNC A;  1CEW I;  4WHA A;  4HZB B;  4XB5 A;  3KZT A;  3GZB A;  4EC6 A;  4LEH A;  3CXC 2;  4MMY B;  2V1L A;  3MYT A;  1RRL A;  2JDI H;  2P0X A;  4MJD A;  1IV7 A;  1VQ7 3;  1M90 4;  4HM3 B;  2GBX B;  4R80 A;  3NM2 A;  5D82 A;  1FGR A;  1JB5 A;  3EJV A;  5FW5 A;  3TDG A;  2F99 A;  1IVU A;  3NX0 A;  2FXT A;  4LMI A;  4Q53 A;  4N6M A;  3G16 A;  1PU4 A;  3WA3 A;  2WOF A;  4KFE A;  1O7W B;  1S5A A;  1ROV A;  3FKA A;  2E2T A;  5LC7 A;  2MC8 A;  1VZZ A;  1W00 A;  3X41 A;  1FA3 A;  2YFJ B;  2CWV A;  1Q7Y 4;  1E3R A;  5CXO A;  3FG4 A;  2XSO B;  3DGN A;  3CCE 3;  1K41 A;  3GAX A;  1IVW A;  2XH9 A;  3KSP A;  2WGQ A;  4J9A A;  2WOH A;  2B1X B;  2P38 A;  3OX9 A;  4RNY A;  2LYX A;  2A15 A;  1JNQ A;  1ISK A;  1O7N B;  2O9U X;  1QVG 2;  3T8U A;  2BO9 B;  2PNC A;  3B8L A;  3CME 3;  3CNX A;  3CCJ 3;  4RNZ A;  1YIT 3;  2XGN A;  1A67 A;  5FGO A;  1Y4K A;  3Q1C A;  5IG3 A;  3E99 A;  2FGT A;  2P09 A;  4BTY A;  3GWR A;  1KWI A;  1N9E A;  4XDW A;  4J8T A;  3BND A;  2O3O A;  1N5P A;  1SII A;  3KII A;  4MMZ B;  4HM7 B;  1JB2 A;  1IVV A;  2IUJ A;  1W6C A;  1IQY A;  1ASK A;  2CHC A;  3JUQ A;  3CCV 3;  3MPH A;  4TX4 A;  3HI7 A;  1JB4 A;  3VSY A;  1IDP A;  3A76 A;  3EBT A;  3GZY B;  1M1X B;  3STD A;  1K9M 4;  3EB8 A;  3VGN A;  3FCS B;  4K90 B;  2OQE A;  3DXO A;  1NJI 4;  1IVX A;  1YHQ 3;  1UUW B;  2ZDJ A;  4HVN A;  3FF0 A;  1STD A;  3D9R A;  3HK4 A;  2W9P A;  1T5Y A;  3RGA A;  3AMO A;  1Q82 4;  4WFO A;  1ULJ B;  2IMJ A;  3G4S 3;  5CF2 A;  3LTA A;  3SOA A;  3LTB A;  3NQY A;  4HM0 B;  3FGY A;  4N6V 0;  4WYK A;  1E3V A;  3H3H A;  2ML6 A;  5ELJ A;  1NWW A;  1VQP 3;  3DY5 A;  1K28 A;  3L0R A;  1WNH A;  2XF3 A;  1NU3 A;  1OGX A;  4L8P A;  2PZV A;  2Y73 A;  3SLU A;  3EQQ B;  3OWU A;  3NM7 A;  1N8R 4;  3RDE A;  1YGE A;  2BT3 A;  2QA4 3;  3ALA A;  3UNL A;  1JRQ A;  1RKY A;  1DMN A;  3BNE A;  1K8A 4;  4NHF A;  4R1K A;  4HBR A;  1VQO 3;  4K1U A;  1CYU A;  2CFG A;  3EBY A;  3CCQ 3;  4CDL A;  1LXE A;  1A2K A;  3T8N A;  3I0Y A;  4BTX A;  1GD4 A;  3CCS 3;  2OWP A;  3RGR A;  4FCJ A;  5EQL A;  1IK3 A;  1SQW A;  2HMN B;  3F14 A;  4HM5 B;  2C10 A;  1OHO A;  5KP3 A;  2CFK A;  2OOV A;  2BNG A;  4HM4 B;  3K9M C;  4I4K A;  1FGQ A;  4HZ9 B;  3EF8 A;  2OTJ 3;  3VF1 A;  1W7C A;  4O3V A;  2IA7 A;  3GRD A;  4WP5 A;  2I9W A;  1JKG A;  3V98 A;  2LQV A;  2CFL A;  1Q86 4;  2BHM A;  4GL6 A;  1O7P B;  1DMM A;  1N8Q A;  3ER7 A;  1Q40 B;  2E2U A;  3DMC A;  2GEX A;  3SED A;  5JPU A;  2HML B;  1AVL A;  3G71 3;  1VQL 3;  3V92 A;  1JN5 B;  2XSH B;  2XRX B;  1O7M B;  3DGL A;  2FNQ A;  1L5G B;  4N6U A;  3CCM 3;  3OW2 2;  3PGB A;  3DM8 A;  3CC7 3;  1TUH A;  8CHO A;  1O7G B;  2CWU A;  5I97 A;  1DVC A;  1GY5 A;  1C7H A;  1VQ5 3;  3HX8 A;  2KRT A;  1DMQ A;  1W6Y A;  3FF2 A;  2K54 A;  2P05 A;  1DYU A;  5KP1 A;  1ROA A;  5STD A;  3N9H A;  1IV9 A;  2W2C A;  1GS3 A;  2CK3 H;  1CQS A;  1HKX A;  3T0U A;  1OH0 A;  3F8X A;  2R4I A;  4G1M B;  3CU3 A;  2CC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...