1Q824

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q82400
1VQ53 1VQ73 1VQ83 3CCR3 3CCU3 3CCV3 1VQL3 3CMA3 3CPW2 3G4S3 2OTJ3 3CC73 1M1K4 1YIJ3 1YI23 1KC84 1YJW3 1YHQ3 1Q814 1K9M4 1M904 3CC43 1VQP3 1S723 3CCL3 3CCM3 3G6E3 2QA43 1K734 1VQM3 1N8R4 3CD63 1Q7Y4 3I563 1Q824 1K8A4 1VQN3 1JJ22 2QEX3 1YJ93 3CME3 1KQS2 3I553 3CC23 3CCJ3 1KD14 1QVF2 1YIT3 3CCS3 1VQ43 1VQK3 1NJI4 3G713 3CXC2 3CCE3 1VQO3 1YJN3 3CCQ3 1Q864 1QVG2 1VQ93 1W2B2 3OW22 2OTL3 1VQ63
chains in the Genus database with same CATH superfamily
1NNVA 2H0HA 1LVNA 3WMDA 3FG1A 2Q07A 2RNTA 3FG4A 3MHEA 4MMZB 1FGTA 2BIRA 4HKVB 4N6MA 5DREA 3S29A 3MG1A 1WMNA 4J5GA 3X40A 1HKXA 1M904 2H0GA 2FNQA 2ZA4A 3OX9A 1N5HA 3HZPA 3GZYB 3MG3A 4XB5A 5FW5A 1TFOA 3FG3A 1UUVB 5KP1A 5I97A 3NQYA 1CEWI 2CFLA 3SEDA 1EKMA 3DUKA 3GAXA 3SOYA 2PNCA 8RNTA 1NWWA 2E2UA 2E2TA 3NHXA 3CCE3 1RGFA 1TUHA 3AGOA 1W2B2 1CYVA 1WMOA 4LSOA 3PCRA 1QAFA 3LTDA 1FYSA 1RRHA 2Z77A 1T5YA 3EBTA 3EBYA 1UI8A 2BMRB 2KF6A 1VQ73 1TFKA 1NU3A 1TJDA 2CWUA 1BRSA 1B2XA 1RGEA 1T3BA 1R4YA 3ECFA 1FZUA 4HM3B 1UI7A 3EX9A 6GSPA 1LRAA 1LQMB 1JKGB 2XRXB 4XM4A 1GOUA 4N3VA 3UL5A 3LH4A 1W4NA 4WHAA 1K734 4MMYB 5IERA 4EXRA 1IQXA 2KCDA 1TRQA 1W6CA 2OQEC 3U97A 4Q53A 2HMMB 3SLUA 1K8A4 1CH0A 1JN5B 3KFQC 1AQZA 4G1MB 1A2PA 1RRLA 2IUKA 3HK4A 5IEOA 3NXJA 1BRIA 2F86B 5CF1A 1BUJA 3OW22 2RSXA 1FGQA 2GEXA 4J5KA 3SOAA 2P38A 2H0IA 4KZ1A 1W5ZA 3X42A 1MGRA 1RSNA 4OK0A 1JKGA 2GU1A 3CCR3 1VQ83 1DETA 4ILFA 4N6UA 4AKYA 1M1XB 3BIRA 2CKFB 3MWZA 1M1K4 5AIGA 1EQKA 3FZWA 3BNDA 3N9HA 3U1WA 5IG0A 2QIYA 3M8CA 1LNIA 5G1LA 4LMIA 4FMCA 5DRVA 1GOVA 3X3ZA 3AHSA 1YVBI 1SJWA 1ROVA 3UL6A 3WODG 2W04A 3CCJ3 1VQK3 4CJNA 4NREA 3AMOB 2LYXA 3EQQB 4CDLA 3NBJA 4CCVA 2F99A 4X2OA 2P09A 1W2ZA 3FF0A 1UW1A 2CIUA 3I0YA 4PEJA 1OHPA 3G16A 3V98A 2B24B 2BO9B 2Y73A 4GHOA 1GY5A 2XF3A 2RBIA 1C7HA 3WOEB 1V74A 3CPW2 2OTJ3 1ROAA 2W6JH 3IJEB 1JRQA 1YIJ3 1UCIA 1I70A 4OVMA 1SQWA 1PFPA 1EG9B 1UGHI 1MGWA 3MYTA 3CD63 1SARA 1EA2A 1RGHA 3I563 1DMMA 4XBXA 5KP4A 1RKYA 3UJMA 1W00A 3A76A 1LOYA 1FA3A 4MJDA 4K1UA 2XH9A 3IPTA 2KRTA 4L7KA 5G1KA 5LC6A 4EW5A 3D5GA 5CLKA 1LNHA 3LTBA 1QVG2 4R1KA 2XSHB 2CFGA 3B4PA 4TX4A 8CHOA 1B2ZA 3WHOA 1GD3A 1Q42A 3D4AA 1JBSA 5A0OB 1IV9A 1Q9EA 3H51A 1EEJA 3NV0B 4EBGA 1K41A 1JV2B 1KWIA 3BNBA 1I3IA 1O7WB 4MEIA 3URPA 3ZG0A 1ZS7A 1YNVX 2YFLB 3PGBA 5CF2A 3DY5A 4LYLB 5AIIA 3CCM3 1N8R4 2C10A 2MF7A 1LQGC 1RNTA 1Q824 1WNHA 1GD4A 1RGLA 2HMOB 1X1UA 1BNGA 2XEPA 3I553 3HI7A 4KFEA 3ALAA 3ER7A 4EC6A 1Q864 4HZ9B 1YJN3 1N5PA 5M18A 2GBXB 3CNXA 1L5GB 1VQ63 1BRJA 1ASKA 2CG0A 3K5TA 2D42A 3NV0A 1O7MB 3JUQA 1O7HB 4LZIA 2C11A 3VGNA 2WOFA 5AEWB 3V92A 2GXFA 1G0TA 2KF3A 3DXOA 4R9LA 2UUGC 3T8NA 1KSIA 3H3HA 1YHQ3 1DVDA 2GSPA 2WGQA 1CYUA 4HZBB 1JZDA 3T8UA 4QWTA 1IK3A 1AVLA 2BMQB 1N8QA 3G8ZA 1D6ZA 1TIJA 1IYYA 3CU3A 2GBWB 3S67A 1YGWA 3OV4A 3K63A 1UUWB 4K61A 2CX1A 1WQLB 2RGQA 2HOHA 5ELUA 1OCVA 2OCTA 1IQYA 2D1WA 3DH2A 1ULIB 1W6GA 1BRHA 3DGMA 3G0KA 1SPUA 3WA2X 1I0VA 4XBTA 3DM8A 2F5MA 1OHSA 1FUWA 3B7CA 3K7CA 3G4S3 4X2HA 1R4CA 3MKIA 3GRDA 1X1YA 1YGEA 1BVIA 1RHLA 4N6LA 3LTCA 1OHOA 2Y74A 3GZBA 3PS8A 2P0XA 3STDA 3X3XA 1BNRA 1S5AA 3RGRA 1BGSA 1E97A 4RNZA 2XSOB 3JVCA 5G2GA 1JJ22 3L0RA 1STDA 1O7GB 1F8NA 3ZFZA 2CWTA 3EHCA 3QK9A 4LEHA 1NB5I 3V99A 1TTOA 4R9KA 1MWSA 1IT8A 2QGUA 4RZMA 4FCZA 2FXTA 5HOHA 5IG3A 1RN1A 4KVHA 1GYBA 5IG4A 2GU3A 3GZRA 4IT7A 1JB2A 3LOYA 1RTUA 2XGNA 1B2SA 3CCU3 3EJVA 1GY7A 3VF1A 4L8OA 3F14A 1YI23 4O02B 1ZGXA 1OGXA 3EN1B 1E3VA 2CC3A 3BB9A 2OQEA 5JPPA 4HM5B 1HYFA 1RGCA 5AYSC 1JN5A 2AAEA 1BSBA 5BXQA 7STDA 4O3VA 3QRDA 3WR2A 5TGNA 3HIGA 4GL6A 2RCDA 4HAAA 1X1WA 3E99A 1BNIA 2ML6A 3HIIA 4N6V0 3HX8A 1MWRA 2A15A 3S28A 3X3YA 2OOVC 2J8XB 1NJI4 1WMPA 1X1XA 1W6YA 3OXAA 1GMRA 3S5CA 1W02A 2CHCA 4AKZA 1A2VA 1RCKA 1UCJA 2IA7A 5M1AA 1PU4A 4RBNA 5CXOA 1I2FA 2BU4A 4I4KA 4J8TA 3DGOA 3KIIA 1J2BA 2GEYA 1HU9A 9RNTA 1US1A 3CC73 3Q2PA 1IT7A 4EV2A 4FMBA 1YVSA 4N6TA 2F5WA 1FGRA 2SBLA 4JRFA 2QA43 3PYJA 2JDIH 3F40A 3JUOA 1OACA 3D5IA 6STDA 5JBSA 1RN7A 2OOVA 1BRKA 3AMOA 2QEX3 1TP6A 2MC8A 3LT8A 1FW7A 4HYZA 1VQ43 2ML5A 4I5QA 1UDII 3HOHA 2WO0A 4BTWA 3PCSA 3J7Yd 4KT3B 1BRNL 1E3RA 1OUNA 4K1VA 1DVCA 1B3SA 1LXEA 4R80A 3NUVA 1MWTA 2IY2A 4CPKA 2CFDA 2KAAA 1MOLA 3RGAA 1IVXA 1IVWA 4HJLB 5IENA 1B2MA 3MG2A 1RJOA 4NPBA 3D9RA 3F8HA 1IV7A 2HMJB 3WA3A 3KKGA 1GOYA 1VZZA 5EEOA 1RMSA 1UGIA 3N8BA 1RN4A 1ZX2A 1VQM3 2M7OA 1FUSA 3DMCA 3JUNA 2P0MA 4BIRA 2XGLA 2CFWA 4FCJA 5AIFA 2INXA 3CNMA 1ISKA 1QAKA 4HM6B 1YIT3 4WYKB 1ULJB 1VQ93 2XFSA 1G02A 2STDA 3VSYA 3FGYA 1OF5B 1BSAA 1UCKA 2CW9A 2W56B 3FH1A 3NQZA 5AIHA 1RGGA 1NDOB 4JF8A 1SIHA 5IEPA 1Q7HA 5RNTA 4K90B 2F98A 1FGOA 3CCV3 1GSPA 3CMA3 1TU5A 2L1SA 4BTXA 5BU4A 1NB3I 3N54B 1RGAA 1LOXA 5BVBA 1YJW3 1K9M4 3LYGA 1HZ1A 5FGOA 2ZDJA 3MSOA 1NO3A 4WYKA 2Z76A 2IMJA 2ZHXB 2XR8B 3Q90A 1O7NB 1DYUA 2BHMA 4XBYA 3WDGB 5ELJA 1KQS2 2W0QA 1BSDA 3NBRA 3CC23 2YFJB 3JUPA 1FUTA 3CCS3 1IU7A 5IF6A 1AR0A 3Q1CA 3KSPA 3X41A 1CQSA 3F9SA 3KSED 1A2KA 1N9JA 3K9MC 2HMNB 3EN8A 3JUMA 4KFDA 1A67A 1O7PB 2ZL8A 2RFRA 1DMQA 1I2GA 1Y4KA 1AV4A 1TRPA 2F56A 3EC9A 3LMLA 4H61A 4DKIA 3FLJA 4NHFA 3WOFB 1Q814 4HOHA 1LOVA 2YFIB 2E2VA 3G6E3 4BTYA 2KXGA 3MPHA 4WP5A 5HGRA 4EV5A 1A90A 1VQN3 1V57A 5EVHA 1T2IA 2L4VA 4KFFA 1YJ93 2K0MA 5D82A 3NX0A 4HM2B 1KD14 5STDA 1K28A 1MWUA 2AADA 1BNJA 1PY3A 2O9UX 2I9WA 2O3OA 3FF2A 3O8YA 3Q3FA 4O2HA 2W9QA 4XDVA 3RNTA 1B20A 2P05A 2OTL3 4HBRA 3KCHA 3KN4A 3D79A 3IMAB 3BLZA 3ZG5A 1QJGA 3AHWA 1W01A 2HMKB 4EYCA 2PZVA 2UGIA 3OWUA 4BU4A 4IPBA 2YX9A 2LQVA 5LC7A 3NM2A 2Z6BA 3OWSA 1OPYA 1JNQA 4HM4B 4N6NB 1QALA 5KP3A 1IVVA 1JB5A 1MNLA 1B21A 1BANA 1BAOA 1BIRA 1BRGA 3DGYA 4HM8B 4LGQA 5D81A 1Z1SA 3B8LA 4U13A 4FMDA 2W9PA 2IUJA 3B4OA 1C54A 1BU4A 3CPOA 4RNYA 3PZWA 5M19A 4N6OB 5JPUA 1N9EA 3AGNA 3PXMA 4FMAA 3NBBA 4XDWA 6RNTA 1AY7A 3SXXA 3CCQ3 1DE3A 1WTHA 2CH9A 2V1LA 1EUIC 3BU4A 1W7CA 3LT9A 1T2HA 1BNEA 2KF5A 4STDA 2R41A 2W03A 2K54A 1VQ53 1B27A 3F8XA 4AEQA 1JZOA 4HM0B 2BT3A 4HM1B 3KZTA 2IYJA 5EQLA 1VQQA 2W2CA 3ROBA 1GMQA 4R4KA 4RNTA 1KC84 1BNSA 1IDPA 1UCLA 3CC43 1VQP3 1S723 5IW9A 1AVKA 1D6UA 3FKAA 4BL3A 4WFOA 3S27A 3F7SA 4H3UA 1BSEA 4J9AA 1DMNA 1QVF2 1STFI 1JB4A 2R4IA 3GSPA 3G713 3GZXB 1GS3A 1ZO2A 3CXC2 2WOHA 2XFTA 2CK3H 4MMXB 1I8VA 1BOXA 4FR9A 2FGTA 4HM7B 3FSDA 1RNBA 1VQL3 1I0XA 4GSPA 2WGOA 3DZLA 1PYLA 3BNCA 2KF4A 1SIIA 1JBTA 1D6YA 3D3LA 1B2UA 1BSCA 1QMAA 3KE7A 5GSPA 1FGMA 2B1XB 4L8PA 1RLSA 1G96A 1Q7Y4 2BNGA 3LZAA 1UUGB 3EF8A 2K3DA 1IVUA 1RDSA 3K0ZA 3CME3 2CWVA 3F7XA 5BIRA 3LTAA 3UNLA 3DGLA 1IQ8A 1OH0A 3OWYA 4FCMA 1GY6A 1Q40B 1JBRA 3BNEA 3SVAA 4IIAA 1GMPA 1U8CB 7RNTA 1OGZA 1M9GA 2C4BA 2CX0A 5CK6A 3A5EA 5AI1A 4ZM8A 3EB8A 3SYUA 4BL2A 1LOWA 3UB1A 2HMLB 1U5OA 2SARA 3SX1A 1RCLA 4WWUC 3CCL3 2CFKA 2CG1A 3T0UA 2OWPA 2F4YA 5IG5A 4O8SA 4GB5A 5AYRB 1V58A 2Z7AA 3DGNA 1BNFA 1RGKA 4HVNA 5AEUB 3GWRA 1I2EA 3TDGA 7GSPA 4OUQA 1OF5A 1Q40A 3FCSB 5D83A 2W56A 3LXUX 3RDEA 2JQ5A 2BMOB 3NM7A 1VQO3 4ORLA 1BUQA 2UX0A 3EE1A 1I3FA
chains in the Genus database with same CATH topology
1LVNA 3WMDA 3FG1A 2Q07A 3FG4A 3MHEA 4MMZB 1FGTA 4HKVB 4N6MA 5DREA 3S29A 3MG1A 1WMNA 3X40A 1HKXA 1M904 2FNQA 5FW5A 3OX9A 1N5HA 3HZPA 3GZYB 3MG3A 4XB5A 5KP1A 1TFOA 3FG3A 1UUVB 5I97A 3NQYA 1CEWI 2CFLA 3SEDA 1EKMA 3DUKA 3GAXA 3SOYA 2PNCA 1NWWA 2E2UA 2E2TA 3NHXA 3CCE3 1TUHA 1W2B2 1CYVA 1WMOA 4LSOA 3PCRA 1QAFA 3LTDA 2Z77A 1RRHA 3EBTA 1T5YA 3EBYA 1UI8A 2BMRB 1VQ73 1TFKA 1NU3A 2CWUA 3ECFA 4HM3B 1UI7A 3EX9A 4XM4A 2XRXB 1JKGB 3UL5A 4N3VA 3LH4A 1W4NA 4WHAA 1K734 4MMYB 5IERA 4EXRA 1IQXA 2KCDA 2OQEC 1W6CA 3U97A 4Q53A 2HMMB 3SLUA 1K8A4 1JN5B 3KFQC 4G1MB 1RRLA 2IUKA 3HK4A 5IEOA 3NXJA 2F86B 5CF1A 3OW22 2RSXA 1FGQA 2GEXA 3SOAA 2P38A 3X42A 4KZ1A 1W5ZA 4OK0A 1JKGA 2GU1A 3CCR3 1VQ83 4N6UA 4AKYA 1M1XB 2CKFB 3MWZA 1M1K4 5AIGA 1EQKA 3FZWA 3BNDA 3N9HA 3U1WA 5IG0A 2QIYA 3M8CA 4LMIA 4FMCA 5DRVA 3X3ZA 1SJWA 1YVBI 1ROVA 3UL6A 3WODG 2W04A 3CCJ3 4NREA 3AMOB 2LYXA 3EQQB 4CDLA 3NBJA 4CCVA 2F99A 4X2OA 2P09A 1W2ZA 3FF0A 1UW1A 2CIUA 3I0YA 4PEJA 1OHPA 3G16A 3V98A 2B24B 2BO9B 2Y73A 1GY5A 2XF3A 1C7HA 3WOEB 1V74A 3CPW2 2OTJ3 1ROAA 2W6JH 3IJEB 1JRQA 1YIJ3 4OVMA 1SQWA 1PFPA 1EG9B 3MYTA 3CD63 3I563 1EA2A 1DMMA 4XBXA 5KP4A 1RKYA 3UJMA 1W00A 3A76A 1FA3A 4MJDA 4K1UA 2XH9A 3IPTA 2KRTA 4L7KA 5LC6A 5CLKA 1LNHA 3LTBA 1QVG2 4R1KA 2XSHB 2CFGA 3B4PA 4TX4A 8CHOA 1GD3A 1Q42A 5A0OB 1IV9A 3H51A 3NV0B 4EBGA 1K41A 1JV2B 1KWIA 3BNBA 1O7WB 4MEIA 2YFLB 3PGBA 5CF2A 3DY5A 5AIIA 3CCM3 1N8R4 2C10A 2MF7A 1Q824 1WNHA 1GD4A 2HMOB 2XEPA 3I553 3HI7A 4KFEA 3ALAA 3ER7A 4EC6A 1Q864 4HZ9B 1YJN3 1N5PA 2GBXB 3CNXA 1L5GB 1VQ63 2CG0A 1ASKA 3K5TA 2D42A 3NV0A 1O7MB 3JUQA 1O7HB 4LZIA 2C11A 3VGNA 2WOFA 5AEWB 3V92A 2GXFA 3DXOA 4R9LA 3T8NA 1KSIA 3H3HA 1YHQ3 1DVDA 2WGQA 1CYUA 4HZBB 3T8UA 4QWTA 1IK3A 1AVLA 2BMQB 1N8QA 3G8ZA 1D6ZA 1TIJA 3CU3A 2GBWB 3S67A 3OV4A 3K63A 1UUWB 4K61A 1WQLB 2RGQA 5ELUA 1OCVA 2OCTA 1IQYA 2D1WA 1ULIB 1W6GA 3DGMA 3G0KA 1SPUA 3WA2X 4XBTA 3DM8A 1OHSA 1FUWA 3B7CA 3K7CA 3G4S3 4X2HA 1R4CA 3MKIA 3GRDA 1YGEA 4N6LA 3LTCA 1OHOA 2Y74A 3GZBA 3PS8A 2P0XA 3STDA 3X3XA 1S5AA 3RGRA 1E97A 4RNZA 2XSOB 3JVCA 5G2GA 1JJ22 3L0RA 1STDA 1O7GB 1F8NA 2CWTA 3EHCA 3QK9A 4LEHA 1NB5I 3V99A 4R9KA 1IT8A 2QGUA 4RZMA 4FCZA 2FXTA 5IG3A 4KVHA 1GYBA 5IG4A 2GU3A 3GZRA 4IT7A 1JB2A 3LOYA 2XGNA 3CCU3 3EJVA 1GY7A 3VF1A 4L8OA 3F14A 1YI23 4O02B 1OGXA 3EN1B 1E3VA 2CC3A 3BB9A 2OQEA 5JPPA 4HM5B 5AYSC 7STDA 1JN5A 5BXQA 4O3VA 3QRDA 5TGNA 3HIGA 4GL6A 2RCDA 3E99A 4N6V0 2ML6A 3HIIA 3HX8A 3S28A 2A15A 3X3YA 2OOVC 1NJI4 1WMPA 1W6YA 3OXAA 3S5CA 1W02A 2CHCA 4AKZA 1A2VA 2IA7A 1PU4A 4RBNA 5CXOA 4I4KA 4J8TA 3DGOA 3KIIA 1J2BA 2GEYA 1HU9A 3CC73 1US1A 3Q2PA 1IT7A 4EV2A 4FMBA 4N6TA 2SBLA 1FGRA 4JRFA 2QA43 3PYJA 2JDIH 3F40A 3JUOA 1OACA 6STDA 5JBSA 2QEX3 1RN7A 2OOVA 3AMOA 1TP6A 2MC8A 3LT8A 4HYZA 1VQ43 2ML5A 2WO0A 4BTWA 3PCSA 3J7Yd 1E3RA 1OUNA 4K1VA 1DVCA 1LXEA 4R80A 3NUVA 2CFDA 1MOLA 3RGAA 1IVXA 1IVWA 4HJLB 5IENA 3MG2A 1RJOA 3D9RA 3F8HA 1IV7A 2HMJB 3WA3A 3KKGA 1VZZA 5EEOA 3N8BA 1ZX2A 1VQM3 2M7OA 3DMCA 3JUNA 2P0MA 2XGLA 2CFWA 4FCJA 5AIFA 2INXA 3CNMA 1ISKA 1QAKA 4HM6B 1YIT3 4WYKB 1ULJB 1VQ93 2XFSA 3VSYA 2STDA 3FGYA 1OF5B 3NQZA 2CW9A 2W56B 3FH1A 5AIHA 5IEPA 1NDOB 4JF8A 1SIHA 4K90B 2F98A 1FGOA 3CCV3 3CMA3 1TU5A 4BTXA 1NB3I 3N54B 1LOXA 5BVBA 1YJW3 1K9M4 3LYGA 5FGOA 2ZDJA 3MSOA 1NO3A 4WYKA 2Z76A 2IMJA 3Q90A 2XR8B 1O7NB 1DYUA 2BHMA 4XBYA 3WDGB 5ELJA 1KQS2 2W0QA 3NBRA 3CC23 2YFJB 3JUPA 3CCS3 1IU7A 5IF6A 1AR0A 3Q1CA 3KSPA 3X41A 1CQSA 3F9SA 3KSED 1A2KA 1N9JA 3K9MC 2HMNB 3EN8A 3JUMA 4KFDA 1A67A 1O7PB 2ZL8A 2RFRA 1DMQA 3LMLA 1Y4KA 1AV4A 4H61A 3EC9A 3FLJA 4NHFA 3WOFB 1Q814 2YFIB 2E2VA 3G6E3 4BTYA 2KXGA 3MPHA 4WP5A 5HGRA 4EV5A 1A90A 1VQN3 5EVHA 2L4VA 4KFFA 1YJ93 2K0MA 5D82A 3NX0A 4HM2B 1KD14 5STDA 1K28A 5CK6A 1VQK3 3O8YA 2O9UX 2I9WA 2O3OA 3FF2A 4O2HA 2W9QA 4XDVA 2P05A 2OTL3 4HBRA 3KN4A 3IMAB 3BLZA 1QJGA 1W01A 2HMKB 4EYCA 2PZVA 3OWUA 4IPBA 2YX9A 2LQVA 5LC7A 3NM2A 2Z6BA 3OWSA 1OPYA 1JNQA 4HM4B 4N6NB 1QALA 5KP3A 1IVVA 1JB5A 1MNLA 4HM8B 4LGQA 5D81A 1Z1SA 3B8LA 4U13A 4FMDA 2W9PA 2IUJA 3B4OA 3CPOA 4RNYA 3PZWA 4N6OB 5JPUA 1N9EA 4FMAA 3PXMA 4XDWA 3NBBA 3CCQ3 3SXXA 1WTHA 2CH9A 2V1LA 3LT9A 1W7CA 1VQ53 4STDA 2W03A 2K54A 3F8XA 4AEQA 4HM0B 2BT3A 4HM1B 3KZTA 5EQLA 2W2CA 3ROBA 4R4KA 1KC84 1IDPA 3CC43 1VQP3 1S723 5IW9A 1AVKA 1D6UA 3FKAA 4WFOA 3S27A 3F7SA 4H3UA 4J9AA 1DMNA 1QVF2 1STFI 1JB4A 2R4IA 3G713 3CXC2 3GZXB 1GS3A 1ZO2A 2WOHA 2XFTA 2CK3H 4MMXB 4FR9A 2FGTA 4HM7B 3FSDA 1VQL3 2WGOA 3DZLA 3BNCA 1SIIA 1D6YA 3D3LA 3KE7A 1QMAA 1FGMA 2B1XB 4L8PA 1Q7Y4 1G96A 2BNGA 3LZAA 3EF8A 3K0ZA 1IVUA 3CME3 2CWVA 3F7XA 3LTAA 3UNLA 3DGLA 1IQ8A 1OH0A 3OWYA 4FCMA 1GY6A 1Q40B 3BNEA 3SVAA 4IIAA 1U8CB 1OGZA 1M9GA 5AI1A 4ZM8A 3EB8A 3UB1A 2HMLB 1U5OA 3SX1A 4WWUC 3CCL3 2CFKA 2CG1A 3T0UA 2OWPA 5IG5A 4O8SA 4GB5A 5AYRB 2Z7AA 3DGNA 4HVNA 5AEUB 3GWRA 3TDGA 4OUQA 1OF5A 1Q40A 3FCSB 5D83A 2W56A 3LXUX 3RDEA 2JQ5A 2BMOB 3NM7A 1VQO3 4ORLA 1BUQA 2UX0A 3EE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 3;  1VQ7 3;  1VQ8 3;  3CCR 3;  3CCU 3;  3CCV 3;  1VQL 3;  3CMA 3;  3CPW 2;  3G4S 3;  2OTJ 3;  3CC7 3;  1M1K 4;  1YIJ 3;  1YI2 3;  1KC8 4;  1YJW 3;  1YHQ 3;  1Q81 4;  1K9M 4;  1M90 4;  3CC4 3;  1VQP 3;  1S72 3;  3CCL 3;  3CCM 3;  3G6E 3;  2QA4 3;  1K73 4;  1VQM 3;  1N8R 4;  3CD6 3;  1Q7Y 4;  3I56 3;  1Q82 4;  1K8A 4;  1VQN 3;  1JJ2 2;  2QEX 3;  1YJ9 3;  3CME 3;  1KQS 2;  3I55 3;  3CC2 3;  3CCJ 3;  1KD1 4;  1QVF 2;  1YIT 3;  3CCS 3;  1VQ4 3;  1VQK 3;  1NJI 4;  3G71 3;  3CXC 2;  3CCE 3;  1VQO 3;  1YJN 3;  3CCQ 3;  1Q86 4;  1QVG 2;  1VQ9 3;  1W2B 2;  3OW2 2;  2OTL 3;  1VQ6 3; 
#chains in the Genus database with same CATH topology
 1NNV A;  2H0H A;  1LVN A;  3WMD A;  3FG1 A;  2Q07 A;  2RNT A;  3FG4 A;  3MHE A;  4MMZ B;  1FGT A;  2BIR A;  4HKV B;  4N6M A;  5DRE A;  3S29 A;  3MG1 A;  1WMN A;  4J5G A;  3X40 A;  1HKX A;  1M90 4;  2H0G A;  2FNQ A;  2ZA4 A;  3OX9 A;  1N5H A;  3HZP A;  3GZY B;  3MG3 A;  4XB5 A;  5FW5 A;  1TFO A;  3FG3 A;  1UUV B;  5KP1 A;  5I97 A;  3NQY A;  1CEW I;  2CFL A;  3SED A;  1EKM A;  3DUK A;  3GAX A;  3SOY A;  2PNC A;  8RNT A;  1NWW A;  2E2U A;  2E2T A;  3NHX A;  3CCE 3;  1RGF A;  1TUH A;  3AGO A;  1W2B 2;  1CYV A;  1WMO A;  4LSO A;  3PCR A;  1QAF A;  3LTD A;  1FYS A;  1RRH A;  2Z77 A;  1T5Y A;  3EBT A;  3EBY A;  1UI8 A;  2BMR B;  2KF6 A;  1VQ7 3;  1TFK A;  1NU3 A;  1TJD A;  2CWU A;  1BRS A;  1B2X A;  1RGE A;  1T3B A;  1R4Y A;  3ECF A;  1FZU A;  4HM3 B;  1UI7 A;  3EX9 A;  6GSP A;  1LRA A;  1LQM B;  1JKG B;  2XRX B;  4XM4 A;  1GOU A;  4N3V A;  3UL5 A;  3LH4 A;  1W4N A;  4WHA A;  1K73 4;  4MMY B;  5IER A;  4EXR A;  1IQX A;  2KCD A;  1TRQ A;  1W6C A;  2OQE C;  3U97 A;  4Q53 A;  2HMM B;  3SLU A;  1K8A 4;  1CH0 A;  1JN5 B;  3KFQ C;  1AQZ A;  4G1M B;  1A2P A;  1RRL A;  2IUK A;  3HK4 A;  5IEO A;  3NXJ A;  1BRI A;  2F86 B;  5CF1 A;  1BUJ A;  3OW2 2;  2RSX A;  1FGQ A;  2GEX A;  4J5K A;  3SOA A;  2P38 A;  2H0I A;  4KZ1 A;  1W5Z A;  3X42 A;  1MGR A;  1RSN A;  4OK0 A;  1JKG A;  2GU1 A;  3CCR 3;  1VQ8 3;  1DET A;  4ILF A;  4N6U A;  4AKY A;  1M1X B;  3BIR A;  2CKF B;  3MWZ A;  1M1K 4;  5AIG A;  1EQK A;  3FZW A;  3BND A;  3N9H A;  3U1W A;  5IG0 A;  2QIY A;  3M8C A;  1LNI A;  5G1L A;  4LMI A;  4FMC A;  5DRV A;  1GOV A;  3X3Z A;  3AHS A;  1YVB I;  1SJW A;  1ROV A;  3UL6 A;  3WOD G;  2W04 A;  3CCJ 3;  1VQK 3;  4CJN A;  4NRE A;  3AMO B;  2LYX A;  3EQQ B;  4CDL A;  3NBJ A;  4CCV A;  2F99 A;  4X2O A;  2P09 A;  1W2Z A;  3FF0 A;  1UW1 A;  2CIU A;  3I0Y A;  4PEJ A;  1OHP A;  3G16 A;  3V98 A;  2B24 B;  2BO9 B;  2Y73 A;  4GHO A;  1GY5 A;  2XF3 A;  2RBI A;  1C7H A;  3WOE B;  1V74 A;  3CPW 2;  2OTJ 3;  1ROA A;  2W6J H;  3IJE B;  1JRQ A;  1YIJ 3;  1UCI A;  1I70 A;  4OVM A;  1SQW A;  1PFP A;  1EG9 B;  1UGH I;  1MGW A;  3MYT A;  3CD6 3;  1SAR A;  1EA2 A;  1RGH A;  3I56 3;  1DMM A;  4XBX A;  5KP4 A;  1RKY A;  3UJM A;  1W00 A;  3A76 A;  1LOY A;  1FA3 A;  4MJD A;  4K1U A;  2XH9 A;  3IPT A;  2KRT A;  4L7K A;  5G1K A;  5LC6 A;  4EW5 A;  3D5G A;  5CLK A;  1LNH A;  3LTB A;  1QVG 2;  4R1K A;  2XSH B;  2CFG A;  3B4P A;  4TX4 A;  8CHO A;  1B2Z A;  3WHO A;  1GD3 A;  1Q42 A;  3D4A A;  1JBS A;  5A0O B;  1IV9 A;  1Q9E A;  3H51 A;  1EEJ A;  3NV0 B;  4EBG A;  1K41 A;  1JV2 B;  1KWI A;  3BNB A;  1I3I A;  1O7W B;  4MEI A;  3URP A;  3ZG0 A;  1ZS7 A;  1YNV X;  2YFL B;  3PGB A;  5CF2 A;  3DY5 A;  4LYL B;  5AII A;  3CCM 3;  1N8R 4;  2C10 A;  2MF7 A;  1LQG C;  1RNT A;  1Q82 4;  1WNH A;  1GD4 A;  1RGL A;  2HMO B;  1X1U A;  1BNG A;  2XEP A;  3I55 3;  3HI7 A;  4KFE A;  3ALA A;  3ER7 A;  4EC6 A;  1Q86 4;  4HZ9 B;  1YJN 3;  1N5P A;  5M18 A;  2GBX B;  3CNX A;  1L5G B;  1VQ6 3;  1BRJ A;  1ASK A;  2CG0 A;  3K5T A;  2D42 A;  3NV0 A;  1O7M B;  3JUQ A;  1O7H B;  4LZI A;  2C11 A;  3VGN A;  2WOF A;  5AEW B;  3V92 A;  2GXF A;  1G0T A;  2KF3 A;  3DXO A;  4R9L A;  2UUG C;  3T8N A;  1KSI A;  3H3H A;  1YHQ 3;  1DVD A;  2GSP A;  2WGQ A;  1CYU A;  4HZB B;  1JZD A;  3T8U A;  4QWT A;  1IK3 A;  1AVL A;  2BMQ B;  1N8Q A;  3G8Z A;  1D6Z A;  1TIJ A;  1IYY A;  3CU3 A;  2GBW B;  3S67 A;  1YGW A;  3OV4 A;  3K63 A;  1UUW B;  4K61 A;  2CX1 A;  1WQL B;  2RGQ A;  2HOH A;  5ELU A;  1OCV A;  2OCT A;  1IQY A;  2D1W A;  3DH2 A;  1ULI B;  1W6G A;  1BRH A;  3DGM A;  3G0K A;  1SPU A;  3WA2 X;  1I0V A;  4XBT A;  3DM8 A;  2F5M A;  1OHS A;  1FUW A;  3B7C A;  3K7C A;  3G4S 3;  4X2H A;  1R4C A;  3MKI A;  3GRD A;  1X1Y A;  1YGE A;  1BVI A;  1RHL A;  4N6L A;  3LTC A;  1OHO A;  2Y74 A;  3GZB A;  3PS8 A;  2P0X A;  3STD A;  3X3X A;  1BNR A;  1S5A A;  3RGR A;  1BGS A;  1E97 A;  4RNZ A;  2XSO B;  3JVC A;  5G2G A;  1JJ2 2;  3L0R A;  1STD A;  1O7G B;  1F8N A;  3ZFZ A;  2CWT A;  3EHC A;  3QK9 A;  4LEH A;  1NB5 I;  3V99 A;  1TTO A;  4R9K A;  1MWS A;  1IT8 A;  2QGU A;  4RZM A;  4FCZ A;  2FXT A;  5HOH A;  5IG3 A;  1RN1 A;  4KVH A;  1GYB A;  5IG4 A;  2GU3 A;  3GZR A;  4IT7 A;  1JB2 A;  3LOY A;  1RTU A;  2XGN A;  1B2S A;  3CCU 3;  3EJV A;  1GY7 A;  3VF1 A;  4L8O A;  3F14 A;  1YI2 3;  4O02 B;  1ZGX A;  1OGX A;  3EN1 B;  1E3V A;  2CC3 A;  3BB9 A;  2OQE A;  5JPP A;  4HM5 B;  1HYF A;  1RGC A;  5AYS C;  1JN5 A;  2AAE A;  1BSB A;  5BXQ A;  7STD A;  4O3V A;  3QRD A;  3WR2 A;  5TGN A;  3HIG A;  4GL6 A;  2RCD A;  4HAA A;  1X1W A;  3E99 A;  1BNI A;  2ML6 A;  3HII A;  4N6V 0;  3HX8 A;  1MWR A;  2A15 A;  3S28 A;  3X3Y A;  2OOV C;  2J8X B;  1NJI 4;  1WMP A;  1X1X A;  1W6Y A;  3OXA A;  1GMR A;  3S5C A;  1W02 A;  2CHC A;  4AKZ A;  1A2V A;  1RCK A;  1UCJ A;  2IA7 A;  5M1A A;  1PU4 A;  4RBN A;  5CXO A;  1I2F A;  2BU4 A;  4I4K A;  4J8T A;  3DGO A;  3KII A;  1J2B A;  2GEY A;  1HU9 A;  9RNT A;  1US1 A;  3CC7 3;  3Q2P A;  1IT7 A;  4EV2 A;  4FMB A;  1YVS A;  4N6T A;  2F5W A;  1FGR A;  2SBL A;  4JRF A;  2QA4 3;  3PYJ A;  2JDI H;  3F40 A;  3JUO A;  1OAC A;  3D5I A;  6STD A;  5JBS A;  1RN7 A;  2OOV A;  1BRK A;  3AMO A;  2QEX 3;  1TP6 A;  2MC8 A;  3LT8 A;  1FW7 A;  4HYZ A;  1VQ4 3;  2ML5 A;  4I5Q A;  1UDI I;  3HOH A;  2WO0 A;  4BTW A;  3PCS A;  3J7Y d;  4KT3 B;  1BRN L;  1E3R A;  1OUN A;  4K1V A;  1DVC A;  1B3S A;  1LXE A;  4R80 A;  3NUV A;  1MWT A;  2IY2 A;  4CPK A;  2CFD A;  2KAA A;  1MOL A;  3RGA A;  1IVX A;  1IVW A;  4HJL B;  5IEN A;  1B2M A;  3MG2 A;  1RJO A;  4NPB A;  3D9R A;  3F8H A;  1IV7 A;  2HMJ B;  3WA3 A;  3KKG A;  1GOY A;  1VZZ A;  5EEO A;  1RMS A;  1UGI A;  3N8B A;  1RN4 A;  1ZX2 A;  1VQM 3;  2M7O A;  1FUS A;  3DMC A;  3JUN A;  2P0M A;  4BIR A;  2XGL A;  2CFW A;  4FCJ A;  5AIF A;  2INX A;  3CNM A;  1ISK A;  1QAK A;  4HM6 B;  1YIT 3;  4WYK B;  1ULJ B;  1VQ9 3;  2XFS A;  1G02 A;  2STD A;  3VSY A;  3FGY A;  1OF5 B;  1BSA A;  1UCK A;  2CW9 A;  2W56 B;  3FH1 A;  3NQZ A;  5AIH A;  1RGG A;  1NDO B;  4JF8 A;  1SIH A;  5IEP A;  1Q7H A;  5RNT A;  4K90 B;  2F98 A;  1FGO A;  3CCV 3;  1GSP A;  3CMA 3;  1TU5 A;  2L1S A;  4BTX A;  5BU4 A;  1NB3 I;  3N54 B;  1RGA A;  1LOX A;  5BVB A;  1YJW 3;  1K9M 4;  3LYG A;  1HZ1 A;  5FGO A;  2ZDJ A;  3MSO A;  1NO3 A;  4WYK A;  2Z76 A;  2IMJ A;  2ZHX B;  2XR8 B;  3Q90 A;  1O7N B;  1DYU A;  2BHM A;  4XBY A;  3WDG B;  5ELJ A;  1KQS 2;  2W0Q A;  1BSD A;  3NBR A;  3CC2 3;  2YFJ B;  3JUP A;  1FUT A;  3CCS 3;  1IU7 A;  5IF6 A;  1AR0 A;  3Q1C A;  3KSP A;  3X41 A;  1CQS A;  3F9S A;  3KSE D;  1A2K A;  1N9J A;  3K9M C;  2HMN B;  3EN8 A;  3JUM A;  4KFD A;  1A67 A;  1O7P B;  2ZL8 A;  2RFR A;  1DMQ A;  1I2G A;  1Y4K A;  1AV4 A;  1TRP A;  2F56 A;  3EC9 A;  3LML A;  4H61 A;  4DKI A;  3FLJ A;  4NHF A;  3WOF B;  1Q81 4;  4HOH A;  1LOV A;  2YFI B;  2E2V A;  3G6E 3;  4BTY A;  2KXG A;  3MPH A;  4WP5 A;  5HGR A;  4EV5 A;  1A90 A;  1VQN 3;  1V57 A;  5EVH A;  1T2I A;  2L4V A;  4KFF A;  1YJ9 3;  2K0M A;  5D82 A;  3NX0 A;  4HM2 B;  1KD1 4;  5STD A;  1K28 A;  1MWU A;  2AAD A;  1BNJ A;  1PY3 A;  2O9U X;  2I9W A;  2O3O A;  3FF2 A;  3O8Y A;  3Q3F A;  4O2H A;  2W9Q A;  4XDV A;  3RNT A;  1B20 A;  2P05 A;  2OTL 3;  4HBR A;  3KCH A;  3KN4 A;  3D79 A;  3IMA B;  3BLZ A;  3ZG5 A;  1QJG A;  3AHW A;  1W01 A;  2HMK B;  4EYC A;  2PZV A;  2UGI A;  3OWU A;  4BU4 A;  4IPB A;  2YX9 A;  2LQV A;  5LC7 A;  3NM2 A;  2Z6B A;  3OWS A;  1OPY A;  1JNQ A;  4HM4 B;  4N6N B;  1QAL A;  5KP3 A;  1IVV A;  1JB5 A;  1MNL A;  1B21 A;  1BAN A;  1BAO A;  1BIR A;  1BRG A;  3DGY A;  4HM8 B;  4LGQ A;  5D81 A;  1Z1S A;  3B8L A;  4U13 A;  4FMD A;  2W9P A;  2IUJ A;  3B4O A;  1C54 A;  1BU4 A;  3CPO A;  4RNY A;  3PZW A;  5M19 A;  4N6O B;  5JPU A;  1N9E A;  3AGN A;  3PXM A;  4FMA A;  3NBB A;  4XDW A;  6RNT A;  1AY7 A;  3SXX A;  3CCQ 3;  1DE3 A;  1WTH A;  2CH9 A;  2V1L A;  1EUI C;  3BU4 A;  1W7C A;  3LT9 A;  1T2H A;  1BNE A;  2KF5 A;  4STD A;  2R41 A;  2W03 A;  2K54 A;  1VQ5 3;  1B27 A;  3F8X A;  4AEQ A;  1JZO A;  4HM0 B;  2BT3 A;  4HM1 B;  3KZT A;  2IYJ A;  5EQL A;  1VQQ A;  2W2C A;  3ROB A;  1GMQ A;  4R4K A;  4RNT A;  1KC8 4;  1BNS A;  1IDP A;  1UCL A;  3CC4 3;  1VQP 3;  1S72 3;  5IW9 A;  1AVK A;  1D6U A;  3FKA A;  4BL3 A;  4WFO A;  3S27 A;  3F7S A;  4H3U A;  1BSE A;  4J9A A;  1DMN A;  1QVF 2;  1STF I;  1JB4 A;  2R4I A;  3GSP A;  3G71 3;  3GZX B;  1GS3 A;  1ZO2 A;  3CXC 2;  2WOH A;  2XFT A;  2CK3 H;  4MMX B;  1I8V A;  1BOX A;  4FR9 A;  2FGT A;  4HM7 B;  3FSD A;  1RNB A;  1VQL 3;  1I0X A;  4GSP A;  2WGO A;  3DZL A;  1PYL A;  3BNC A;  2KF4 A;  1SII A;  1JBT A;  1D6Y A;  3D3L A;  1B2U A;  1BSC A;  1QMA A;  3KE7 A;  5GSP A;  1FGM A;  2B1X B;  4L8P A;  1RLS A;  1G96 A;  1Q7Y 4;  2BNG A;  3LZA A;  1UUG B;  3EF8 A;  2K3D A;  1IVU A;  1RDS A;  3K0Z A;  3CME 3;  2CWV A;  3F7X A;  5BIR A;  3LTA A;  3UNL A;  3DGL A;  1IQ8 A;  1OH0 A;  3OWY A;  4FCM A;  1GY6 A;  1Q40 B;  1JBR A;  3BNE A;  3SVA A;  4IIA A;  1GMP A;  1U8C B;  7RNT A;  1OGZ A;  1M9G A;  2C4B A;  2CX0 A;  5CK6 A;  3A5E A;  5AI1 A;  4ZM8 A;  3EB8 A;  3SYU A;  4BL2 A;  1LOW A;  3UB1 A;  2HML B;  1U5O A;  2SAR A;  3SX1 A;  1RCL A;  4WWU C;  3CCL 3;  2CFK A;  2CG1 A;  3T0U A;  2OWP A;  2F4Y A;  5IG5 A;  4O8S A;  4GB5 A;  5AYR B;  1V58 A;  2Z7A A;  3DGN A;  1BNF A;  1RGK A;  4HVN A;  5AEU B;  3GWR A;  1I2E A;  3TDG A;  7GSP A;  4OUQ A;  1OF5 A;  1Q40 A;  3FCS B;  5D83 A;  2W56 A;  3LXU X;  3RDE A;  2JQ5 A;  2BMO B;  3NM7 A;  1VQO 3;  4ORL A;  1BUQ A;  2UX0 A;  3EE1 A;  1I3F A; 
#chains in the Genus database with same CATH homology
 1LVN A;  3WMD A;  3FG1 A;  2Q07 A;  3FG4 A;  3MHE A;  4MMZ B;  1FGT A;  4HKV B;  4N6M A;  5DRE A;  3S29 A;  3MG1 A;  1WMN A;  3X40 A;  1HKX A;  1M90 4;  2FNQ A;  5FW5 A;  3OX9 A;  1N5H A;  3HZP A;  3GZY B;  3MG3 A;  4XB5 A;  5KP1 A;  1TFO A;  3FG3 A;  1UUV B;  5I97 A;  3NQY A;  1CEW I;  2CFL A;  3SED A;  1EKM A;  3DUK A;  3GAX A;  3SOY A;  2PNC A;  1NWW A;  2E2U A;  2E2T A;  3NHX A;  3CCE 3;  1TUH A;  1W2B 2;  1CYV A;  1WMO A;  4LSO A;  3PCR A;  1QAF A;  3LTD A;  2Z77 A;  1RRH A;  3EBT A;  1T5Y A;  3EBY A;  1UI8 A;  2BMR B;  1VQ7 3;  1TFK A;  1NU3 A;  2CWU A;  3ECF A;  4HM3 B;  1UI7 A;  3EX9 A;  4XM4 A;  2XRX B;  1JKG B;  3UL5 A;  4N3V A;  3LH4 A;  1W4N A;  4WHA A;  1K73 4;  4MMY B;  5IER A;  4EXR A;  1IQX A;  2KCD A;  2OQE C;  1W6C A;  3U97 A;  4Q53 A;  2HMM B;  3SLU A;  1K8A 4;  1JN5 B;  3KFQ C;  4G1M B;  1RRL A;  2IUK A;  3HK4 A;  5IEO A;  3NXJ A;  2F86 B;  5CF1 A;  3OW2 2;  2RSX A;  1FGQ A;  2GEX A;  3SOA A;  2P38 A;  3X42 A;  4KZ1 A;  1W5Z A;  4OK0 A;  1JKG A;  2GU1 A;  3CCR 3;  1VQ8 3;  4N6U A;  4AKY A;  1M1X B;  2CKF B;  3MWZ A;  1M1K 4;  5AIG A;  1EQK A;  3FZW A;  3BND A;  3N9H A;  3U1W A;  5IG0 A;  2QIY A;  3M8C A;  4LMI A;  4FMC A;  5DRV A;  3X3Z A;  1SJW A;  1YVB I;  1ROV A;  3UL6 A;  3WOD G;  2W04 A;  3CCJ 3;  4NRE A;  3AMO B;  2LYX A;  3EQQ B;  4CDL A;  3NBJ A;  4CCV A;  2F99 A;  4X2O A;  2P09 A;  1W2Z A;  3FF0 A;  1UW1 A;  2CIU A;  3I0Y A;  4PEJ A;  1OHP A;  3G16 A;  3V98 A;  2B24 B;  2BO9 B;  2Y73 A;  1GY5 A;  2XF3 A;  1C7H A;  3WOE B;  1V74 A;  3CPW 2;  2OTJ 3;  1ROA A;  2W6J H;  3IJE B;  1JRQ A;  1YIJ 3;  4OVM A;  1SQW A;  1PFP A;  1EG9 B;  3MYT A;  3CD6 3;  3I56 3;  1EA2 A;  1DMM A;  4XBX A;  5KP4 A;  1RKY A;  3UJM A;  1W00 A;  3A76 A;  1FA3 A;  4MJD A;  4K1U A;  2XH9 A;  3IPT A;  2KRT A;  4L7K A;  5LC6 A;  5CLK A;  1LNH A;  3LTB A;  1QVG 2;  4R1K A;  2XSH B;  2CFG A;  3B4P A;  4TX4 A;  8CHO A;  1GD3 A;  1Q42 A;  5A0O B;  1IV9 A;  3H51 A;  3NV0 B;  4EBG A;  1K41 A;  1JV2 B;  1KWI A;  3BNB A;  1O7W B;  4MEI A;  2YFL B;  3PGB A;  5CF2 A;  3DY5 A;  5AII A;  3CCM 3;  1N8R 4;  2C10 A;  2MF7 A;  1Q82 4;  1WNH A;  1GD4 A;  2HMO B;  2XEP A;  3I55 3;  3HI7 A;  4KFE A;  3ALA A;  3ER7 A;  4EC6 A;  1Q86 4;  4HZ9 B;  1YJN 3;  1N5P A;  2GBX B;  3CNX A;  1L5G B;  1VQ6 3;  2CG0 A;  1ASK A;  3K5T A;  2D42 A;  3NV0 A;  1O7M B;  3JUQ A;  1O7H B;  4LZI A;  2C11 A;  3VGN A;  2WOF A;  5AEW B;  3V92 A;  2GXF A;  3DXO A;  4R9L A;  3T8N A;  1KSI A;  3H3H A;  1YHQ 3;  1DVD A;  2WGQ A;  1CYU A;  4HZB B;  3T8U A;  4QWT A;  1IK3 A;  1AVL A;  2BMQ B;  1N8Q A;  3G8Z A;  1D6Z A;  1TIJ A;  3CU3 A;  2GBW B;  3S67 A;  3OV4 A;  3K63 A;  1UUW B;  4K61 A;  1WQL B;  2RGQ A;  5ELU A;  1OCV A;  2OCT A;  1IQY A;  2D1W A;  1ULI B;  1W6G A;  3DGM A;  3G0K A;  1SPU A;  3WA2 X;  4XBT A;  3DM8 A;  1OHS A;  1FUW A;  3B7C A;  3K7C A;  3G4S 3;  4X2H A;  1R4C A;  3MKI A;  3GRD A;  1YGE A;  4N6L A;  3LTC A;  1OHO A;  2Y74 A;  3GZB A;  3PS8 A;  2P0X A;  3STD A;  3X3X A;  1S5A A;  3RGR A;  1E97 A;  4RNZ A;  2XSO B;  3JVC A;  5G2G A;  1JJ2 2;  3L0R A;  1STD A;  1O7G B;  1F8N A;  2CWT A;  3EHC A;  3QK9 A;  4LEH A;  1NB5 I;  3V99 A;  4R9K A;  1IT8 A;  2QGU A;  4RZM A;  4FCZ A;  2FXT A;  5IG3 A;  4KVH A;  1GYB A;  5IG4 A;  2GU3 A;  3GZR A;  4IT7 A;  1JB2 A;  3LOY A;  2XGN A;  3CCU 3;  3EJV A;  1GY7 A;  3VF1 A;  4L8O A;  3F14 A;  1YI2 3;  4O02 B;  1OGX A;  3EN1 B;  1E3V A;  2CC3 A;  3BB9 A;  2OQE A;  5JPP A;  4HM5 B;  5AYS C;  7STD A;  1JN5 A;  5BXQ A;  4O3V A;  3QRD A;  5TGN A;  3HIG A;  4GL6 A;  2RCD A;  3E99 A;  4N6V 0;  2ML6 A;  3HII A;  3HX8 A;  3S28 A;  2A15 A;  3X3Y A;  2OOV C;  1NJI 4;  1WMP A;  1W6Y A;  3OXA A;  3S5C A;  1W02 A;  2CHC A;  4AKZ A;  1A2V A;  2IA7 A;  1PU4 A;  4RBN A;  5CXO A;  4I4K A;  4J8T A;  3DGO A;  3KII A;  1J2B A;  2GEY A;  1HU9 A;  3CC7 3;  1US1 A;  3Q2P A;  1IT7 A;  4EV2 A;  4FMB A;  4N6T A;  2SBL A;  1FGR A;  4JRF A;  2QA4 3;  3PYJ A;  2JDI H;  3F40 A;  3JUO A;  1OAC A;  6STD A;  5JBS A;  2QEX 3;  1RN7 A;  2OOV A;  3AMO A;  1TP6 A;  2MC8 A;  3LT8 A;  4HYZ A;  1VQ4 3;  2ML5 A;  2WO0 A;  4BTW A;  3PCS A;  3J7Y d;  1E3R A;  1OUN A;  4K1V A;  1DVC A;  1LXE A;  4R80 A;  3NUV A;  2CFD A;  1MOL A;  3RGA A;  1IVX A;  1IVW A;  4HJL B;  5IEN A;  3MG2 A;  1RJO A;  3D9R A;  3F8H A;  1IV7 A;  2HMJ B;  3WA3 A;  3KKG A;  1VZZ A;  5EEO A;  3N8B A;  1ZX2 A;  1VQM 3;  2M7O A;  3DMC A;  3JUN A;  2P0M A;  2XGL A;  2CFW A;  4FCJ A;  5AIF A;  2INX A;  3CNM A;  1ISK A;  1QAK A;  4HM6 B;  1YIT 3;  4WYK B;  1ULJ B;  1VQ9 3;  2XFS A;  3VSY A;  2STD A;  3FGY A;  1OF5 B;  3NQZ A;  2CW9 A;  2W56 B;  3FH1 A;  5AIH A;  5IEP A;  1NDO B;  4JF8 A;  1SIH A;  4K90 B;  2F98 A;  1FGO A;  3CCV 3;  3CMA 3;  1TU5 A;  4BTX A;  1NB3 I;  3N54 B;  1LOX A;  5BVB A;  1YJW 3;  1K9M 4;  3LYG A;  5FGO A;  2ZDJ A;  3MSO A;  1NO3 A;  4WYK A;  2Z76 A;  2IMJ A;  3Q90 A;  2XR8 B;  1O7N B;  1DYU A;  2BHM A;  4XBY A;  3WDG B;  5ELJ A;  1KQS 2;  2W0Q A;  3NBR A;  3CC2 3;  2YFJ B;  3JUP A;  3CCS 3;  1IU7 A;  5IF6 A;  1AR0 A;  3Q1C A;  3KSP A;  3X41 A;  1CQS A;  3F9S A;  3KSE D;  1A2K A;  1N9J A;  3K9M C;  2HMN B;  3EN8 A;  3JUM A;  4KFD A;  1A67 A;  1O7P B;  2ZL8 A;  2RFR A;  1DMQ A;  3LML A;  1Y4K A;  1AV4 A;  4H61 A;  3EC9 A;  3FLJ A;  4NHF A;  3WOF B;  1Q81 4;  2YFI B;  2E2V A;  3G6E 3;  4BTY A;  2KXG A;  3MPH A;  4WP5 A;  5HGR A;  4EV5 A;  1A90 A;  1VQN 3;  5EVH A;  2L4V A;  4KFF A;  1YJ9 3;  2K0M A;  5D82 A;  3NX0 A;  4HM2 B;  1KD1 4;  5STD A;  1K28 A;  5CK6 A;  1VQK 3;  3O8Y A;  2O9U X;  2I9W A;  2O3O A;  3FF2 A;  4O2H A;  2W9Q A;  4XDV A;  2P05 A;  2OTL 3;  4HBR A;  3KN4 A;  3IMA B;  3BLZ A;  1QJG A;  1W01 A;  2HMK B;  4EYC A;  2PZV A;  3OWU A;  4IPB A;  2YX9 A;  2LQV A;  5LC7 A;  3NM2 A;  2Z6B A;  3OWS A;  1OPY A;  1JNQ A;  4HM4 B;  4N6N B;  1QAL A;  5KP3 A;  1IVV A;  1JB5 A;  1MNL A;  4HM8 B;  4LGQ A;  5D81 A;  1Z1S A;  3B8L A;  4U13 A;  4FMD A;  2W9P A;  2IUJ A;  3B4O A;  3CPO A;  4RNY A;  3PZW A;  4N6O B;  5JPU A;  1N9E A;  4FMA A;  3PXM A;  4XDW A;  3NBB A;  3CCQ 3;  3SXX A;  1WTH A;  2CH9 A;  2V1L A;  3LT9 A;  1W7C A;  1VQ5 3;  4STD A;  2W03 A;  2K54 A;  3F8X A;  4AEQ A;  4HM0 B;  2BT3 A;  4HM1 B;  3KZT A;  5EQL A;  2W2C A;  3ROB A;  4R4K A;  1KC8 4;  1IDP A;  3CC4 3;  1VQP 3;  1S72 3;  5IW9 A;  1AVK A;  1D6U A;  3FKA A;  4WFO A;  3S27 A;  3F7S A;  4H3U A;  4J9A A;  1DMN A;  1QVF 2;  1STF I;  1JB4 A;  2R4I A;  3G71 3;  3CXC 2;  3GZX B;  1GS3 A;  1ZO2 A;  2WOH A;  2XFT A;  2CK3 H;  4MMX B;  4FR9 A;  2FGT A;  4HM7 B;  3FSD A;  1VQL 3;  2WGO A;  3DZL A;  3BNC A;  1SII A;  1D6Y A;  3D3L A;  3KE7 A;  1QMA A;  1FGM A;  2B1X B;  4L8P A;  1Q7Y 4;  1G96 A;  2BNG A;  3LZA A;  3EF8 A;  3K0Z A;  1IVU A;  3CME 3;  2CWV A;  3F7X A;  3LTA A;  3UNL A;  3DGL A;  1IQ8 A;  1OH0 A;  3OWY A;  4FCM A;  1GY6 A;  1Q40 B;  3BNE A;  3SVA A;  4IIA A;  1U8C B;  1OGZ A;  1M9G A;  5AI1 A;  4ZM8 A;  3EB8 A;  3UB1 A;  2HML B;  1U5O A;  3SX1 A;  4WWU C;  3CCL 3;  2CFK A;  2CG1 A;  3T0U A;  2OWP A;  5IG5 A;  4O8S A;  4GB5 A;  5AYR B;  2Z7A A;  3DGN A;  4HVN A;  5AEU B;  3GWR A;  3TDG A;  4OUQ A;  1OF5 A;  1Q40 A;  3FCS B;  5D83 A;  2W56 A;  3LXU X;  3RDE A;  2JQ5 A;  2BMO B;  3NM7 A;  1VQO 3;  4ORL A;  1BUQ A;  2UX0 A;  3EE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...