1Q824

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q82400
3CC23 1K8A4 1VQP3 1VQ43 1K9M4 3CMA3 3I563 1VQK3 1K734 3CCV3 3CCQ3 1YJW3 3CCR3 1YHQ3 3CC43 3I553 3CCS3 1QVG2 1N8R4 1VQO3 3G4S3 1M1K4 2OTL3 1NJI4 3G713 1KQS2 1Q824 1KD14 1VQL3 1QVF2 1VQN3 3CPW2 3CME3 1YI23 1Q864 1VQ53 1JJ22 1VQ63 3CCJ3 1VQ73 1VQ83 3OW22 1S723 1Q814 1M904 1VQ93 3CCM3 2QEX3 1YIT3 1W2B2 3CXC2 1YIJ3 3CCL3 3CD63 2OTJ3 1YJN3 3G6E3 1VQM3 1KC84 3CCE3 1YJ93 3CCU3 3CC73 1Q7Y4 2QA43
chains in the Genus database with same CATH superfamily
3B4OA 2HMNB 3NV0A 1E3VA 2XFSA 1TU5A 3CMA3 2GBXB 2IUKA 1IQ8A 1LOVA 3JVCA 5IERA 1JBTA 4MMXB 1MWTA 3EQQB 3FGYA 1RNTA 4RBNA 1W6YA 2RCDA 3BNBA 1RGCA 5AIFA 3FH1A 3ALAA 4HAAA 1O7WB 2AAEA 3LH4A 3G0KA 3KSPA 1RN7A 3Q2PA 3A5EA 4N6MA 2W0QA 5DREA 3WODG 3ECFA 3GWRA 4N6LA 1UI7A 1GYBA 4N6TA 3U97A 2W03A 1ROVA 1I2GA 1K41A 2WOHA 2UX0A 3WA2X 1VQM3 1YVSA 5DRVA 1D6YA 3ROBA 1B2MA 3DGOA 3QRDA 4R9KA 1C54A 3B7CA 2ZDJA 2R4IA 1O7PB 4XBYA 1Y4KA 3KIIA 2OCTA 3IJEB 5IENA 1K734 3D5GA 1N5PA 2XH9A 4HZBB 1OHPA 1BRJA 1KQS2 3KKGA 3DM8A 2ZA4A 1FYSA 1SJWA 1X1UA 3BNEA 3EX9A 4WFOA 1OUNA 4XBXA 1BSCA 1EA2A 5IEOA 2CWTA 2CWVA 4DKIA 1PY3A 1SPUA 4EYCA 3EB8A 2F98A 3AGNA 1B2SA 4J5KA 3UJMA 1MOLA 3SYUA 2OTJ3 3LT8A 3HZPA 4K1VA 1RGAA 4KZ1A 5HGRA 4XDVA 3EN8A 6RNTA 5JBSA 5G2GA 3CC73 1VQP3 4EV2A 2F5MA 1W5ZA 3MHEA 2KXGA 3IPTA 4FMCA 2FNQA 3CC43 5D81A 4GHOA 1ZX2A 1M1K4 3J7Yd 1LQGC 3N54B 1OH0A 2BMOB 2HMMB 5LC6A 3VF1A 1IYYA 1BNRA 1VQN3 4OVMA 3ER7A 1MWSA 3S28A 4HJLB 1W02A 2LYXA 1JV2B 2XFTA 4FMDA 4O02B 2QEX3 1WNHA 2B24B 3OWSA 5FW5A 5IG5A 1SQWA 5M19A 5IF6A 1YJN3 2GSPA 2GU3A 2XR8B 3B4PA 3U1WA 3WDGB 1E3RA 1GSPA 1M1XB 5IG0A 4LGQA 1K8A4 1K28A 4WHAA 3X42A 1I2EA 1LOXA 1MWUA 1Q42A 1QMAA 2KF5A 2WGQA 1EG9B 1U5OA 3EBTA 4I4KA 4EC6A 2BHMA 2QGUA 1N9EA 3UL6A 1BU4A 2P05A 2P0MA 3PCRA 3T0UA 2LQVA 2P38A 2W6JH 3LMLA 3K5TA 3MKIA 1VQL3 2MF7A 1QVF2 2YFLB 4HM4B 3FG3A 3DGYA 1J2BA 3GZXB 2F4YA 3MPHA 3CCJ3 1VQ83 4HOHA 1JN5B 2HMJB 2FXTA 5AEWB 1RHLA 2WOFA 3H51A 3LZAA 3V92A 2OQEA 1RSNA 3CNXA 3FCSB 1DMNA 1OF5A 1SARA 3DMCA 1G96A 3OWUA 3Q90A 4X2OA 3WHOA 2OOVC 5EQLA 1RMSA 1MGRA 2F99A 1BSEA 1DMMA 4OK0A 3CC23 1VQQA 4R1KA 1BVIA 2P09A 3F8XA 3GZBA 5JPUA 4RNYA 3HIGA 1AR0A 4LMIA 3PYJA 5IW9A 1HU9A 1YHQ3 1FUTA 1T2IA 1I0XA 3RDEA 1X1XA 4I5QA 3G713 3JUNA 1US1A 3LTAA 4LYLB 3HIIA 4ILFA 2R41A 1VQ63 2F86B 1PFPA 1WMPA 2YFIB 1RGEA 2BNGA 3L0RA 4PEJA 2Z76A 3GZYB 2RSXA 3STDA 1TTOA 1IT7A 4HM2B 1GY7A 3X3XA 4HVNA 1YGEA 1A2KA 1B21A 1RRLA 4L8OA 1RGKA 1KWIA 2IA7A 3PS8A 4N3VA 2O3OA 1TJDA 1UGIA 3AMOA 4J5GA 1Q814 4RZMA 3V98A 4HM3B 2CFKA 4K61A 1VZZA 3FG4A 3UNLA 8CHOA 2JDIH 3AHSA 1NWWA 2K54A 2KF4A 1BSAA 1BNEA 4GB5A 3G4S3 1LXEA 5HOHA 1DMQA 1ROAA 1OF5B 1RRHA 4EW5A 1UCIA 1IQYA 3K63A 1W00A 2PZVA 1Q864 5ELJA 2I9WA 3SXXA 1IVUA 3Q3FA 1O7MB 1TFKA 4FCJA 4BTXA 1I3FA 1EEJA 1IQXA 1U8CB 4K1UA 1RN4A 5KP1A 2CK3H 2CFGA 3K7CA 3FZWA 3PXMA 4HM8B 2XSHB 4KT3B 5CXOA 1CYUA 3D5IA 1NNVA 5AYSC 3LTCA 1WQLB 3NXJA 3SVAA 1FUSA 3EF8A 3F9SA 2OWPA 1T5YA 2KF3A 3SX1A 4NHFA 5AYRB 4KFFA 1QVG2 4O2HA 4BL2A 3DGNA 3S27A 1NB3I 3BLZA 5JPPA 1SIHA 3BU4A 4FCZA 1UUWB 1UCLA 1MGWA 3DUKA 1QJGA 3OWYA 2CX0A 4X2HA 1DETA 1MNLA 1RCKA 4GSPA 2GXFA 4Q53A 3CPOA 5G1KA 1BUJA 1YIT3 1TIJA 3KCHA 4HM7B 2HMKB 3JUQA 1N8QA 3DGLA 3BIRA 4FMBA 4JRFA 1STFI 1QAFA 4RNTA 4CCVA 1E97A 3D9RA 3NBRA 1OPYA 2W04A 1Q7HA 1UW1A 3D79A 3HX8A 4IPBA 3CU3A 3M8CA 3MG3A 4JF8A 4MEIA 3KSED 3S67A 5BXQA 4CDLA 3CCV3 4FMAA 4BU4A 3AHWA 2E2VA 1GOYA 2D42A 1GMPA 2HMLB 3ZG0A 4BL3A 7STDA 3AMOB 1Z1SA 4GL6A 1NJI4 2ZL8A 1FA3A 3F40A 1BAOA 4CJNA 2YFJB 1B27A 3GRDA 1CH0A 4STDA 3LXUX 1AVKA 5CF1A 1VQ73 1GMQA 3MYTA 2RGQA 1Q40B 1M904 4MMYB 4LEHA 3CCM3 1RGLA 3GZRA 2FGTA 1JBRA 1HZ1A 4OUQA 1S5AA 1TRQA 2RBIA 1DVDA 1JKGA 2XGLA 4TX4A 3SOYA 4HM6B 5A0OB 1IVXA 4G1MB 1LRAA 1GMRA 1BNGA 3KN4A 1IVVA 4J9AA 3NHXA 1BNJA 1TFOA 1W6CA 5AIIA 3T8UA 4EXRA 6STDA 3X3ZA 3BNCA 3VSYA 4O3VA 1RDSA 3VGNA 1LOYA 1JZOA 1VQ53 2OQEC 3T8NA 1S723 1FGTA 3B8LA 1RGHA 1PYLA 5EVHA 2F56A 1LVNA 1R4CA 3OV4A 5D82A 1W6GA 3O8YA 4XDWA 2CG1A 3S5CA 3RNTA 3HOHA 3CNMA 3N9HA 3AGOA 5G1LA 1NDOB 2BMRB 1O7GB 1JB4A 1I0VA 1UI8A 1LNIA 2CHCA 2AADA 3LTBA 3CCE3 1IV7A 1RGFA 2O9UX 3CCU3 1RNBA 2QA43 1IT8A 1X1WA 1RGGA 3BB9A 4KFEA 2BU4A 4R80A 5KP3A 3RGAA 2GEXA 2H0HA 2H0GA 1ZGXA 2Z7AA 2OTL3 2KCDA 1TP6A 2W2CA 5I97A 2W9QA 4ORLA 3FF2A 1KD14 4N6OB 1FZUA 3MG1A 1V57A 4LSOA 3URPA 1R4YA 1UUGB 1I70A 5M1AA 5RNTA 2CFDA 2M7OA 1BUQA 3WOFB 1Q9EA 1NU3A 1OHSA 3GSPA 2D1WA 1JB2A 1PU4A 4N6V0 1FGOA 3G8ZA 3NBJA 5BVBA 1B2UA 2BO9B 3KE7A 1BSDA 3I0YA 4WP5A 1YJ93 3KZTA 2W9PA 3I563 1FW7A 4K90B 3JUOA 3FG1A 3MG2A 2C11A 1UUVB 1AV4A 2CC3A 2QIYA 4HBRA 1WTHA 5AEUB 5AIHA 2ZHXB 2SBLA 1QALA 3WA3A 5LC7A 5BU4A 1BSBA 5TGNA 1BNIA 1JNQA 1W01A 3CXC2 1BRNL 3EN1B 1YIJ3 2KRTA 1GY6A 1V58A 2IMJA 4BIRA 1BNSA 1GS3A 3F7XA 1RN1A 3Q1CA 3KFQC 4KFDA 3G16A 1ULIB 3LTDA 1HKXA 2WGOA 4KVHA 3NM7A 1NB5I 1B2ZA 1D6UA 1Q40A 3QK9A 1VQK3 3IMAB 1OGZA 1G02A 2CFLA 2IUJA 4N6NB 2UUGC 1CEWI 1JKGB 1VQO3 1N9JA 1RKYA 1GY5A 1Q824 3LYGA 1GOVA 2IYJA 2MC8A 1BGSA 2GEYA 4NPBA 4AKZA 1OCVA 1O7NB 3MSOA 3DGMA 3S29A 3V99A 1JJ22 1RLSA 1GD4A 3ZG5A 1A2VA 3H3HA 3PZWA 1B2XA 2GU1A 3NM2A 1I8VA 3D3LA 3EE1A 1BRHA 1W2B2 1FGQA 2OOVA 2Q07A 3K9MC 4HKVB 1ZO2A 3RGRA 2CW9A 3LT9A 3G6E3 4R9LA 2RFRA 1BANA 2L4VA 3PCSA 3SEDA 5KP4A 1LQMB 1KSIA 3EJVA 4EV5A 4WWUC 3EC9A 3SLUA 2PNCA 5GSPA 2B1XB 8RNTA 1VQ43 3GAXA 1BRSA 3UL5A 1YJW3 1IU7A 4QWTA 1UDII 2ML6A 4BTYA 3DXOA 1TUHA 2CWUA 4XM4A 2JQ5A 5IG3A 4WYKA 5D83A 1C7HA 2BMQB 4FCMA 2CH9A 1JB5A 3TDGA 1CQSA 1X1YA 1VQ93 1TRPA 3DY5A 3MWZA 1JZDA 1OGXA 3X3YA 3NV0B 2E2UA 2K0MA 2BT3A 5AIGA 3X41A 1IV9A 1DYUA 5BIRA 2Z77A 3WOEB 4MMZB 1RJOA 4H61A 2K3DA 2UGIA 3CCS3 1MWRA 3WMDA 1OACA 3E99A 2RNTA 1W4NA 2Y73A 1RTUA 1IDPA 2F5WA 2W56A 3NX0A 1ULJB 1ZS7A 4XBTA 3CCQ3 2INXA 3F8HA 3I553 2STDA 3FF0A 1YVBI 1I3IA 4HM5B 1ISKA 2E2TA 1UGHI 2XSOB 4LZIA 3OX9A 3NUVA 4O8SA 4FR9A 4L7KA 9RNTA 3ZFZA 1YI23 2V1LA 1IK3A 3D4AA 3UB1A 4AEQA 2GBWB 3HK4A 4XB5A 4AKYA 1WMNA 1HYFA 1QAKA 3EBYA 3NQYA 5IG4A 7RNTA 3CCL3 3JUMA 4MJDA 2HOHA 2CFWA 2L1SA 1JRQA 4EBGA 1KC84 3FLJA 3FKAA 3HI7A 4WYKB 3NQZA 1L5GB 2YX9A 1RCLA 5CLKA 2A15A 2W56B 1GOUA 2J8XB 3DH2A 1EUIC 4J8TA 1A2PA 3DZLA 1YGWA 1W2ZA 3CCR3 7GSPA 1FGMA 2XRXB 5CK6A 1DVCA 5CF2A 3NBBA 2C10A 3FSDA 1DE3A 1BOXA 1F8NA 1A90A 5STDA 2Y74A 3CPW2 1AQZA 1BRKA 4ZM8A 1SIIA 3F7SA 4BTWA 3CME3 4IT7A 2ML5A 5AI1A 4RNZA 5M18A 2CKFB 1I2FA 1FGRA 1IVWA 2WO0A 5EEOA 3CD63 1AVLA 1GD3A 3N8BA 1JBSA 3F14A 1O7HB 1B20A 4HM1B 4IIAA 4N6UA 2KF6A 2XF3A 2KAAA 2BIRA 6GSPA 3JUPA 4HM0B 1Q7Y4 4NREA 2IY2A 1EQKA 2P0XA 3SOAA 1K9M4 1NO3A 1AY7A 1G0TA 2SARA 1N8R4 1D6ZA 3X40A 1UCKA 1OHOA 5ELUA 1M9GA 1BRIA 1EKMA 2H0IA 2CG0A 4HYZA 1BRGA 4R4KA 2CX1A 2HMOB 5IEPA 1T3BA 3WR2A 5FGOA 4H3UA 1N5HA 2Z6BA 1LNHA 3OW22 1CYVA 1JN5A 2CIUA 4U13A 2XEPA 1LOWA 4CPKA 1V74A 3EHCA 3PGBA 1ASKA 1UCJA 1B3SA 1W7CA 2C4BA 1YNVX 2XGNA 1FUWA 3OXAA 3BNDA 3K0ZA 1BIRA 1T2HA 1A67A 3LOYA 4HZ9B 1STDA 1WMOA 3A76A 4L8PA 1BNFA
chains in the Genus database with same CATH topology
3B4OA 2HMNB 3NV0A 1E3VA 2XFSA 1TU5A 3CMA3 2GBXB 2IUKA 1IQ8A 3JVCA 5IERA 4MMXB 3EQQB 3FGYA 4RBNA 1W6YA 2RCDA 3BNBA 5AIFA 3FH1A 3ALAA 1O7WB 3LH4A 3G0KA 3KSPA 1RN7A 3Q2PA 4N6MA 3WODG 2W0QA 5DREA 3ECFA 3GWRA 4N6LA 1UI7A 1GYBA 4N6TA 3U97A 2W03A 1ROVA 1K41A 2WOHA 2UX0A 3WA2X 1VQM3 5DRVA 1D6YA 3ROBA 3DGOA 3QRDA 4R9KA 3B7CA 2ZDJA 2R4IA 1O7PB 4XBYA 1Y4KA 3KIIA 2OCTA 3IJEB 5IENA 1K734 1N5PA 2XH9A 4HZBB 1OHPA 1KQS2 3KKGA 3DM8A 1SJWA 3EX9A 3BNEA 4WFOA 1OUNA 4XBXA 1EA2A 5IEOA 2CWTA 2CWVA 1SPUA 4EYCA 3EB8A 2F98A 2OTJ3 3UJMA 1MOLA 3LT8A 3HZPA 4K1VA 4KZ1A 5HGRA 5JBSA 4XDVA 3EN8A 3CC73 5G2GA 1VQP3 4EV2A 1W5ZA 3MHEA 2KXGA 3IPTA 4FMCA 2FNQA 3CC43 5D81A 1ZX2A 1M1K4 3J7Yd 3N54B 1OH0A 2BMOB 2HMMB 5LC6A 3VF1A 1VQN3 4OVMA 3ER7A 3S28A 4HJLB 1W02A 2LYXA 1JV2B 2XFTA 4FMDA 4O02B 2QEX3 1WNHA 2B24B 3OWSA 5FW5A 5IG5A 1SQWA 5IF6A 1YJN3 2GU3A 2XR8B 3B4PA 3U1WA 3WDGB 1E3RA 1M1XB 5IG0A 4LGQA 1K8A4 1K28A 4WHAA 3X42A 1LOXA 1Q42A 1QMAA 2WGQA 4I4KA 1EG9B 1U5OA 3EBTA 4EC6A 2BHMA 2QGUA 1N9EA 3UL6A 2P05A 2P0MA 3PCRA 3T0UA 2LQVA 2P38A 2W6JH 3LMLA 3K5TA 3MKIA 1VQL3 2MF7A 1QVF2 2YFLB 4HM4B 3FG3A 1J2BA 3GZXB 3MPHA 3CCJ3 1VQ83 1JN5B 2HMJB 2FXTA 5AEWB 3H51A 2WOFA 3LZAA 3V92A 2OQEA 3CNXA 3FCSB 1DMNA 1OF5A 3DMCA 1G96A 3OWUA 3Q90A 4X2OA 2OOVC 5EQLA 2F99A 1DMMA 3CC23 4R1KA 3F8XA 2P09A 5JPUA 3GZBA 4RNYA 3HIGA 1AR0A 4LMIA 3PYJA 5IW9A 1HU9A 1YHQ3 3RDEA 3G713 3JUNA 1US1A 3LTAA 3HIIA 1VQ63 2F86B 1PFPA 1WMPA 2YFIB 4PEJA 2BNGA 3L0RA 2Z76A 3GZYB 2RSXA 3STDA 1IT7A 4HM2B 1GY7A 3X3XA 4HVNA 1YGEA 1A2KA 1RRLA 4L8OA 1KWIA 2IA7A 3PS8A 4N3VA 2O3OA 3AMOA 1Q814 4RZMA 3V98A 4HM3B 2CFKA 4K61A 1VZZA 3FG4A 3UNLA 8CHOA 2JDIH 1NWWA 2K54A 4GB5A 3G4S3 1LXEA 1DMQA 1ROAA 1OF5B 1RRHA 1IQYA 3K63A 1W00A 2PZVA 1Q864 5ELJA 2I9WA 3SXXA 1IVUA 1O7MB 1TFKA 4FCJA 4BTXA 1IQXA 1U8CB 4K1UA 5KP1A 2CK3H 2CFGA 3K7CA 3FZWA 3PXMA 4HM8B 2XSHB 5CXOA 1CYUA 5AYSC 3LTCA 1WQLB 3NXJA 3SVAA 3EF8A 3F9SA 2OWPA 1T5YA 3SX1A 4NHFA 5AYRB 4KFFA 1QVG2 4O2HA 3DGNA 3S27A 1NB3I 3BLZA 5JPPA 1SIHA 4FCZA 1UUWB 3DUKA 1QJGA 3OWYA 4X2HA 1MNLA 4Q53A 2GXFA 3CPOA 1YIT3 1TIJA 4HM7B 2HMKB 3JUQA 1N8QA 3DGLA 4FMBA 4JRFA 1STFI 1QAFA 4CCVA 1E97A 3D9RA 3NBRA 1OPYA 2W04A 4IPBA 1UW1A 4JF8A 3HX8A 4OK0A 3CU3A 3M8CA 3MG3A 4MEIA 3VGNA 3KSED 3S67A 5BXQA 4CDLA 3CCV3 4FMAA 2D42A 2E2VA 2HMLB 7STDA 3AMOB 1Z1SA 4GL6A 1NJI4 2ZL8A 1FA3A 3F40A 2YFJB 3GRDA 4STDA 3LXUX 1AVKA 5CF1A 1VQ73 3MYTA 2RGQA 1Q40B 1M904 4MMYB 4LEHA 3CCM3 3GZRA 2FGTA 4OUQA 1S5AA 1DVDA 1JKGA 2XGLA 4TX4A 3SOYA 4HM6B 5A0OB 1IVXA 4G1MB 3KN4A 1IVVA 4J9AA 3NHXA 1W6CA 1TFOA 3T8UA 5AIIA 4EXRA 6STDA 3X3ZA 3BNCA 3VSYA 4O3VA 1VQ53 2OQEC 3T8NA 1S723 1FGTA 3B8LA 5EVHA 2CG1A 1LVNA 1R4CA 3OV4A 5D82A 1W6GA 3O8YA 4XDWA 3S5CA 3CNMA 3N9HA 1NDOB 2BMRB 1O7GB 1JB4A 3CCE3 1UI8A 2CHCA 3LTBA 1IV7A 2O9UX 3CCU3 2QA43 1IT8A 3BB9A 4R80A 4KFEA 3RGAA 5KP3A 2GEXA 2Z7AA 2OTL3 2KCDA 1TP6A 2W2CA 5I97A 2W9QA 4ORLA 3FF2A 1KD14 4N6OB 3MG1A 4LSOA 2CFDA 2M7OA 1BUQA 3WOFB 1NU3A 1OHSA 1PU4A 1JB2A 2D1WA 4N6V0 1FGOA 3G8ZA 3NBJA 5BVBA 2BO9B 3KE7A 3I0YA 4WP5A 1YJ93 3KZTA 2W9PA 3I563 4K90B 3JUOA 3FG1A 3MG2A 2C11A 1UUVB 1AV4A 2CC3A 2QIYA 4HBRA 1WTHA 5AEUB 5AIHA 2SBLA 1QALA 3WA3A 5LC7A 5TGNA 1JNQA 1W01A 3CXC2 3EN1B 1YIJ3 2KRTA 1GY6A 1GS3A 3F7XA 3Q1CA 3KFQC 4KFDA 3G16A 1ULIB 3LTDA 1HKXA 2WGOA 4KVHA 3NM7A 1NB5I 1D6UA 1Q40A 3QK9A 1VQK3 3IMAB 1OGZA 2CFLA 2IUJA 4N6NB 1CEWI 1JKGB 1VQO3 1N9JA 1RKYA 1GY5A 1Q824 3LYGA 2MC8A 4AKZA 2GEYA 1OCVA 1O7NB 3MSOA 3DGMA 3S29A 3V99A 1JJ22 1GD4A 1A2VA 3H3HA 3PZWA 2GU1A 3NM2A 3D3LA 3EE1A 1W2B2 1FGQA 2OOVA 2Q07A 3K9MC 4HKVB 1ZO2A 3RGRA 2CW9A 3LT9A 3G6E3 4R9LA 2RFRA 3PCSA 2L4VA 3SEDA 5KP4A 1KSIA 3EJVA 4EV5A 4WWUC 3EC9A 3SLUA 2PNCA 1VQ43 2B1XB 3GAXA 3UL5A 1YJW3 1IU7A 4QWTA 4BTYA 2ML6A 3DXOA 1TUHA 2CWUA 4XM4A 2JQ5A 5IG3A 4WYKA 5D83A 1C7HA 2BMQB 4FCMA 2CH9A 1JB5A 3TDGA 1CQSA 1VQ93 3DY5A 3MWZA 1OGXA 3X3YA 3NV0B 2E2UA 2K0MA 2BT3A 5AIGA 3X41A 1IV9A 1DYUA 2Z77A 3WOEB 4MMZB 1RJOA 4H61A 3CCS3 3WMDA 1OACA 3E99A 1W4NA 2Y73A 2W56A 1IDPA 4XBTA 3NX0A 1ULJB 3CCQ3 2INXA 3F8HA 3I553 2STDA 3FF0A 1YVBI 4HM5B 1ISKA 2E2TA 2XSOB 4LZIA 3OX9A 3NUVA 4O8SA 4FR9A 4L7KA 1YI23 2V1LA 1IK3A 3UB1A 4AEQA 2GBWB 3HK4A 4XB5A 4AKYA 1WMNA 1QAKA 3EBYA 3NQYA 5IG4A 3CCL3 3JUMA 4MJDA 2CFWA 1JRQA 4EBGA 1KC84 3FLJA 3FKAA 3HI7A 4WYKB 3NQZA 1L5GB 2YX9A 5CLKA 2A15A 2W56B 4J8TA 3DZLA 3CCR3 1W2ZA 1FGMA 2XRXB 5CK6A 1DVCA 5CF2A 3NBBA 2C10A 3FSDA 1F8NA 1A90A 5STDA 2Y74A 3CPW2 4ZM8A 1SIIA 3F7SA 4BTWA 3CME3 4IT7A 2ML5A 5AI1A 4RNZA 2CKFB 1FGRA 1IVWA 2WO0A 5EEOA 3CD63 1AVLA 1GD3A 3N8BA 3F14A 1O7HB 4N6UA 4HM1B 4IIAA 2XF3A 3JUPA 4HM0B 1Q7Y4 4NREA 1EQKA 2P0XA 3SOAA 1K9M4 1NO3A 1N8R4 1D6ZA 3X40A 1OHOA 5ELUA 1M9GA 4HYZA 1EKMA 4R4KA 2CG0A 2HMOB 5IEPA 5FGOA 4H3UA 1N5HA 2Z6BA 1LNHA 3OW22 1CYVA 1JN5A 2CIUA 4U13A 2XEPA 1V74A 3EHCA 3PGBA 1ASKA 1W7CA 1FUWA 2XGNA 3OXAA 3BNDA 3K0ZA 1A67A 3LOYA 4HZ9B 1STDA 1WMOA 3A76A 4L8PA 2IMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 3;  1K8A 4;  1VQP 3;  1VQ4 3;  1K9M 4;  3CMA 3;  3I56 3;  1VQK 3;  1K73 4;  3CCV 3;  3CCQ 3;  1YJW 3;  3CCR 3;  1YHQ 3;  3CC4 3;  3I55 3;  3CCS 3;  1QVG 2;  1N8R 4;  1VQO 3;  3G4S 3;  1M1K 4;  2OTL 3;  1NJI 4;  3G71 3;  1KQS 2;  1Q82 4;  1KD1 4;  1VQL 3;  1QVF 2;  1VQN 3;  3CPW 2;  3CME 3;  1YI2 3;  1Q86 4;  1VQ5 3;  1JJ2 2;  1VQ6 3;  3CCJ 3;  1VQ7 3;  1VQ8 3;  3OW2 2;  1S72 3;  1Q81 4;  1M90 4;  1VQ9 3;  3CCM 3;  2QEX 3;  1YIT 3;  1W2B 2;  3CXC 2;  1YIJ 3;  3CCL 3;  3CD6 3;  2OTJ 3;  1YJN 3;  3G6E 3;  1VQM 3;  1KC8 4;  3CCE 3;  1YJ9 3;  3CCU 3;  3CC7 3;  1Q7Y 4;  2QA4 3; 
#chains in the Genus database with same CATH topology
 3B4O A;  2HMN B;  3NV0 A;  1E3V A;  2XFS A;  1TU5 A;  3CMA 3;  2GBX B;  2IUK A;  1IQ8 A;  1LOV A;  3JVC A;  5IER A;  1JBT A;  4MMX B;  1MWT A;  3EQQ B;  3FGY A;  1RNT A;  4RBN A;  1W6Y A;  2RCD A;  3BNB A;  1RGC A;  5AIF A;  3FH1 A;  3ALA A;  4HAA A;  1O7W B;  2AAE A;  3LH4 A;  3G0K A;  3KSP A;  1RN7 A;  3Q2P A;  3A5E A;  4N6M A;  2W0Q A;  5DRE A;  3WOD G;  3ECF A;  3GWR A;  4N6L A;  1UI7 A;  1GYB A;  4N6T A;  3U97 A;  2W03 A;  1ROV A;  1I2G A;  1K41 A;  2WOH A;  2UX0 A;  3WA2 X;  1VQM 3;  1YVS A;  5DRV A;  1D6Y A;  3ROB A;  1B2M A;  3DGO A;  3QRD A;  4R9K A;  1C54 A;  3B7C A;  2ZDJ A;  2R4I A;  1O7P B;  4XBY A;  1Y4K A;  3KII A;  2OCT A;  3IJE B;  5IEN A;  1K73 4;  3D5G A;  1N5P A;  2XH9 A;  4HZB B;  1OHP A;  1BRJ A;  1KQS 2;  3KKG A;  3DM8 A;  2ZA4 A;  1FYS A;  1SJW A;  1X1U A;  3BNE A;  3EX9 A;  4WFO A;  1OUN A;  4XBX A;  1BSC A;  1EA2 A;  5IEO A;  2CWT A;  2CWV A;  4DKI A;  1PY3 A;  1SPU A;  4EYC A;  3EB8 A;  2F98 A;  3AGN A;  1B2S A;  4J5K A;  3UJM A;  1MOL A;  3SYU A;  2OTJ 3;  3LT8 A;  3HZP A;  4K1V A;  1RGA A;  4KZ1 A;  5HGR A;  4XDV A;  3EN8 A;  6RNT A;  5JBS A;  5G2G A;  3CC7 3;  1VQP 3;  4EV2 A;  2F5M A;  1W5Z A;  3MHE A;  2KXG A;  3IPT A;  4FMC A;  2FNQ A;  3CC4 3;  5D81 A;  4GHO A;  1ZX2 A;  1M1K 4;  3J7Y d;  1LQG C;  3N54 B;  1OH0 A;  2BMO B;  2HMM B;  5LC6 A;  3VF1 A;  1IYY A;  1BNR A;  1VQN 3;  4OVM A;  3ER7 A;  1MWS A;  3S28 A;  4HJL B;  1W02 A;  2LYX A;  1JV2 B;  2XFT A;  4FMD A;  4O02 B;  2QEX 3;  1WNH A;  2B24 B;  3OWS A;  5FW5 A;  5IG5 A;  1SQW A;  5M19 A;  5IF6 A;  1YJN 3;  2GSP A;  2GU3 A;  2XR8 B;  3B4P A;  3U1W A;  3WDG B;  1E3R A;  1GSP A;  1M1X B;  5IG0 A;  4LGQ A;  1K8A 4;  1K28 A;  4WHA A;  3X42 A;  1I2E A;  1LOX A;  1MWU A;  1Q42 A;  1QMA A;  2KF5 A;  2WGQ A;  1EG9 B;  1U5O A;  3EBT A;  4I4K A;  4EC6 A;  2BHM A;  2QGU A;  1N9E A;  3UL6 A;  1BU4 A;  2P05 A;  2P0M A;  3PCR A;  3T0U A;  2LQV A;  2P38 A;  2W6J H;  3LML A;  3K5T A;  3MKI A;  1VQL 3;  2MF7 A;  1QVF 2;  2YFL B;  4HM4 B;  3FG3 A;  3DGY A;  1J2B A;  3GZX B;  2F4Y A;  3MPH A;  3CCJ 3;  1VQ8 3;  4HOH A;  1JN5 B;  2HMJ B;  2FXT A;  5AEW B;  1RHL A;  2WOF A;  3H51 A;  3LZA A;  3V92 A;  2OQE A;  1RSN A;  3CNX A;  3FCS B;  1DMN A;  1OF5 A;  1SAR A;  3DMC A;  1G96 A;  3OWU A;  3Q90 A;  4X2O A;  3WHO A;  2OOV C;  5EQL A;  1RMS A;  1MGR A;  2F99 A;  1BSE A;  1DMM A;  4OK0 A;  3CC2 3;  1VQQ A;  4R1K A;  1BVI A;  2P09 A;  3F8X A;  3GZB A;  5JPU A;  4RNY A;  3HIG A;  1AR0 A;  4LMI A;  3PYJ A;  5IW9 A;  1HU9 A;  1YHQ 3;  1FUT A;  1T2I A;  1I0X A;  3RDE A;  1X1X A;  4I5Q A;  3G71 3;  3JUN A;  1US1 A;  3LTA A;  4LYL B;  3HII A;  4ILF A;  2R41 A;  1VQ6 3;  2F86 B;  1PFP A;  1WMP A;  2YFI B;  1RGE A;  2BNG A;  3L0R A;  4PEJ A;  2Z76 A;  3GZY B;  2RSX A;  3STD A;  1TTO A;  1IT7 A;  4HM2 B;  1GY7 A;  3X3X A;  4HVN A;  1YGE A;  1A2K A;  1B21 A;  1RRL A;  4L8O A;  1RGK A;  1KWI A;  2IA7 A;  3PS8 A;  4N3V A;  2O3O A;  1TJD A;  1UGI A;  3AMO A;  4J5G A;  1Q81 4;  4RZM A;  3V98 A;  4HM3 B;  2CFK A;  4K61 A;  1VZZ A;  3FG4 A;  3UNL A;  8CHO A;  2JDI H;  3AHS A;  1NWW A;  2K54 A;  2KF4 A;  1BSA A;  1BNE A;  4GB5 A;  3G4S 3;  1LXE A;  5HOH A;  1DMQ A;  1ROA A;  1OF5 B;  1RRH A;  4EW5 A;  1UCI A;  1IQY A;  3K63 A;  1W00 A;  2PZV A;  1Q86 4;  5ELJ A;  2I9W A;  3SXX A;  1IVU A;  3Q3F A;  1O7M B;  1TFK A;  4FCJ A;  4BTX A;  1I3F A;  1EEJ A;  1IQX A;  1U8C B;  4K1U A;  1RN4 A;  5KP1 A;  2CK3 H;  2CFG A;  3K7C A;  3FZW A;  3PXM A;  4HM8 B;  2XSH B;  4KT3 B;  5CXO A;  1CYU A;  3D5I A;  1NNV A;  5AYS C;  3LTC A;  1WQL B;  3NXJ A;  3SVA A;  1FUS A;  3EF8 A;  3F9S A;  2OWP A;  1T5Y A;  2KF3 A;  3SX1 A;  4NHF A;  5AYR B;  4KFF A;  1QVG 2;  4O2H A;  4BL2 A;  3DGN A;  3S27 A;  1NB3 I;  3BLZ A;  5JPP A;  1SIH A;  3BU4 A;  4FCZ A;  1UUW B;  1UCL A;  1MGW A;  3DUK A;  1QJG A;  3OWY A;  2CX0 A;  4X2H A;  1DET A;  1MNL A;  1RCK A;  4GSP A;  2GXF A;  4Q53 A;  3CPO A;  5G1K A;  1BUJ A;  1YIT 3;  1TIJ A;  3KCH A;  4HM7 B;  2HMK B;  3JUQ A;  1N8Q A;  3DGL A;  3BIR A;  4FMB A;  4JRF A;  1STF I;  1QAF A;  4RNT A;  4CCV A;  1E97 A;  3D9R A;  3NBR A;  1OPY A;  2W04 A;  1Q7H A;  1UW1 A;  3D79 A;  3HX8 A;  4IPB A;  3CU3 A;  3M8C A;  3MG3 A;  4JF8 A;  4MEI A;  3KSE D;  3S67 A;  5BXQ A;  4CDL A;  3CCV 3;  4FMA A;  4BU4 A;  3AHW A;  2E2V A;  1GOY A;  2D42 A;  1GMP A;  2HML B;  3ZG0 A;  4BL3 A;  7STD A;  3AMO B;  1Z1S A;  4GL6 A;  1NJI 4;  2ZL8 A;  1FA3 A;  3F40 A;  1BAO A;  4CJN A;  2YFJ B;  1B27 A;  3GRD A;  1CH0 A;  4STD A;  3LXU X;  1AVK A;  5CF1 A;  1VQ7 3;  1GMQ A;  3MYT A;  2RGQ A;  1Q40 B;  1M90 4;  4MMY B;  4LEH A;  3CCM 3;  1RGL A;  3GZR A;  2FGT A;  1JBR A;  1HZ1 A;  4OUQ A;  1S5A A;  1TRQ A;  2RBI A;  1DVD A;  1JKG A;  2XGL A;  4TX4 A;  3SOY A;  4HM6 B;  5A0O B;  1IVX A;  4G1M B;  1LRA A;  1GMR A;  1BNG A;  3KN4 A;  1IVV A;  4J9A A;  3NHX A;  1BNJ A;  1TFO A;  1W6C A;  5AII A;  3T8U A;  4EXR A;  6STD A;  3X3Z A;  3BNC A;  3VSY A;  4O3V A;  1RDS A;  3VGN A;  1LOY A;  1JZO A;  1VQ5 3;  2OQE C;  3T8N A;  1S72 3;  1FGT A;  3B8L A;  1RGH A;  1PYL A;  5EVH A;  2F56 A;  1LVN A;  1R4C A;  3OV4 A;  5D82 A;  1W6G A;  3O8Y A;  4XDW A;  2CG1 A;  3S5C A;  3RNT A;  3HOH A;  3CNM A;  3N9H A;  3AGO A;  5G1L A;  1NDO B;  2BMR B;  1O7G B;  1JB4 A;  1I0V A;  1UI8 A;  1LNI A;  2CHC A;  2AAD A;  3LTB A;  3CCE 3;  1IV7 A;  1RGF A;  2O9U X;  3CCU 3;  1RNB A;  2QA4 3;  1IT8 A;  1X1W A;  1RGG A;  3BB9 A;  4KFE A;  2BU4 A;  4R80 A;  5KP3 A;  3RGA A;  2GEX A;  2H0H A;  2H0G A;  1ZGX A;  2Z7A A;  2OTL 3;  2KCD A;  1TP6 A;  2W2C A;  5I97 A;  2W9Q A;  4ORL A;  3FF2 A;  1KD1 4;  4N6O B;  1FZU A;  3MG1 A;  1V57 A;  4LSO A;  3URP A;  1R4Y A;  1UUG B;  1I70 A;  5M1A A;  5RNT A;  2CFD A;  2M7O A;  1BUQ A;  3WOF B;  1Q9E A;  1NU3 A;  1OHS A;  3GSP A;  2D1W A;  1JB2 A;  1PU4 A;  4N6V 0;  1FGO A;  3G8Z A;  3NBJ A;  5BVB A;  1B2U A;  2BO9 B;  3KE7 A;  1BSD A;  3I0Y A;  4WP5 A;  1YJ9 3;  3KZT A;  2W9P A;  3I56 3;  1FW7 A;  4K90 B;  3JUO A;  3FG1 A;  3MG2 A;  2C11 A;  1UUV B;  1AV4 A;  2CC3 A;  2QIY A;  4HBR A;  1WTH A;  5AEU B;  5AIH A;  2ZHX B;  2SBL A;  1QAL A;  3WA3 A;  5LC7 A;  5BU4 A;  1BSB A;  5TGN A;  1BNI A;  1JNQ A;  1W01 A;  3CXC 2;  1BRN L;  3EN1 B;  1YIJ 3;  2KRT A;  1GY6 A;  1V58 A;  2IMJ A;  4BIR A;  1BNS A;  1GS3 A;  3F7X A;  1RN1 A;  3Q1C A;  3KFQ C;  4KFD A;  3G16 A;  1ULI B;  3LTD A;  1HKX A;  2WGO A;  4KVH A;  3NM7 A;  1NB5 I;  1B2Z A;  1D6U A;  1Q40 A;  3QK9 A;  1VQK 3;  3IMA B;  1OGZ A;  1G02 A;  2CFL A;  2IUJ A;  4N6N B;  2UUG C;  1CEW I;  1JKG B;  1VQO 3;  1N9J A;  1RKY A;  1GY5 A;  1Q82 4;  3LYG A;  1GOV A;  2IYJ A;  2MC8 A;  1BGS A;  2GEY A;  4NPB A;  4AKZ A;  1OCV A;  1O7N B;  3MSO A;  3DGM A;  3S29 A;  3V99 A;  1JJ2 2;  1RLS A;  1GD4 A;  3ZG5 A;  1A2V A;  3H3H A;  3PZW A;  1B2X A;  2GU1 A;  3NM2 A;  1I8V A;  3D3L A;  3EE1 A;  1BRH A;  1W2B 2;  1FGQ A;  2OOV A;  2Q07 A;  3K9M C;  4HKV B;  1ZO2 A;  3RGR A;  2CW9 A;  3LT9 A;  3G6E 3;  4R9L A;  2RFR A;  1BAN A;  2L4V A;  3PCS A;  3SED A;  5KP4 A;  1LQM B;  1KSI A;  3EJV A;  4EV5 A;  4WWU C;  3EC9 A;  3SLU A;  2PNC A;  5GSP A;  2B1X B;  8RNT A;  1VQ4 3;  3GAX A;  1BRS A;  3UL5 A;  1YJW 3;  1IU7 A;  4QWT A;  1UDI I;  2ML6 A;  4BTY A;  3DXO A;  1TUH A;  2CWU A;  4XM4 A;  2JQ5 A;  5IG3 A;  4WYK A;  5D83 A;  1C7H A;  2BMQ B;  4FCM A;  2CH9 A;  1JB5 A;  3TDG A;  1CQS A;  1X1Y A;  1VQ9 3;  1TRP A;  3DY5 A;  3MWZ A;  1JZD A;  1OGX A;  3X3Y A;  3NV0 B;  2E2U A;  2K0M A;  2BT3 A;  5AIG A;  3X41 A;  1IV9 A;  1DYU A;  5BIR A;  2Z77 A;  3WOE B;  4MMZ B;  1RJO A;  4H61 A;  2K3D A;  2UGI A;  3CCS 3;  1MWR A;  3WMD A;  1OAC A;  3E99 A;  2RNT A;  1W4N A;  2Y73 A;  1RTU A;  1IDP A;  2F5W A;  2W56 A;  3NX0 A;  1ULJ B;  1ZS7 A;  4XBT A;  3CCQ 3;  2INX A;  3F8H A;  3I55 3;  2STD A;  3FF0 A;  1YVB I;  1I3I A;  4HM5 B;  1ISK A;  2E2T A;  1UGH I;  2XSO B;  4LZI A;  3OX9 A;  3NUV A;  4O8S A;  4FR9 A;  4L7K A;  9RNT A;  3ZFZ A;  1YI2 3;  2V1L A;  1IK3 A;  3D4A A;  3UB1 A;  4AEQ A;  2GBW B;  3HK4 A;  4XB5 A;  4AKY A;  1WMN A;  1HYF A;  1QAK A;  3EBY A;  3NQY A;  5IG4 A;  7RNT A;  3CCL 3;  3JUM A;  4MJD A;  2HOH A;  2CFW A;  2L1S A;  1JRQ A;  4EBG A;  1KC8 4;  3FLJ A;  3FKA A;  3HI7 A;  4WYK B;  3NQZ A;  1L5G B;  2YX9 A;  1RCL A;  5CLK A;  2A15 A;  2W56 B;  1GOU A;  2J8X B;  3DH2 A;  1EUI C;  4J8T A;  1A2P A;  3DZL A;  1YGW A;  1W2Z A;  3CCR 3;  7GSP A;  1FGM A;  2XRX B;  5CK6 A;  1DVC A;  5CF2 A;  3NBB A;  2C10 A;  3FSD A;  1DE3 A;  1BOX A;  1F8N A;  1A90 A;  5STD A;  2Y74 A;  3CPW 2;  1AQZ A;  1BRK A;  4ZM8 A;  1SII A;  3F7S A;  4BTW A;  3CME 3;  4IT7 A;  2ML5 A;  5AI1 A;  4RNZ A;  5M18 A;  2CKF B;  1I2F A;  1FGR A;  1IVW A;  2WO0 A;  5EEO A;  3CD6 3;  1AVL A;  1GD3 A;  3N8B A;  1JBS A;  3F14 A;  1O7H B;  1B20 A;  4HM1 B;  4IIA A;  4N6U A;  2KF6 A;  2XF3 A;  2KAA A;  2BIR A;  6GSP A;  3JUP A;  4HM0 B;  1Q7Y 4;  4NRE A;  2IY2 A;  1EQK A;  2P0X A;  3SOA A;  1K9M 4;  1NO3 A;  1AY7 A;  1G0T A;  2SAR A;  1N8R 4;  1D6Z A;  3X40 A;  1UCK A;  1OHO A;  5ELU A;  1M9G A;  1BRI A;  1EKM A;  2H0I A;  2CG0 A;  4HYZ A;  1BRG A;  4R4K A;  2CX1 A;  2HMO B;  5IEP A;  1T3B A;  3WR2 A;  5FGO A;  4H3U A;  1N5H A;  2Z6B A;  1LNH A;  3OW2 2;  1CYV A;  1JN5 A;  2CIU A;  4U13 A;  2XEP A;  1LOW A;  4CPK A;  1V74 A;  3EHC A;  3PGB A;  1ASK A;  1UCJ A;  1B3S A;  1W7C A;  2C4B A;  1YNV X;  2XGN A;  1FUW A;  3OXA A;  3BND A;  3K0Z A;  1BIR A;  1T2H A;  1A67 A;  3LOY A;  4HZ9 B;  1STD A;  1WMO A;  3A76 A;  4L8P A;  1BNF A; 
#chains in the Genus database with same CATH homology
 3B4O A;  2HMN B;  3NV0 A;  1E3V A;  2XFS A;  1TU5 A;  3CMA 3;  2GBX B;  2IUK A;  1IQ8 A;  3JVC A;  5IER A;  4MMX B;  3EQQ B;  3FGY A;  4RBN A;  1W6Y A;  2RCD A;  3BNB A;  5AIF A;  3FH1 A;  3ALA A;  1O7W B;  3LH4 A;  3G0K A;  3KSP A;  1RN7 A;  3Q2P A;  4N6M A;  3WOD G;  2W0Q A;  5DRE A;  3ECF A;  3GWR A;  4N6L A;  1UI7 A;  1GYB A;  4N6T A;  3U97 A;  2W03 A;  1ROV A;  1K41 A;  2WOH A;  2UX0 A;  3WA2 X;  1VQM 3;  5DRV A;  1D6Y A;  3ROB A;  3DGO A;  3QRD A;  4R9K A;  3B7C A;  2ZDJ A;  2R4I A;  1O7P B;  4XBY A;  1Y4K A;  3KII A;  2OCT A;  3IJE B;  5IEN A;  1K73 4;  1N5P A;  2XH9 A;  4HZB B;  1OHP A;  1KQS 2;  3KKG A;  3DM8 A;  1SJW A;  3EX9 A;  3BNE A;  4WFO A;  1OUN A;  4XBX A;  1EA2 A;  5IEO A;  2CWT A;  2CWV A;  1SPU A;  4EYC A;  3EB8 A;  2F98 A;  2OTJ 3;  3UJM A;  1MOL A;  3LT8 A;  3HZP A;  4K1V A;  4KZ1 A;  5HGR A;  5JBS A;  4XDV A;  3EN8 A;  3CC7 3;  5G2G A;  1VQP 3;  4EV2 A;  1W5Z A;  3MHE A;  2KXG A;  3IPT A;  4FMC A;  2FNQ A;  3CC4 3;  5D81 A;  1ZX2 A;  1M1K 4;  3J7Y d;  3N54 B;  1OH0 A;  2BMO B;  2HMM B;  5LC6 A;  3VF1 A;  1VQN 3;  4OVM A;  3ER7 A;  3S28 A;  4HJL B;  1W02 A;  2LYX A;  1JV2 B;  2XFT A;  4FMD A;  4O02 B;  2QEX 3;  1WNH A;  2B24 B;  3OWS A;  5FW5 A;  5IG5 A;  1SQW A;  5IF6 A;  1YJN 3;  2GU3 A;  2XR8 B;  3B4P A;  3U1W A;  3WDG B;  1E3R A;  1M1X B;  5IG0 A;  4LGQ A;  1K8A 4;  1K28 A;  4WHA A;  3X42 A;  1LOX A;  1Q42 A;  1QMA A;  2WGQ A;  4I4K A;  1EG9 B;  1U5O A;  3EBT A;  4EC6 A;  2BHM A;  2QGU A;  1N9E A;  3UL6 A;  2P05 A;  2P0M A;  3PCR A;  3T0U A;  2LQV A;  2P38 A;  2W6J H;  3LML A;  3K5T A;  3MKI A;  1VQL 3;  2MF7 A;  1QVF 2;  2YFL B;  4HM4 B;  3FG3 A;  1J2B A;  3GZX B;  3MPH A;  3CCJ 3;  1VQ8 3;  1JN5 B;  2HMJ B;  2FXT A;  5AEW B;  3H51 A;  2WOF A;  3LZA A;  3V92 A;  2OQE A;  3CNX A;  3FCS B;  1DMN A;  1OF5 A;  3DMC A;  1G96 A;  3OWU A;  3Q90 A;  4X2O A;  2OOV C;  5EQL A;  2F99 A;  1DMM A;  3CC2 3;  4R1K A;  3F8X A;  2P09 A;  5JPU A;  3GZB A;  4RNY A;  3HIG A;  1AR0 A;  4LMI A;  3PYJ A;  5IW9 A;  1HU9 A;  1YHQ 3;  3RDE A;  3G71 3;  3JUN A;  1US1 A;  3LTA A;  3HII A;  1VQ6 3;  2F86 B;  1PFP A;  1WMP A;  2YFI B;  4PEJ A;  2BNG A;  3L0R A;  2Z76 A;  3GZY B;  2RSX A;  3STD A;  1IT7 A;  4HM2 B;  1GY7 A;  3X3X A;  4HVN A;  1YGE A;  1A2K A;  1RRL A;  4L8O A;  1KWI A;  2IA7 A;  3PS8 A;  4N3V A;  2O3O A;  3AMO A;  1Q81 4;  4RZM A;  3V98 A;  4HM3 B;  2CFK A;  4K61 A;  1VZZ A;  3FG4 A;  3UNL A;  8CHO A;  2JDI H;  1NWW A;  2K54 A;  4GB5 A;  3G4S 3;  1LXE A;  1DMQ A;  1ROA A;  1OF5 B;  1RRH A;  1IQY A;  3K63 A;  1W00 A;  2PZV A;  1Q86 4;  5ELJ A;  2I9W A;  3SXX A;  1IVU A;  1O7M B;  1TFK A;  4FCJ A;  4BTX A;  1IQX A;  1U8C B;  4K1U A;  5KP1 A;  2CK3 H;  2CFG A;  3K7C A;  3FZW A;  3PXM A;  4HM8 B;  2XSH B;  5CXO A;  1CYU A;  5AYS C;  3LTC A;  1WQL B;  3NXJ A;  3SVA A;  3EF8 A;  3F9S A;  2OWP A;  1T5Y A;  3SX1 A;  4NHF A;  5AYR B;  4KFF A;  1QVG 2;  4O2H A;  3DGN A;  3S27 A;  1NB3 I;  3BLZ A;  5JPP A;  1SIH A;  4FCZ A;  1UUW B;  3DUK A;  1QJG A;  3OWY A;  4X2H A;  1MNL A;  4Q53 A;  2GXF A;  3CPO A;  1YIT 3;  1TIJ A;  4HM7 B;  2HMK B;  3JUQ A;  1N8Q A;  3DGL A;  4FMB A;  4JRF A;  1STF I;  1QAF A;  4CCV A;  1E97 A;  3D9R A;  3NBR A;  1OPY A;  2W04 A;  4IPB A;  1UW1 A;  4JF8 A;  3HX8 A;  4OK0 A;  3CU3 A;  3M8C A;  3MG3 A;  4MEI A;  3VGN A;  3KSE D;  3S67 A;  5BXQ A;  4CDL A;  3CCV 3;  4FMA A;  2D42 A;  2E2V A;  2HML B;  7STD A;  3AMO B;  1Z1S A;  4GL6 A;  1NJI 4;  2ZL8 A;  1FA3 A;  3F40 A;  2YFJ B;  3GRD A;  4STD A;  3LXU X;  1AVK A;  5CF1 A;  1VQ7 3;  3MYT A;  2RGQ A;  1Q40 B;  1M90 4;  4MMY B;  4LEH A;  3CCM 3;  3GZR A;  2FGT A;  4OUQ A;  1S5A A;  1DVD A;  1JKG A;  2XGL A;  4TX4 A;  3SOY A;  4HM6 B;  5A0O B;  1IVX A;  4G1M B;  3KN4 A;  1IVV A;  4J9A A;  3NHX A;  1W6C A;  1TFO A;  3T8U A;  5AII A;  4EXR A;  6STD A;  3X3Z A;  3BNC A;  3VSY A;  4O3V A;  1VQ5 3;  2OQE C;  3T8N A;  1S72 3;  1FGT A;  3B8L A;  5EVH A;  2CG1 A;  1LVN A;  1R4C A;  3OV4 A;  5D82 A;  1W6G A;  3O8Y A;  4XDW A;  3S5C A;  3CNM A;  3N9H A;  1NDO B;  2BMR B;  1O7G B;  1JB4 A;  3CCE 3;  1UI8 A;  2CHC A;  3LTB A;  1IV7 A;  2O9U X;  3CCU 3;  2QA4 3;  1IT8 A;  3BB9 A;  4R80 A;  4KFE A;  3RGA A;  5KP3 A;  2GEX A;  2Z7A A;  2OTL 3;  2KCD A;  1TP6 A;  2W2C A;  5I97 A;  2W9Q A;  4ORL A;  3FF2 A;  1KD1 4;  4N6O B;  3MG1 A;  4LSO A;  2CFD A;  2M7O A;  1BUQ A;  3WOF B;  1NU3 A;  1OHS A;  1PU4 A;  1JB2 A;  2D1W A;  4N6V 0;  1FGO A;  3G8Z A;  3NBJ A;  5BVB A;  2BO9 B;  3KE7 A;  3I0Y A;  4WP5 A;  1YJ9 3;  3KZT A;  2W9P A;  3I56 3;  4K90 B;  3JUO A;  3FG1 A;  3MG2 A;  2C11 A;  1UUV B;  1AV4 A;  2CC3 A;  2QIY A;  4HBR A;  1WTH A;  5AEU B;  5AIH A;  2SBL A;  1QAL A;  3WA3 A;  5LC7 A;  5TGN A;  1JNQ A;  1W01 A;  3CXC 2;  3EN1 B;  1YIJ 3;  2KRT A;  1GY6 A;  1GS3 A;  3F7X A;  3Q1C A;  3KFQ C;  4KFD A;  3G16 A;  1ULI B;  3LTD A;  1HKX A;  2WGO A;  4KVH A;  3NM7 A;  1NB5 I;  1D6U A;  1Q40 A;  3QK9 A;  1VQK 3;  3IMA B;  1OGZ A;  2CFL A;  2IUJ A;  4N6N B;  1CEW I;  1JKG B;  1VQO 3;  1N9J A;  1RKY A;  1GY5 A;  1Q82 4;  3LYG A;  2MC8 A;  4AKZ A;  2GEY A;  1OCV A;  1O7N B;  3MSO A;  3DGM A;  3S29 A;  3V99 A;  1JJ2 2;  1GD4 A;  1A2V A;  3H3H A;  3PZW A;  2GU1 A;  3NM2 A;  3D3L A;  3EE1 A;  1W2B 2;  1FGQ A;  2OOV A;  2Q07 A;  3K9M C;  4HKV B;  1ZO2 A;  3RGR A;  2CW9 A;  3LT9 A;  3G6E 3;  4R9L A;  2RFR A;  3PCS A;  2L4V A;  3SED A;  5KP4 A;  1KSI A;  3EJV A;  4EV5 A;  4WWU C;  3EC9 A;  3SLU A;  2PNC A;  1VQ4 3;  2B1X B;  3GAX A;  3UL5 A;  1YJW 3;  1IU7 A;  4QWT A;  4BTY A;  2ML6 A;  3DXO A;  1TUH A;  2CWU A;  4XM4 A;  2JQ5 A;  5IG3 A;  4WYK A;  5D83 A;  1C7H A;  2BMQ B;  4FCM A;  2CH9 A;  1JB5 A;  3TDG A;  1CQS A;  1VQ9 3;  3DY5 A;  3MWZ A;  1OGX A;  3X3Y A;  3NV0 B;  2E2U A;  2K0M A;  2BT3 A;  5AIG A;  3X41 A;  1IV9 A;  1DYU A;  2Z77 A;  3WOE B;  4MMZ B;  1RJO A;  4H61 A;  3CCS 3;  3WMD A;  1OAC A;  3E99 A;  1W4N A;  2Y73 A;  2W56 A;  1IDP A;  4XBT A;  3NX0 A;  1ULJ B;  3CCQ 3;  2INX A;  3F8H A;  3I55 3;  2STD A;  3FF0 A;  1YVB I;  4HM5 B;  1ISK A;  2E2T A;  2XSO B;  4LZI A;  3OX9 A;  3NUV A;  4O8S A;  4FR9 A;  4L7K A;  1YI2 3;  2V1L A;  1IK3 A;  3UB1 A;  4AEQ A;  2GBW B;  3HK4 A;  4XB5 A;  4AKY A;  1WMN A;  1QAK A;  3EBY A;  3NQY A;  5IG4 A;  3CCL 3;  3JUM A;  4MJD A;  2CFW A;  1JRQ A;  4EBG A;  1KC8 4;  3FLJ A;  3FKA A;  3HI7 A;  4WYK B;  3NQZ A;  1L5G B;  2YX9 A;  5CLK A;  2A15 A;  2W56 B;  4J8T A;  3DZL A;  3CCR 3;  1W2Z A;  1FGM A;  2XRX B;  5CK6 A;  1DVC A;  5CF2 A;  3NBB A;  2C10 A;  3FSD A;  1F8N A;  1A90 A;  5STD A;  2Y74 A;  3CPW 2;  4ZM8 A;  1SII A;  3F7S A;  4BTW A;  3CME 3;  4IT7 A;  2ML5 A;  5AI1 A;  4RNZ A;  2CKF B;  1FGR A;  1IVW A;  2WO0 A;  5EEO A;  3CD6 3;  1AVL A;  1GD3 A;  3N8B A;  3F14 A;  1O7H B;  4N6U A;  4HM1 B;  4IIA A;  2XF3 A;  3JUP A;  4HM0 B;  1Q7Y 4;  4NRE A;  1EQK A;  2P0X A;  3SOA A;  1K9M 4;  1NO3 A;  1N8R 4;  1D6Z A;  3X40 A;  1OHO A;  5ELU A;  1M9G A;  4HYZ A;  1EKM A;  4R4K A;  2CG0 A;  2HMO B;  5IEP A;  5FGO A;  4H3U A;  1N5H A;  2Z6B A;  1LNH A;  3OW2 2;  1CYV A;  1JN5 A;  2CIU A;  4U13 A;  2XEP A;  1V74 A;  3EHC A;  3PGB A;  1ASK A;  1W7C A;  1FUW A;  2XGN A;  3OXA A;  3BND A;  3K0Z A;  1A67 A;  3LOY A;  4HZ9 B;  1STD A;  1WMO A;  3A76 A;  4L8P A;  2IMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...