4R80A

Crystal structure of a de novo designed beta sheet protein, cystatin fold, northeast structural genomics consortium (nesg) target or486
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
PSEEEEKRRAKQVAKEKILEQNPSSKVQVRRVQKQGNTIRVELEITENGKKTNITVEVEKQGNTFTVKRITETVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords OR486
publication title Crystal Structure of an engineered protein with denovo beta sheet design, Northeast Structural Genomics Consortium (NESG) Target OR486
rcsb
source organism Synthetic construct
total genus 17
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.630 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r80A00
4R80A
chains in the Genus database with same CATH superfamily
1Q864 4HM1B 1QAFA 3EX9A 4J8TA 2BMOB 1BRGA 2XFSA 1US1A 4AKZA 7RNTA 3KSED 2WO0A 3UNLA 2O9UX 3LT9A 1OCVA 1RJOA 4XBTA 4K1VA 1YJ93 5IG5A 1IU7A 2L4VA 2D42A 4BL3A 3F8XA 1RDSA 3FG1A 2KAAA 3PXMA 4WP5A 1OH0A 1T2IA 3OWYA 3DH2A 3RDEA 2RNTA 1SIIA 4HZBB 1RGGA 1BNFA 4KFDA 4L8PA 2IUJA 2QEX3 4GB5A 1AY7A 5CXOA 2SBLA 3ER7A 3FCSB 1G0TA 1BGSA 4GL6A 1I2GA 1FUTA 3HZPA 3FZWA 3K63A 3NQYA 1IQYA 3AHWA 5CLKA 1Y4KA 3CC23 1UCIA 1N5HA 1BANA 4HM6B 3SVAA 2GU3A 1AV4A 3EN8A 3NBRA 4HM2B 2CWTA 1W2ZA 1JRQA 3TDGA 2K54A 3CCV3 2H0HA 1UGIA 4HJLB 2IMJA 1DE3A 2Y74A 2OOVA 2ZHXB 2GBWB 1N8QA 2CX1A 2L1SA 4HAAA 8RNTA 4CCVA 1D6ZA 3OWUA 2XEPA 1OUNA 3E99A 2CHCA 1RN4A 5I97A 5IEOA 5HOHA 2W0QA 2C11A 1X1WA 4X2HA 1A2KA 3ALAA 3F9SA 4GHOA 1BRNL 3U97A 1BRKA 1LQMB 4J9AA 2BMQB 5AIIA 1ULJB 1Q42A 3NM7A 4EW5A 3O8YA 3BNEA 2HOHA 2H0GA 1O7GB 2BU4A 5AIHA 2V1LA 2GEXA 2RCDA 3LXUX 3CC43 1GY6A 1OHPA 3GRDA 3DGLA 3N8BA 3BU4A 3X40A 4IPBA 2YX9A 1JZDA 4LSOA 1Q824 1LOYA 5G1KA 1IVWA 4O2HA 2CW9A 1DMNA 3G4S3 2MF7A 2XGNA 1IVVA 1Q7HA 3D5GA 1RKYA 3MWZA 1V57A 3DGNA 3X3XA 3CNMA 1ULIB 3CCE3 3OXAA 1NB3I 3JUPA 4ORLA 1RLSA 1N9EA 1QALA 1Q40A 3RGRA 5AYRB 3Q2PA 5DREA 3CME3 3I0YA 4WYKA 1TFOA 3H3HA 1YHQ3 2W04A 1PFPA 4K1UA 1SQWA 4RNYA 1T2HA 2KF3A 1YGEA 7STDA 2LYXA 1M9GA 4RNZA 1F8NA 1PYLA 4H61A 1X1YA 3L0RA 1IQ8A 5ELJA 1HU9A 1B2UA 1BNGA 3PS8A 4R9LA 5D82A 1VQQA 3WDGB 4PEJA 1A67A 3OV4A 3CC73 1JB4A 3B4PA 3D9RA 3NQZA 3B7CA 4I4KA 4XDWA 3IJEB 3BLZA 3KCHA 3LTCA 5BU4A 1X1XA 1PU4A 1ASKA 3JUQA 4R4KA 1K9M4 5TGNA 1B20A 1RSNA 1E97A 1JBRA 4K90B 2E2VA 1LVNA 5AI1A 3WA3A 2SARA 5GSPA 5KP3A 1GD4A 1BNSA 1RGAA 1RN7A 2WGQA 1A2PA 2M7OA 2XH9A 3DGMA 3T0UA 3D5IA 3GAXA 1ZO2A 6RNTA 1MGRA 4HM8B 2INXA 2FNQA 1A2VA 5EEOA 4ZM8A 3CXC2 3S29A 2XSOB 1KSIA 1G02A 3CNXA 1JB5A 2UX0A 2FGTA 2Y73A 5AIGA 3VSYA 3UL5A 2XGLA 4CDLA 1K8A4 3N54B 4HOHA 1EG9B 1TFKA 2YFLB 2Z77A 4L7KA 3VGNA 1CQSA 3A76A 3PCSA 2Z7AA 1V58A 5ELUA 1IV9A 1B2ZA 1RGCA 1FUWA 5AYSC 1N8R4 4GSPA 1OHSA 3AHSA 4IIAA 1OGXA 2D1WA 1RGHA 3SEDA 1ISKA 3DGYA 3PZWA 1AVLA 2H0IA 3LOYA 5IEPA 1BSCA 3S27A 1M1K4 2CFLA 1O7WB 2OQEA 3CCR3 1UCLA 2IA7A 3DMCA 4EC6A 2BMRB 1EQKA 1OF5A 1B27A 1MOLA 5AIFA 3AMOA 1TRPA 2LQVA 3WHOA 3CCM3 4BIRA 3B4OA 3N9HA 4O8SA 1W4NA 1NNVA 4O02B 2IUKA 1HZ1A 4HM3B 4KFFA 1IDPA 1MWTA 2E2UA 1I70A 1IYYA 2YFIB 1NJI4 4J5GA 5A0OB 1GSPA 3NV0A 1WQLB 1M1XB 2HMOB 1B2XA 4OUQA 4HBRA 1OPYA 4FMBA 4KVHA 3CCS3 3G713 2GBXB 3FSDA 1LQGC 1C7HA 1GY5A 1UUGB 2E2TA 3ROBA 2OTL3 5KP1A 3F14A 1KC84 2OCTA 2F98A 1RCKA 1TU5A 3I553 1LOWA 2QIYA 3LMLA 4LYLB 3DGOA 4N6LA 4BTWA 4WFOA 2QA43 1GMQA 1LXEA 3EN1B 3WODG 2CH9A 2PZVA 3F7SA 1Q40B 3LT8A 2OWPA 2F86B 3D79A 4WYKB 1G96A 1DMMA 2WGOA 5DRVA 1BRSA 3SXXA 1LNHA 3X42A 1JNQA 3I563 2HMLB 2XSHB 4HM0B 1PY3A 1YVSA 3JUMA 4N6V0 1K734 1GOVA 1LRAA 1HKXA 3BB9A 1VQP3 1V74A 1VQK3 3FLJA 1DVCA 2OTJ3 3LTDA 1IT7A 1B21A 1I3FA 4NPBA 3STDA 3OW22 1BUQA 2JDIH 2HMJB 4O3VA 1TP6A 4XBYA 1N9JA 3CD63 2R4IA 3EF8A 3G0KA 2GEYA 4I5QA 3GZYB 2BO9B 1O7MB 1EUIC 3FF0A 3LZAA 5IERA 1JKGB 3H51A 4HM5B 4R80A 3CCJ3 2CFKA 1AR0A 4FMAA 4N6MA 3LTBA 1LOVA 2CIUA 5HGRA 3S28A 1FW7A 3HK4A 3Q90A 1GMPA 5BVBA 1E3RA 3MYTA 3SX1A 4LMIA 2KRTA 3NM2A 1C54A 1BUJA 1CH0A 2ML6A 1UI8A 5FGOA 4JF8A 1AQZA 4BL2A 1QVG2 3EQQB 8CHOA 3CCQ3 2BNGA 1UUWB 1WMNA 4Q53A 1BOXA 1LOXA 1Q814 1VQM3 5RNTA 3UB1A 5EVHA 1YI23 3FH1A 2CFGA 1NO3A 3KIIA 4RZMA 2W56A 1TIJA 2F5WA 2K0MA 4HM4B 5M1AA 1J2BA 1SPUA 2O3OA 2P09A 6GSPA 1HYFA 1VQ83 1WMOA 2GU1A 4MEIA 3IMAB 1RTUA 1T3BA 1Z1SA 2ZL8A 3JUNA 2KF4A 2OOVC 1YVBI 1FA3A 1I3IA 1QAKA 3EBYA 1B2MA 1WMPA 4KZ1A 5JPUA 1YIJ3 3FG4A 1CEWI 1RRHA 1BNJA 4N6OB 3GZXB 4XM4A 4EYCA 2W6JH 3LH4A 1QVF2 2CG0A 3FF2A 3BNDA 3PCRA 1S5AA 1UCJA 1IVUA 1BRHA 1JB2A 1NDOB 1K28A 2RGQA 2W2CA 2ZA4A 1RCLA 2CWVA 4G1MB 1YNVX 2KF5A 2Z6BA 3SYUA 4DKIA 1VQ43 4HM7B 1U5OA 2B24B 1EKMA 3NXJA 3MKIA 3KN4A 1W6CA 5IG0A 3UJMA 3FKAA 1DYUA 4BU4A 2BHMA 1OF5B 2W03A 2MC8A 1W02A 2P0MA 3NHXA 4R1KA 3AMOB 3B8LA 2RBIA 3EC9A 1I2FA 2F5MA 4L8OA 4NHFA 3FG3A 1D6UA 4X2OA 1MGWA 1YGWA 1KD14 3RNTA 1M904 1NB5I 3BIRA 3NV0B 2P38A 3MSOA 3KE7A 3WOEB 9RNTA 2HMMB 1FYSA 4N6NB 1MNLA 1LNIA 1RHLA 2CFWA 3NUVA 1JN5A 2K3DA 3CCU3 1OHOA 3JVCA 3CCL3 3DY5A 1L5GB 1MWUA 4JRFA 2YFJB 3SOAA 2GXFA 4J5KA 4FCZA 1SARA 4HYZA 4MJDA 3T8UA 1VQ63 5IG4A 5CF1A 4BTXA 4N3VA 3ZG5A 2P0XA 1BSBA 1KWIA 3MG1A 1JZOA 3D3LA 5G2GA 4K61A 4AEQA 3ZFZA 1FGOA 4CPKA 2CC3A 1EA2A 1DETA 4XDVA 1BRJA 5D83A 3T8NA 1RGEA 1DVDA 3KZTA 5JPPA 2XF3A 1EEJA 3UL6A 1YJN3 2CK3H 3HIIA 4KT3B 4HZ9B 3X3ZA 1BSAA 1I8VA 1Q9EA 2W9QA 3OX9A 1JBTA 1W01A 1W7CA 2ZDJA 5IF6A 3URPA 2F99A 1A90A 1CYUA 1R4YA 1GD3A 3ECFA 3NBBA 2KF6A 1FZUA 1VQO3 3EJVA 3KFQC 1GMRA 4AKYA 1IV7A 5FW5A 3HIGA 3X41A 3V92A 4RBNA 1ZGXA 2AADA 1O7NB 2KXGA 1K41A 3MG2A 1BAOA 1ZS7A 1O7PB 4MMZB 1STDA 1R4CA 1RGFA 2Q07A 2UGIA 5CK6A 3QK9A 1RGKA 4BTYA 3G6E3 2CX0A 1TUHA 1S723 1QJGA 1BNIA 3F8HA 1VZZA 3MPHA 4OVMA 2GSPA 2XRXB 5G1LA 5AEWB 3CMA3 1VQ53 2STDA 3GZBA 4XB5A 3CU3A 4NREA 3SLUA 1FGTA 1RRLA 2Z76A 1VQ93 1GS3A 3SOYA 2HMNB 3X3YA 1GYBA 2W9PA 1AVKA 1Q7Y4 3IPTA 2R41A 5STDA 3KSPA 3RGAA 2XFTA 5CF2A 3EBTA 1SJWA 1JBSA 1VQ73 2ML5A 5D81A 1NU3A 1MWSA 3V98A 1UCKA 3U1WA 3GZRA 3K9MC 1BNEA 3F7XA 1IQXA 5AEUB 1NWWA 1B2SA 2W56B 2JQ5A 4RNTA 1KQS2 4OK0A 1TTOA 5JBSA 4KFEA 4CJNA 1BRIA 3V99A 2OQEC 3G8ZA 3LYGA 1W6YA 1UDII 4EXRA 4WHAA 1O7HB 3DUKA 3Q3FA 4H3UA 5EQLA 4R9KA 1QMAA 1I0VA 1I0XA 1I2EA 1UGHI 4LGQA 1W2B2 2HMKB 2B1XB 3K5TA 1RMSA 1VQN3 2C4BA 1CYVA 2KCDA 4FMCA 1IVXA 2CWUA 3NBJA 5LC7A 5M19A 3KKGA 3PGBA 1BSDA 4HVNA 1RN1A 2QGUA 4MMYB 4FCJA 1GOYA 7GSPA 5IW9A 3EB8A 3EHCA 2F56A 3K0ZA 2XR8B 2CG1A 3G16A 3D4AA 3BNBA 1MWRA 1RGLA 1FGRA 1STFI 3CPOA 4QWTA 1BNRA 1JV2B 2CFDA 3HX8A 3NX0A 3HOHA 4TX4A 3EE1A 1BSEA 5BIRA 1ROVA 3JUOA 1ROAA 1UUVB 2RSXA 3M8CA 4N6TA 1IT8A 1YIT3 2J8XB 1UI7A 2FXTA 2BT3A 4EBGA 3MHEA 1D6YA 5LC6A 1WNHA 1W00A 5IENA 1YJW3 4EV2A 3QRDA 1JN5B 4ILFA 4LEHA 1OGZA 1DMQA 1OACA 1JJ22 3GWRA 5KP4A 1W5ZA 3DZLA 3K7CA 3MG3A 3WR2A 1E3VA 3DXOA 1JKGA 4LZIA 1GY7A 1B3SA 3F40A 3CPW2 1VQL3 2UUGC 3AGOA 4XBXA 1SIHA 2WOHA 1W6GA 1T5YA 2PNCA 2I9WA 4EV5A 3AGNA 4HKVB 2RFRA 3BNCA 1BIRA 2AAEA 2C10A 3A5EA 4MMXB 3J7Yd 4WWUC 2IYJA 1FGQA 1FGMA 4FMDA 1X1UA 2BIRA 3WOFB 1RNTA 3S67A 3PYJA 4STDA 5BXQA 3VF1A 2F4YA 3ZG0A 1RNBA 2A15A 3DM8A 3WMDA 1GOUA 4U13A 3FGYA 1IK3A 3Q1CA 1U8CB 5IG3A 2IY2A 1BVIA 3GSPA 2P05A 1TJDA 2CKFB 1BU4A 4IT7A 4N6UA 3LTAA 3HI7A 6STDA 1ZX2A 1WTHA 4FCMA 4FR9A 3WA2X 3S5CA 5M18A 1TRQA 3OWSA 1FUSA 2WOFA 1N5PA 1UW1A
chains in the Genus database with same CATH topology
1Q864 4HM1B 1QAFA 3EX9A 4J8TA 2BMOB 2XFSA 1US1A 4AKZA 3KSED 2WO0A 3UNLA 2O9UX 3LT9A 1OCVA 1RJOA 4XBTA 4K1VA 1YJ93 5IG5A 1IU7A 2L4VA 2D42A 3F8XA 3FG1A 3PXMA 4WP5A 1OH0A 3OWYA 3RDEA 1SIIA 4HZBB 4L8PA 4KFDA 2IUJA 2QEX3 4GB5A 5CXOA 2SBLA 3ER7A 3FCSB 4GL6A 3HZPA 3FZWA 3K63A 3NQYA 1IQYA 5CLKA 1Y4KA 3CC23 1N5HA 4HM6B 3SVAA 2GU3A 1AV4A 3EN8A 3NBRA 4HM2B 2CWTA 1W2ZA 1JRQA 3TDGA 2K54A 3CCV3 4HJLB 2IMJA 2Y74A 2OOVA 2GBWB 1N8QA 4CCVA 1D6ZA 3OWUA 2XEPA 1OUNA 3E99A 2CHCA 5I97A 5IEOA 2W0QA 2C11A 4X2HA 1A2KA 3ALAA 3F9SA 3U97A 4J9AA 2BMQB 5AIIA 1ULJB 1Q42A 3NM7A 3O8YA 3BNEA 1O7GB 5AIHA 2V1LA 2GEXA 2RCDA 3LXUX 3CC43 1GY6A 1OHPA 3GRDA 3DGLA 3N8BA 3X40A 4IPBA 2YX9A 4LSOA 1Q824 1IVWA 4O2HA 2CW9A 1DMNA 3G4S3 2MF7A 2XGNA 1IVVA 1RKYA 3MWZA 3DGNA 3X3XA 3CNMA 1ULIB 3CCE3 3OXAA 1NB3I 3JUPA 4ORLA 1N9EA 1QALA 1Q40A 3RGRA 5AYRB 3Q2PA 5DREA 3CME3 3I0YA 4WYKA 1TFOA 3H3HA 1YHQ3 2W04A 1PFPA 4K1UA 1SQWA 4RNYA 1YGEA 7STDA 2LYXA 1M9GA 4RNZA 1F8NA 4H61A 3L0RA 1IQ8A 5ELJA 1HU9A 3PS8A 4R9LA 5D82A 3WDGB 4PEJA 1A67A 3OV4A 3CC73 1JB4A 3B4PA 3D9RA 3NQZA 3B7CA 4I4KA 4XDWA 3IJEB 3BLZA 3LTCA 1PU4A 1ASKA 3JUQA 4R4KA 1K9M4 5TGNA 1E97A 4K90B 2E2VA 1LVNA 5AI1A 3WA3A 5KP3A 1GD4A 1RN7A 2WGQA 2M7OA 2XH9A 3DGMA 3T0UA 3GAXA 1ZO2A 4HM8B 2INXA 2FNQA 1A2VA 5EEOA 4ZM8A 3CXC2 3S29A 2XSOB 1KSIA 3CNXA 1JB5A 2UX0A 2FGTA 2Y73A 5AIGA 3VSYA 3UL5A 2XGLA 4CDLA 1K8A4 3N54B 1EG9B 1TFKA 2YFLB 2Z77A 4L7KA 3VGNA 1CQSA 3A76A 3PCSA 2Z7AA 5ELUA 1IV9A 1FUWA 5AYSC 1N8R4 1OHSA 4IIAA 1OGXA 2D1WA 3SEDA 1ISKA 3PZWA 1AVLA 3LOYA 5IEPA 3S27A 1M1K4 2CFLA 1O7WB 2OQEA 3CCR3 2IA7A 3DMCA 4EC6A 2BMRB 1EQKA 1OF5A 5AIFA 1MOLA 3AMOA 2LQVA 3CCM3 3B4OA 3N9HA 4O8SA 1W4NA 4O02B 2IUKA 4HM3B 4KFFA 1IDPA 2E2UA 2YFIB 1NJI4 5A0OB 3NV0A 1WQLB 1M1XB 2HMOB 4OUQA 4HBRA 1OPYA 4FMBA 4KVHA 3CCS3 3G713 2GBXB 3FSDA 1C7HA 1GY5A 3ROBA 2E2TA 2OTL3 5KP1A 3F14A 1KC84 2OCTA 2F98A 1TU5A 3I553 2QIYA 3LMLA 3DGOA 4N6LA 4BTWA 4WFOA 2QA43 1LXEA 3EN1B 3WODG 2CH9A 2PZVA 3F7SA 1Q40B 3LT8A 2OWPA 2F86B 4WYKB 1G96A 1DMMA 2WGOA 5DRVA 3SXXA 3X42A 1LNHA 1JNQA 3I563 2HMLB 2XSHB 4HM0B 4N6V0 3JUMA 1K734 1HKXA 3BB9A 1VQP3 1V74A 1VQK3 3FLJA 1DVCA 2OTJ3 3LTDA 1IT7A 3STDA 3OW22 1BUQA 2JDIH 2HMJB 4O3VA 1TP6A 4XBYA 1N9JA 3CD63 2R4IA 3EF8A 3G0KA 2GEYA 3GZYB 2BO9B 1O7MB 3FF0A 3LZAA 5IERA 1JKGB 3H51A 4HM5B 4R80A 3CCJ3 2CFKA 1AR0A 4FMAA 4N6MA 3LTBA 2CIUA 5HGRA 3S28A 3HK4A 3Q90A 5BVBA 1E3RA 3MYTA 3SX1A 4LMIA 2KRTA 3NM2A 2ML6A 1UI8A 5FGOA 4JF8A 1QVG2 3EQQB 8CHOA 3CCQ3 2BNGA 1UUWB 1WMNA 4Q53A 1LOXA 1Q814 1VQM3 3UB1A 5EVHA 1YI23 3FH1A 2CFGA 1NO3A 3KIIA 4RZMA 2W56A 1TIJA 2K0MA 4HM4B 1J2BA 1SPUA 2O3OA 2P09A 1VQ83 1WMOA 2GU1A 4MEIA 3IMAB 1Z1SA 2ZL8A 3JUNA 2OOVC 1YVBI 1FA3A 1QAKA 3EBYA 1WMPA 4KZ1A 5JPUA 1YIJ3 3FG4A 1CEWI 1RRHA 4N6OB 4EYCA 3GZXB 4XM4A 1QVF2 2W6JH 3LH4A 2CG0A 3FF2A 3BNDA 3PCRA 1S5AA 1IVUA 1JB2A 1NDOB 1K28A 2RGQA 2W2CA 2CWVA 4G1MB 2Z6BA 1VQ43 4HM7B 1U5OA 2B24B 1EKMA 3NXJA 3MKIA 3KN4A 1W6CA 5IG0A 3UJMA 3FKAA 1DYUA 2BHMA 1OF5B 2W03A 2MC8A 1W02A 2P0MA 3NHXA 4R1KA 3AMOB 3B8LA 3EC9A 4L8OA 4NHFA 3FG3A 1D6UA 4X2OA 1KD14 1M904 1NB5I 3NV0B 2P38A 3MSOA 3KE7A 3WOEB 2HMMB 4N6NB 1MNLA 2CFWA 3NUVA 1JN5A 3CCU3 1OHOA 3JVCA 3CCL3 3DY5A 1L5GB 4JRFA 2YFJB 3SOAA 2GXFA 3T8UA 4FCZA 4HYZA 4MJDA 1VQ63 5IG4A 5CF1A 4BTXA 4N3VA 2P0XA 1KWIA 3MG1A 3D3LA 5G2GA 4K61A 4AEQA 1FGOA 2CC3A 1EA2A 4XDVA 5D83A 3T8NA 1DVDA 3KZTA 5JPPA 2XF3A 3UL6A 1YJN3 2CK3H 3HIIA 4HZ9B 3X3ZA 2W9QA 3OX9A 1W01A 1W7CA 2ZDJA 5IF6A 2F99A 1A90A 1CYUA 1VQO3 1GD3A 3ECFA 3NBBA 3EJVA 3KFQC 4AKYA 1IV7A 5FW5A 3HIGA 3X41A 3V92A 4RBNA 1O7NB 2KXGA 1K41A 3MG2A 4MMZB 1O7PB 1STDA 1R4CA 5CK6A 2Q07A 3G6E3 3QK9A 4BTYA 1TUHA 1S723 1QJGA 3F8HA 3MPHA 1VZZA 4OVMA 2XRXB 5AEWB 3CMA3 1VQ53 2STDA 3GZBA 4XB5A 3CU3A 4NREA 3SLUA 1FGTA 1RRLA 2Z76A 1VQ93 1GS3A 3SOYA 2HMNB 3X3YA 1GYBA 2W9PA 1AVKA 1Q7Y4 3IPTA 5STDA 3KSPA 3RGAA 2XFTA 5CF2A 3EBTA 1SJWA 1VQ73 2ML5A 5D81A 1NU3A 3V98A 3U1WA 3GZRA 3K9MC 3F7XA 1IQXA 5AEUB 1NWWA 2W56B 2JQ5A 1KQS2 4OK0A 5JBSA 4KFEA 3V99A 2OQEC 3G8ZA 3LYGA 1W6YA 4EXRA 4WHAA 1O7HB 3DUKA 4H3UA 5EQLA 4R9KA 1QMAA 4LGQA 1W2B2 2HMKB 2B1XB 3K5TA 1VQN3 2KCDA 1CYVA 4FMCA 1IVXA 2CWUA 3NBJA 5LC7A 3KKGA 3PGBA 4HVNA 2QGUA 4MMYB 4FCJA 5IW9A 3EB8A 3EHCA 3K0ZA 2XR8B 2CG1A 3G16A 3BNBA 1FGRA 1STFI 3CPOA 4QWTA 1JV2B 2CFDA 3HX8A 3NX0A 4TX4A 3EE1A 1ROVA 3JUOA 1ROAA 1UUVB 2RSXA 3M8CA 4N6TA 1IT8A 1YIT3 1UI7A 2FXTA 2BT3A 4EBGA 3MHEA 1D6YA 5LC6A 1WNHA 1W00A 5IENA 1YJW3 4EV2A 3QRDA 1JN5B 4LEHA 1OGZA 1DMQA 1OACA 1JJ22 3GWRA 5KP4A 1W5ZA 3DZLA 3K7CA 3MG3A 1E3VA 3DXOA 1JKGA 4LZIA 1GY7A 3F40A 1VQL3 3CPW2 4XBXA 1SIHA 2WOHA 1W6GA 2PNCA 1T5YA 2I9WA 4EV5A 2RFRA 3BNCA 2C10A 3J7Yd 4MMXB 4WWUC 1FGQA 1FGMA 4FMDA 3WOFB 3S67A 3PYJA 4STDA 5BXQA 3VF1A 2A15A 3DM8A 3WMDA 4U13A 3FGYA 1IK3A 3Q1CA 1U8CB 5IG3A 2P05A 2CKFB 4IT7A 6STDA 4N6UA 3LTAA 3HI7A 1WTHA 1ZX2A 4FCMA 4FR9A 3WA2X 3S5CA 3OWSA 4HKVB 2WOFA 1N5PA 1UW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R80 A; 
#chains in the Genus database with same CATH topology
 1Q86 4;  4HM1 B;  1QAF A;  3EX9 A;  4J8T A;  2BMO B;  1BRG A;  2XFS A;  1US1 A;  4AKZ A;  7RNT A;  3KSE D;  2WO0 A;  3UNL A;  2O9U X;  3LT9 A;  1OCV A;  1RJO A;  4XBT A;  4K1V A;  1YJ9 3;  5IG5 A;  1IU7 A;  2L4V A;  2D42 A;  4BL3 A;  3F8X A;  1RDS A;  3FG1 A;  2KAA A;  3PXM A;  4WP5 A;  1OH0 A;  1T2I A;  3OWY A;  3DH2 A;  3RDE A;  2RNT A;  1SII A;  4HZB B;  1RGG A;  1BNF A;  4KFD A;  4L8P A;  2IUJ A;  2QEX 3;  4GB5 A;  1AY7 A;  5CXO A;  2SBL A;  3ER7 A;  3FCS B;  1G0T A;  1BGS A;  4GL6 A;  1I2G A;  1FUT A;  3HZP A;  3FZW A;  3K63 A;  3NQY A;  1IQY A;  3AHW A;  5CLK A;  1Y4K A;  3CC2 3;  1UCI A;  1N5H A;  1BAN A;  4HM6 B;  3SVA A;  2GU3 A;  1AV4 A;  3EN8 A;  3NBR A;  4HM2 B;  2CWT A;  1W2Z A;  1JRQ A;  3TDG A;  2K54 A;  3CCV 3;  2H0H A;  1UGI A;  4HJL B;  2IMJ A;  1DE3 A;  2Y74 A;  2OOV A;  2ZHX B;  2GBW B;  1N8Q A;  2CX1 A;  2L1S A;  4HAA A;  8RNT A;  4CCV A;  1D6Z A;  3OWU A;  2XEP A;  1OUN A;  3E99 A;  2CHC A;  1RN4 A;  5I97 A;  5IEO A;  5HOH A;  2W0Q A;  2C11 A;  1X1W A;  4X2H A;  1A2K A;  3ALA A;  3F9S A;  4GHO A;  1BRN L;  3U97 A;  1BRK A;  1LQM B;  4J9A A;  2BMQ B;  5AII A;  1ULJ B;  1Q42 A;  3NM7 A;  4EW5 A;  3O8Y A;  3BNE A;  2HOH A;  2H0G A;  1O7G B;  2BU4 A;  5AIH A;  2V1L A;  2GEX A;  2RCD A;  3LXU X;  3CC4 3;  1GY6 A;  1OHP A;  3GRD A;  3DGL A;  3N8B A;  3BU4 A;  3X40 A;  4IPB A;  2YX9 A;  1JZD A;  4LSO A;  1Q82 4;  1LOY A;  5G1K A;  1IVW A;  4O2H A;  2CW9 A;  1DMN A;  3G4S 3;  2MF7 A;  2XGN A;  1IVV A;  1Q7H A;  3D5G A;  1RKY A;  3MWZ A;  1V57 A;  3DGN A;  3X3X A;  3CNM A;  1ULI B;  3CCE 3;  3OXA A;  1NB3 I;  3JUP A;  4ORL A;  1RLS A;  1N9E A;  1QAL A;  1Q40 A;  3RGR A;  5AYR B;  3Q2P A;  5DRE A;  3CME 3;  3I0Y A;  4WYK A;  1TFO A;  3H3H A;  1YHQ 3;  2W04 A;  1PFP A;  4K1U A;  1SQW A;  4RNY A;  1T2H A;  2KF3 A;  1YGE A;  7STD A;  2LYX A;  1M9G A;  4RNZ A;  1F8N A;  1PYL A;  4H61 A;  1X1Y A;  3L0R A;  1IQ8 A;  5ELJ A;  1HU9 A;  1B2U A;  1BNG A;  3PS8 A;  4R9L A;  5D82 A;  1VQQ A;  3WDG B;  4PEJ A;  1A67 A;  3OV4 A;  3CC7 3;  1JB4 A;  3B4P A;  3D9R A;  3NQZ A;  3B7C A;  4I4K A;  4XDW A;  3IJE B;  3BLZ A;  3KCH A;  3LTC A;  5BU4 A;  1X1X A;  1PU4 A;  1ASK A;  3JUQ A;  4R4K A;  1K9M 4;  5TGN A;  1B20 A;  1RSN A;  1E97 A;  1JBR A;  4K90 B;  2E2V A;  1LVN A;  5AI1 A;  3WA3 A;  2SAR A;  5GSP A;  5KP3 A;  1GD4 A;  1BNS A;  1RGA A;  1RN7 A;  2WGQ A;  1A2P A;  2M7O A;  2XH9 A;  3DGM A;  3T0U A;  3D5I A;  3GAX A;  1ZO2 A;  6RNT A;  1MGR A;  4HM8 B;  2INX A;  2FNQ A;  1A2V A;  5EEO A;  4ZM8 A;  3CXC 2;  3S29 A;  2XSO B;  1KSI A;  1G02 A;  3CNX A;  1JB5 A;  2UX0 A;  2FGT A;  2Y73 A;  5AIG A;  3VSY A;  3UL5 A;  2XGL A;  4CDL A;  1K8A 4;  3N54 B;  4HOH A;  1EG9 B;  1TFK A;  2YFL B;  2Z77 A;  4L7K A;  3VGN A;  1CQS A;  3A76 A;  3PCS A;  2Z7A A;  1V58 A;  5ELU A;  1IV9 A;  1B2Z A;  1RGC A;  1FUW A;  5AYS C;  1N8R 4;  4GSP A;  1OHS A;  3AHS A;  4IIA A;  1OGX A;  2D1W A;  1RGH A;  3SED A;  1ISK A;  3DGY A;  3PZW A;  1AVL A;  2H0I A;  3LOY A;  5IEP A;  1BSC A;  3S27 A;  1M1K 4;  2CFL A;  1O7W B;  2OQE A;  3CCR 3;  1UCL A;  2IA7 A;  3DMC A;  4EC6 A;  2BMR B;  1EQK A;  1OF5 A;  1B27 A;  1MOL A;  5AIF A;  3AMO A;  1TRP A;  2LQV A;  3WHO A;  3CCM 3;  4BIR A;  3B4O A;  3N9H A;  4O8S A;  1W4N A;  1NNV A;  4O02 B;  2IUK A;  1HZ1 A;  4HM3 B;  4KFF A;  1IDP A;  1MWT A;  2E2U A;  1I70 A;  1IYY A;  2YFI B;  1NJI 4;  4J5G A;  5A0O B;  1GSP A;  3NV0 A;  1WQL B;  1M1X B;  2HMO B;  1B2X A;  4OUQ A;  4HBR A;  1OPY A;  4FMB A;  4KVH A;  3CCS 3;  3G71 3;  2GBX B;  3FSD A;  1LQG C;  1C7H A;  1GY5 A;  1UUG B;  2E2T A;  3ROB A;  2OTL 3;  5KP1 A;  3F14 A;  1KC8 4;  2OCT A;  2F98 A;  1RCK A;  1TU5 A;  3I55 3;  1LOW A;  2QIY A;  3LML A;  4LYL B;  3DGO A;  4N6L A;  4BTW A;  4WFO A;  2QA4 3;  1GMQ A;  1LXE A;  3EN1 B;  3WOD G;  2CH9 A;  2PZV A;  3F7S A;  1Q40 B;  3LT8 A;  2OWP A;  2F86 B;  3D79 A;  4WYK B;  1G96 A;  1DMM A;  2WGO A;  5DRV A;  1BRS A;  3SXX A;  1LNH A;  3X42 A;  1JNQ A;  3I56 3;  2HML B;  2XSH B;  4HM0 B;  1PY3 A;  1YVS A;  3JUM A;  4N6V 0;  1K73 4;  1GOV A;  1LRA A;  1HKX A;  3BB9 A;  1VQP 3;  1V74 A;  1VQK 3;  3FLJ A;  1DVC A;  2OTJ 3;  3LTD A;  1IT7 A;  1B21 A;  1I3F A;  4NPB A;  3STD A;  3OW2 2;  1BUQ A;  2JDI H;  2HMJ B;  4O3V A;  1TP6 A;  4XBY A;  1N9J A;  3CD6 3;  2R4I A;  3EF8 A;  3G0K A;  2GEY A;  4I5Q A;  3GZY B;  2BO9 B;  1O7M B;  1EUI C;  3FF0 A;  3LZA A;  5IER A;  1JKG B;  3H51 A;  4HM5 B;  4R80 A;  3CCJ 3;  2CFK A;  1AR0 A;  4FMA A;  4N6M A;  3LTB A;  1LOV A;  2CIU A;  5HGR A;  3S28 A;  1FW7 A;  3HK4 A;  3Q90 A;  1GMP A;  5BVB A;  1E3R A;  3MYT A;  3SX1 A;  4LMI A;  2KRT A;  3NM2 A;  1C54 A;  1BUJ A;  1CH0 A;  2ML6 A;  1UI8 A;  5FGO A;  4JF8 A;  1AQZ A;  4BL2 A;  1QVG 2;  3EQQ B;  8CHO A;  3CCQ 3;  2BNG A;  1UUW B;  1WMN A;  4Q53 A;  1BOX A;  1LOX A;  1Q81 4;  1VQM 3;  5RNT A;  3UB1 A;  5EVH A;  1YI2 3;  3FH1 A;  2CFG A;  1NO3 A;  3KII A;  4RZM A;  2W56 A;  1TIJ A;  2F5W A;  2K0M A;  4HM4 B;  5M1A A;  1J2B A;  1SPU A;  2O3O A;  2P09 A;  6GSP A;  1HYF A;  1VQ8 3;  1WMO A;  2GU1 A;  4MEI A;  3IMA B;  1RTU A;  1T3B A;  1Z1S A;  2ZL8 A;  3JUN A;  2KF4 A;  2OOV C;  1YVB I;  1FA3 A;  1I3I A;  1QAK A;  3EBY A;  1B2M A;  1WMP A;  4KZ1 A;  5JPU A;  1YIJ 3;  3FG4 A;  1CEW I;  1RRH A;  1BNJ A;  4N6O B;  3GZX B;  4XM4 A;  4EYC A;  2W6J H;  3LH4 A;  1QVF 2;  2CG0 A;  3FF2 A;  3BND A;  3PCR A;  1S5A A;  1UCJ A;  1IVU A;  1BRH A;  1JB2 A;  1NDO B;  1K28 A;  2RGQ A;  2W2C A;  2ZA4 A;  1RCL A;  2CWV A;  4G1M B;  1YNV X;  2KF5 A;  2Z6B A;  3SYU A;  4DKI A;  1VQ4 3;  4HM7 B;  1U5O A;  2B24 B;  1EKM A;  3NXJ A;  3MKI A;  3KN4 A;  1W6C A;  5IG0 A;  3UJM A;  3FKA A;  1DYU A;  4BU4 A;  2BHM A;  1OF5 B;  2W03 A;  2MC8 A;  1W02 A;  2P0M A;  3NHX A;  4R1K A;  3AMO B;  3B8L A;  2RBI A;  3EC9 A;  1I2F A;  2F5M A;  4L8O A;  4NHF A;  3FG3 A;  1D6U A;  4X2O A;  1MGW A;  1YGW A;  1KD1 4;  3RNT A;  1M90 4;  1NB5 I;  3BIR A;  3NV0 B;  2P38 A;  3MSO A;  3KE7 A;  3WOE B;  9RNT A;  2HMM B;  1FYS A;  4N6N B;  1MNL A;  1LNI A;  1RHL A;  2CFW A;  3NUV A;  1JN5 A;  2K3D A;  3CCU 3;  1OHO A;  3JVC A;  3CCL 3;  3DY5 A;  1L5G B;  1MWU A;  4JRF A;  2YFJ B;  3SOA A;  2GXF A;  4J5K A;  4FCZ A;  1SAR A;  4HYZ A;  4MJD A;  3T8U A;  1VQ6 3;  5IG4 A;  5CF1 A;  4BTX A;  4N3V A;  3ZG5 A;  2P0X A;  1BSB A;  1KWI A;  3MG1 A;  1JZO A;  3D3L A;  5G2G A;  4K61 A;  4AEQ A;  3ZFZ A;  1FGO A;  4CPK A;  2CC3 A;  1EA2 A;  1DET A;  4XDV A;  1BRJ A;  5D83 A;  3T8N A;  1RGE A;  1DVD A;  3KZT A;  5JPP A;  2XF3 A;  1EEJ A;  3UL6 A;  1YJN 3;  2CK3 H;  3HII A;  4KT3 B;  4HZ9 B;  3X3Z A;  1BSA A;  1I8V A;  1Q9E A;  2W9Q A;  3OX9 A;  1JBT A;  1W01 A;  1W7C A;  2ZDJ A;  5IF6 A;  3URP A;  2F99 A;  1A90 A;  1CYU A;  1R4Y A;  1GD3 A;  3ECF A;  3NBB A;  2KF6 A;  1FZU A;  1VQO 3;  3EJV A;  3KFQ C;  1GMR A;  4AKY A;  1IV7 A;  5FW5 A;  3HIG A;  3X41 A;  3V92 A;  4RBN A;  1ZGX A;  2AAD A;  1O7N B;  2KXG A;  1K41 A;  3MG2 A;  1BAO A;  1ZS7 A;  1O7P B;  4MMZ B;  1STD A;  1R4C A;  1RGF A;  2Q07 A;  2UGI A;  5CK6 A;  3QK9 A;  1RGK A;  4BTY A;  3G6E 3;  2CX0 A;  1TUH A;  1S72 3;  1QJG A;  1BNI A;  3F8H A;  1VZZ A;  3MPH A;  4OVM A;  2GSP A;  2XRX B;  5G1L A;  5AEW B;  3CMA 3;  1VQ5 3;  2STD A;  3GZB A;  4XB5 A;  3CU3 A;  4NRE A;  3SLU A;  1FGT A;  1RRL A;  2Z76 A;  1VQ9 3;  1GS3 A;  3SOY A;  2HMN B;  3X3Y A;  1GYB A;  2W9P A;  1AVK A;  1Q7Y 4;  3IPT A;  2R41 A;  5STD A;  3KSP A;  3RGA A;  2XFT A;  5CF2 A;  3EBT A;  1SJW A;  1JBS A;  1VQ7 3;  2ML5 A;  5D81 A;  1NU3 A;  1MWS A;  3V98 A;  1UCK A;  3U1W A;  3GZR A;  3K9M C;  1BNE A;  3F7X A;  1IQX A;  5AEU B;  1NWW A;  1B2S A;  2W56 B;  2JQ5 A;  4RNT A;  1KQS 2;  4OK0 A;  1TTO A;  5JBS A;  4KFE A;  4CJN A;  1BRI A;  3V99 A;  2OQE C;  3G8Z A;  3LYG A;  1W6Y A;  1UDI I;  4EXR A;  4WHA A;  1O7H B;  3DUK A;  3Q3F A;  4H3U A;  5EQL A;  4R9K A;  1QMA A;  1I0V A;  1I0X A;  1I2E A;  1UGH I;  4LGQ A;  1W2B 2;  2HMK B;  2B1X B;  3K5T A;  1RMS A;  1VQN 3;  2C4B A;  1CYV A;  2KCD A;  4FMC A;  1IVX A;  2CWU A;  3NBJ A;  5LC7 A;  5M19 A;  3KKG A;  3PGB A;  1BSD A;  4HVN A;  1RN1 A;  2QGU A;  4MMY B;  4FCJ A;  1GOY A;  7GSP A;  5IW9 A;  3EB8 A;  3EHC A;  2F56 A;  3K0Z A;  2XR8 B;  2CG1 A;  3G16 A;  3D4A A;  3BNB A;  1MWR A;  1RGL A;  1FGR A;  1STF I;  3CPO A;  4QWT A;  1BNR A;  1JV2 B;  2CFD A;  3HX8 A;  3NX0 A;  3HOH A;  4TX4 A;  3EE1 A;  1BSE A;  5BIR A;  1ROV A;  3JUO A;  1ROA A;  1UUV B;  2RSX A;  3M8C A;  4N6T A;  1IT8 A;  1YIT 3;  2J8X B;  1UI7 A;  2FXT A;  2BT3 A;  4EBG A;  3MHE A;  1D6Y A;  5LC6 A;  1WNH A;  1W00 A;  5IEN A;  1YJW 3;  4EV2 A;  3QRD A;  1JN5 B;  4ILF A;  4LEH A;  1OGZ A;  1DMQ A;  1OAC A;  1JJ2 2;  3GWR A;  5KP4 A;  1W5Z A;  3DZL A;  3K7C A;  3MG3 A;  3WR2 A;  1E3V A;  3DXO A;  1JKG A;  4LZI A;  1GY7 A;  1B3S A;  3F40 A;  3CPW 2;  1VQL 3;  2UUG C;  3AGO A;  4XBX A;  1SIH A;  2WOH A;  1W6G A;  1T5Y A;  2PNC A;  2I9W A;  4EV5 A;  3AGN A;  4HKV B;  2RFR A;  3BNC A;  1BIR A;  2AAE A;  2C10 A;  3A5E A;  4MMX B;  3J7Y d;  4WWU C;  2IYJ A;  1FGQ A;  1FGM A;  4FMD A;  1X1U A;  2BIR A;  3WOF B;  1RNT A;  3S67 A;  3PYJ A;  4STD A;  5BXQ A;  3VF1 A;  2F4Y A;  3ZG0 A;  1RNB A;  2A15 A;  3DM8 A;  3WMD A;  1GOU A;  4U13 A;  3FGY A;  1IK3 A;  3Q1C A;  1U8C B;  5IG3 A;  2IY2 A;  1BVI A;  3GSP A;  2P05 A;  1TJD A;  2CKF B;  1BU4 A;  4IT7 A;  4N6U A;  3LTA A;  3HI7 A;  6STD A;  1ZX2 A;  1WTH A;  4FCM A;  4FR9 A;  3WA2 X;  3S5C A;  5M18 A;  1TRQ A;  3OWS A;  1FUS A;  2WOF A;  1N5P A;  1UW1 A; 
#chains in the Genus database with same CATH homology
 1Q86 4;  4HM1 B;  1QAF A;  3EX9 A;  4J8T A;  2BMO B;  2XFS A;  1US1 A;  4AKZ A;  3KSE D;  2WO0 A;  3UNL A;  2O9U X;  3LT9 A;  1OCV A;  1RJO A;  4XBT A;  4K1V A;  1YJ9 3;  5IG5 A;  1IU7 A;  2L4V A;  2D42 A;  3F8X A;  3FG1 A;  3PXM A;  4WP5 A;  1OH0 A;  3OWY A;  3RDE A;  1SII A;  4HZB B;  4L8P A;  4KFD A;  2IUJ A;  2QEX 3;  4GB5 A;  5CXO A;  2SBL A;  3ER7 A;  3FCS B;  4GL6 A;  3HZP A;  3FZW A;  3K63 A;  3NQY A;  1IQY A;  5CLK A;  1Y4K A;  3CC2 3;  1N5H A;  4HM6 B;  3SVA A;  2GU3 A;  1AV4 A;  3EN8 A;  3NBR A;  4HM2 B;  2CWT A;  1W2Z A;  1JRQ A;  3TDG A;  2K54 A;  3CCV 3;  4HJL B;  2IMJ A;  2Y74 A;  2OOV A;  2GBW B;  1N8Q A;  4CCV A;  1D6Z A;  3OWU A;  2XEP A;  1OUN A;  3E99 A;  2CHC A;  5I97 A;  5IEO A;  2W0Q A;  2C11 A;  4X2H A;  1A2K A;  3ALA A;  3F9S A;  3U97 A;  4J9A A;  2BMQ B;  5AII A;  1ULJ B;  1Q42 A;  3NM7 A;  3O8Y A;  3BNE A;  1O7G B;  5AIH A;  2V1L A;  2GEX A;  2RCD A;  3LXU X;  3CC4 3;  1GY6 A;  1OHP A;  3GRD A;  3DGL A;  3N8B A;  3X40 A;  4IPB A;  2YX9 A;  4LSO A;  1Q82 4;  1IVW A;  4O2H A;  2CW9 A;  1DMN A;  3G4S 3;  2MF7 A;  2XGN A;  1IVV A;  1RKY A;  3MWZ A;  3DGN A;  3X3X A;  3CNM A;  1ULI B;  3CCE 3;  3OXA A;  1NB3 I;  3JUP A;  4ORL A;  1N9E A;  1QAL A;  1Q40 A;  3RGR A;  5AYR B;  3Q2P A;  5DRE A;  3CME 3;  3I0Y A;  4WYK A;  1TFO A;  3H3H A;  1YHQ 3;  2W04 A;  1PFP A;  4K1U A;  1SQW A;  4RNY A;  1YGE A;  7STD A;  2LYX A;  1M9G A;  4RNZ A;  1F8N A;  4H61 A;  3L0R A;  1IQ8 A;  5ELJ A;  1HU9 A;  3PS8 A;  4R9L A;  5D82 A;  3WDG B;  4PEJ A;  1A67 A;  3OV4 A;  3CC7 3;  1JB4 A;  3B4P A;  3D9R A;  3NQZ A;  3B7C A;  4I4K A;  4XDW A;  3IJE B;  3BLZ A;  3LTC A;  1PU4 A;  1ASK A;  3JUQ A;  4R4K A;  1K9M 4;  5TGN A;  1E97 A;  4K90 B;  2E2V A;  1LVN A;  5AI1 A;  3WA3 A;  5KP3 A;  1GD4 A;  1RN7 A;  2WGQ A;  2M7O A;  2XH9 A;  3DGM A;  3T0U A;  3GAX A;  1ZO2 A;  4HM8 B;  2INX A;  2FNQ A;  1A2V A;  5EEO A;  4ZM8 A;  3CXC 2;  3S29 A;  2XSO B;  1KSI A;  3CNX A;  1JB5 A;  2UX0 A;  2FGT A;  2Y73 A;  5AIG A;  3VSY A;  3UL5 A;  2XGL A;  4CDL A;  1K8A 4;  3N54 B;  1EG9 B;  1TFK A;  2YFL B;  2Z77 A;  4L7K A;  3VGN A;  1CQS A;  3A76 A;  3PCS A;  2Z7A A;  5ELU A;  1IV9 A;  1FUW A;  5AYS C;  1N8R 4;  1OHS A;  4IIA A;  1OGX A;  2D1W A;  3SED A;  1ISK A;  3PZW A;  1AVL A;  3LOY A;  5IEP A;  3S27 A;  1M1K 4;  2CFL A;  1O7W B;  2OQE A;  3CCR 3;  2IA7 A;  3DMC A;  4EC6 A;  2BMR B;  1EQK A;  1OF5 A;  5AIF A;  1MOL A;  3AMO A;  2LQV A;  3CCM 3;  3B4O A;  3N9H A;  4O8S A;  1W4N A;  4O02 B;  2IUK A;  4HM3 B;  4KFF A;  1IDP A;  2E2U A;  2YFI B;  1NJI 4;  5A0O B;  3NV0 A;  1WQL B;  1M1X B;  2HMO B;  4OUQ A;  4HBR A;  1OPY A;  4FMB A;  4KVH A;  3CCS 3;  3G71 3;  2GBX B;  3FSD A;  1C7H A;  1GY5 A;  3ROB A;  2E2T A;  2OTL 3;  5KP1 A;  3F14 A;  1KC8 4;  2OCT A;  2F98 A;  1TU5 A;  3I55 3;  2QIY A;  3LML A;  3DGO A;  4N6L A;  4BTW A;  4WFO A;  2QA4 3;  1LXE A;  3EN1 B;  3WOD G;  2CH9 A;  2PZV A;  3F7S A;  1Q40 B;  3LT8 A;  2OWP A;  2F86 B;  4WYK B;  1G96 A;  1DMM A;  2WGO A;  5DRV A;  3SXX A;  3X42 A;  1LNH A;  1JNQ A;  3I56 3;  2HML B;  2XSH B;  4HM0 B;  4N6V 0;  3JUM A;  1K73 4;  1HKX A;  3BB9 A;  1VQP 3;  1V74 A;  1VQK 3;  3FLJ A;  1DVC A;  2OTJ 3;  3LTD A;  1IT7 A;  3STD A;  3OW2 2;  1BUQ A;  2JDI H;  2HMJ B;  4O3V A;  1TP6 A;  4XBY A;  1N9J A;  3CD6 3;  2R4I A;  3EF8 A;  3G0K A;  2GEY A;  3GZY B;  2BO9 B;  1O7M B;  3FF0 A;  3LZA A;  5IER A;  1JKG B;  3H51 A;  4HM5 B;  4R80 A;  3CCJ 3;  2CFK A;  1AR0 A;  4FMA A;  4N6M A;  3LTB A;  2CIU A;  5HGR A;  3S28 A;  3HK4 A;  3Q90 A;  5BVB A;  1E3R A;  3MYT A;  3SX1 A;  4LMI A;  2KRT A;  3NM2 A;  2ML6 A;  1UI8 A;  5FGO A;  4JF8 A;  1QVG 2;  3EQQ B;  8CHO A;  3CCQ 3;  2BNG A;  1UUW B;  1WMN A;  4Q53 A;  1LOX A;  1Q81 4;  1VQM 3;  3UB1 A;  5EVH A;  1YI2 3;  3FH1 A;  2CFG A;  1NO3 A;  3KII A;  4RZM A;  2W56 A;  1TIJ A;  2K0M A;  4HM4 B;  1J2B A;  1SPU A;  2O3O A;  2P09 A;  1VQ8 3;  1WMO A;  2GU1 A;  4MEI A;  3IMA B;  1Z1S A;  2ZL8 A;  3JUN A;  2OOV C;  1YVB I;  1FA3 A;  1QAK A;  3EBY A;  1WMP A;  4KZ1 A;  5JPU A;  1YIJ 3;  3FG4 A;  1CEW I;  1RRH A;  4N6O B;  4EYC A;  3GZX B;  4XM4 A;  1QVF 2;  2W6J H;  3LH4 A;  2CG0 A;  3FF2 A;  3BND A;  3PCR A;  1S5A A;  1IVU A;  1JB2 A;  1NDO B;  1K28 A;  2RGQ A;  2W2C A;  2CWV A;  4G1M B;  2Z6B A;  1VQ4 3;  4HM7 B;  1U5O A;  2B24 B;  1EKM A;  3NXJ A;  3MKI A;  3KN4 A;  1W6C A;  5IG0 A;  3UJM A;  3FKA A;  1DYU A;  2BHM A;  1OF5 B;  2W03 A;  2MC8 A;  1W02 A;  2P0M A;  3NHX A;  4R1K A;  3AMO B;  3B8L A;  3EC9 A;  4L8O A;  4NHF A;  3FG3 A;  1D6U A;  4X2O A;  1KD1 4;  1M90 4;  1NB5 I;  3NV0 B;  2P38 A;  3MSO A;  3KE7 A;  3WOE B;  2HMM B;  4N6N B;  1MNL A;  2CFW A;  3NUV A;  1JN5 A;  3CCU 3;  1OHO A;  3JVC A;  3CCL 3;  3DY5 A;  1L5G B;  4JRF A;  2YFJ B;  3SOA A;  2GXF A;  3T8U A;  4FCZ A;  4HYZ A;  4MJD A;  1VQ6 3;  5IG4 A;  5CF1 A;  4BTX A;  4N3V A;  2P0X A;  1KWI A;  3MG1 A;  3D3L A;  5G2G A;  4K61 A;  4AEQ A;  1FGO A;  2CC3 A;  1EA2 A;  4XDV A;  5D83 A;  3T8N A;  1DVD A;  3KZT A;  5JPP A;  2XF3 A;  3UL6 A;  1YJN 3;  2CK3 H;  3HII A;  4HZ9 B;  3X3Z A;  2W9Q A;  3OX9 A;  1W01 A;  1W7C A;  2ZDJ A;  5IF6 A;  2F99 A;  1A90 A;  1CYU A;  1VQO 3;  1GD3 A;  3ECF A;  3NBB A;  3EJV A;  3KFQ C;  4AKY A;  1IV7 A;  5FW5 A;  3HIG A;  3X41 A;  3V92 A;  4RBN A;  1O7N B;  2KXG A;  1K41 A;  3MG2 A;  4MMZ B;  1O7P B;  1STD A;  1R4C A;  5CK6 A;  2Q07 A;  3G6E 3;  3QK9 A;  4BTY A;  1TUH A;  1S72 3;  1QJG A;  3F8H A;  3MPH A;  1VZZ A;  4OVM A;  2XRX B;  5AEW B;  3CMA 3;  1VQ5 3;  2STD A;  3GZB A;  4XB5 A;  3CU3 A;  4NRE A;  3SLU A;  1FGT A;  1RRL A;  2Z76 A;  1VQ9 3;  1GS3 A;  3SOY A;  2HMN B;  3X3Y A;  1GYB A;  2W9P A;  1AVK A;  1Q7Y 4;  3IPT A;  5STD A;  3KSP A;  3RGA A;  2XFT A;  5CF2 A;  3EBT A;  1SJW A;  1VQ7 3;  2ML5 A;  5D81 A;  1NU3 A;  3V98 A;  3U1W A;  3GZR A;  3K9M C;  3F7X A;  1IQX A;  5AEU B;  1NWW A;  2W56 B;  2JQ5 A;  1KQS 2;  4OK0 A;  5JBS A;  4KFE A;  3V99 A;  2OQE C;  3G8Z A;  3LYG A;  1W6Y A;  4EXR A;  4WHA A;  1O7H B;  3DUK A;  4H3U A;  5EQL A;  4R9K A;  1QMA A;  4LGQ A;  1W2B 2;  2HMK B;  2B1X B;  3K5T A;  1VQN 3;  2KCD A;  1CYV A;  4FMC A;  1IVX A;  2CWU A;  3NBJ A;  5LC7 A;  3KKG A;  3PGB A;  4HVN A;  2QGU A;  4MMY B;  4FCJ A;  5IW9 A;  3EB8 A;  3EHC A;  3K0Z A;  2XR8 B;  2CG1 A;  3G16 A;  3BNB A;  1FGR A;  1STF I;  3CPO A;  4QWT A;  1JV2 B;  2CFD A;  3HX8 A;  3NX0 A;  4TX4 A;  3EE1 A;  1ROV A;  3JUO A;  1ROA A;  1UUV B;  2RSX A;  3M8C A;  4N6T A;  1IT8 A;  1YIT 3;  1UI7 A;  2FXT A;  2BT3 A;  4EBG A;  3MHE A;  1D6Y A;  5LC6 A;  1WNH A;  1W00 A;  5IEN A;  1YJW 3;  4EV2 A;  3QRD A;  1JN5 B;  4LEH A;  1OGZ A;  1DMQ A;  1OAC A;  1JJ2 2;  3GWR A;  5KP4 A;  1W5Z A;  3DZL A;  3K7C A;  3MG3 A;  1E3V A;  3DXO A;  1JKG A;  4LZI A;  1GY7 A;  3F40 A;  1VQL 3;  3CPW 2;  4XBX A;  1SIH A;  2WOH A;  1W6G A;  2PNC A;  1T5Y A;  2I9W A;  4EV5 A;  2RFR A;  3BNC A;  2C10 A;  3J7Y d;  4MMX B;  4WWU C;  1FGQ A;  1FGM A;  4FMD A;  3WOF B;  3S67 A;  3PYJ A;  4STD A;  5BXQ A;  3VF1 A;  2A15 A;  3DM8 A;  3WMD A;  4U13 A;  3FGY A;  1IK3 A;  3Q1C A;  1U8C B;  5IG3 A;  2P05 A;  2CKF B;  4IT7 A;  6STD A;  4N6U A;  3LTA A;  3HI7 A;  1WTH A;  1ZX2 A;  4FCM A;  4FR9 A;  3WA2 X;  3S5C A;  3OWS A;  4HKV B;  2WOF A;  1N5P A;  1UW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...