4R80A

Crystal structure of a de novo designed beta sheet protein, cystatin fold, northeast structural genomics consortium (nesg) target or486
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
b'PSEEEEKRRAKQVAKEKILEQNPSSKVQVRRVQKQGNTIRVELEITENGKKTNITVEVEKQGNTFTVKRITETVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OR486
publication title Crystal Structure of an engineered protein with denovo beta sheet design, Northeast Structural Genomics Consortium (NESG) Target OR486
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 17
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.630 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r80A00
4R80A
chains in the Genus database with same CATH superfamily
3CCM3 1BRGA 3UJMA 1VQ73 2KF6A 1LVNA 1UGHI 1MWUA 2BHMA 3UL5A 3S5CA 2XF3A 1BOXA 4N6V0 4R1KA 3X40A 3CNMA 5EEOA 4LZIA 3T8NA 3WHOA 1EG9B 1VQ53 1RJOA 4O02B 4CDLA 1ROVA 1J2BA 4OVMA 1DYUA 2B24B 3NV0B 4R9KA 2FXTA 1D6UA 3BNEA 1FZUA 1JZOA 1IVXA 4HM1B 1KQS2 1RSNA 4HBRA 1OGXA 3ECFA 4WFOA 1BNGA 4BTWA 1RKYA 5M19A 2UUGC 1QJGA 3FLJA 1UW1A 1FGMA 3X3YA 3O8YA 1BU4A 1B21A 2KAAA 3FG1A 1NDOB 2W9PA 3NV0A 4IPBA 2CC3A 3Q1CA 3UL6A 3AGOA 2GBWB 1W5ZA 3OV4A 3UNLA 3F8HA 1OHPA 4HJLB 5RNTA 1GD4A 4KFDA 4XDWA 3AMOA 4KZ1A 5JBSA 5HOHA 1VZZA 1W6CA 4NREA 3DY5A 3V98A 4JRFA 2WOHA 2CFDA 2IMJA 1FUTA 1RGFA 2R41A 3J7Yd 4J5KA 3F9SA 1IU7A 4HM7B 3B4PA 1WMOA 2O3OA 1OH0A 3FH1A 1RGEA 2JQ5A 5IEOA 1PU4A 1MWTA 2J8XB 2KF5A 3EBTA 3CPW2 3I563 2UGIA 3MG3A 5DREA 2RSXA 1SIHA 5KP3A 2ZDJA 2BO9B 4U13A 5BIRA 1O7MB 3OX9A 4N6OB 3H3HA 4ORLA 1DVDA 3G8ZA 1SIIA 2IA7A 1K8A4 3KFQC 1NB5I 1IQYA 1PY3A 1U8CB 2OWPA 2H0GA 2P0XA 1VQN3 1EUIC 1FGTA 3JUOA 2L1SA 2IYJA 4NHFA 3CCQ3 5FW5A 3CCL3 2XFSA 1GMRA 1LOXA 5IW9A 1DMQA 3A76A 1BNSA 2STDA 2AAEA 1RGAA 3U97A 5LC7A 1YVSA 1JBRA 4FCJA 3VSYA 1GMPA 3GZYB 4EC6A 2XEPA 1RN1A 3G16A 3FF2A 4O8SA 5EVHA 5D82A 1BNIA 1G0TA 4HM8B 1EA2A 1D6ZA 3EB8A 3WOEB 4BTYA 1BNRA 4R9LA 4OUQA 5CF1A 1PFPA 3KCHA 4WHAA 1JB5A 2F5MA 1EKMA 5IG0A 1QAKA 3V99A 1N8R4 1BRNL 2MF7A 3NBBA 1LQGC 4HKVB 2OTJ3 3ER7A 1NWWA 3WDGB 1NB3I 5IERA 1JJ22 4ILFA 1EEJA 2RFRA 3WOFB 3CCS3 4FCMA 3Q2PA 1DE3A 3OWSA 1B2MA 6GSPA 1BSAA 3EE1A 1ZS7A 3ALAA 4BIRA 2HMKB 1RRHA 1X1XA 3HK4A 3X42A 5M1AA 3CCU3 3MPHA 3CC23 4DKIA 1UGIA 3MYTA 3KE7A 3OWUA 1YIJ3 3CXC2 4NPBA 1W01A 2CFWA 2BT3A 3BNDA 1BGSA 2XSOB 2GBXB 2E2TA 3CCE3 3NXJA 1YGEA 3PYJA 3H51A 3SX1A 1I2FA 3KIIA 6STDA 1BAOA 3Q90A 1YIT3 1Q864 5CXOA 1VQ83 1TP6A 2M7OA 4HM5B 3PCRA 3NUVA 2GEYA 4TX4A 3D9RA 5JPUA 1OGZA 1VQQA 1Q814 1ZO2A 2WOFA 1B2ZA 5D81A 1C54A 1TFKA 1L5GB 5AI1A 2KCDA 5IENA 3K7CA 1V57A 1OHSA 3DMCA 1RTUA 1BUQA 1TRPA 2KF3A 3PGBA 3CU3A 1S723 3AHSA 1BIRA 4N6LA 3GZBA 1CQSA 3FF0A 4RNYA 7GSPA 4O2HA 3EHCA 3SXXA 1M1K4 1Y4KA 4R4KA 2KXGA 3MWZA 2SARA 5BVBA 2F4YA 3URPA 1EQKA 3G0KA 1YI23 1BRIA 1NO3A 3DM8A 3EJVA 4MMZB 3DXOA 4RNZA 1NU3A 1RRLA 2F98A 2R4IA 5JPPA 3NQZA 4PEJA 2P09A 1UUVB 4XM4A 1WTHA 5IG3A 3UB1A 2INXA 1BSBA 1FUWA 1RGGA 1BRKA 1LNIA 1GYBA 3Q3FA 1MNLA 1I2EA 1OF5B 3K63A 3GSPA 4N3VA 3MHEA 1SARA 2IY2A 2OQEA 1A2KA 2Q07A 3S67A 1AVLA 3AHWA 3B7CA 4R80A 2CFKA 2Z7AA 1DETA 2HOHA 4EW5A 2PNCA 1AY7A 1X1WA 3AMOB 1ULJB 3JUNA 3NM7A 2LQVA 1I3FA 3NBRA 4J9AA 4CPKA 9RNTA 1TU5A 1VQM3 1VQL3 1VQ93 1OF5A 5G1KA 5G2GA 1MWRA 4MJDA 3L0RA 3SVAA 3NBJA 5KP4A 4RBNA 3G713 1VQO3 1IDPA 4XBXA 3SYUA 4KFEA 1LOYA 3NM2A 4LEHA 4K61A 1AVKA 3DUKA 4KT3B 1K41A 1VQP3 1SJWA 4L8PA 2BIRA 1ULIB 1ZGXA 1A67A 8CHOA 2XSHB 1BUJA 2XGNA 3G6E3 2Z6BA 4MEIA 1N9EA 1OPYA 3B4OA 3FGYA 1OCVA 3AGNA 3JUMA 4L7KA 2F86B 2KF4A 2IUKA 3DGNA 4GL6A 5D83A 2W6JH 5CF2A 3KZTA 2IUJA 3ZG0A 3KSED 3CPOA 1U5OA 1IK3A 2Y74A 3M8CA 5BU4A 2GSPA 1MWSA 2CHCA 1BSDA 3BNCA 5G1LA 4IIAA 1MGRA 1T3BA 1UCJA 3RGAA 3LT9A 1GD3A 3D3LA 2B1XB 2JDIH 1W2ZA 4FCZA 4FMDA 1E3VA 3HX8A 1OACA 2OCTA 4XBYA 2K0MA 3WODG 3EC9A 2QIYA 3FSDA 3DH2A 1GSPA 1RMSA 4I5QA 3S27A 4Q53A 1WQLB 3EN1B 5IG5A 3CCV3 2HMLB 1US1A 1BRJA 3K9MC 1YHQ3 3SOYA 1O7GB 3GZRA 2RBIA 1LXEA 3X41A 3IPTA 1B2XA 1AV4A 1WMNA 3BU4A 2OQEC 1RCKA 4WWUC 1BSEA 2W04A 1FA3A 3S28A 1I8VA 4HM2B 4HM3B 1YJN3 2FNQA 3PZWA 5AIHA 1BSCA 2XGLA 3D4AA 5AEUB 2I9WA 3HI7A 1STDA 2WGOA 1N8QA 1N5PA 1E3RA 3KKGA 1NJI4 2CKFB 2MC8A 3BNBA 1B27A 3WA3A 1C7HA 3FKAA 1GMQA 2F56A 1BNFA 5TGNA 1JN5B 4KFFA 1GY5A 3FCSB 3N8BA 1QVF2 1CH0A 3MG1A 2RGQA 1IVUA 1IVVA 2CG1A 2ZHXB 3GRDA 2P05A 2A15A 1KWIA 1Q7HA 3QRDA 3X3ZA 1E97A 3QK9A 1LOVA 2P38A 3ROBA 1JN5A 3LTBA 4LMIA 7STDA 2CFLA 3RGRA 3D5GA 1TRQA 1TIJA 3LZAA 3HOHA 2QA43 1G96A 2BU4A 1KD14 3I0YA 1UDII 3LXUX 2OOVA 2QEX3 1HZ1A 2QGUA 1W4NA 3NQYA 3STDA 2HMJB 3LTAA 4J5GA 4STDA 1A2PA 3EN8A 5DRVA 5KP1A 4FR9A 3S29A 1GOVA 1LRAA 4H61A 4HM4B 4L8OA 3CMA3 2RCDA 3DZLA 3HIIA 2W9QA 8RNTA 2XFTA 1LOWA 3LTDA 2GEXA 1LNHA 3CNXA 3NHXA 2C11A 1JKGB 2FGTA 4MMYB 4H3UA 2O9UX 2WO0A 3EQQB 1A90A 2GU3A 2ML6A 1R4CA 1RN4A 3JUPA 4LYLB 1YJW3 4HYZA 1GY7A 2C10A 4CJNA 3HIGA 5AYSC 5IEPA 3K0ZA 1W6YA 4QWTA 1IV7A 4AKYA 1MGWA 4WYKB 1O7WB 3LYGA 3LOYA 2LYXA 1JKGA 1A2VA 3U1WA 1PYLA 1GOUA 3PCSA 4XBTA 2BNGA 2CK3H 3PS8A 4HM6B 4BU4A 2OTL3 3MKIA 1UCKA 3F14A 3B8LA 1V74A 3F7SA 1CEWI 3N54B 4HVNA 4WYKA 2W0QA 3CC43 2BMOB 3EX9A 1K9M4 1HU9A 3VGNA 4LSOA 1RGCA 4K1VA 4N6MA 7RNTA 1KSIA 3MG2A 1I0XA 2V1LA 1QVG2 1UCIA 2D42A 1F8NA 2ZL8A 4ZM8A 3I553 5M18A 1UUWB 2CWTA 5AIIA 2CH9A 4RZMA 1JB4A 1Q7Y4 1I3IA 5FGOA 1STFI 1HYFA 3T0UA 1VQ63 3T8UA 3D79A 4FMAA 3V92A 1GS3A 3RDEA 1BNEA 3HZPA 2BMRB 2YFJB 4HZ9B 5CLKA 1N5HA 2WGQA 2KRTA 1ROAA 1T5YA 4X2HA 1Q9EA 1FUSA 1AR0A 3F8XA 1V58A 2Y73A 4EBGA 4XDVA 3A5EA 1O7PB 4N6TA 3G4S3 1BRHA 2OOVC 2C4BA 5AIGA 1M1XB 4EV5A 1UI7A 3ZG5A 2CIUA 1HKXA 4OK0A 1ISKA 1UI8A 1TUHA 3IJEB 3LMLA 1YJ93 2ZA4A 3RNTA 2CFGA 3TDGA 1OHOA 1JBSA 1RDSA 4FMBA 1ZX2A 1YNVX 2GU1A 1GY6A 1R4YA 4GSPA 2YFIB 2Z77A 1RCLA 3FG3A 3LTCA 1QAFA 3D5IA 4HZBB 3VF1A 3SEDA 2F99A 3PXMA 2F5WA 1M9GA 1W7CA 3LT8A 1FW7A 5AEWB 2HMNB 1FGQA 5EQLA 1B2SA 3CME3 1T2IA 3JUQA 1RN7A 4I4KA 2XH9A 5IF6A 1N9JA 1BRSA 2E2UA 2K3DA 3MSOA 1VQ43 4XB5A 5I97A 1MOLA 3IMAB 5CK6A 3WA2X 2L4VA 1X1UA 3OW22 4G1MB 4FMCA 1M904 1I0VA 2XR8B 1YVBI 3SLUA 5BXQA 3GZXB 1QALA 1AQZA 1W02A 3E99A 4EXRA 1TTOA 2CW9A 2P0MA 1CYVA 1W00A 4BL2A 3CCJ3 5ELUA 3WMDA 3KN4A 1G02A 2CX1A 3GAXA 1Q40B 1B2UA 1TFOA 2H0HA 1RGHA 4HM0B 4RNTA 1S5AA 3LH4A 1W6GA 1DMMA 2ML5A 1OUNA 3FG4A 4MMXB 1JNQA 5AIFA 2H0IA 2Z76A 1RGKA 3ZFZA 3DGYA 1WNHA 5HGRA 2CWUA 3CD63 1W2B2 1LQMB 4N6NB 2K54A 1JRQA 1Q40A 2W03A 1YGWA 4WP5A 1O7HB 1IVWA 4X2OA 4K1UA 4GB5A 1RHLA 1Z1SA 3KSPA 3OWYA 1GOYA 2HMMB 1SPUA 1IQXA 5GSPA 2AADA 3X3XA 4BL3A 1I70A 3CC73 1IQ8A 3BLZA 5AYRB 4AKZA 4IT7A 3SOAA 2D1WA 1FYSA 3F40A 4JF8A 4N6UA 2UX0A 1O7NB 1TJDA 3OXAA 3DGOA 1B3SA 1JV2B 1JBTA 1JB2A 2YX9A 5IG4A 2E2VA 1IT8A 3DGMA 2HMOB 4CCVA 1BVIA 1RNTA 4HAAA 4O3VA 3N9HA 1WMPA 4J8TA 1RGLA 1I2GA 2CG0A 2CWVA 3GWRA 3JVCA 1RLSA 4KVHA 6RNTA 1ASKA 3CCR3 3EF8A 1QMAA 2BMQB 5LC6A 3BB9A 1Q42A 2W56B 3DGLA 1Q824 1UCLA 5ELJA 1NNVA 4EV2A 1T2HA 4AEQA 1DVCA 4HOHA 2SBLA 2XRXB 4EYCA 5A0OB 1SQWA 3K5TA 1IV9A 1IYYA 1CYUA 1FGOA 3F7XA 1VQK3 4K90B 2W2CA 1UUGB 2W56A 1BANA 1X1YA 2GXFA 1B20A 2RNTA 3FZWA 1KC84 4GHOA 1IT7A 3BIRA 2PZVA 3NX0A 1RNBA 5STDA 4LGQA 3EBYA 1BNJA 2YFLB 1DMNA 1FGRA 1K28A 2CX0A 1K734 1D6YA 1JZDA 3WR2A 4BTXA
chains in the Genus database with same CATH topology
3CCM3 3UJMA 1VQ73 1LVNA 2BHMA 3UL5A 3S5CA 2XF3A 4N6V0 4R1KA 3X40A 3CNMA 5EEOA 4LZIA 3T8NA 1EG9B 1VQ53 1RJOA 4O02B 4CDLA 1ROVA 1J2BA 4OVMA 1DYUA 2B24B 3NV0B 4R9KA 2FXTA 1D6UA 3BNEA 4HM1B 1IVXA 1KQS2 4HBRA 1OGXA 3ECFA 4WFOA 4BTWA 1RKYA 1QJGA 3FLJA 1UW1A 1FGMA 3X3YA 3O8YA 3FG1A 3UL6A 1NDOB 2W9PA 3NV0A 4IPBA 2CC3A 3Q1CA 2GBWB 1W5ZA 3OV4A 3UNLA 3F8HA 1OHPA 4HJLB 1GD4A 4KFDA 4XDWA 3AMOA 4KZ1A 5JBSA 1VZZA 1W6CA 4NREA 3DY5A 3V98A 4JRFA 2WOHA 2CFDA 2IMJA 3J7Yd 3F9SA 1IU7A 4HM7B 3B4PA 1WMOA 2O3OA 1OH0A 3FH1A 2JQ5A 5IEOA 1PU4A 3EBTA 3CPW2 3I563 3MG3A 5DREA 2RSXA 1SIHA 5KP3A 2ZDJA 2BO9B 4U13A 1O7MB 3OX9A 4N6OB 3H3HA 4ORLA 1DVDA 3G8ZA 1SIIA 2IA7A 1K8A4 3KFQC 1NB5I 1IQYA 2OWPA 1U8CB 1VQN3 2P0XA 1FGTA 3JUOA 4NHFA 3CCQ3 3CCL3 5FW5A 2XFSA 1LOXA 5IW9A 1DMQA 3A76A 2STDA 3U97A 5LC7A 4FCJA 3VSYA 3GZYB 4EC6A 2XEPA 4O8SA 3G16A 3FF2A 5EVHA 5D82A 4HM8B 1EA2A 1D6ZA 3EB8A 3WOEB 4BTYA 4R9LA 4OUQA 5CF1A 1PFPA 4WHAA 1JB5A 1EKMA 5IG0A 1QAKA 3V99A 1N8R4 2MF7A 3NBBA 4HKVB 2OTJ3 3ER7A 1NWWA 3WDGB 1NB3I 5IERA 1JJ22 3WOFB 2RFRA 3CCS3 4FCMA 3Q2PA 3OWSA 3EE1A 3ALAA 2HMKB 1RRHA 3HK4A 3X42A 3MPHA 3CC23 3MYTA 3KE7A 3OWUA 1YIJ3 3CXC2 1W01A 2CFWA 2BT3A 3BNDA 2XSOB 2GBXB 2E2TA 3CCE3 3NXJA 1YGEA 3PYJA 3H51A 3SX1A 6STDA 3KIIA 3Q90A 1YIT3 1Q864 5CXOA 1VQ83 1TP6A 2M7OA 4HM5B 3PCRA 3NUVA 2GEYA 4TX4A 3D9RA 5JPUA 1OGZA 1Q814 1ZO2A 2WOFA 5D81A 1TFKA 1L5GB 5AI1A 2KCDA 5IENA 3K7CA 1OHSA 3DMCA 1BUQA 3PGBA 3CU3A 1S723 4N6LA 3GZBA 1CQSA 3FF0A 4RNYA 4O2HA 3EHCA 3SXXA 1M1K4 1Y4KA 4R4KA 2KXGA 3MWZA 5BVBA 1EQKA 3G0KA 1YI23 1NO3A 3DM8A 3EJVA 4MMZB 3DXOA 4RNZA 1NU3A 1RRLA 2F98A 2R4IA 5JPPA 3NQZA 4PEJA 2P09A 1UUVB 4XM4A 1WTHA 5IG3A 3UB1A 2INXA 1FUWA 1GYBA 1MNLA 1OF5B 3K63A 4N3VA 3MHEA 2OQEA 3S67A 1A2KA 2Q07A 1AVLA 3B7CA 4R80A 2CFKA 2Z7AA 2PNCA 3AMOB 3JUNA 4J9AA 1ULJB 3NM7A 1TU5A 2LQVA 3NBRA 3CC43 1VQM3 1VQL3 1VQ93 1OF5A 5G2GA 4MJDA 3L0RA 3SVAA 3NBJA 5KP4A 4RBNA 3G713 1VQO3 1IDPA 4XBXA 4KFEA 3NM2A 4LEHA 4K61A 1AVKA 3DUKA 1K41A 1VQP3 1SJWA 4L8PA 1ULIB 1A67A 8CHOA 2XSHB 2XGNA 3G6E3 2Z6BA 4MEIA 1N9EA 1OPYA 3B4OA 3FGYA 1OCVA 3JUMA 4L7KA 2F86B 2IUKA 3DGNA 4GL6A 5D83A 2W6JH 5CF2A 3KZTA 2IUJA 3KSED 3CPOA 1U5OA 1IK3A 2Y74A 3M8CA 2CHCA 3BNCA 4IIAA 3RGAA 3LT9A 1GD3A 3D3LA 2B1XB 2JDIH 1W2ZA 4FCZA 4FMDA 1E3VA 3HX8A 1OACA 2OCTA 4XBYA 2K0MA 3WODG 3EC9A 2QIYA 3FSDA 3S27A 4Q53A 1WQLB 3EN1B 5IG5A 3CCV3 2HMLB 1US1A 3K9MC 1YHQ3 3SOYA 1O7GB 3GZRA 1LXEA 3X41A 3IPTA 1AV4A 1WMNA 2OQEC 4WWUC 2W04A 1FA3A 3S28A 4HM2B 4HM3B 1YJN3 2FNQA 3PZWA 5AIHA 2XGLA 5AEUB 2I9WA 3HI7A 1STDA 2WGOA 1N8QA 1N5PA 1E3RA 3KKGA 1NJI4 2CKFB 2MC8A 3BNBA 3WA3A 1C7HA 3FKAA 5TGNA 1JN5B 4KFFA 1GY5A 3FCSB 3N8BA 1QVF2 3MG1A 2RGQA 1IVUA 1IVVA 2CG1A 3GRDA 2P05A 2A15A 1KWIA 3QRDA 3X3ZA 1E97A 3QK9A 2P38A 3ROBA 1JN5A 3LTBA 4LMIA 7STDA 2CFLA 3RGRA 1TIJA 3LZAA 2QA43 1G96A 1KD14 3I0YA 3LXUX 2OOVA 2QEX3 2QGUA 1W4NA 3NQYA 3STDA 2HMJB 3LTAA 4STDA 5DRVA 3EN8A 5KP1A 3CCU3 4FR9A 3S29A 4HM4B 4H61A 4L8OA 3CMA3 2RCDA 3DZLA 3HIIA 2W9QA 2XFTA 3LTDA 2GEXA 1LNHA 3CNXA 3NHXA 2C11A 1JKGB 2FGTA 4MMYB 4H3UA 2O9UX 2WO0A 3EQQB 1A90A 2GU3A 2ML6A 1R4CA 3JUPA 1YJW3 4HYZA 1GY7A 2C10A 5IEPA 3HIGA 5AYSC 3K0ZA 1W6YA 4QWTA 1IV7A 4WYKB 1O7WB 3LYGA 3LOYA 2LYXA 1JKGA 1A2VA 3U1WA 3PCSA 4XBTA 2BNGA 2CK3H 3PS8A 4HM6B 2OTL3 3MKIA 3F14A 3B8LA 1V74A 3F7SA 1CEWI 3N54B 4HVNA 4WYKA 2W0QA 2BMOB 3EX9A 1K9M4 1HU9A 3VGNA 4LSOA 4K1VA 4N6MA 1KSIA 3MG2A 2V1LA 1QVG2 2D42A 1F8NA 2ZL8A 4ZM8A 3I553 1UUWB 2CWTA 5AIIA 2CH9A 4RZMA 1JB4A 1Q7Y4 5FGOA 1STFI 3T0UA 1VQ63 3T8UA 4FMAA 3V92A 1GS3A 3RDEA 3HZPA 2BMRB 2YFJB 4HZ9B 5CLKA 1N5HA 2WGQA 2KRTA 1ROAA 1T5YA 4X2HA 1AR0A 3F8XA 2Y73A 4EBGA 4XDVA 1O7PB 4N6TA 3G4S3 2OOVC 5AIGA 1M1XB 4EV5A 1UI7A 2CIUA 1HKXA 4OK0A 1ISKA 1UI8A 1TUHA 3IJEB 3LMLA 1YJ93 3TDGA 2CFGA 1OHOA 4FMBA 1ZX2A 2GU1A 1GY6A 2YFIB 2Z77A 3FG3A 3LTCA 1QAFA 4HZBB 3VF1A 3SEDA 2F99A 3PXMA 1M9GA 1W7CA 3LT8A 5AEWB 2HMNB 1FGQA 5EQLA 3CME3 3JUQA 1RN7A 4I4KA 2XH9A 5IF6A 1N9JA 2E2UA 3MSOA 1VQ43 4XB5A 5I97A 1MOLA 3IMAB 5CK6A 3WA2X 2L4VA 3OW22 4G1MB 4FMCA 1M904 3SLUA 2XR8B 1YVBI 5BXQA 3GZXB 1QALA 1W02A 3E99A 4EXRA 2CW9A 2P0MA 1CYVA 1W00A 3CCJ3 5ELUA 3WMDA 3KN4A 3GAXA 1Q40B 1TFOA 4HM0B 1S5AA 3LH4A 1W6GA 1DMMA 2ML5A 1OUNA 3FG4A 4MMXB 1JNQA 5AIFA 2Z76A 1WNHA 5HGRA 2CWUA 3CD63 1W2B2 4N6NB 2K54A 2W03A 1JRQA 1Q40A 4WP5A 1O7HB 1IVWA 4X2OA 4K1UA 4GB5A 1Z1SA 3KSPA 3OWYA 2HMMB 1SPUA 1IQXA 3X3XA 3CC73 1IQ8A 3BLZA 5AYRB 4AKZA 4IT7A 3SOAA 2D1WA 4N6UA 3F40A 4JF8A 2UX0A 1O7NB 3OXAA 3DGOA 1JV2B 1JB2A 2YX9A 5IG4A 2E2VA 1IT8A 3DGMA 2HMOB 4CCVA 4O3VA 3N9HA 1WMPA 4J8TA 2CWVA 2CG0A 3GWRA 4KVHA 3JVCA 1ASKA 3CCR3 3EF8A 1QMAA 2BMQB 5LC6A 3BB9A 1Q42A 2W56B 3DGLA 1Q824 5ELJA 4EV2A 4AEQA 1DVCA 2SBLA 2XRXB 4EYCA 5A0OB 1SQWA 3K5TA 1IV9A 1CYUA 1FGOA 3F7XA 1VQK3 4K90B 2W2CA 2W56A 2GXFA 3FZWA 1KC84 1IT7A 2PZVA 3NX0A 5STDA 4LGQA 3EBYA 2YFLB 1K734 1DMNA 1FGRA 1K28A 1D6YA 4AKYA 4BTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R80 A; 
#chains in the Genus database with same CATH topology
 3CCM 3;  1BRG A;  3UJM A;  1VQ7 3;  2KF6 A;  1LVN A;  1UGH I;  1MWU A;  2BHM A;  3UL5 A;  3S5C A;  2XF3 A;  1BOX A;  4N6V 0;  4R1K A;  3X40 A;  3CNM A;  5EEO A;  4LZI A;  3T8N A;  3WHO A;  1EG9 B;  1VQ5 3;  1RJO A;  4O02 B;  4CDL A;  1ROV A;  1J2B A;  4OVM A;  1DYU A;  2B24 B;  3NV0 B;  4R9K A;  2FXT A;  1D6U A;  3BNE A;  1FZU A;  1JZO A;  1IVX A;  4HM1 B;  1KQS 2;  1RSN A;  4HBR A;  1OGX A;  3ECF A;  4WFO A;  1BNG A;  4BTW A;  1RKY A;  5M19 A;  2UUG C;  1QJG A;  3FLJ A;  1UW1 A;  1FGM A;  3X3Y A;  3O8Y A;  1BU4 A;  1B21 A;  2KAA A;  3FG1 A;  1NDO B;  2W9P A;  3NV0 A;  4IPB A;  2CC3 A;  3Q1C A;  3UL6 A;  3AGO A;  2GBW B;  1W5Z A;  3OV4 A;  3UNL A;  3F8H A;  1OHP A;  4HJL B;  5RNT A;  1GD4 A;  4KFD A;  4XDW A;  3AMO A;  4KZ1 A;  5JBS A;  5HOH A;  1VZZ A;  1W6C A;  4NRE A;  3DY5 A;  3V98 A;  4JRF A;  2WOH A;  2CFD A;  2IMJ A;  1FUT A;  1RGF A;  2R41 A;  3J7Y d;  4J5K A;  3F9S A;  1IU7 A;  4HM7 B;  3B4P A;  1WMO A;  2O3O A;  1OH0 A;  3FH1 A;  1RGE A;  2JQ5 A;  5IEO A;  1PU4 A;  1MWT A;  2J8X B;  2KF5 A;  3EBT A;  3CPW 2;  3I56 3;  2UGI A;  3MG3 A;  5DRE A;  2RSX A;  1SIH A;  5KP3 A;  2ZDJ A;  2BO9 B;  4U13 A;  5BIR A;  1O7M B;  3OX9 A;  4N6O B;  3H3H A;  4ORL A;  1DVD A;  3G8Z A;  1SII A;  2IA7 A;  1K8A 4;  3KFQ C;  1NB5 I;  1IQY A;  1PY3 A;  1U8C B;  2OWP A;  2H0G A;  2P0X A;  1VQN 3;  1EUI C;  1FGT A;  3JUO A;  2L1S A;  2IYJ A;  4NHF A;  3CCQ 3;  5FW5 A;  3CCL 3;  2XFS A;  1GMR A;  1LOX A;  5IW9 A;  1DMQ A;  3A76 A;  1BNS A;  2STD A;  2AAE A;  1RGA A;  3U97 A;  5LC7 A;  1YVS A;  1JBR A;  4FCJ A;  3VSY A;  1GMP A;  3GZY B;  4EC6 A;  2XEP A;  1RN1 A;  3G16 A;  3FF2 A;  4O8S A;  5EVH A;  5D82 A;  1BNI A;  1G0T A;  4HM8 B;  1EA2 A;  1D6Z A;  3EB8 A;  3WOE B;  4BTY A;  1BNR A;  4R9L A;  4OUQ A;  5CF1 A;  1PFP A;  3KCH A;  4WHA A;  1JB5 A;  2F5M A;  1EKM A;  5IG0 A;  1QAK A;  3V99 A;  1N8R 4;  1BRN L;  2MF7 A;  3NBB A;  1LQG C;  4HKV B;  2OTJ 3;  3ER7 A;  1NWW A;  3WDG B;  1NB3 I;  5IER A;  1JJ2 2;  4ILF A;  1EEJ A;  2RFR A;  3WOF B;  3CCS 3;  4FCM A;  3Q2P A;  1DE3 A;  3OWS A;  1B2M A;  6GSP A;  1BSA A;  3EE1 A;  1ZS7 A;  3ALA A;  4BIR A;  2HMK B;  1RRH A;  1X1X A;  3HK4 A;  3X42 A;  5M1A A;  3CCU 3;  3MPH A;  3CC2 3;  4DKI A;  1UGI A;  3MYT A;  3KE7 A;  3OWU A;  1YIJ 3;  3CXC 2;  4NPB A;  1W01 A;  2CFW A;  2BT3 A;  3BND A;  1BGS A;  2XSO B;  2GBX B;  2E2T A;  3CCE 3;  3NXJ A;  1YGE A;  3PYJ A;  3H51 A;  3SX1 A;  1I2F A;  3KII A;  6STD A;  1BAO A;  3Q90 A;  1YIT 3;  1Q86 4;  5CXO A;  1VQ8 3;  1TP6 A;  2M7O A;  4HM5 B;  3PCR A;  3NUV A;  2GEY A;  4TX4 A;  3D9R A;  5JPU A;  1OGZ A;  1VQQ A;  1Q81 4;  1ZO2 A;  2WOF A;  1B2Z A;  5D81 A;  1C54 A;  1TFK A;  1L5G B;  5AI1 A;  2KCD A;  5IEN A;  3K7C A;  1V57 A;  1OHS A;  3DMC A;  1RTU A;  1BUQ A;  1TRP A;  2KF3 A;  3PGB A;  3CU3 A;  1S72 3;  3AHS A;  1BIR A;  4N6L A;  3GZB A;  1CQS A;  3FF0 A;  4RNY A;  7GSP A;  4O2H A;  3EHC A;  3SXX A;  1M1K 4;  1Y4K A;  4R4K A;  2KXG A;  3MWZ A;  2SAR A;  5BVB A;  2F4Y A;  3URP A;  1EQK A;  3G0K A;  1YI2 3;  1BRI A;  1NO3 A;  3DM8 A;  3EJV A;  4MMZ B;  3DXO A;  4RNZ A;  1NU3 A;  1RRL A;  2F98 A;  2R4I A;  5JPP A;  3NQZ A;  4PEJ A;  2P09 A;  1UUV B;  4XM4 A;  1WTH A;  5IG3 A;  3UB1 A;  2INX A;  1BSB A;  1FUW A;  1RGG A;  1BRK A;  1LNI A;  1GYB A;  3Q3F A;  1MNL A;  1I2E A;  1OF5 B;  3K63 A;  3GSP A;  4N3V A;  3MHE A;  1SAR A;  2IY2 A;  2OQE A;  1A2K A;  2Q07 A;  3S67 A;  1AVL A;  3AHW A;  3B7C A;  4R80 A;  2CFK A;  2Z7A A;  1DET A;  2HOH A;  4EW5 A;  2PNC A;  1AY7 A;  1X1W A;  3AMO B;  1ULJ B;  3JUN A;  3NM7 A;  2LQV A;  1I3F A;  3NBR A;  4J9A A;  4CPK A;  9RNT A;  1TU5 A;  1VQM 3;  1VQL 3;  1VQ9 3;  1OF5 A;  5G1K A;  5G2G A;  1MWR A;  4MJD A;  3L0R A;  3SVA A;  3NBJ A;  5KP4 A;  4RBN A;  3G71 3;  1VQO 3;  1IDP A;  4XBX A;  3SYU A;  4KFE A;  1LOY A;  3NM2 A;  4LEH A;  4K61 A;  1AVK A;  3DUK A;  4KT3 B;  1K41 A;  1VQP 3;  1SJW A;  4L8P A;  2BIR A;  1ULI B;  1ZGX A;  1A67 A;  8CHO A;  2XSH B;  1BUJ A;  2XGN A;  3G6E 3;  2Z6B A;  4MEI A;  1N9E A;  1OPY A;  3B4O A;  3FGY A;  1OCV A;  3AGN A;  3JUM A;  4L7K A;  2F86 B;  2KF4 A;  2IUK A;  3DGN A;  4GL6 A;  5D83 A;  2W6J H;  5CF2 A;  3KZT A;  2IUJ A;  3ZG0 A;  3KSE D;  3CPO A;  1U5O A;  1IK3 A;  2Y74 A;  3M8C A;  5BU4 A;  2GSP A;  1MWS A;  2CHC A;  1BSD A;  3BNC A;  5G1L A;  4IIA A;  1MGR A;  1T3B A;  1UCJ A;  3RGA A;  3LT9 A;  1GD3 A;  3D3L A;  2B1X B;  2JDI H;  1W2Z A;  4FCZ A;  4FMD A;  1E3V A;  3HX8 A;  1OAC A;  2OCT A;  4XBY A;  2K0M A;  3WOD G;  3EC9 A;  2QIY A;  3FSD A;  3DH2 A;  1GSP A;  1RMS A;  4I5Q A;  3S27 A;  4Q53 A;  1WQL B;  3EN1 B;  5IG5 A;  3CCV 3;  2HML B;  1US1 A;  1BRJ A;  3K9M C;  1YHQ 3;  3SOY A;  1O7G B;  3GZR A;  2RBI A;  1LXE A;  3X41 A;  3IPT A;  1B2X A;  1AV4 A;  1WMN A;  3BU4 A;  2OQE C;  1RCK A;  4WWU C;  1BSE A;  2W04 A;  1FA3 A;  3S28 A;  1I8V A;  4HM2 B;  4HM3 B;  1YJN 3;  2FNQ A;  3PZW A;  5AIH A;  1BSC A;  2XGL A;  3D4A A;  5AEU B;  2I9W A;  3HI7 A;  1STD A;  2WGO A;  1N8Q A;  1N5P A;  1E3R A;  3KKG A;  1NJI 4;  2CKF B;  2MC8 A;  3BNB A;  1B27 A;  3WA3 A;  1C7H A;  3FKA A;  1GMQ A;  2F56 A;  1BNF A;  5TGN A;  1JN5 B;  4KFF A;  1GY5 A;  3FCS B;  3N8B A;  1QVF 2;  1CH0 A;  3MG1 A;  2RGQ A;  1IVU A;  1IVV A;  2CG1 A;  2ZHX B;  3GRD A;  2P05 A;  2A15 A;  1KWI A;  1Q7H A;  3QRD A;  3X3Z A;  1E97 A;  3QK9 A;  1LOV A;  2P38 A;  3ROB A;  1JN5 A;  3LTB A;  4LMI A;  7STD A;  2CFL A;  3RGR A;  3D5G A;  1TRQ A;  1TIJ A;  3LZA A;  3HOH A;  2QA4 3;  1G96 A;  2BU4 A;  1KD1 4;  3I0Y A;  1UDI I;  3LXU X;  2OOV A;  2QEX 3;  1HZ1 A;  2QGU A;  1W4N A;  3NQY A;  3STD A;  2HMJ B;  3LTA A;  4J5G A;  4STD A;  1A2P A;  3EN8 A;  5DRV A;  5KP1 A;  4FR9 A;  3S29 A;  1GOV A;  1LRA A;  4H61 A;  4HM4 B;  4L8O A;  3CMA 3;  2RCD A;  3DZL A;  3HII A;  2W9Q A;  8RNT A;  2XFT A;  1LOW A;  3LTD A;  2GEX A;  1LNH A;  3CNX A;  3NHX A;  2C11 A;  1JKG B;  2FGT A;  4MMY B;  4H3U A;  2O9U X;  2WO0 A;  3EQQ B;  1A90 A;  2GU3 A;  2ML6 A;  1R4C A;  1RN4 A;  3JUP A;  4LYL B;  1YJW 3;  4HYZ A;  1GY7 A;  2C10 A;  4CJN A;  3HIG A;  5AYS C;  5IEP A;  3K0Z A;  1W6Y A;  4QWT A;  1IV7 A;  4AKY A;  1MGW A;  4WYK B;  1O7W B;  3LYG A;  3LOY A;  2LYX A;  1JKG A;  1A2V A;  3U1W A;  1PYL A;  1GOU A;  3PCS A;  4XBT A;  2BNG A;  2CK3 H;  3PS8 A;  4HM6 B;  4BU4 A;  2OTL 3;  3MKI A;  1UCK A;  3F14 A;  3B8L A;  1V74 A;  3F7S A;  1CEW I;  3N54 B;  4HVN A;  4WYK A;  2W0Q A;  3CC4 3;  2BMO B;  3EX9 A;  1K9M 4;  1HU9 A;  3VGN A;  4LSO A;  1RGC A;  4K1V A;  4N6M A;  7RNT A;  1KSI A;  3MG2 A;  1I0X A;  2V1L A;  1QVG 2;  1UCI A;  2D42 A;  1F8N A;  2ZL8 A;  4ZM8 A;  3I55 3;  5M18 A;  1UUW B;  2CWT A;  5AII A;  2CH9 A;  4RZM A;  1JB4 A;  1Q7Y 4;  1I3I A;  5FGO A;  1STF I;  1HYF A;  3T0U A;  1VQ6 3;  3T8U A;  3D79 A;  4FMA A;  3V92 A;  1GS3 A;  3RDE A;  1BNE A;  3HZP A;  2BMR B;  2YFJ B;  4HZ9 B;  5CLK A;  1N5H A;  2WGQ A;  2KRT A;  1ROA A;  1T5Y A;  4X2H A;  1Q9E A;  1FUS A;  1AR0 A;  3F8X A;  1V58 A;  2Y73 A;  4EBG A;  4XDV A;  3A5E A;  1O7P B;  4N6T A;  3G4S 3;  1BRH A;  2OOV C;  2C4B A;  5AIG A;  1M1X B;  4EV5 A;  1UI7 A;  3ZG5 A;  2CIU A;  1HKX A;  4OK0 A;  1ISK A;  1UI8 A;  1TUH A;  3IJE B;  3LML A;  1YJ9 3;  2ZA4 A;  3RNT A;  2CFG A;  3TDG A;  1OHO A;  1JBS A;  1RDS A;  4FMB A;  1ZX2 A;  1YNV X;  2GU1 A;  1GY6 A;  1R4Y A;  4GSP A;  2YFI B;  2Z77 A;  1RCL A;  3FG3 A;  3LTC A;  1QAF A;  3D5I A;  4HZB B;  3VF1 A;  3SED A;  2F99 A;  3PXM A;  2F5W A;  1M9G A;  1W7C A;  3LT8 A;  1FW7 A;  5AEW B;  2HMN B;  1FGQ A;  5EQL A;  1B2S A;  3CME 3;  1T2I A;  3JUQ A;  1RN7 A;  4I4K A;  2XH9 A;  5IF6 A;  1N9J A;  1BRS A;  2E2U A;  2K3D A;  3MSO A;  1VQ4 3;  4XB5 A;  5I97 A;  1MOL A;  3IMA B;  5CK6 A;  3WA2 X;  2L4V A;  1X1U A;  3OW2 2;  4G1M B;  4FMC A;  1M90 4;  1I0V A;  2XR8 B;  1YVB I;  3SLU A;  5BXQ A;  3GZX B;  1QAL A;  1AQZ A;  1W02 A;  3E99 A;  4EXR A;  1TTO A;  2CW9 A;  2P0M A;  1CYV A;  1W00 A;  4BL2 A;  3CCJ 3;  5ELU A;  3WMD A;  3KN4 A;  1G02 A;  2CX1 A;  3GAX A;  1Q40 B;  1B2U A;  1TFO A;  2H0H A;  1RGH A;  4HM0 B;  4RNT A;  1S5A A;  3LH4 A;  1W6G A;  1DMM A;  2ML5 A;  1OUN A;  3FG4 A;  4MMX B;  1JNQ A;  5AIF A;  2H0I A;  2Z76 A;  1RGK A;  3ZFZ A;  3DGY A;  1WNH A;  5HGR A;  2CWU A;  3CD6 3;  1W2B 2;  1LQM B;  4N6N B;  2K54 A;  1JRQ A;  1Q40 A;  2W03 A;  1YGW A;  4WP5 A;  1O7H B;  1IVW A;  4X2O A;  4K1U A;  4GB5 A;  1RHL A;  1Z1S A;  3KSP A;  3OWY A;  1GOY A;  2HMM B;  1SPU A;  1IQX A;  5GSP A;  2AAD A;  3X3X A;  4BL3 A;  1I70 A;  3CC7 3;  1IQ8 A;  3BLZ A;  5AYR B;  4AKZ A;  4IT7 A;  3SOA A;  2D1W A;  1FYS A;  3F40 A;  4JF8 A;  4N6U A;  2UX0 A;  1O7N B;  1TJD A;  3OXA A;  3DGO A;  1B3S A;  1JV2 B;  1JBT A;  1JB2 A;  2YX9 A;  5IG4 A;  2E2V A;  1IT8 A;  3DGM A;  2HMO B;  4CCV A;  1BVI A;  1RNT A;  4HAA A;  4O3V A;  3N9H A;  1WMP A;  4J8T A;  1RGL A;  1I2G A;  2CG0 A;  2CWV A;  3GWR A;  3JVC A;  1RLS A;  4KVH A;  6RNT A;  1ASK A;  3CCR 3;  3EF8 A;  1QMA A;  2BMQ B;  5LC6 A;  3BB9 A;  1Q42 A;  2W56 B;  3DGL A;  1Q82 4;  1UCL A;  5ELJ A;  1NNV A;  4EV2 A;  1T2H A;  4AEQ A;  1DVC A;  4HOH A;  2SBL A;  2XRX B;  4EYC A;  5A0O B;  1SQW A;  3K5T A;  1IV9 A;  1IYY A;  1CYU A;  1FGO A;  3F7X A;  1VQK 3;  4K90 B;  2W2C A;  1UUG B;  2W56 A;  1BAN A;  1X1Y A;  2GXF A;  1B20 A;  2RNT A;  3FZW A;  1KC8 4;  4GHO A;  1IT7 A;  3BIR A;  2PZV A;  3NX0 A;  1RNB A;  5STD A;  4LGQ A;  3EBY A;  1BNJ A;  2YFL B;  1DMN A;  1FGR A;  1K28 A;  2CX0 A;  1K73 4;  1D6Y A;  1JZD A;  3WR2 A;  4BTX A; 
#chains in the Genus database with same CATH homology
 3CCM 3;  3UJM A;  1VQ7 3;  1LVN A;  2BHM A;  3UL5 A;  3S5C A;  2XF3 A;  4N6V 0;  4R1K A;  3X40 A;  3CNM A;  5EEO A;  4LZI A;  3T8N A;  1EG9 B;  1VQ5 3;  1RJO A;  4O02 B;  4CDL A;  1ROV A;  1J2B A;  4OVM A;  1DYU A;  2B24 B;  3NV0 B;  4R9K A;  2FXT A;  1D6U A;  3BNE A;  4HM1 B;  1IVX A;  1KQS 2;  4HBR A;  1OGX A;  3ECF A;  4WFO A;  4BTW A;  1RKY A;  1QJG A;  3FLJ A;  1UW1 A;  1FGM A;  3X3Y A;  3O8Y A;  3FG1 A;  3UL6 A;  1NDO B;  2W9P A;  3NV0 A;  4IPB A;  2CC3 A;  3Q1C A;  2GBW B;  1W5Z A;  3OV4 A;  3UNL A;  3F8H A;  1OHP A;  4HJL B;  1GD4 A;  4KFD A;  4XDW A;  3AMO A;  4KZ1 A;  5JBS A;  1VZZ A;  1W6C A;  4NRE A;  3DY5 A;  3V98 A;  4JRF A;  2WOH A;  2CFD A;  2IMJ A;  3J7Y d;  3F9S A;  1IU7 A;  4HM7 B;  3B4P A;  1WMO A;  2O3O A;  1OH0 A;  3FH1 A;  2JQ5 A;  5IEO A;  1PU4 A;  3EBT A;  3CPW 2;  3I56 3;  3MG3 A;  5DRE A;  2RSX A;  1SIH A;  5KP3 A;  2ZDJ A;  2BO9 B;  4U13 A;  1O7M B;  3OX9 A;  4N6O B;  3H3H A;  4ORL A;  1DVD A;  3G8Z A;  1SII A;  2IA7 A;  1K8A 4;  3KFQ C;  1NB5 I;  1IQY A;  2OWP A;  1U8C B;  1VQN 3;  2P0X A;  1FGT A;  3JUO A;  4NHF A;  3CCQ 3;  3CCL 3;  5FW5 A;  2XFS A;  1LOX A;  5IW9 A;  1DMQ A;  3A76 A;  2STD A;  3U97 A;  5LC7 A;  4FCJ A;  3VSY A;  3GZY B;  4EC6 A;  2XEP A;  4O8S A;  3G16 A;  3FF2 A;  5EVH A;  5D82 A;  4HM8 B;  1EA2 A;  1D6Z A;  3EB8 A;  3WOE B;  4BTY A;  4R9L A;  4OUQ A;  5CF1 A;  1PFP A;  4WHA A;  1JB5 A;  1EKM A;  5IG0 A;  1QAK A;  3V99 A;  1N8R 4;  2MF7 A;  3NBB A;  4HKV B;  2OTJ 3;  3ER7 A;  1NWW A;  3WDG B;  1NB3 I;  5IER A;  1JJ2 2;  3WOF B;  2RFR A;  3CCS 3;  4FCM A;  3Q2P A;  3OWS A;  3EE1 A;  3ALA A;  2HMK B;  1RRH A;  3HK4 A;  3X42 A;  3MPH A;  3CC2 3;  3MYT A;  3KE7 A;  3OWU A;  1YIJ 3;  3CXC 2;  1W01 A;  2CFW A;  2BT3 A;  3BND A;  2XSO B;  2GBX B;  2E2T A;  3CCE 3;  3NXJ A;  1YGE A;  3PYJ A;  3H51 A;  3SX1 A;  6STD A;  3KII A;  3Q90 A;  1YIT 3;  1Q86 4;  5CXO A;  1VQ8 3;  1TP6 A;  2M7O A;  4HM5 B;  3PCR A;  3NUV A;  2GEY A;  4TX4 A;  3D9R A;  5JPU A;  1OGZ A;  1Q81 4;  1ZO2 A;  2WOF A;  5D81 A;  1TFK A;  1L5G B;  5AI1 A;  2KCD A;  5IEN A;  3K7C A;  1OHS A;  3DMC A;  1BUQ A;  3PGB A;  3CU3 A;  1S72 3;  4N6L A;  3GZB A;  1CQS A;  3FF0 A;  4RNY A;  4O2H A;  3EHC A;  3SXX A;  1M1K 4;  1Y4K A;  4R4K A;  2KXG A;  3MWZ A;  5BVB A;  1EQK A;  3G0K A;  1YI2 3;  1NO3 A;  3DM8 A;  3EJV A;  4MMZ B;  3DXO A;  4RNZ A;  1NU3 A;  1RRL A;  2F98 A;  2R4I A;  5JPP A;  3NQZ A;  4PEJ A;  2P09 A;  1UUV B;  4XM4 A;  1WTH A;  5IG3 A;  3UB1 A;  2INX A;  1FUW A;  1GYB A;  1MNL A;  1OF5 B;  3K63 A;  4N3V A;  3MHE A;  2OQE A;  3S67 A;  1A2K A;  2Q07 A;  1AVL A;  3B7C A;  4R80 A;  2CFK A;  2Z7A A;  2PNC A;  3AMO B;  3JUN A;  4J9A A;  1ULJ B;  3NM7 A;  1TU5 A;  2LQV A;  3NBR A;  3CC4 3;  1VQM 3;  1VQL 3;  1VQ9 3;  1OF5 A;  5G2G A;  4MJD A;  3L0R A;  3SVA A;  3NBJ A;  5KP4 A;  4RBN A;  3G71 3;  1VQO 3;  1IDP A;  4XBX A;  4KFE A;  3NM2 A;  4LEH A;  4K61 A;  1AVK A;  3DUK A;  1K41 A;  1VQP 3;  1SJW A;  4L8P A;  1ULI B;  1A67 A;  8CHO A;  2XSH B;  2XGN A;  3G6E 3;  2Z6B A;  4MEI A;  1N9E A;  1OPY A;  3B4O A;  3FGY A;  1OCV A;  3JUM A;  4L7K A;  2F86 B;  2IUK A;  3DGN A;  4GL6 A;  5D83 A;  2W6J H;  5CF2 A;  3KZT A;  2IUJ A;  3KSE D;  3CPO A;  1U5O A;  1IK3 A;  2Y74 A;  3M8C A;  2CHC A;  3BNC A;  4IIA A;  3RGA A;  3LT9 A;  1GD3 A;  3D3L A;  2B1X B;  2JDI H;  1W2Z A;  4FCZ A;  4FMD A;  1E3V A;  3HX8 A;  1OAC A;  2OCT A;  4XBY A;  2K0M A;  3WOD G;  3EC9 A;  2QIY A;  3FSD A;  3S27 A;  4Q53 A;  1WQL B;  3EN1 B;  5IG5 A;  3CCV 3;  2HML B;  1US1 A;  3K9M C;  1YHQ 3;  3SOY A;  1O7G B;  3GZR A;  1LXE A;  3X41 A;  3IPT A;  1AV4 A;  1WMN A;  2OQE C;  4WWU C;  2W04 A;  1FA3 A;  3S28 A;  4HM2 B;  4HM3 B;  1YJN 3;  2FNQ A;  3PZW A;  5AIH A;  2XGL A;  5AEU B;  2I9W A;  3HI7 A;  1STD A;  2WGO A;  1N8Q A;  1N5P A;  1E3R A;  3KKG A;  1NJI 4;  2CKF B;  2MC8 A;  3BNB A;  3WA3 A;  1C7H A;  3FKA A;  5TGN A;  1JN5 B;  4KFF A;  1GY5 A;  3FCS B;  3N8B A;  1QVF 2;  3MG1 A;  2RGQ A;  1IVU A;  1IVV A;  2CG1 A;  3GRD A;  2P05 A;  2A15 A;  1KWI A;  3QRD A;  3X3Z A;  1E97 A;  3QK9 A;  2P38 A;  3ROB A;  1JN5 A;  3LTB A;  4LMI A;  7STD A;  2CFL A;  3RGR A;  1TIJ A;  3LZA A;  2QA4 3;  1G96 A;  1KD1 4;  3I0Y A;  3LXU X;  2OOV A;  2QEX 3;  2QGU A;  1W4N A;  3NQY A;  3STD A;  2HMJ B;  3LTA A;  4STD A;  5DRV A;  3EN8 A;  5KP1 A;  3CCU 3;  4FR9 A;  3S29 A;  4HM4 B;  4H61 A;  4L8O A;  3CMA 3;  2RCD A;  3DZL A;  3HII A;  2W9Q A;  2XFT A;  3LTD A;  2GEX A;  1LNH A;  3CNX A;  3NHX A;  2C11 A;  1JKG B;  2FGT A;  4MMY B;  4H3U A;  2O9U X;  2WO0 A;  3EQQ B;  1A90 A;  2GU3 A;  2ML6 A;  1R4C A;  3JUP A;  1YJW 3;  4HYZ A;  1GY7 A;  2C10 A;  5IEP A;  3HIG A;  5AYS C;  3K0Z A;  1W6Y A;  4QWT A;  1IV7 A;  4WYK B;  1O7W B;  3LYG A;  3LOY A;  2LYX A;  1JKG A;  1A2V A;  3U1W A;  3PCS A;  4XBT A;  2BNG A;  2CK3 H;  3PS8 A;  4HM6 B;  2OTL 3;  3MKI A;  3F14 A;  3B8L A;  1V74 A;  3F7S A;  1CEW I;  3N54 B;  4HVN A;  4WYK A;  2W0Q A;  2BMO B;  3EX9 A;  1K9M 4;  1HU9 A;  3VGN A;  4LSO A;  4K1V A;  4N6M A;  1KSI A;  3MG2 A;  2V1L A;  1QVG 2;  2D42 A;  1F8N A;  2ZL8 A;  4ZM8 A;  3I55 3;  1UUW B;  2CWT A;  5AII A;  2CH9 A;  4RZM A;  1JB4 A;  1Q7Y 4;  5FGO A;  1STF I;  3T0U A;  1VQ6 3;  3T8U A;  4FMA A;  3V92 A;  1GS3 A;  3RDE A;  3HZP A;  2BMR B;  2YFJ B;  4HZ9 B;  5CLK A;  1N5H A;  2WGQ A;  2KRT A;  1ROA A;  1T5Y A;  4X2H A;  1AR0 A;  3F8X A;  2Y73 A;  4EBG A;  4XDV A;  1O7P B;  4N6T A;  3G4S 3;  2OOV C;  5AIG A;  1M1X B;  4EV5 A;  1UI7 A;  2CIU A;  1HKX A;  4OK0 A;  1ISK A;  1UI8 A;  1TUH A;  3IJE B;  3LML A;  1YJ9 3;  3TDG A;  2CFG A;  1OHO A;  4FMB A;  1ZX2 A;  2GU1 A;  1GY6 A;  2YFI B;  2Z77 A;  3FG3 A;  3LTC A;  1QAF A;  4HZB B;  3VF1 A;  3SED A;  2F99 A;  3PXM A;  1M9G A;  1W7C A;  3LT8 A;  5AEW B;  2HMN B;  1FGQ A;  5EQL A;  3CME 3;  3JUQ A;  1RN7 A;  4I4K A;  2XH9 A;  5IF6 A;  1N9J A;  2E2U A;  3MSO A;  1VQ4 3;  4XB5 A;  5I97 A;  1MOL A;  3IMA B;  5CK6 A;  3WA2 X;  2L4V A;  3OW2 2;  4G1M B;  4FMC A;  1M90 4;  3SLU A;  2XR8 B;  1YVB I;  5BXQ A;  3GZX B;  1QAL A;  1W02 A;  3E99 A;  4EXR A;  2CW9 A;  2P0M A;  1CYV A;  1W00 A;  3CCJ 3;  5ELU A;  3WMD A;  3KN4 A;  3GAX A;  1Q40 B;  1TFO A;  4HM0 B;  1S5A A;  3LH4 A;  1W6G A;  1DMM A;  2ML5 A;  1OUN A;  3FG4 A;  4MMX B;  1JNQ A;  5AIF A;  2Z76 A;  1WNH A;  5HGR A;  2CWU A;  3CD6 3;  1W2B 2;  4N6N B;  2K54 A;  2W03 A;  1JRQ A;  1Q40 A;  4WP5 A;  1O7H B;  1IVW A;  4X2O A;  4K1U A;  4GB5 A;  1Z1S A;  3KSP A;  3OWY A;  2HMM B;  1SPU A;  1IQX A;  3X3X A;  3CC7 3;  1IQ8 A;  3BLZ A;  5AYR B;  4AKZ A;  4IT7 A;  3SOA A;  2D1W A;  4N6U A;  3F40 A;  4JF8 A;  2UX0 A;  1O7N B;  3OXA A;  3DGO A;  1JV2 B;  1JB2 A;  2YX9 A;  5IG4 A;  2E2V A;  1IT8 A;  3DGM A;  2HMO B;  4CCV A;  4O3V A;  3N9H A;  1WMP A;  4J8T A;  2CWV A;  2CG0 A;  3GWR A;  4KVH A;  3JVC A;  1ASK A;  3CCR 3;  3EF8 A;  1QMA A;  2BMQ B;  5LC6 A;  3BB9 A;  1Q42 A;  2W56 B;  3DGL A;  1Q82 4;  5ELJ A;  4EV2 A;  4AEQ A;  1DVC A;  2SBL A;  2XRX B;  4EYC A;  5A0O B;  1SQW A;  3K5T A;  1IV9 A;  1CYU A;  1FGO A;  3F7X A;  1VQK 3;  4K90 B;  2W2C A;  2W56 A;  2GXF A;  3FZW A;  1KC8 4;  1IT7 A;  2PZV A;  3NX0 A;  5STD A;  4LGQ A;  3EBY A;  2YFL B;  1K73 4;  1DMN A;  1FGR A;  1K28 A;  1D6Y A;  4AKY A;  4BTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...