4R80A

Crystal structure of a de novo designed beta sheet protein, cystatin fold, northeast structural genomics consortium (nesg) target or486
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
PSEEEEKRRAKQVAKEKILEQNPSSKVQVRRVQKQGNTIRVELEITENGKKTNITVEVEKQGNTFTVKRITETVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OR486
publication title Crystal Structure of an engineered protein with denovo beta sheet design, Northeast Structural Genomics Consortium (NESG) Target OR486
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 17
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.630 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r80A00
4R80A
chains in the Genus database with same CATH superfamily
2IA7A 3GRDA 2XF3A 2F86B 3S5CA 1ZX2A 5ELJA 4N6V0 1EQKA 3J7Yd 1T2HA 1AV4A 1R4CA 2KXGA 3BNEA 3NUVA 2RNTA 4HVNA 3NM2A 1GY6A 2K54A 4CCVA 1J2BA 1C54A 1RN1A 3HK4A 1OUNA 3E99A 3EF8A 1UGHI 4EV2A 3OV4A 3CMA3 2UGIA 5GSPA 8RNTA 4HM1B 4BL2A 4LGQA 1JBTA 3MWZA 1JZDA 2H0HA 4I5QA 3CPOA 3LTCA 3IMAB 5G2GA 4HM3B 4TX4A 3CCL3 2AADA 5IG0A 3EN1B 4HM8B 1JB4A 4XDWA 4WFOA 4AKYA 1JNQA 3CCQ3 1BANA 5IENA 2E2UA 1M1K4 2AAEA 3OWSA 1VQP3 1RJOA 2K3DA 2RBIA 4EYCA 5AIFA 1RCKA 4HM4B 3TDGA 1BRJA 4O3VA 2P38A 1BNJA 1SARA 3HX8A 5EEOA 5D81A 3G4S3 2FXTA 3NV0A 1RNBA 1NO3A 1V74A 3LTDA 1VQ83 3NQZA 3KSED 1O7MB 2ML5A 4FCZA 2JQ5A 5IF6A 1O7WB 5JPUA 2CKFB 4R4KA 3CC43 1K8A4 1PU4A 2W2CA 2YX9A 3CCR3 3PGBA 2GEXA 4QWTA 5DRVA 1MWSA 3EBYA 1FGTA 3HI7A 1M9GA 1LNIA 1CYUA 1BOXA 1RHLA 1TRQA 4FMCA 1I2FA 1HU9A 1CYVA 1T3BA 2HMKB 2BMOB 1Q9EA 8CHOA 4BIRA 1D6YA 3NQYA 2SARA 3U97A 4ILFA 2CWUA 2HMMB 3FSDA 1KWIA 4EBGA 3X41A 1IU7A 3UJMA 1W6CA 1O7GB 4MMXB 4AEQA 1UUVB 1JJ22 3FCSB 2C11A 3WA2X 1U8CB 3T8NA 5IERA 3SX1A 1LOWA 1JKGA 4IPBA 3CC73 1FW7A 1I70A 1VQK3 2SBLA 5G1KA 2OOVA 2CWTA 2HOHA 1DVCA 3MHEA 1UI8A 2CK3H 7GSPA 5M18A 3G8ZA 1YJ93 2F98A 3DGMA 1N5HA 1IT7A 3X3XA 1O7HB 3V99A 5JPPA 1WTHA 3EC9A 2W56B 3GZYB 2ZHXB 2LQVA 1QVF2 1GD4A 3STDA 1ISKA 1SJWA 2O3OA 1JRQA 2KCDA 2OTJ3 1YI23 1OF5A 4EV5A 3DZLA 1JB5A 3BNCA 5ELUA 1JBRA 1T5YA 1OGZA 1W6GA 1IK3A 1TFKA 3V92A 3IJEB 1BU4A 1W7CA 2WO0A 7STDA 1B2MA 9RNTA 3ALAA 2OCTA 4GL6A 1A90A 1D6UA 3GZBA 1ROAA 5A0OB 2M7OA 3PCSA 3BU4A 2FNQA 4H3UA 1LRAA 1BVIA 1WMOA 2BHMA 3BIRA 1FGMA 1B3SA 1IVWA 3EHCA 3FKAA 3FZWA 3RGAA 1JN5A 3ROBA 1VQN3 1LQMB 1BRSA 1QAFA 3F14A 3Q3FA 4N6OB 3N9HA 4ORLA 1GYBA 1GS3A 2CX1A 3PZWA 1YVBI 2MC8A 1VQM3 2UX0A 3ZG5A 3UNLA 2HMJB 1N8R4 1X1WA 1ZO2A 4KFEA 1YJW3 3KSPA 3T0UA 1UW1A 1QVG2 2F5WA 1HZ1A 1WQLB 3S67A 1Q814 4CPKA 4N6MA 3UB1A 1NB5I 1IVUA 6RNTA 3K63A 1UUWB 3LTAA 2R4IA 1RN4A 4IIAA 3CCM3 1VQ53 2IUJA 1B2SA 1BNFA 1EG9B 2ZL8A 3JUPA 1IV9A 3OWUA 4WYKA 1DVDA 1FGQA 2P09A 3EE1A 4XBTA 1PY3A 1RTUA 1FA3A 4LYLB 1Q40A 2IUKA 2B1XB 4R9KA 1I2GA 1C7HA 2E2TA 1N5PA 1E97A 1LOVA 2L1SA 1BSBA 3HZPA 4J5GA 1VZZA 5IG3A 1BNIA 4FCMA 4LSOA 1JZOA 2BMQB 3VF1A 3N8BA 3K5TA 2BT3A 2CFKA 1IVXA 1OF5B 2WGQA 4RNTA 1WNHA 2P0MA 2E2VA 1QALA 3FLJA 2YFJB 2OOVC 2RFRA 4LEHA 2Z7AA 1RNTA 2F99A 1LVNA 3JUMA 4FCJA 2B24B 3DGOA 3FGYA 3MG2A 1HKXA 1IVVA 3NBBA 1CQSA 2D42A 2WOFA 1LXEA 5M19A 2H0GA 1DMQA 2C4BA 2XGNA 3ER7A 1FYSA 3IPTA 2INXA 3MSOA 4KFFA 2V1LA 4Q53A 1OACA 4R80A 1SIIA 2W56A 3BB9A 1A67A 1JN5B 2XFSA 2CIUA 2IYJA 3UL5A 1VQQA 1L5GB 1CEWI 1FGOA 2KF4A 2KAAA 1Q824 2W0QA 1GY5A 3V98A 1KQS2 4N6NB 5AYSC 3KKGA 4FMAA 1MWRA 1FUWA 2XGLA 2W6JH 3B8LA 4XDVA 4BU4A 4FR9A 4KZ1A 1RRHA 1BRHA 2BNGA 4NREA 1ULIB 1KC84 4WWUC 3CPW2 1RGEA 2XFTA 1IQ8A 1IQXA 1U5OA 1W6YA 1BRGA 1UDII 2CFDA 2WGOA 3DH2A 3NHXA 2OQEA 5KP4A 4CJNA 3HIIA 4GB5A 1I3FA 3RNTA 3LXUX 4WYKB 1STFI 5AIIA 1M1XB 3CNXA 3DY5A 3G713 1F8NA 4WHAA 3F8XA 4RZMA 1JV2B 1DYUA 1Q40B 2Y74A 1O7NB 2HMOB 2GU1A 2OWPA 1ROVA 1YHQ3 3N54B 4HBRA 1AR0A 2XR8B 4L7KA 4N3VA 5LC7A 2Y73A 4NPBA 4HM6B 1BNSA 1OHPA 4RNZA 3S29A 1FUTA 1QAKA 3I553 1M904 1IDPA 1RGAA 1GMPA 1BSAA 1Q7Y4 5IG4A 3FG4A 3WODG 3M8CA 3K0ZA 4R9LA 3DXOA 3AMOA 2RSXA 3D4AA 6STDA 1AQZA 3LOYA 5LC6A 1BNRA 4EXRA 3CCE3 1TU5A 2GBWB 1TP6A 1A2KA 3UL6A 1RGHA 5BIRA 3BNDA 4J5KA 5IG5A 4HYZA 5RNTA 3LMLA 3SEDA 1G96A 3LT8A 3JUQA 3PXMA 1I3IA 4N6LA 1B2ZA 3BNBA 1GOYA 3AHWA 3QK9A 1DETA 1RCLA 3KFQC 1EUIC 4LZIA 1MOLA 1OPYA 2CG1A 5CF1A 1DMNA 3H51A 4FMBA 1WMPA 1S723 2O9UX 2H0IA 2Z6BA 4BTYA 1BIRA 1BSEA 3JUOA 3MG1A 4RNYA 3AHSA 2CFWA 2P0XA 3I0YA 1BUQA 1TRPA 3EQQB 4NHFA 5D82A 3D79A 5M1AA 1Q7HA 2JDIH 3SOAA 1BRIA 3GZRA 4K61A 3CNMA 5TGNA 4HAAA 1LOYA 1QMAA 2YFLB 2GEYA 1GD3A 2HMLB 3T8UA 5CF2A 3WA3A 2QIYA 1OGXA 1N8QA 1RGKA 3WHOA 4HZBB 3NM7A 1X1YA 1UCKA 3LTBA 1E3VA 2PNCA 1KSIA 4HM5B 1G0TA 4XM4A 1YJN3 4K1VA 1K41A 1BRNL 1NJI4 5KP1A 1V58A 2A15A 2OQEC 1UI7A 1VQO3 4JF8A 3CME3 4O8SA 1W2ZA 1AVLA 3CCU3 1ZS7A 1UCLA 3Q2PA 4PEJA 4MJDA 3ZFZA 3GZXB 5JBSA 2CW9A 2KF3A 3AMOB 3URPA 2OTL3 5AIHA 4STDA 1GMRA 3CU3A 3HIGA 3DM8A 2QEX3 3BLZA 3LZAA 3OXAA 4L8PA 4XBYA 3SVAA 3I563 1IYYA 3KN4A 1Q42A 2CHCA 4MMYB 1YGWA 3X3ZA 5G1LA 2Z77A 3CCJ3 3DGLA 5D83A 5HGRA 1IT8A 1K734 4DKIA 1O7PB 1T2IA 1E3RA 1OCVA 3D3LA 1D6ZA 1NNVA 3EBTA 3MPHA 1Z1SA 1YGEA 4EW5A 5AIGA 1BSCA 3NXJA 1FGRA 1EA2A 1HYFA 1B2XA 1VQ93 2ML6A 3WR2A 3S28A 1ASKA 5AEWB 3CCS3 3ZG0A 3CD63 4U13A 1BAOA 1RGLA 2D1WA 5CXOA 1B2UA 3CCV3 3FG1A 5AYRB 2GXFA 1I8VA 2BIRA 3WMDA 4N6UA 1VQ73 3LT9A 3EN8A 3H3HA 2XRXB 1RKYA 1MWTA 2F4YA 1TFOA 3MKIA 2MF7A 3Q90A 3NBJA 1PYLA 1IQYA 3KE7A 1RSNA 2FGTA 5HOHA 5IW9A 2BO9B 1B27A 1BRKA 1GOUA 2GSPA 1I2EA 2XH9A 3PYJA 3GSPA 4R1KA 1Y4KA 1IV7A 4HM7B 1YVSA 2C10A 4BTWA 1BNGA 3U1WA 2I9WA 1NB3I 1CH0A 1OH0A 1ULJB 4XB5A 4EC6A 4X2HA 6GSPA 2W04A 1MWUA 1W5ZA 3G16A 5FGOA 4AKZA 5KP3A 1BGSA 1TUHA 3OW22 2KF6A 3GAXA 1JB2A 1RGGA 2BMRB 4N6TA 1I0VA 2RCDA 3FF2A 2Q07A 2J8XB 2XSHB 3VSYA 3K7CA 1RGFA 5IEPA 1YIT3 1VQ43 2ZDJA 4LMIA 1GMQA 1RGCA 3GWRA 1N9JA 3A5EA 5I97A 4G1MB 1W00A 4GSPA 1W01A 4L8OA 3PCRA 2RGQA 3MG3A 4GHOA 5EQLA 1B21A 1GSPA 3SLUA 2STDA 2W9PA 1ZGXA 3O8YA 1W02A 3DGNA 1BSDA 2XEPA 5IEOA 1X1XA 3FF0A 1LOXA 3AGNA 3DGYA 4BL3A 5BU4A 3PS8A 2CG0A 1MGWA 3JVCA 3S27A 3SXXA 7RNTA 1VQL3 1BNEA 2QGUA 3KIIA 3B4OA 1A2PA 1YIJ3 2HMNB 3RDEA 3G6E3 4OVMA 2PZVA 3HOHA 3D9RA 4WP5A 2CC3A 1YNVX 3RGRA 4KVHA 3WDGB 3X42A 1DMMA 1SIHA 4O02B 2IY2A 3ECFA 3KZTA 1AVKA 1UUGB 2L4VA 1OHOA 1MNLA 1PFPA 4I4KA 2W03A 3K9MC 1RRLA 4J8TA 2GBXB 1VQ63 1AY7A 5FW5A 4ZM8A 2K0MA 1I0XA 3F9SA 1DE3A 2GU3A 2R41A 5STDA 1SQWA 3MYTA 1Q864 2W9QA 2CFLA 4OK0A 3EB8A 3WOFB 1BUJA 3B7CA 3CC23 1NWWA 1V57A 2CFGA 1WMNA 1LQGC 4OUQA 4IT7A 1FUSA 4HJLB 3FG3A 4FMDA 3JUNA 3CXC2 4H61A 4KFDA 1X1UA 2YFIB 3F8HA 5EVHA 3A76A 3OWYA 1TTOA 1TIJA 4XBXA 3NX0A 3AGOA 3NBRA 3F40A 1NDOB 3G0KA 3X3YA 2KRTA 1N9EA 3WOEB 3QRDA 1QJGA 5BVBA 2QA43 2BU4A 4X2OA 4HM0B 3Q1CA 1W4NA 3NV0B 4MEIA 2UUGC 3EX9A 3X40A 1K9M4 1A2VA 3D5IA 1OHSA 1TJDA 3FH1A 1W2B2 2Z76A 4K1UA 3D5GA 1GOVA 1UGIA 1K28A 1RN7A 1SPUA 2KF5A 2WOHA 1S5AA 1RMSA 4JRFA 1STDA 1RDSA 4HOHA 2F56A 1JBSA 4O2HA 2F5MA 1UCIA 1FZUA 3KCHA 3VGNA 1KD14 1EKMA 1US1A 1LNHA 1EEJA 1GY7A 3OX9A 3F7XA 2IMJA 3F7SA 5DREA 4MMZB 2XSOB 4CDLA 1UCJA 5CK6A 3SYUA 2CH9A 3L0RA 5CLKA 4HM2B 2CWVA 5BXQA 3LH4A 2P05A 1RLSA 1NU3A 3DMCA 5AI1A 1MGRA 4KT3B 4HKVB 3SOYA 1JKGB 3LYGA 4K90B 4HZ9B 3EJVA 2ZA4A 4J9AA 4BTXA 4RBNA 1G02A 2LYXA 3B4PA 5AEUB 1B20A 1R4YA 3DUKA 2CX0A
chains in the Genus database with same CATH topology
2IA7A 3GRDA 2XF3A 2F86B 3S5CA 1ZX2A 5ELJA 4N6V0 1EQKA 3J7Yd 1AV4A 1R4CA 2KXGA 3BNEA 3NUVA 4HVNA 3NM2A 1GY6A 2K54A 4CCVA 3HK4A 1OUNA 3E99A 3EF8A 4EV2A 3OV4A 3CMA3 4HM1B 4LGQA 3MWZA 3CPOA 3LTCA 3IMAB 5G2GA 4HM3B 4TX4A 3CCL3 5IG0A 3EN1B 4HM8B 1JB4A 4XDWA 4WFOA 4AKYA 1JNQA 3CCQ3 5IENA 2E2UA 1M1K4 3OWSA 1VQP3 1RJOA 4EYCA 5AIFA 4HM4B 3TDGA 4O3VA 2P38A 5EEOA 3HX8A 5D81A 3G4S3 2FXTA 3NV0A 1NO3A 1V74A 3LTDA 1VQ83 3NQZA 3KSED 1O7MB 2ML5A 4FCZA 2JQ5A 5IF6A 1O7WB 5JPUA 2CKFB 4R4KA 3CC43 1K8A4 1PU4A 2W2CA 2YX9A 3CCR3 3PGBA 2GEXA 4QWTA 5DRVA 3EBYA 1FGTA 3HI7A 1M9GA 1CYUA 4FMCA 1HU9A 1CYVA 2HMKB 2BMOB 8CHOA 1D6YA 3NQYA 3U97A 2CWUA 2HMMB 3FSDA 1KWIA 4EBGA 3X41A 1IU7A 3UJMA 1W6CA 1O7GB 4MMXB 4AEQA 1UUVB 1JJ22 3FCSB 2C11A 3WA2X 1U8CB 3T8NA 5IERA 3SX1A 1JKGA 4IPBA 3CC73 1VQK3 2SBLA 2OOVA 2CWTA 1DVCA 3MHEA 1UI8A 2CK3H 3G8ZA 1YJ93 2F98A 3DGMA 1N5HA 1IT7A 3X3XA 1O7HB 3V99A 5JPPA 1WTHA 3EC9A 2W56B 3GZYB 2LQVA 1QVF2 1GD4A 3STDA 1ISKA 1SJWA 2O3OA 1JRQA 2KCDA 2OTJ3 1YI23 1OF5A 4EV5A 3DZLA 1JB5A 3BNCA 5ELUA 1T5YA 1OGZA 1W6GA 1IK3A 1TFKA 3V92A 3IJEB 1W7CA 2WO0A 7STDA 3ALAA 2OCTA 4GL6A 1A90A 1D6UA 3GZBA 1ROAA 5A0OB 2M7OA 3PCSA 2FNQA 4H3UA 1WMOA 2BHMA 3EHCA 3FZWA 1FGMA 3FKAA 1IVWA 3RGAA 3ROBA 1JN5A 1VQN3 4N6OB 3F14A 1QAFA 4ORLA 3N9HA 1GYBA 1GS3A 3PZWA 1YVBI 2MC8A 1VQM3 2UX0A 3UNLA 2HMJB 1N8R4 1ZO2A 4KFEA 1YJW3 3KSPA 3T0UA 1UW1A 1QVG2 1WQLB 3S67A 1Q814 4N6MA 3UB1A 1NB5I 1IVUA 3K63A 1UUWB 3LTAA 2R4IA 4IIAA 3CCM3 1VQ53 2IUJA 3JUPA 1EG9B 2ZL8A 3OWUA 1IV9A 4WYKA 1DVDA 1FGQA 2P09A 3EE1A 4XBTA 1FA3A 1Q40A 2IUKA 2B1XB 4R9KA 1C7HA 2E2TA 1N5PA 1E97A 3HZPA 5IG3A 1VZZA 4FCMA 4LSOA 2BMQB 3VF1A 3N8BA 3K5TA 2BT3A 2CFKA 1IVXA 1OF5B 2WGQA 1WNHA 2P0MA 2E2VA 1QALA 3FLJA 2YFJB 2OOVC 2RFRA 4LEHA 2Z7AA 2F99A 4FCJA 1LVNA 3JUMA 2B24B 3DGOA 3FGYA 3MG2A 1HKXA 1IVVA 3NBBA 1CQSA 2D42A 2WOFA 1LXEA 4KFFA 1DMQA 2XGNA 3ER7A 3IPTA 3MSOA 4Q53A 2INXA 4R80A 3RGRA 2V1LA 1OACA 1SIIA 2W56A 3BB9A 1A67A 1JN5B 2XFSA 2CIUA 3UL5A 1L5GB 1CEWI 1FGOA 1Q824 2W0QA 1GY5A 3V98A 1KQS2 4N6NB 5AYSC 3KKGA 4FMAA 1FUWA 2XGLA 2W6JH 3B8LA 4XDVA 4FR9A 4KZ1A 1RRHA 2BNGA 4NREA 1ULIB 1KC84 4WWUC 3CPW2 2XFTA 1IQ8A 1IQXA 1U5OA 1W6YA 2WGOA 3NHXA 2CFDA 2OQEA 5KP4A 3HIIA 4GB5A 3LXUX 4WYKB 1STFI 5AIIA 1M1XB 3CNXA 3DY5A 3G713 1F8NA 4WHAA 3F8XA 4RZMA 1JV2B 1DYUA 1Q40B 2Y74A 1O7NB 2HMOB 2GU1A 2OWPA 1ROVA 1YHQ3 3N54B 4HBRA 1AR0A 2XR8B 4L7KA 4N3VA 5LC7A 2Y73A 4HM6B 1OHPA 4RNZA 3S29A 1QAKA 3I553 1M904 1IDPA 1Q7Y4 5IG4A 3FG4A 3WODG 3M8CA 3K0ZA 4R9LA 3DXOA 3AMOA 2RSXA 6STDA 5LC6A 3LOYA 4EXRA 3CCE3 1TU5A 2GBWB 1TP6A 1A2KA 3UL6A 3BNDA 5IG5A 4HYZA 3LMLA 3SEDA 1G96A 3LT8A 3JUQA 3PXMA 4N6LA 3BNBA 3QK9A 3KFQC 4LZIA 1MOLA 1OPYA 2CG1A 5CF1A 1DMNA 3H51A 4FMBA 1WMPA 1S723 2O9UX 2Z6BA 4BTYA 3JUOA 3MG1A 4RNYA 2CFWA 2P0XA 3I0YA 1BUQA 3EQQB 4NHFA 5D82A 3SOAA 2JDIH 3GZRA 4K61A 3CNMA 5TGNA 1QMAA 2YFLB 2GEYA 1GD3A 2HMLB 3T8UA 5CF2A 3WA3A 2QIYA 1OGXA 1N8QA 4HZBB 3NM7A 3LTBA 1E3VA 2PNCA 1KSIA 4HM5B 4XM4A 1YJN3 4K1VA 1K41A 1NJI4 5KP1A 2A15A 2OQEC 1UI7A 1VQO3 4JF8A 3CME3 4O8SA 1W2ZA 1AVLA 3CCU3 3Q2PA 4PEJA 4MJDA 3GZXB 5JBSA 2CW9A 3AMOB 2OTL3 5AIHA 4STDA 3CU3A 3HIGA 3DM8A 2QEX3 3BLZA 3LZAA 3OXAA 4L8PA 4XBYA 3SVAA 3I563 3KN4A 1Q42A 2CHCA 4MMYB 3CCJ3 3X3ZA 2Z77A 3DGLA 5D83A 5HGRA 1IT8A 1K734 1O7PB 1E3RA 1OCVA 3D3LA 1D6ZA 3EBTA 3MPHA 1Z1SA 1YGEA 5AIGA 3NXJA 1FGRA 1EA2A 1VQ93 2ML6A 3S28A 1ASKA 5AEWB 3CCS3 3CD63 4U13A 2D1WA 5CXOA 3CCV3 3FG1A 5AYRB 2GXFA 3WMDA 4N6UA 1VQ73 3LT9A 3EN8A 3H3HA 2XRXB 1RKYA 1TFOA 3MKIA 2MF7A 3Q90A 3NBJA 1IQYA 3KE7A 2FGTA 5IW9A 2BO9B 2XH9A 3PYJA 4R1KA 1Y4KA 1IV7A 4HM7B 2C10A 4BTWA 3U1WA 2I9WA 1NB3I 1ULJB 1OH0A 4XB5A 4EC6A 4X2HA 2W04A 1W5ZA 3G16A 5FGOA 4AKZA 5KP3A 1TUHA 3OW22 3GAXA 1JB2A 2BMRB 4N6TA 2RCDA 3FF2A 2Q07A 2XSHB 3VSYA 3K7CA 5IEPA 1YIT3 1VQ43 2ZDJA 4LMIA 3GWRA 1N9JA 5I97A 4G1MB 1W00A 1W01A 4L8OA 3PCRA 2RGQA 3MG3A 5EQLA 3SLUA 2STDA 2W9PA 3O8YA 1W02A 3DGNA 5IEOA 2XEPA 3FF0A 1LOXA 3PS8A 2CG0A 3JVCA 3SXXA 3S27A 1VQL3 2QGUA 3KIIA 3B4OA 1YIJ3 2HMNB 3RDEA 3G6E3 4OVMA 2PZVA 4WP5A 3D9RA 2CC3A 4KVHA 3WDGB 3X42A 1DMMA 1SIHA 4O02B 3ECFA 3KZTA 2L4VA 1AVKA 1OHOA 1MNLA 1PFPA 4I4KA 2W03A 3K9MC 1RRLA 4J8TA 2GBXB 1VQ63 5FW5A 4ZM8A 2K0MA 3F9SA 2GU3A 1Q864 5STDA 1SQWA 3MYTA 2W9QA 2CFLA 4OK0A 3EB8A 3WOFB 3B7CA 3CC23 1NWWA 2CFGA 1WMNA 4OUQA 4IT7A 4HJLB 3FG3A 4FMDA 3JUNA 3CXC2 4H61A 4KFDA 2YFIB 3F8HA 5EVHA 3A76A 3OWYA 1TIJA 4XBXA 3NX0A 3NBRA 3F40A 1NDOB 3G0KA 3X3YA 2KRTA 1N9EA 3WOEB 3QRDA 1QJGA 5BVBA 2QA43 4X2OA 4HM0B 3Q1CA 1W4NA 3NV0B 4MEIA 3EX9A 3X40A 1K9M4 1A2VA 1OHSA 1W2B2 3FH1A 2Z76A 4K1UA 1K28A 1RN7A 1SPUA 2WOHA 4JRFA 1S5AA 1STDA 4O2HA 3VGNA 1KD14 1EKMA 1US1A 1LNHA 3OX9A 1GY7A 5DREA 3F7XA 2IMJA 3F7SA 4MMZB 2XSOB 4CDLA 5CK6A 2CH9A 3L0RA 5CLKA 4HM2B 2CWVA 5BXQA 3LH4A 2P05A 1NU3A 3DMCA 5AI1A 4HKVB 3SOYA 1JKGB 3LYGA 4K90B 4HZ9B 3EJVA 4J9AA 4BTXA 4RBNA 2LYXA 3B4PA 5AEUB 3DUKA 1J2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R80 A; 
#chains in the Genus database with same CATH topology
 2IA7 A;  3GRD A;  2XF3 A;  2F86 B;  3S5C A;  1ZX2 A;  5ELJ A;  4N6V 0;  1EQK A;  3J7Y d;  1T2H A;  1AV4 A;  1R4C A;  2KXG A;  3BNE A;  3NUV A;  2RNT A;  4HVN A;  3NM2 A;  1GY6 A;  2K54 A;  4CCV A;  1J2B A;  1C54 A;  1RN1 A;  3HK4 A;  1OUN A;  3E99 A;  3EF8 A;  1UGH I;  4EV2 A;  3OV4 A;  3CMA 3;  2UGI A;  5GSP A;  8RNT A;  4HM1 B;  4BL2 A;  4LGQ A;  1JBT A;  3MWZ A;  1JZD A;  2H0H A;  4I5Q A;  3CPO A;  3LTC A;  3IMA B;  5G2G A;  4HM3 B;  4TX4 A;  3CCL 3;  2AAD A;  5IG0 A;  3EN1 B;  4HM8 B;  1JB4 A;  4XDW A;  4WFO A;  4AKY A;  1JNQ A;  3CCQ 3;  1BAN A;  5IEN A;  2E2U A;  1M1K 4;  2AAE A;  3OWS A;  1VQP 3;  1RJO A;  2K3D A;  2RBI A;  4EYC A;  5AIF A;  1RCK A;  4HM4 B;  3TDG A;  1BRJ A;  4O3V A;  2P38 A;  1BNJ A;  1SAR A;  3HX8 A;  5EEO A;  5D81 A;  3G4S 3;  2FXT A;  3NV0 A;  1RNB A;  1NO3 A;  1V74 A;  3LTD A;  1VQ8 3;  3NQZ A;  3KSE D;  1O7M B;  2ML5 A;  4FCZ A;  2JQ5 A;  5IF6 A;  1O7W B;  5JPU A;  2CKF B;  4R4K A;  3CC4 3;  1K8A 4;  1PU4 A;  2W2C A;  2YX9 A;  3CCR 3;  3PGB A;  2GEX A;  4QWT A;  5DRV A;  1MWS A;  3EBY A;  1FGT A;  3HI7 A;  1M9G A;  1LNI A;  1CYU A;  1BOX A;  1RHL A;  1TRQ A;  4FMC A;  1I2F A;  1HU9 A;  1CYV A;  1T3B A;  2HMK B;  2BMO B;  1Q9E A;  8CHO A;  4BIR A;  1D6Y A;  3NQY A;  2SAR A;  3U97 A;  4ILF A;  2CWU A;  2HMM B;  3FSD A;  1KWI A;  4EBG A;  3X41 A;  1IU7 A;  3UJM A;  1W6C A;  1O7G B;  4MMX B;  4AEQ A;  1UUV B;  1JJ2 2;  3FCS B;  2C11 A;  3WA2 X;  1U8C B;  3T8N A;  5IER A;  3SX1 A;  1LOW A;  1JKG A;  4IPB A;  3CC7 3;  1FW7 A;  1I70 A;  1VQK 3;  2SBL A;  5G1K A;  2OOV A;  2CWT A;  2HOH A;  1DVC A;  3MHE A;  1UI8 A;  2CK3 H;  7GSP A;  5M18 A;  3G8Z A;  1YJ9 3;  2F98 A;  3DGM A;  1N5H A;  1IT7 A;  3X3X A;  1O7H B;  3V99 A;  5JPP A;  1WTH A;  3EC9 A;  2W56 B;  3GZY B;  2ZHX B;  2LQV A;  1QVF 2;  1GD4 A;  3STD A;  1ISK A;  1SJW A;  2O3O A;  1JRQ A;  2KCD A;  2OTJ 3;  1YI2 3;  1OF5 A;  4EV5 A;  3DZL A;  1JB5 A;  3BNC A;  5ELU A;  1JBR A;  1T5Y A;  1OGZ A;  1W6G A;  1IK3 A;  1TFK A;  3V92 A;  3IJE B;  1BU4 A;  1W7C A;  2WO0 A;  7STD A;  1B2M A;  9RNT A;  3ALA A;  2OCT A;  4GL6 A;  1A90 A;  1D6U A;  3GZB A;  1ROA A;  5A0O B;  2M7O A;  3PCS A;  3BU4 A;  2FNQ A;  4H3U A;  1LRA A;  1BVI A;  1WMO A;  2BHM A;  3BIR A;  1FGM A;  1B3S A;  1IVW A;  3EHC A;  3FKA A;  3FZW A;  3RGA A;  1JN5 A;  3ROB A;  1VQN 3;  1LQM B;  1BRS A;  1QAF A;  3F14 A;  3Q3F A;  4N6O B;  3N9H A;  4ORL A;  1GYB A;  1GS3 A;  2CX1 A;  3PZW A;  1YVB I;  2MC8 A;  1VQM 3;  2UX0 A;  3ZG5 A;  3UNL A;  2HMJ B;  1N8R 4;  1X1W A;  1ZO2 A;  4KFE A;  1YJW 3;  3KSP A;  3T0U A;  1UW1 A;  1QVG 2;  2F5W A;  1HZ1 A;  1WQL B;  3S67 A;  1Q81 4;  4CPK A;  4N6M A;  3UB1 A;  1NB5 I;  1IVU A;  6RNT A;  3K63 A;  1UUW B;  3LTA A;  2R4I A;  1RN4 A;  4IIA A;  3CCM 3;  1VQ5 3;  2IUJ A;  1B2S A;  1BNF A;  1EG9 B;  2ZL8 A;  3JUP A;  1IV9 A;  3OWU A;  4WYK A;  1DVD A;  1FGQ A;  2P09 A;  3EE1 A;  4XBT A;  1PY3 A;  1RTU A;  1FA3 A;  4LYL B;  1Q40 A;  2IUK A;  2B1X B;  4R9K A;  1I2G A;  1C7H A;  2E2T A;  1N5P A;  1E97 A;  1LOV A;  2L1S A;  1BSB A;  3HZP A;  4J5G A;  1VZZ A;  5IG3 A;  1BNI A;  4FCM A;  4LSO A;  1JZO A;  2BMQ B;  3VF1 A;  3N8B A;  3K5T A;  2BT3 A;  2CFK A;  1IVX A;  1OF5 B;  2WGQ A;  4RNT A;  1WNH A;  2P0M A;  2E2V A;  1QAL A;  3FLJ A;  2YFJ B;  2OOV C;  2RFR A;  4LEH A;  2Z7A A;  1RNT A;  2F99 A;  1LVN A;  3JUM A;  4FCJ A;  2B24 B;  3DGO A;  3FGY A;  3MG2 A;  1HKX A;  1IVV A;  3NBB A;  1CQS A;  2D42 A;  2WOF A;  1LXE A;  5M19 A;  2H0G A;  1DMQ A;  2C4B A;  2XGN A;  3ER7 A;  1FYS A;  3IPT A;  2INX A;  3MSO A;  4KFF A;  2V1L A;  4Q53 A;  1OAC A;  4R80 A;  1SII A;  2W56 A;  3BB9 A;  1A67 A;  1JN5 B;  2XFS A;  2CIU A;  2IYJ A;  3UL5 A;  1VQQ A;  1L5G B;  1CEW I;  1FGO A;  2KF4 A;  2KAA A;  1Q82 4;  2W0Q A;  1GY5 A;  3V98 A;  1KQS 2;  4N6N B;  5AYS C;  3KKG A;  4FMA A;  1MWR A;  1FUW A;  2XGL A;  2W6J H;  3B8L A;  4XDV A;  4BU4 A;  4FR9 A;  4KZ1 A;  1RRH A;  1BRH A;  2BNG A;  4NRE A;  1ULI B;  1KC8 4;  4WWU C;  3CPW 2;  1RGE A;  2XFT A;  1IQ8 A;  1IQX A;  1U5O A;  1W6Y A;  1BRG A;  1UDI I;  2CFD A;  2WGO A;  3DH2 A;  3NHX A;  2OQE A;  5KP4 A;  4CJN A;  3HII A;  4GB5 A;  1I3F A;  3RNT A;  3LXU X;  4WYK B;  1STF I;  5AII A;  1M1X B;  3CNX A;  3DY5 A;  3G71 3;  1F8N A;  4WHA A;  3F8X A;  4RZM A;  1JV2 B;  1DYU A;  1Q40 B;  2Y74 A;  1O7N B;  2HMO B;  2GU1 A;  2OWP A;  1ROV A;  1YHQ 3;  3N54 B;  4HBR A;  1AR0 A;  2XR8 B;  4L7K A;  4N3V A;  5LC7 A;  2Y73 A;  4NPB A;  4HM6 B;  1BNS A;  1OHP A;  4RNZ A;  3S29 A;  1FUT A;  1QAK A;  3I55 3;  1M90 4;  1IDP A;  1RGA A;  1GMP A;  1BSA A;  1Q7Y 4;  5IG4 A;  3FG4 A;  3WOD G;  3M8C A;  3K0Z A;  4R9L A;  3DXO A;  3AMO A;  2RSX A;  3D4A A;  6STD A;  1AQZ A;  3LOY A;  5LC6 A;  1BNR A;  4EXR A;  3CCE 3;  1TU5 A;  2GBW B;  1TP6 A;  1A2K A;  3UL6 A;  1RGH A;  5BIR A;  3BND A;  4J5K A;  5IG5 A;  4HYZ A;  5RNT A;  3LML A;  3SED A;  1G96 A;  3LT8 A;  3JUQ A;  3PXM A;  1I3I A;  4N6L A;  1B2Z A;  3BNB A;  1GOY A;  3AHW A;  3QK9 A;  1DET A;  1RCL A;  3KFQ C;  1EUI C;  4LZI A;  1MOL A;  1OPY A;  2CG1 A;  5CF1 A;  1DMN A;  3H51 A;  4FMB A;  1WMP A;  1S72 3;  2O9U X;  2H0I A;  2Z6B A;  4BTY A;  1BIR A;  1BSE A;  3JUO A;  3MG1 A;  4RNY A;  3AHS A;  2CFW A;  2P0X A;  3I0Y A;  1BUQ A;  1TRP A;  3EQQ B;  4NHF A;  5D82 A;  3D79 A;  5M1A A;  1Q7H A;  2JDI H;  3SOA A;  1BRI A;  3GZR A;  4K61 A;  3CNM A;  5TGN A;  4HAA A;  1LOY A;  1QMA A;  2YFL B;  2GEY A;  1GD3 A;  2HML B;  3T8U A;  5CF2 A;  3WA3 A;  2QIY A;  1OGX A;  1N8Q A;  1RGK A;  3WHO A;  4HZB B;  3NM7 A;  1X1Y A;  1UCK A;  3LTB A;  1E3V A;  2PNC A;  1KSI A;  4HM5 B;  1G0T A;  4XM4 A;  1YJN 3;  4K1V A;  1K41 A;  1BRN L;  1NJI 4;  5KP1 A;  1V58 A;  2A15 A;  2OQE C;  1UI7 A;  1VQO 3;  4JF8 A;  3CME 3;  4O8S A;  1W2Z A;  1AVL A;  3CCU 3;  1ZS7 A;  1UCL A;  3Q2P A;  4PEJ A;  4MJD A;  3ZFZ A;  3GZX B;  5JBS A;  2CW9 A;  2KF3 A;  3AMO B;  3URP A;  2OTL 3;  5AIH A;  4STD A;  1GMR A;  3CU3 A;  3HIG A;  3DM8 A;  2QEX 3;  3BLZ A;  3LZA A;  3OXA A;  4L8P A;  4XBY A;  3SVA A;  3I56 3;  1IYY A;  3KN4 A;  1Q42 A;  2CHC A;  4MMY B;  1YGW A;  3X3Z A;  5G1L A;  2Z77 A;  3CCJ 3;  3DGL A;  5D83 A;  5HGR A;  1IT8 A;  1K73 4;  4DKI A;  1O7P B;  1T2I A;  1E3R A;  1OCV A;  3D3L A;  1D6Z A;  1NNV A;  3EBT A;  3MPH A;  1Z1S A;  1YGE A;  4EW5 A;  5AIG A;  1BSC A;  3NXJ A;  1FGR A;  1EA2 A;  1HYF A;  1B2X A;  1VQ9 3;  2ML6 A;  3WR2 A;  3S28 A;  1ASK A;  5AEW B;  3CCS 3;  3ZG0 A;  3CD6 3;  4U13 A;  1BAO A;  1RGL A;  2D1W A;  5CXO A;  1B2U A;  3CCV 3;  3FG1 A;  5AYR B;  2GXF A;  1I8V A;  2BIR A;  3WMD A;  4N6U A;  1VQ7 3;  3LT9 A;  3EN8 A;  3H3H A;  2XRX B;  1RKY A;  1MWT A;  2F4Y A;  1TFO A;  3MKI A;  2MF7 A;  3Q90 A;  3NBJ A;  1PYL A;  1IQY A;  3KE7 A;  1RSN A;  2FGT A;  5HOH A;  5IW9 A;  2BO9 B;  1B27 A;  1BRK A;  1GOU A;  2GSP A;  1I2E A;  2XH9 A;  3PYJ A;  3GSP A;  4R1K A;  1Y4K A;  1IV7 A;  4HM7 B;  1YVS A;  2C10 A;  4BTW A;  1BNG A;  3U1W A;  2I9W A;  1NB3 I;  1CH0 A;  1OH0 A;  1ULJ B;  4XB5 A;  4EC6 A;  4X2H A;  6GSP A;  2W04 A;  1MWU A;  1W5Z A;  3G16 A;  5FGO A;  4AKZ A;  5KP3 A;  1BGS A;  1TUH A;  3OW2 2;  2KF6 A;  3GAX A;  1JB2 A;  1RGG A;  2BMR B;  4N6T A;  1I0V A;  2RCD A;  3FF2 A;  2Q07 A;  2J8X B;  2XSH B;  3VSY A;  3K7C A;  1RGF A;  5IEP A;  1YIT 3;  1VQ4 3;  2ZDJ A;  4LMI A;  1GMQ A;  1RGC A;  3GWR A;  1N9J A;  3A5E A;  5I97 A;  4G1M B;  1W00 A;  4GSP A;  1W01 A;  4L8O A;  3PCR A;  2RGQ A;  3MG3 A;  4GHO A;  5EQL A;  1B21 A;  1GSP A;  3SLU A;  2STD A;  2W9P A;  1ZGX A;  3O8Y A;  1W02 A;  3DGN A;  1BSD A;  2XEP A;  5IEO A;  1X1X A;  3FF0 A;  1LOX A;  3AGN A;  3DGY A;  4BL3 A;  5BU4 A;  3PS8 A;  2CG0 A;  1MGW A;  3JVC A;  3S27 A;  3SXX A;  7RNT A;  1VQL 3;  1BNE A;  2QGU A;  3KII A;  3B4O A;  1A2P A;  1YIJ 3;  2HMN B;  3RDE A;  3G6E 3;  4OVM A;  2PZV A;  3HOH A;  3D9R A;  4WP5 A;  2CC3 A;  1YNV X;  3RGR A;  4KVH A;  3WDG B;  3X42 A;  1DMM A;  1SIH A;  4O02 B;  2IY2 A;  3ECF A;  3KZT A;  1AVK A;  1UUG B;  2L4V A;  1OHO A;  1MNL A;  1PFP A;  4I4K A;  2W03 A;  3K9M C;  1RRL A;  4J8T A;  2GBX B;  1VQ6 3;  1AY7 A;  5FW5 A;  4ZM8 A;  2K0M A;  1I0X A;  3F9S A;  1DE3 A;  2GU3 A;  2R41 A;  5STD A;  1SQW A;  3MYT A;  1Q86 4;  2W9Q A;  2CFL A;  4OK0 A;  3EB8 A;  3WOF B;  1BUJ A;  3B7C A;  3CC2 3;  1NWW A;  1V57 A;  2CFG A;  1WMN A;  1LQG C;  4OUQ A;  4IT7 A;  1FUS A;  4HJL B;  3FG3 A;  4FMD A;  3JUN A;  3CXC 2;  4H61 A;  4KFD A;  1X1U A;  2YFI B;  3F8H A;  5EVH A;  3A76 A;  3OWY A;  1TTO A;  1TIJ A;  4XBX A;  3NX0 A;  3AGO A;  3NBR A;  3F40 A;  1NDO B;  3G0K A;  3X3Y A;  2KRT A;  1N9E A;  3WOE B;  3QRD A;  1QJG A;  5BVB A;  2QA4 3;  2BU4 A;  4X2O A;  4HM0 B;  3Q1C A;  1W4N A;  3NV0 B;  4MEI A;  2UUG C;  3EX9 A;  3X40 A;  1K9M 4;  1A2V A;  3D5I A;  1OHS A;  1TJD A;  3FH1 A;  1W2B 2;  2Z76 A;  4K1U A;  3D5G A;  1GOV A;  1UGI A;  1K28 A;  1RN7 A;  1SPU A;  2KF5 A;  2WOH A;  1S5A A;  1RMS A;  4JRF A;  1STD A;  1RDS A;  4HOH A;  2F56 A;  1JBS A;  4O2H A;  2F5M A;  1UCI A;  1FZU A;  3KCH A;  3VGN A;  1KD1 4;  1EKM A;  1US1 A;  1LNH A;  1EEJ A;  1GY7 A;  3OX9 A;  3F7X A;  2IMJ A;  3F7S A;  5DRE A;  4MMZ B;  2XSO B;  4CDL A;  1UCJ A;  5CK6 A;  3SYU A;  2CH9 A;  3L0R A;  5CLK A;  4HM2 B;  2CWV A;  5BXQ A;  3LH4 A;  2P05 A;  1RLS A;  1NU3 A;  3DMC A;  5AI1 A;  1MGR A;  4KT3 B;  4HKV B;  3SOY A;  1JKG B;  3LYG A;  4K90 B;  4HZ9 B;  3EJV A;  2ZA4 A;  4J9A A;  4BTX A;  4RBN A;  1G02 A;  2LYX A;  3B4P A;  5AEU B;  1B20 A;  1R4Y A;  3DUK A;  2CX0 A; 
#chains in the Genus database with same CATH homology
 2IA7 A;  3GRD A;  2XF3 A;  2F86 B;  3S5C A;  1ZX2 A;  5ELJ A;  4N6V 0;  1EQK A;  3J7Y d;  1AV4 A;  1R4C A;  2KXG A;  3BNE A;  3NUV A;  4HVN A;  3NM2 A;  1GY6 A;  2K54 A;  4CCV A;  3HK4 A;  1OUN A;  3E99 A;  3EF8 A;  4EV2 A;  3OV4 A;  3CMA 3;  4HM1 B;  4LGQ A;  3MWZ A;  3CPO A;  3LTC A;  3IMA B;  5G2G A;  4HM3 B;  4TX4 A;  3CCL 3;  5IG0 A;  3EN1 B;  4HM8 B;  1JB4 A;  4XDW A;  4WFO A;  4AKY A;  1JNQ A;  3CCQ 3;  5IEN A;  2E2U A;  1M1K 4;  3OWS A;  1VQP 3;  1RJO A;  4EYC A;  5AIF A;  4HM4 B;  3TDG A;  4O3V A;  2P38 A;  5EEO A;  3HX8 A;  5D81 A;  3G4S 3;  2FXT A;  3NV0 A;  1NO3 A;  1V74 A;  3LTD A;  1VQ8 3;  3NQZ A;  3KSE D;  1O7M B;  2ML5 A;  4FCZ A;  2JQ5 A;  5IF6 A;  1O7W B;  5JPU A;  2CKF B;  4R4K A;  3CC4 3;  1K8A 4;  1PU4 A;  2W2C A;  2YX9 A;  3CCR 3;  3PGB A;  2GEX A;  4QWT A;  5DRV A;  3EBY A;  1FGT A;  3HI7 A;  1M9G A;  1CYU A;  4FMC A;  1HU9 A;  1CYV A;  2HMK B;  2BMO B;  8CHO A;  1D6Y A;  3NQY A;  3U97 A;  2CWU A;  2HMM B;  3FSD A;  1KWI A;  4EBG A;  3X41 A;  1IU7 A;  3UJM A;  1W6C A;  1O7G B;  4MMX B;  4AEQ A;  1UUV B;  1JJ2 2;  3FCS B;  2C11 A;  3WA2 X;  1U8C B;  3T8N A;  5IER A;  3SX1 A;  1JKG A;  4IPB A;  3CC7 3;  1VQK 3;  2SBL A;  2OOV A;  2CWT A;  1DVC A;  3MHE A;  1UI8 A;  2CK3 H;  3G8Z A;  1YJ9 3;  2F98 A;  3DGM A;  1N5H A;  1IT7 A;  3X3X A;  1O7H B;  3V99 A;  5JPP A;  1WTH A;  3EC9 A;  2W56 B;  3GZY B;  2LQV A;  1QVF 2;  1GD4 A;  3STD A;  1ISK A;  1SJW A;  2O3O A;  1JRQ A;  2KCD A;  2OTJ 3;  1YI2 3;  1OF5 A;  4EV5 A;  3DZL A;  1JB5 A;  3BNC A;  5ELU A;  1T5Y A;  1OGZ A;  1W6G A;  1IK3 A;  1TFK A;  3V92 A;  3IJE B;  1W7C A;  2WO0 A;  7STD A;  3ALA A;  2OCT A;  4GL6 A;  1A90 A;  1D6U A;  3GZB A;  1ROA A;  5A0O B;  2M7O A;  3PCS A;  2FNQ A;  4H3U A;  1WMO A;  2BHM A;  3EHC A;  3FZW A;  1FGM A;  3FKA A;  1IVW A;  3RGA A;  3ROB A;  1JN5 A;  1VQN 3;  4N6O B;  3F14 A;  1QAF A;  4ORL A;  3N9H A;  1GYB A;  1GS3 A;  3PZW A;  1YVB I;  2MC8 A;  1VQM 3;  2UX0 A;  3UNL A;  2HMJ B;  1N8R 4;  1ZO2 A;  4KFE A;  1YJW 3;  3KSP A;  3T0U A;  1UW1 A;  1QVG 2;  1WQL B;  3S67 A;  1Q81 4;  4N6M A;  3UB1 A;  1NB5 I;  1IVU A;  3K63 A;  1UUW B;  3LTA A;  2R4I A;  4IIA A;  3CCM 3;  1VQ5 3;  2IUJ A;  3JUP A;  1EG9 B;  2ZL8 A;  3OWU A;  1IV9 A;  4WYK A;  1DVD A;  1FGQ A;  2P09 A;  3EE1 A;  4XBT A;  1FA3 A;  1Q40 A;  2IUK A;  2B1X B;  4R9K A;  1C7H A;  2E2T A;  1N5P A;  1E97 A;  3HZP A;  5IG3 A;  1VZZ A;  4FCM A;  4LSO A;  2BMQ B;  3VF1 A;  3N8B A;  3K5T A;  2BT3 A;  2CFK A;  1IVX A;  1OF5 B;  2WGQ A;  1WNH A;  2P0M A;  2E2V A;  1QAL A;  3FLJ A;  2YFJ B;  2OOV C;  2RFR A;  4LEH A;  2Z7A A;  2F99 A;  4FCJ A;  1LVN A;  3JUM A;  2B24 B;  3DGO A;  3FGY A;  3MG2 A;  1HKX A;  1IVV A;  3NBB A;  1CQS A;  2D42 A;  2WOF A;  1LXE A;  4KFF A;  1DMQ A;  2XGN A;  3ER7 A;  3IPT A;  3MSO A;  4Q53 A;  2INX A;  4R80 A;  3RGR A;  2V1L A;  1OAC A;  1SII A;  2W56 A;  3BB9 A;  1A67 A;  1JN5 B;  2XFS A;  2CIU A;  3UL5 A;  1L5G B;  1CEW I;  1FGO A;  1Q82 4;  2W0Q A;  1GY5 A;  3V98 A;  1KQS 2;  4N6N B;  5AYS C;  3KKG A;  4FMA A;  1FUW A;  2XGL A;  2W6J H;  3B8L A;  4XDV A;  4FR9 A;  4KZ1 A;  1RRH A;  2BNG A;  4NRE A;  1ULI B;  1KC8 4;  4WWU C;  3CPW 2;  2XFT A;  1IQ8 A;  1IQX A;  1U5O A;  1W6Y A;  2WGO A;  3NHX A;  2CFD A;  2OQE A;  5KP4 A;  3HII A;  4GB5 A;  3LXU X;  4WYK B;  1STF I;  5AII A;  1M1X B;  3CNX A;  3DY5 A;  3G71 3;  1F8N A;  4WHA A;  3F8X A;  4RZM A;  1JV2 B;  1DYU A;  1Q40 B;  2Y74 A;  1O7N B;  2HMO B;  2GU1 A;  2OWP A;  1ROV A;  1YHQ 3;  3N54 B;  4HBR A;  1AR0 A;  2XR8 B;  4L7K A;  4N3V A;  5LC7 A;  2Y73 A;  4HM6 B;  1OHP A;  4RNZ A;  3S29 A;  1QAK A;  3I55 3;  1M90 4;  1IDP A;  1Q7Y 4;  5IG4 A;  3FG4 A;  3WOD G;  3M8C A;  3K0Z A;  4R9L A;  3DXO A;  3AMO A;  2RSX A;  6STD A;  5LC6 A;  3LOY A;  4EXR A;  3CCE 3;  1TU5 A;  2GBW B;  1TP6 A;  1A2K A;  3UL6 A;  3BND A;  5IG5 A;  4HYZ A;  3LML A;  3SED A;  1G96 A;  3LT8 A;  3JUQ A;  3PXM A;  4N6L A;  3BNB A;  3QK9 A;  3KFQ C;  4LZI A;  1MOL A;  1OPY A;  2CG1 A;  5CF1 A;  1DMN A;  3H51 A;  4FMB A;  1WMP A;  1S72 3;  2O9U X;  2Z6B A;  4BTY A;  3JUO A;  3MG1 A;  4RNY A;  2CFW A;  2P0X A;  3I0Y A;  1BUQ A;  3EQQ B;  4NHF A;  5D82 A;  3SOA A;  2JDI H;  3GZR A;  4K61 A;  3CNM A;  5TGN A;  1QMA A;  2YFL B;  2GEY A;  1GD3 A;  2HML B;  3T8U A;  5CF2 A;  3WA3 A;  2QIY A;  1OGX A;  1N8Q A;  4HZB B;  3NM7 A;  3LTB A;  1E3V A;  2PNC A;  1KSI A;  4HM5 B;  4XM4 A;  1YJN 3;  4K1V A;  1K41 A;  1NJI 4;  5KP1 A;  2A15 A;  2OQE C;  1UI7 A;  1VQO 3;  4JF8 A;  3CME 3;  4O8S A;  1W2Z A;  1AVL A;  3CCU 3;  3Q2P A;  4PEJ A;  4MJD A;  3GZX B;  5JBS A;  2CW9 A;  3AMO B;  2OTL 3;  5AIH A;  4STD A;  3CU3 A;  3HIG A;  3DM8 A;  2QEX 3;  3BLZ A;  3LZA A;  3OXA A;  4L8P A;  4XBY A;  3SVA A;  3I56 3;  3KN4 A;  1Q42 A;  2CHC A;  4MMY B;  3CCJ 3;  3X3Z A;  2Z77 A;  3DGL A;  5D83 A;  5HGR A;  1IT8 A;  1K73 4;  1O7P B;  1E3R A;  1OCV A;  3D3L A;  1D6Z A;  3EBT A;  3MPH A;  1Z1S A;  1YGE A;  5AIG A;  3NXJ A;  1FGR A;  1EA2 A;  1VQ9 3;  2ML6 A;  3S28 A;  1ASK A;  5AEW B;  3CCS 3;  3CD6 3;  4U13 A;  2D1W A;  5CXO A;  3CCV 3;  3FG1 A;  5AYR B;  2GXF A;  3WMD A;  4N6U A;  1VQ7 3;  3LT9 A;  3EN8 A;  3H3H A;  2XRX B;  1RKY A;  1TFO A;  3MKI A;  2MF7 A;  3Q90 A;  3NBJ A;  1IQY A;  3KE7 A;  2FGT A;  5IW9 A;  2BO9 B;  2XH9 A;  3PYJ A;  4R1K A;  1Y4K A;  1IV7 A;  4HM7 B;  2C10 A;  4BTW A;  3U1W A;  2I9W A;  1NB3 I;  1ULJ B;  1OH0 A;  4XB5 A;  4EC6 A;  4X2H A;  2W04 A;  1W5Z A;  3G16 A;  5FGO A;  4AKZ A;  5KP3 A;  1TUH A;  3OW2 2;  3GAX A;  1JB2 A;  2BMR B;  4N6T A;  2RCD A;  3FF2 A;  2Q07 A;  2XSH B;  3VSY A;  3K7C A;  5IEP A;  1YIT 3;  1VQ4 3;  2ZDJ A;  4LMI A;  3GWR A;  1N9J A;  5I97 A;  4G1M B;  1W00 A;  1W01 A;  4L8O A;  3PCR A;  2RGQ A;  3MG3 A;  5EQL A;  3SLU A;  2STD A;  2W9P A;  3O8Y A;  1W02 A;  3DGN A;  5IEO A;  2XEP A;  3FF0 A;  1LOX A;  3PS8 A;  2CG0 A;  3JVC A;  3SXX A;  3S27 A;  1VQL 3;  2QGU A;  3KII A;  3B4O A;  1YIJ 3;  2HMN B;  3RDE A;  3G6E 3;  4OVM A;  2PZV A;  4WP5 A;  3D9R A;  2CC3 A;  4KVH A;  3WDG B;  3X42 A;  1DMM A;  1SIH A;  4O02 B;  3ECF A;  3KZT A;  2L4V A;  1AVK A;  1OHO A;  1MNL A;  1PFP A;  4I4K A;  2W03 A;  3K9M C;  1RRL A;  4J8T A;  2GBX B;  1VQ6 3;  5FW5 A;  4ZM8 A;  2K0M A;  3F9S A;  2GU3 A;  1Q86 4;  5STD A;  1SQW A;  3MYT A;  2W9Q A;  2CFL A;  4OK0 A;  3EB8 A;  3WOF B;  3B7C A;  3CC2 3;  1NWW A;  2CFG A;  1WMN A;  4OUQ A;  4IT7 A;  4HJL B;  3FG3 A;  4FMD A;  3JUN A;  3CXC 2;  4H61 A;  4KFD A;  2YFI B;  3F8H A;  5EVH A;  3A76 A;  3OWY A;  1TIJ A;  4XBX A;  3NX0 A;  3NBR A;  3F40 A;  1NDO B;  3G0K A;  3X3Y A;  2KRT A;  1N9E A;  3WOE B;  3QRD A;  1QJG A;  5BVB A;  2QA4 3;  4X2O A;  4HM0 B;  3Q1C A;  1W4N A;  3NV0 B;  4MEI A;  3EX9 A;  3X40 A;  1K9M 4;  1A2V A;  1OHS A;  1W2B 2;  3FH1 A;  2Z76 A;  4K1U A;  1K28 A;  1RN7 A;  1SPU A;  2WOH A;  4JRF A;  1S5A A;  1STD A;  4O2H A;  3VGN A;  1KD1 4;  1EKM A;  1US1 A;  1LNH A;  3OX9 A;  1GY7 A;  5DRE A;  3F7X A;  2IMJ A;  3F7S A;  4MMZ B;  2XSO B;  4CDL A;  5CK6 A;  2CH9 A;  3L0R A;  5CLK A;  4HM2 B;  2CWV A;  5BXQ A;  3LH4 A;  2P05 A;  1NU3 A;  3DMC A;  5AI1 A;  4HKV B;  3SOY A;  1JKG B;  3LYG A;  4K90 B;  4HZ9 B;  3EJV A;  4J9A A;  4BTX A;  4RBN A;  2LYX A;  3B4P A;  5AEU B;  3DUK A;  1J2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...