2GEYA

Crystal structure of aclr a putative hydroxylase from streptomyces galilaeus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
SMAERKALCLEMVAAWNRWDLSGIIKHWSPDIVHYSEDNEVSSADMVKLMEGGLKAFPDLQLEVKSIMAEEDRVALRITVTATHQGEFMGVQPTGQRVSWHLVEELRFVDGKVVEHWDVINMRPLLVRLGKLPDVPKVVLEASAKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AclR protein
publication title Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics
pubmed doi rcsb
source organism Streptomyces galilaeus
molecule tags Oxidoreductase
total genus 52
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2geyA00
3T8NA 1S5AA 2GXFA 3EBYA 1E97A 4U13A 1W01A 3GWRA 1Q40A 3SOAA 3JUQA 1JB4A 1Q40B 1BUQA 5HGRA 1W00A 4FCJA 4L8OA 3RGAA 3CPOA 3EN8A 3MYTA 1JB5A 3A76A 5IEOA 3E99A 3F7SA 3F14A 2F99A 2YFLB 3NHXA 4PEJA 2BMRB 3B8LA 5JPUA 1GY7A 3S5CA 4GB5A 4WYKB 2YFIB 4XDWA 2K54A 3LZAA 3F40A 2A15A 3VGNA 3DM8A 1OH0A 1Z1SA 1OF5A 2YFJB 3MSOA 1Q42A 1HKXA 5AIIA 1OHPA 3RGRA 3K0ZA 3BLZA 2JQ5A 3EF8A 4ORLA 2GEYA 1OHOA 5G2GA 3FF0A 4Q53A 2INXA 4HM7B 2BMOB 2OWPA 1W02A 3HK4A 3GRDA 4J9AA 5IG3A 3JUNA 2GBXB 1IDPA 3NBRA 3F8XA 4HM2B 2CHCA 3OWYA 4R9KA 5KP1A 3HX8A 3OV4A 3LYGA 1EA2A 1QJGA 3ROBA 4HM4B 5STDA 5D82A 5D81A 3B4PA 2F86B 3CNMA 6STDA 1GYBA 5IG5A 3EHCA 3FLJA 4L8PA 1C7HA 2HMKB 1ISKA 4HM6B 3STDA 3BB9A 3MHEA 1NDOB 4HM1B 2HMNB 5TGNA 3G16A 3D9RA 4RZMA 1GY6A 1O7PB 5CLKA 4WP5A 1NU3A 3WMDA 2GBWB 2RGQA 4K1VA 2Z77A 3OX9A 3NXJA 4HVNA 3MG1A 3GZBA 3EJVA 4HM0B 3I0YA 2W2CA 1GS3A 3UNLA 4XDVA 4K1UA 4OVMA 3ECFA 1OF5B 1GY5A 3NM2A 2BNGA 1E3VA 4OUQA 4X2HA 3F9SA 3EC9A 5IG0A 3CNXA 3T8UA 4MJDA 1W6YA 4H3UA 3CU3A 4HM5B 2STDA 5KP3A 3H3HA 4R9LA 1JKGA 1JKGB 5KP4A 4J8TA 3NV0A 1JN5A 3FH1A 3Q90A 3FKAA 5CXOA 5CK6A 1U5OA 3EN1B 1OHSA 3JUPA 2RFRA 3GZRA 2HMLB 4XB5A 5BVBA 4HZBB 3DXOA 4LMIA 2PZVA 3MG3A 5BXQA 5AI1A 4LGQA 2HMMB 3EX9A 4HZ9B 4XBXA 1ULIB 5EVHA 3FGYA 3DZLA 3ER7A 3HZPA 1ZX2A 5IERA 2HMOB 2XSOB 2RCDA 5JPPA 1OGXA 1CQSA 4WWUC 1E3RA 1OUNA 1AR0A 1JB2A 4I4KA 4IIAA 5AIGA 3SEDA 1DMNA 1ULJB 5AIFA 3SOYA 1OGZA 3B4OA 3FF2A 1OPYA 2XRXB 4KVHA 1O7HB 1UUWB 1STDA 2CKFB 3KKGA 3DMCA 5IENA 5IF6A 1DMQA 3EQQB 3H51A 1O7MB 1NWWA 4FCMA 3JUMA 4L7KA 3MG2A 3JUOA 3FZWA 2GEXA 3FSDA 1O7NB 3VSYA 3G8ZA 3EBTA 4HJLB 4N3VA 4XBTA 1O7GB 3NUVA 4WYKA 2UX0A 3B7CA 3DUKA 3MKIA 2XSHB 5DREA 1K41A 4HM8B 3KSPA 2B24B 4STDA 3UJMA 2BMQB 5IG4A 3GZXB 2F98A 3F8HA 3M8CA 3G0KA 5IEPA 2QIYA 5D83A 2B1XB 2XR8B 4HM3B 4X2OA 2QGUA 1OCVA 3KZTA 1ASKA 4XM4A 1TP6A 4R1KA 5AEWB 2IMJA 4CDLA 3NV0B 1JN5B 3GZYB 5FW5A 5AEUB 4XBYA 4LEHA 5CF1A 1ZO2A 5AIHA 1QMAA 7STDA 1UUVB 1DMMA 2Z7AA 5CF2A 1WQLB 3K7CA 3IPTA 1TUHA 1EG9B 2R4IA 1SJWA 4HKVB 1VZZA 2I9WA 5DRVA 3OWSA 3F7XA 8CHOA 3OXAA 1A2KA 2HMJB 2Z76A 3KE7A 3OWUA 1O7WB
chains in the Genus database with same CATH superfamily
1RJOA 4WHAA 3FG4A 5M19A 1KD14 1HU9A 1UUGB 5IW9A 3CCL3 2BIRA 3T8NA 2PNCA 2QA43 1S5AA 2GXFA 3EBYA 1IV9A 1E97A 4JF8A 1W01A 4U13A 3GWRA 1S723 3NM7A 3KCHA 1Q40A 3D4AA 3NBBA 3SOAA 5ELUA 4FCZA 1YIT3 2BU4A 2BO9B 3JUQA 1JB4A 1Q40B 1N5HA 3LTAA 1BUQA 5HGRA 1W00A 3LTDA 1GSPA 4FCJA 2IY2A 1YI23 4L8OA 1UGIA 2F5WA 3RGAA 1R4CA 3G713 4HBRA 1G02A 1BNGA 1BRIA 2KAAA 1X1XA 2WOFA 3CPOA 3EN8A 2E2UA 3MYTA 4ZM8A 1T5YA 1JB5A 1BRHA 1BSEA 2ZHXB 3A76A 2CG0A 5IEOA 5EQLA 2OQEA 1VQ43 1MGWA 3E99A 2FXTA 2W6JH 3RNTA 1DYUA 1BGSA 1AQZA 1N8QA 3X3ZA 1I8VA 3F7SA 3CPW2 3F14A 2F99A 2YFLB 4IPBA 3NHXA 2QEX3 1JZOA 1IVWA 1F8NA 1NO3A 1I3IA 2F5MA 3AGOA 3IMAB 1BSAA 1JRQA 4PEJA 2BMRB 3B8LA 5JPUA 3LT8A 1GOUA 1GY7A 1MNLA 3S5CA 4GB5A 4WYKB 2YFIB 4XDWA 1I0VA 4BIRA 1LOVA 4MMYB 2K54A 2BT3A 2KCDA 3F40A 3LZAA 1ROAA 2A15A 3VGNA 2XGNA 3DM8A 4DKIA 3LH4A 2P09A 1RKYA 1RRLA 1OH0A 1B2SA 2XFTA 3LMLA 1Z1SA 1OF5A 1PFPA 2CWUA 1GOVA 2XF3A 5BIRA 1GOYA 3DY5A 1WMNA 4O02B 4KFEA 1VQ93 4BTYA 5LC7A 2GSPA 1QAFA 1K734 2YFJB 1BIRA 1V74A 3FCSB 1EEJA 1YVSA 3HI7A 3HIGA 1BRGA 3MSOA 4LSOA 1Q42A 2CFDA 5I97A 1HKXA 5AIIA 1OHPA 2XGLA 1GD3A 2W56A 1RLSA 1UCIA 1FGMA 3WR2A 1K8A4 3S29A 1RN1A 2W56B 3RGRA 2H0HA 8RNTA 1JBRA 3K0ZA 1QVF2 3BLZA 2JQ5A 2CH9A 2KF5A 3FG1A 3EF8A 1SPUA 3AHWA 3HOHA 3LXUX 3PXMA 1B2MA 1MWUA 5A0OB 1UI7A 2WO0A 4N6OB 4ORLA 1LRAA 2O9UX 1KC84 2AADA 1G0TA 2GEYA 1OHOA 1LOYA 5ELJA 4BTXA 5G2GA 1YIJ3 4EW5A 3FF0A 3X40A 4Q53A 2Q07A 2INXA 4TX4A 3N54B 2BMOB 4HM7B 4EXRA 1BRSA 4HYZA 4R80A 2OCTA 1QALA 2V1LA 4AKYA 1Q7HA 3HIIA 3CC73 2OWPA 1FYSA 1U8CB 1W02A 2E2VA 2LQVA 2P38A 3HK4A 3GRDA 4J9AA 5IG3A 1BRKA 7RNTA 3DGNA 1PU4A 3JUNA 2GBXB 3A5EA 1RSNA 3KSED 5GSPA 1RCLA 1IDPA 1W4NA 3S28A 1Q864 1N8R4 3NBRA 1ZS7A 3ALAA 5JBSA 3Q3FA 3F8XA 2L4VA 4MMZB 3I563 1VQP3 2H0GA 1T2HA 4HM2B 3G4S3 3CXC2 2CHCA 3EE1A 4FMDA 1B2UA 3OWYA 1L5GB 3D79A 4NREA 4MMXB 4R9KA 2IA7A 5KP1A 3HX8A 3URPA 3Q1CA 3OV4A 1VQK3 3LYGA 4CPKA 1EA2A 1VQQA 2CFGA 1KSIA 1JBTA 1SIHA 4FMCA 5LC6A 4K61A 3V98A 1QJGA 3ROBA 4HM4B 2IUKA 5D82A 5STDA 4CJNA 4N6TA 5D81A 4LYLB 1UI8A 5BU4A 1AVKA 3DGLA 3U97A 3B4PA 2H0IA 2F86B 1CH0A 1CYVA 7GSPA 2XEPA 1IVUA 1JZDA 2W04A 3CNMA 6STDA 4EC6A 1RMSA 1GYBA 1I2FA 3D3LA 5IG5A 2P0XA 1PY3A 2W9QA 3BNBA 3EHCA 2K3DA 3FLJA 4L8PA 1C7HA 2HMKB 2CFWA 1B2ZA 3PZWA 1NB5I 1LNHA 2FNQA 1ISKA 1K28A 4HM6B 3STDA 3BB9A 3MHEA 3RDEA 3N9HA 3SX1A 2CFLA 1NDOB 3CCM3 1GMPA 4HM1B 2HMNB 1STFI 5TGNA 1YHQ3 1DVCA 2FGTA 3G16A 5EEOA 3CD63 2P05A 1W5ZA 3WODG 1Q814 3D9RA 3EB8A 4RZMA 1GY6A 2ZL8A 1O7PB 1WMOA 4MEIA 4N6V0 5CLKA 1FGTA 3X41A 1FUWA 1R4YA 4GSPA 4WP5A 1NU3A 3QRDA 1NJI4 2CW9A 2CWVA 1AVLA 4GL6A 1RRHA 3WMDA 2GBWB 2RGQA 3BNCA 1BNEA 3O8YA 1IQ8A 1FZUA 4K1VA 1QAKA 2Z77A 3OX9A 3NXJA 1J2BA 1US1A 3AMOA 1A90A 4HVNA 3BNDA 3L0RA 3GZBA 2LYXA 3EJVA 3MG1A 3PYJA 4HM0B 4N6UA 1M1K4 1B20A 4FMAA 3I0YA 1BSDA 4K90B 1RGEA 2W2CA 1DVDA 1UCLA 1GS3A 3UNLA 3KFQC 4BTWA 2KF6A 2OOVC 1X1WA 1VQ73 4XDVA 1BNJA 1TRPA 2WGQA 4K1UA 1BU4A 1RNTA 3CC23 3SXXA 2XH9A 2BHMA 1RGFA 4OVMA 1I2GA 3ECFA 1OF5B 5M1AA 3WOFB 1MWRA 2AAEA 1GY5A 1UDII 1KWIA 2BNGA 3NM2A 1E3VA 1LNIA 1HYFA 2YX9A 3F9SA 3EC9A 4OUQA 4X2HA 1FGRA 2J8XB 4KZ1A 1IT7A 3CNXA 1IQYA 2CK3H 5IG0A 4HOHA 3T8UA 3X3XA 1KQS2 1V57A 3DGOA 4MJDA 1W6YA 2IUJA 4H3UA 1N9JA 4N6NB 1GD4A 3CMA3 3V92A 1CYUA 1RHLA 2UGIA 3DH2A 3SYUA 3CU3A 3DGYA 1YNVX 4HM5B 3OW22 3WA2X 4KFFA 2CFKA 2MF7A 1B3SA 1IU7A 2GU3A 1RN7A 3ZG5A 3JVCA 2STDA 5KP3A 4RNYA 2CC3A 1N5PA 1RTUA 3NBJA 2D42A 3WOEB 4BU4A 3H3HA 4R9LA 3WA3A 1JKGA 1YJ93 1BANA 1Y4KA 1B2XA 1AV4A 1JKGB 5KP4A 4J8TA 3NV0A 1JN5A 1BRNL 1BSCA 4N6MA 3FH1A 3Q90A 3FKAA 3K63A 1OACA 4J5KA 4EV2A 3PS8A 1FA3A 5CXOA 3PCRA 2IYJA 4I5QA 5M18A 5CK6A 1U5OA 3EN1B 3GAXA 1GMRA 3PCSA 4EV5A 1OHSA 2KF4A 1D6ZA 3JUPA 4KFDA 2RFRA 1GMQA 3GZRA 1LXEA 2HMLB 2ML6A 1LQGC 4XB5A 3KN4A 5BVBA 1N9EA 2KF3A 4HZBB 3DXOA 3S67A 3X42A 1VQ63 5AYRB 4LMIA 2PZVA 2ZA4A 4JRFA 1AY7A 3MG3A 3X3YA 1QVG2 3MWZA 5BXQA 1TTOA 1M904 1FUSA 1M1XB 1RGAA 1D6UA 5AI1A 2L1SA 4LGQA 1BNFA 2HMMB 2OQEC 1YVBI 1TIJA 1T3BA 3LOYA 1YGEA 1BSBA 1W2ZA 3LTCA 3CCV3 1UGHI 3EX9A 4HZ9B 5G1LA 3UL6A 4XBXA 1I70A 1ULIB 4FMBA 3WHOA 2W9PA 5EVHA 1IVXA 3FGYA 3DZLA 2M7OA 2CWTA 3ER7A 1G96A 3HZPA 1SARA 1ZX2A 1Q7Y4 5IERA 2HMOB 2XSOB 1JBSA 2ZDJA 2RCDA 4BL2A 2RNTA 5JPPA 1OGXA 1CQSA 2SBLA 1LOXA 4H61A 1RGGA 2W03A 2W0QA 4WWUC 1E3RA 3BNEA 1WTHA 1MWTA 1OUNA 2ML5A 3S27A 1AR0A 1JB2A 1V58A 2K0MA 2RSXA 4I4KA 4EYCA 3NQYA 1LQMB 4IIAA 1FGQA 5AIGA 3SEDA 1JJ22 2R41A 3ZG0A 1DMNA 3UB1A 1VQM3 1ULJB 5AIFA 3SOYA 1I0XA 1A2VA 1C54A 1OGZA 1YGWA 3B4OA 4O8SA 3FF2A 2CG1A 3CCR3 1OPYA 1A67A 2XRXB 1Q9EA 1RDSA 2Y74A 1IV7A 4KVHA 1O7HB 1UUWB 1RNBA 1STDA 3ZFZA 2CKFB 3KKGA 2OTL3 5HOHA 3DMCA 1D6YA 3T0UA 1BVIA 1VQ53 3TDGA 4KT3B 5AYSC 1VQO3 5IENA 4GHOA 1SIIA 5IF6A 3DGMA 3WDGB 1DMQA 3EQQB 3H51A 1O7MB 1LOWA 3AMOB 1NWWA 4FCMA 3MPHA 1BOXA 4AEQA 1VQ83 3JUMA 1EQKA 1TFKA 1FW7A 2Z6BA 1BNIA 1UCKA 4L7KA 4NPBA 3MG2A 2WOHA 3JUOA 4QWTA 1FGOA 3FZWA 2GEXA 3FSDA 1O7NB 4O2HA 2KXGA 5G1KA 3VSYA 1IK3A 4FR9A 3NX0A 3UL5A 2C10A 4RNZA 4RNTA 3CCE3 1UW1A 3G8ZA 1A2PA 9RNTA 1EKMA 3EBTA 3U1WA 4HJLB 3CME3 4N3VA 3KIIA 1BUJA 4XBTA 1O7GB 3NUVA 4WYKA 2UX0A 2MC8A 4NHFA 4CCVA 5RNTA 3QK9A 3B7CA 3DUKA 6GSPA 2WGOA 4IT7A 3MKIA 1RGCA 2XSHB 1W7CA 5DREA 3SVAA 1YJW3 1B27A 1K41A 4HM8B 3KSPA 4R4KA 2B24B 2XFSA 4STDA 3UJMA 2E2TA 3AHSA 2BMQB 1MOLA 2D1WA 3GZXB 2F98A 5IG4A 1I3FA 3F8HA 2CIUA 3M8CA 1RGHA 3PGBA 3G0KA 1BRJA 1UCJA 1RCKA 4G1MB 5IEPA 2C4BA 2QIYA 1TRQA 1TU5A 5D83A 1M9GA 3I553 1ZGXA 2P0MA 1TFOA 3CCJ3 2B1XB 2XR8B 1NB3I 1MGRA 1JNQA 1BAOA 4WFOA 1SQWA 4HM3B 1W2B2 3FG3A 1JV2B 4X2OA 2QGUA 3LT9A 1OCVA 3KZTA 4BL3A 1ASKA 4ILFA 1EUIC 1TP6A 4R1KA 4XM4A 5AEWB 2IMJA 2Y73A 4CDLA 3K9MC 3BIRA 3CCS3 1IT8A 1W6GA 2F56A 3D5IA 3NV0B 1JN5B 3GZYB 5FW5A 5AEUB 3NQZA 3Q2PA 4N6LA 1LVNA 3N8BA 2C11A 1X1UA 1HZ1A 4OK0A 3VF1A 2JDIH 2HOHA 1NNVA 4XBYA 2OOVA 2GU1A 4LEHA 5CF1A 1ZO2A 1DE3A 5FGOA 1DETA 5AIHA 1YJN3 1QMAA 3AGNA 1VQN3 3IJEB 3K5TA 1PYLA 6RNTA 1VQL3 7STDA 2OTJ3 1UUVB 1IQXA 1CEWI 2SARA 1DMMA 1IVVA 1B21A 1WQLB 2Z7AA 3BU4A 3K7CA 1RGKA 2CX0A 2CX1A 1X1YA 5CF2A 3CCQ3 3IPTA 2KRTA 1TUHA 1RN4A 1EG9B 2RBIA 3CC43 2R4IA 1MWSA 4EBGA 4J5GA 1SJWA 4HKVB 1T2IA 1VZZA 4O3VA 1W6CA 3V99A 4HAAA 2I9WA 1WMPA 1K9M4 5DRVA 3OWSA 1BNSA 2F4YA 3LTBA 1Q824 3F7XA 1TJDA 8CHOA 1BNRA 1RGLA 4RBNA 3CCU3 3D5GA 2O3OA 1I2EA 2UUGC 3GSPA 3SLUA 3OXAA 1A2KA 1ROVA 2HMJB 4AKZA 2Z76A 1IYYA 3J7Yd 3KE7A 4LZIA 1WNHA 3G6E3 3OWUA 1O7WB 1FUTA
chains in the Genus database with same CATH topology
1RJOA 4WHAA 3FG4A 1KD14 1HU9A 5IW9A 3CCL3 3T8NA 2PNCA 2QA43 1S5AA 2GXFA 3EBYA 1IV9A 1E97A 4JF8A 1W01A 4U13A 3GWRA 1S723 3NM7A 1Q40A 3SOAA 3NBBA 1YIT3 5ELUA 4FCZA 2BO9B 3JUQA 1JB4A 1Q40B 1N5HA 3LTAA 1BUQA 5HGRA 1W00A 3LTDA 4FCJA 1YI23 4L8OA 3RGAA 1R4CA 3G713 4HBRA 2WOFA 3CPOA 3EN8A 2E2UA 3MYTA 4ZM8A 1T5YA 1JB5A 3A76A 2CG0A 5IEOA 5EQLA 2OQEA 1VQ43 3E99A 2FXTA 2W6JH 1DYUA 1N8QA 3X3ZA 3F7SA 3CPW2 3F14A 2F99A 2YFLB 4IPBA 3NHXA 2QEX3 1NO3A 1IVWA 1F8NA 3IMAB 1JRQA 4PEJA 2BMRB 3B8LA 5JPUA 3LT8A 1MNLA 1GY7A 3S5CA 4GB5A 4WYKB 2YFIB 4XDWA 4MMYB 2K54A 2BT3A 2KCDA 3F40A 3LZAA 1ROAA 2A15A 3VGNA 2XGNA 3DM8A 3LH4A 2P09A 1RKYA 1RRLA 1OH0A 2XFTA 3LMLA 1Z1SA 1OF5A 1PFPA 2CWUA 2XF3A 3DY5A 1WMNA 4O02B 4KFEA 1VQ93 4BTYA 5LC7A 1QAFA 1K734 2YFJB 1V74A 3FCSB 3HI7A 3HIGA 3MSOA 4LSOA 1Q42A 2CFDA 5I97A 1HKXA 5AIIA 1OHPA 2XGLA 1GD3A 2W56A 1FGMA 1K8A4 3S29A 2W56B 3RGRA 3K0ZA 1QVF2 3BLZA 2JQ5A 2CH9A 3FG1A 3EF8A 1SPUA 3LXUX 3PXMA 5A0OB 1UI7A 2WO0A 4N6OB 4ORLA 1KC84 2O9UX 2GEYA 1OHOA 5ELJA 4BTXA 5G2GA 1YIJ3 3FF0A 3X40A 4Q53A 2Q07A 2INXA 4TX4A 3N54B 2BMOB 4HM7B 4EXRA 4HYZA 4R80A 2OCTA 1QALA 2V1LA 4AKYA 3HIIA 3CC73 2OWPA 1U8CB 1W02A 2E2VA 2LQVA 2P38A 3HK4A 3GRDA 4J9AA 5IG3A 1PU4A 3DGNA 3JUNA 2GBXB 3KSED 1IDPA 1W4NA 3S28A 1Q864 1N8R4 3NBRA 3ALAA 5JBSA 3F8XA 2L4VA 4MMZB 3I563 1VQP3 4HM2B 3G4S3 3CXC2 2CHCA 3EE1A 4FMDA 3OWYA 1L5GB 4NREA 4MMXB 4R9KA 2IA7A 5KP1A 3HX8A 3Q1CA 3OV4A 1VQK3 3LYGA 1EA2A 2CFGA 1KSIA 1SIHA 4FMCA 5LC6A 4K61A 3V98A 1QJGA 3ROBA 4HM4B 2IUKA 5D82A 5STDA 4N6TA 5D81A 1UI8A 1AVKA 3DGLA 3U97A 3B4PA 2F86B 1CYVA 2XEPA 1IVUA 2W04A 3CNMA 6STDA 4EC6A 1GYBA 3D3LA 5IG5A 2P0XA 2W9QA 3BNBA 3EHCA 3FLJA 4L8PA 1C7HA 2HMKB 2CFWA 3PZWA 1NB5I 1LNHA 2FNQA 1ISKA 1K28A 4HM6B 3STDA 3BB9A 3MHEA 3RDEA 3N9HA 3SX1A 2CFLA 1NDOB 3CCM3 4HM1B 2HMNB 1STFI 5TGNA 1YHQ3 1DVCA 2FGTA 3G16A 5EEOA 3CD63 2P05A 1W5ZA 3WODG 1Q814 3D9RA 3EB8A 4RZMA 1GY6A 2ZL8A 1O7PB 1WMOA 4MEIA 4N6V0 5CLKA 1FGTA 3X41A 1FUWA 4WP5A 1NU3A 3QRDA 1NJI4 2CW9A 2CWVA 1AVLA 4GL6A 1RRHA 3WMDA 2GBWB 2RGQA 3BNCA 3O8YA 1IQ8A 4K1VA 1QAKA 2Z77A 3OX9A 3NXJA 1J2BA 1US1A 3AMOA 1A90A 4HVNA 3BNDA 3L0RA 3GZBA 2LYXA 3EJVA 3MG1A 3PYJA 4HM0B 4N6UA 1M1K4 4FMAA 3I0YA 4K90B 2W2CA 1DVDA 1GS3A 3UNLA 3KFQC 4BTWA 2OOVC 1VQ73 4XDVA 2WGQA 4K1UA 3CC23 3SXXA 2XH9A 2BHMA 4OVMA 3ECFA 1OF5B 3WOFB 1GY5A 1KWIA 2BNGA 3NM2A 1E3VA 2YX9A 4OUQA 3F9SA 3EC9A 4X2HA 1FGRA 4KZ1A 1IT7A 3CNXA 1IQYA 2CK3H 5IG0A 3T8UA 3X3XA 1KQS2 3DGOA 4MJDA 1W6YA 2IUJA 4H3UA 1N9JA 4N6NB 1GD4A 3CMA3 3V92A 1CYUA 3CU3A 4HM5B 3OW22 3WA2X 4KFFA 2CFKA 2MF7A 1IU7A 2GU3A 1RN7A 3JVCA 2STDA 5KP3A 4RNYA 2CC3A 1N5PA 3NBJA 2D42A 3WOEB 3H3HA 4R9LA 3WA3A 1JKGA 1YJ93 1Y4KA 1AV4A 1JKGB 5KP4A 4J8TA 3NV0A 1JN5A 4N6MA 3FH1A 3Q90A 3FKAA 3K63A 1OACA 4EV2A 3PS8A 1FA3A 5CXOA 3PCRA 5CK6A 1U5OA 3EN1B 3GAXA 3PCSA 4EV5A 1OHSA 3JUPA 1D6ZA 4KFDA 2RFRA 3GZRA 1LXEA 2HMLB 2ML6A 4XB5A 3KN4A 5BVBA 1N9EA 4HZBB 3DXOA 3S67A 3X42A 1VQ63 5AYRB 4LMIA 2PZVA 4JRFA 3MG3A 3X3YA 1QVG2 3MWZA 5BXQA 1M904 1M1XB 1D6UA 5AI1A 4LGQA 2OQEC 2HMMB 1YVBI 1TIJA 3LOYA 1YGEA 1W2ZA 3LTCA 3CCV3 3EX9A 4HZ9B 3UL6A 4XBXA 1ULIB 4FMBA 2W9PA 5EVHA 1IVXA 3FGYA 3DZLA 2M7OA 2CWTA 3ER7A 1G96A 3HZPA 1ZX2A 1Q7Y4 5IERA 2HMOB 2XSOB 2ZDJA 2RCDA 5JPPA 1OGXA 1CQSA 2SBLA 1LOXA 4H61A 4WWUC 2W03A 2W0QA 1E3RA 3BNEA 1WTHA 1OUNA 2ML5A 3S27A 1AR0A 1JB2A 2K0MA 2RSXA 4I4KA 4EYCA 3NQYA 4IIAA 1FGQA 5AIGA 3SEDA 1JJ22 1VQM3 1DMNA 3UB1A 1ULJB 5AIFA 3SOYA 1A2VA 1OGZA 3B4OA 4O8SA 3FF2A 2CG1A 3CCR3 1OPYA 1A67A 2XRXB 2Y74A 4KVHA 1IV7A 1O7HB 1UUWB 1STDA 2CKFB 3KKGA 2OTL3 3DMCA 1D6YA 3T0UA 1VQ53 3TDGA 5AYSC 1VQO3 5IENA 1SIIA 5IF6A 3DGMA 3WDGB 1DMQA 3EQQB 3H51A 1O7MB 3AMOB 1NWWA 4FCMA 3MPHA 4AEQA 1VQ83 3JUMA 1EQKA 1TFKA 2Z6BA 4L7KA 3MG2A 2WOHA 3JUOA 4QWTA 1FGOA 3FZWA 2GEXA 3FSDA 1O7NB 4O2HA 2KXGA 3VSYA 1IK3A 4FR9A 3NX0A 3UL5A 2C10A 4RNZA 3CCE3 1UW1A 3G8ZA 1EKMA 3EBTA 3U1WA 4HJLB 3CME3 4N3VA 3KIIA 4XBTA 1O7GB 3NUVA 4WYKA 2UX0A 2MC8A 4NHFA 4CCVA 3QK9A 3B7CA 3DUKA 2WGOA 4IT7A 3MKIA 2XSHB 1W7CA 5DREA 3SVAA 1YJW3 1K41A 4HM8B 3KSPA 4R4KA 2B24B 2XFSA 4STDA 3UJMA 2E2TA 2BMQB 1MOLA 2D1WA 3GZXB 2F98A 5IG4A 3F8HA 2CIUA 3M8CA 3PGBA 3G0KA 4G1MB 5IEPA 2QIYA 1TU5A 5D83A 1M9GA 3I553 2P0MA 1TFOA 3CCJ3 2B1XB 2XR8B 1NB3I 1JNQA 4WFOA 1SQWA 4HM3B 1W2B2 3FG3A 1JV2B 4X2OA 2QGUA 3LT9A 1OCVA 3KZTA 1ASKA 4R1KA 1TP6A 4XM4A 5AEWB 2IMJA 2Y73A 4CDLA 3K9MC 3CCS3 1IT8A 1W6GA 3NV0B 1JN5B 3GZYB 5FW5A 5AEUB 3NQZA 3Q2PA 4N6LA 1LVNA 3N8BA 2C11A 4OK0A 3VF1A 2JDIH 4XBYA 2OOVA 2GU1A 4LEHA 5CF1A 1ZO2A 5FGOA 5AIHA 1YJN3 1QMAA 1VQN3 3IJEB 3K5TA 1VQL3 2OTJ3 7STDA 1UUVB 1IQXA 1CEWI 1DMMA 1IVVA 2Z7AA 1WQLB 5CF2A 3K7CA 3CCQ3 3IPTA 2KRTA 1TUHA 3CC43 1EG9B 2R4IA 4EBGA 1SJWA 4HKVB 4O3VA 1VZZA 1W6CA 3V99A 2I9WA 1WMPA 1K9M4 5DRVA 3OWSA 1Q824 3LTBA 3F7XA 8CHOA 4RBNA 3CCU3 2O3OA 3SLUA 3OXAA 1A2KA 1ROVA 2HMJB 4AKZA 2Z76A 3J7Yd 3KE7A 4LZIA 1WNHA 3G6E3 3OWUA 1O7WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8N A;  1S5A A;  2GXF A;  3EBY A;  1E97 A;  4U13 A;  1W01 A;  3GWR A;  1Q40 A;  3SOA A;  3JUQ A;  1JB4 A;  1Q40 B;  1BUQ A;  5HGR A;  1W00 A;  4FCJ A;  4L8O A;  3RGA A;  3CPO A;  3EN8 A;  3MYT A;  1JB5 A;  3A76 A;  5IEO A;  3E99 A;  3F7S A;  3F14 A;  2F99 A;  2YFL B;  3NHX A;  4PEJ A;  2BMR B;  3B8L A;  5JPU A;  1GY7 A;  3S5C A;  4GB5 A;  4WYK B;  2YFI B;  4XDW A;  2K54 A;  3LZA A;  3F40 A;  2A15 A;  3VGN A;  3DM8 A;  1OH0 A;  1Z1S A;  1OF5 A;  2YFJ B;  3MSO A;  1Q42 A;  1HKX A;  5AII A;  1OHP A;  3RGR A;  3K0Z A;  3BLZ A;  2JQ5 A;  3EF8 A;  4ORL A;  2GEY A;  1OHO A;  5G2G A;  3FF0 A;  4Q53 A;  2INX A;  4HM7 B;  2BMO B;  2OWP A;  1W02 A;  3HK4 A;  3GRD A;  4J9A A;  5IG3 A;  3JUN A;  2GBX B;  1IDP A;  3NBR A;  3F8X A;  4HM2 B;  2CHC A;  3OWY A;  4R9K A;  5KP1 A;  3HX8 A;  3OV4 A;  3LYG A;  1EA2 A;  1QJG A;  3ROB A;  4HM4 B;  5STD A;  5D82 A;  5D81 A;  3B4P A;  2F86 B;  3CNM A;  6STD A;  1GYB A;  5IG5 A;  3EHC A;  3FLJ A;  4L8P A;  1C7H A;  2HMK B;  1ISK A;  4HM6 B;  3STD A;  3BB9 A;  3MHE A;  1NDO B;  4HM1 B;  2HMN B;  5TGN A;  3G16 A;  3D9R A;  4RZM A;  1GY6 A;  1O7P B;  5CLK A;  4WP5 A;  1NU3 A;  3WMD A;  2GBW B;  2RGQ A;  4K1V A;  2Z77 A;  3OX9 A;  3NXJ A;  4HVN A;  3MG1 A;  3GZB A;  3EJV A;  4HM0 B;  3I0Y A;  2W2C A;  1GS3 A;  3UNL A;  4XDV A;  4K1U A;  4OVM A;  3ECF A;  1OF5 B;  1GY5 A;  3NM2 A;  2BNG A;  1E3V A;  4OUQ A;  4X2H A;  3F9S A;  3EC9 A;  5IG0 A;  3CNX A;  3T8U A;  4MJD A;  1W6Y A;  4H3U A;  3CU3 A;  4HM5 B;  2STD A;  5KP3 A;  3H3H A;  4R9L A;  1JKG A;  1JKG B;  5KP4 A;  4J8T A;  3NV0 A;  1JN5 A;  3FH1 A;  3Q90 A;  3FKA A;  5CXO A;  5CK6 A;  1U5O A;  3EN1 B;  1OHS A;  3JUP A;  2RFR A;  3GZR A;  2HML B;  4XB5 A;  5BVB A;  4HZB B;  3DXO A;  4LMI A;  2PZV A;  3MG3 A;  5BXQ A;  5AI1 A;  4LGQ A;  2HMM B;  3EX9 A;  4HZ9 B;  4XBX A;  1ULI B;  5EVH A;  3FGY A;  3DZL A;  3ER7 A;  3HZP A;  1ZX2 A;  5IER A;  2HMO B;  2XSO B;  2RCD A;  5JPP A;  1OGX A;  1CQS A;  4WWU C;  1E3R A;  1OUN A;  1AR0 A;  1JB2 A;  4I4K A;  4IIA A;  5AIG A;  3SED A;  1DMN A;  1ULJ B;  5AIF A;  3SOY A;  1OGZ A;  3B4O A;  3FF2 A;  1OPY A;  2XRX B;  4KVH A;  1O7H B;  1UUW B;  1STD A;  2CKF B;  3KKG A;  3DMC A;  5IEN A;  5IF6 A;  1DMQ A;  3EQQ B;  3H51 A;  1O7M B;  1NWW A;  4FCM A;  3JUM A;  4L7K A;  3MG2 A;  3JUO A;  3FZW A;  2GEX A;  3FSD A;  1O7N B;  3VSY A;  3G8Z A;  3EBT A;  4HJL B;  4N3V A;  4XBT A;  1O7G B;  3NUV A;  4WYK A;  2UX0 A;  3B7C A;  3DUK A;  3MKI A;  2XSH B;  5DRE A;  1K41 A;  4HM8 B;  3KSP A;  2B24 B;  4STD A;  3UJM A;  2BMQ B;  5IG4 A;  3GZX B;  2F98 A;  3F8H A;  3M8C A;  3G0K A;  5IEP A;  2QIY A;  5D83 A;  2B1X B;  2XR8 B;  4HM3 B;  4X2O A;  2QGU A;  1OCV A;  3KZT A;  1ASK A;  4XM4 A;  1TP6 A;  4R1K A;  5AEW B;  2IMJ A;  4CDL A;  3NV0 B;  1JN5 B;  3GZY B;  5FW5 A;  5AEU B;  4XBY A;  4LEH A;  5CF1 A;  1ZO2 A;  5AIH A;  1QMA A;  7STD A;  1UUV B;  1DMM A;  2Z7A A;  5CF2 A;  1WQL B;  3K7C A;  3IPT A;  1TUH A;  1EG9 B;  2R4I A;  1SJW A;  4HKV B;  1VZZ A;  2I9W A;  5DRV A;  3OWS A;  3F7X A;  8CHO A;  3OXA A;  1A2K A;  2HMJ B;  2Z76 A;  3KE7 A;  3OWU A;  1O7W B; 
#chains in the Genus database with same CATH topology
 1RJO A;  4WHA A;  3FG4 A;  5M19 A;  1KD1 4;  1HU9 A;  1UUG B;  5IW9 A;  3CCL 3;  2BIR A;  3T8N A;  2PNC A;  2QA4 3;  1S5A A;  2GXF A;  3EBY A;  1IV9 A;  1E97 A;  4JF8 A;  1W01 A;  4U13 A;  3GWR A;  1S72 3;  3NM7 A;  3KCH A;  1Q40 A;  3D4A A;  3NBB A;  3SOA A;  5ELU A;  4FCZ A;  1YIT 3;  2BU4 A;  2BO9 B;  3JUQ A;  1JB4 A;  1Q40 B;  1N5H A;  3LTA A;  1BUQ A;  5HGR A;  1W00 A;  3LTD A;  1GSP A;  4FCJ A;  2IY2 A;  1YI2 3;  4L8O A;  1UGI A;  2F5W A;  3RGA A;  1R4C A;  3G71 3;  4HBR A;  1G02 A;  1BNG A;  1BRI A;  2KAA A;  1X1X A;  2WOF A;  3CPO A;  3EN8 A;  2E2U A;  3MYT A;  4ZM8 A;  1T5Y A;  1JB5 A;  1BRH A;  1BSE A;  2ZHX B;  3A76 A;  2CG0 A;  5IEO A;  5EQL A;  2OQE A;  1VQ4 3;  1MGW A;  3E99 A;  2FXT A;  2W6J H;  3RNT A;  1DYU A;  1BGS A;  1AQZ A;  1N8Q A;  3X3Z A;  1I8V A;  3F7S A;  3CPW 2;  3F14 A;  2F99 A;  2YFL B;  4IPB A;  3NHX A;  2QEX 3;  1JZO A;  1IVW A;  1F8N A;  1NO3 A;  1I3I A;  2F5M A;  3AGO A;  3IMA B;  1BSA A;  1JRQ A;  4PEJ A;  2BMR B;  3B8L A;  5JPU A;  3LT8 A;  1GOU A;  1GY7 A;  1MNL A;  3S5C A;  4GB5 A;  4WYK B;  2YFI B;  4XDW A;  1I0V A;  4BIR A;  1LOV A;  4MMY B;  2K54 A;  2BT3 A;  2KCD A;  3F40 A;  3LZA A;  1ROA A;  2A15 A;  3VGN A;  2XGN A;  3DM8 A;  4DKI A;  3LH4 A;  2P09 A;  1RKY A;  1RRL A;  1OH0 A;  1B2S A;  2XFT A;  3LML A;  1Z1S A;  1OF5 A;  1PFP A;  2CWU A;  1GOV A;  2XF3 A;  5BIR A;  1GOY A;  3DY5 A;  1WMN A;  4O02 B;  4KFE A;  1VQ9 3;  4BTY A;  5LC7 A;  2GSP A;  1QAF A;  1K73 4;  2YFJ B;  1BIR A;  1V74 A;  3FCS B;  1EEJ A;  1YVS A;  3HI7 A;  3HIG A;  1BRG A;  3MSO A;  4LSO A;  1Q42 A;  2CFD A;  5I97 A;  1HKX A;  5AII A;  1OHP A;  2XGL A;  1GD3 A;  2W56 A;  1RLS A;  1UCI A;  1FGM A;  3WR2 A;  1K8A 4;  3S29 A;  1RN1 A;  2W56 B;  3RGR A;  2H0H A;  8RNT A;  1JBR A;  3K0Z A;  1QVF 2;  3BLZ A;  2JQ5 A;  2CH9 A;  2KF5 A;  3FG1 A;  3EF8 A;  1SPU A;  3AHW A;  3HOH A;  3LXU X;  3PXM A;  1B2M A;  1MWU A;  5A0O B;  1UI7 A;  2WO0 A;  4N6O B;  4ORL A;  1LRA A;  2O9U X;  1KC8 4;  2AAD A;  1G0T A;  2GEY A;  1OHO A;  1LOY A;  5ELJ A;  4BTX A;  5G2G A;  1YIJ 3;  4EW5 A;  3FF0 A;  3X40 A;  4Q53 A;  2Q07 A;  2INX A;  4TX4 A;  3N54 B;  2BMO B;  4HM7 B;  4EXR A;  1BRS A;  4HYZ A;  4R80 A;  2OCT A;  1QAL A;  2V1L A;  4AKY A;  1Q7H A;  3HII A;  3CC7 3;  2OWP A;  1FYS A;  1U8C B;  1W02 A;  2E2V A;  2LQV A;  2P38 A;  3HK4 A;  3GRD A;  4J9A A;  5IG3 A;  1BRK A;  7RNT A;  3DGN A;  1PU4 A;  3JUN A;  2GBX B;  3A5E A;  1RSN A;  3KSE D;  5GSP A;  1RCL A;  1IDP A;  1W4N A;  3S28 A;  1Q86 4;  1N8R 4;  3NBR A;  1ZS7 A;  3ALA A;  5JBS A;  3Q3F A;  3F8X A;  2L4V A;  4MMZ B;  3I56 3;  1VQP 3;  2H0G A;  1T2H A;  4HM2 B;  3G4S 3;  3CXC 2;  2CHC A;  3EE1 A;  4FMD A;  1B2U A;  3OWY A;  1L5G B;  3D79 A;  4NRE A;  4MMX B;  4R9K A;  2IA7 A;  5KP1 A;  3HX8 A;  3URP A;  3Q1C A;  3OV4 A;  1VQK 3;  3LYG A;  4CPK A;  1EA2 A;  1VQQ A;  2CFG A;  1KSI A;  1JBT A;  1SIH A;  4FMC A;  5LC6 A;  4K61 A;  3V98 A;  1QJG A;  3ROB A;  4HM4 B;  2IUK A;  5D82 A;  5STD A;  4CJN A;  4N6T A;  5D81 A;  4LYL B;  1UI8 A;  5BU4 A;  1AVK A;  3DGL A;  3U97 A;  3B4P A;  2H0I A;  2F86 B;  1CH0 A;  1CYV A;  7GSP A;  2XEP A;  1IVU A;  1JZD A;  2W04 A;  3CNM A;  6STD A;  4EC6 A;  1RMS A;  1GYB A;  1I2F A;  3D3L A;  5IG5 A;  2P0X A;  1PY3 A;  2W9Q A;  3BNB A;  3EHC A;  2K3D A;  3FLJ A;  4L8P A;  1C7H A;  2HMK B;  2CFW A;  1B2Z A;  3PZW A;  1NB5 I;  1LNH A;  2FNQ A;  1ISK A;  1K28 A;  4HM6 B;  3STD A;  3BB9 A;  3MHE A;  3RDE A;  3N9H A;  3SX1 A;  2CFL A;  1NDO B;  3CCM 3;  1GMP A;  4HM1 B;  2HMN B;  1STF I;  5TGN A;  1YHQ 3;  1DVC A;  2FGT A;  3G16 A;  5EEO A;  3CD6 3;  2P05 A;  1W5Z A;  3WOD G;  1Q81 4;  3D9R A;  3EB8 A;  4RZM A;  1GY6 A;  2ZL8 A;  1O7P B;  1WMO A;  4MEI A;  4N6V 0;  5CLK A;  1FGT A;  3X41 A;  1FUW A;  1R4Y A;  4GSP A;  4WP5 A;  1NU3 A;  3QRD A;  1NJI 4;  2CW9 A;  2CWV A;  1AVL A;  4GL6 A;  1RRH A;  3WMD A;  2GBW B;  2RGQ A;  3BNC A;  1BNE A;  3O8Y A;  1IQ8 A;  1FZU A;  4K1V A;  1QAK A;  2Z77 A;  3OX9 A;  3NXJ A;  1J2B A;  1US1 A;  3AMO A;  1A90 A;  4HVN A;  3BND A;  3L0R A;  3GZB A;  2LYX A;  3EJV A;  3MG1 A;  3PYJ A;  4HM0 B;  4N6U A;  1M1K 4;  1B20 A;  4FMA A;  3I0Y A;  1BSD A;  4K90 B;  1RGE A;  2W2C A;  1DVD A;  1UCL A;  1GS3 A;  3UNL A;  3KFQ C;  4BTW A;  2KF6 A;  2OOV C;  1X1W A;  1VQ7 3;  4XDV A;  1BNJ A;  1TRP A;  2WGQ A;  4K1U A;  1BU4 A;  1RNT A;  3CC2 3;  3SXX A;  2XH9 A;  2BHM A;  1RGF A;  4OVM A;  1I2G A;  3ECF A;  1OF5 B;  5M1A A;  3WOF B;  1MWR A;  2AAE A;  1GY5 A;  1UDI I;  1KWI A;  2BNG A;  3NM2 A;  1E3V A;  1LNI A;  1HYF A;  2YX9 A;  3F9S A;  3EC9 A;  4OUQ A;  4X2H A;  1FGR A;  2J8X B;  4KZ1 A;  1IT7 A;  3CNX A;  1IQY A;  2CK3 H;  5IG0 A;  4HOH A;  3T8U A;  3X3X A;  1KQS 2;  1V57 A;  3DGO A;  4MJD A;  1W6Y A;  2IUJ A;  4H3U A;  1N9J A;  4N6N B;  1GD4 A;  3CMA 3;  3V92 A;  1CYU A;  1RHL A;  2UGI A;  3DH2 A;  3SYU A;  3CU3 A;  3DGY A;  1YNV X;  4HM5 B;  3OW2 2;  3WA2 X;  4KFF A;  2CFK A;  2MF7 A;  1B3S A;  1IU7 A;  2GU3 A;  1RN7 A;  3ZG5 A;  3JVC A;  2STD A;  5KP3 A;  4RNY A;  2CC3 A;  1N5P A;  1RTU A;  3NBJ A;  2D42 A;  3WOE B;  4BU4 A;  3H3H A;  4R9L A;  3WA3 A;  1JKG A;  1YJ9 3;  1BAN A;  1Y4K A;  1B2X A;  1AV4 A;  1JKG B;  5KP4 A;  4J8T A;  3NV0 A;  1JN5 A;  1BRN L;  1BSC A;  4N6M A;  3FH1 A;  3Q90 A;  3FKA A;  3K63 A;  1OAC A;  4J5K A;  4EV2 A;  3PS8 A;  1FA3 A;  5CXO A;  3PCR A;  2IYJ A;  4I5Q A;  5M18 A;  5CK6 A;  1U5O A;  3EN1 B;  3GAX A;  1GMR A;  3PCS A;  4EV5 A;  1OHS A;  2KF4 A;  1D6Z A;  3JUP A;  4KFD A;  2RFR A;  1GMQ A;  3GZR A;  1LXE A;  2HML B;  2ML6 A;  1LQG C;  4XB5 A;  3KN4 A;  5BVB A;  1N9E A;  2KF3 A;  4HZB B;  3DXO A;  3S67 A;  3X42 A;  1VQ6 3;  5AYR B;  4LMI A;  2PZV A;  2ZA4 A;  4JRF A;  1AY7 A;  3MG3 A;  3X3Y A;  1QVG 2;  3MWZ A;  5BXQ A;  1TTO A;  1M90 4;  1FUS A;  1M1X B;  1RGA A;  1D6U A;  5AI1 A;  2L1S A;  4LGQ A;  1BNF A;  2HMM B;  2OQE C;  1YVB I;  1TIJ A;  1T3B A;  3LOY A;  1YGE A;  1BSB A;  1W2Z A;  3LTC A;  3CCV 3;  1UGH I;  3EX9 A;  4HZ9 B;  5G1L A;  3UL6 A;  4XBX A;  1I70 A;  1ULI B;  4FMB A;  3WHO A;  2W9P A;  5EVH A;  1IVX A;  3FGY A;  3DZL A;  2M7O A;  2CWT A;  3ER7 A;  1G96 A;  3HZP A;  1SAR A;  1ZX2 A;  1Q7Y 4;  5IER A;  2HMO B;  2XSO B;  1JBS A;  2ZDJ A;  2RCD A;  4BL2 A;  2RNT A;  5JPP A;  1OGX A;  1CQS A;  2SBL A;  1LOX A;  4H61 A;  1RGG A;  2W03 A;  2W0Q A;  4WWU C;  1E3R A;  3BNE A;  1WTH A;  1MWT A;  1OUN A;  2ML5 A;  3S27 A;  1AR0 A;  1JB2 A;  1V58 A;  2K0M A;  2RSX A;  4I4K A;  4EYC A;  3NQY A;  1LQM B;  4IIA A;  1FGQ A;  5AIG A;  3SED A;  1JJ2 2;  2R41 A;  3ZG0 A;  1DMN A;  3UB1 A;  1VQM 3;  1ULJ B;  5AIF A;  3SOY A;  1I0X A;  1A2V A;  1C54 A;  1OGZ A;  1YGW A;  3B4O A;  4O8S A;  3FF2 A;  2CG1 A;  3CCR 3;  1OPY A;  1A67 A;  2XRX B;  1Q9E A;  1RDS A;  2Y74 A;  1IV7 A;  4KVH A;  1O7H B;  1UUW B;  1RNB A;  1STD A;  3ZFZ A;  2CKF B;  3KKG A;  2OTL 3;  5HOH A;  3DMC A;  1D6Y A;  3T0U A;  1BVI A;  1VQ5 3;  3TDG A;  4KT3 B;  5AYS C;  1VQO 3;  5IEN A;  4GHO A;  1SII A;  5IF6 A;  3DGM A;  3WDG B;  1DMQ A;  3EQQ B;  3H51 A;  1O7M B;  1LOW A;  3AMO B;  1NWW A;  4FCM A;  3MPH A;  1BOX A;  4AEQ A;  1VQ8 3;  3JUM A;  1EQK A;  1TFK A;  1FW7 A;  2Z6B A;  1BNI A;  1UCK A;  4L7K A;  4NPB A;  3MG2 A;  2WOH A;  3JUO A;  4QWT A;  1FGO A;  3FZW A;  2GEX A;  3FSD A;  1O7N B;  4O2H A;  2KXG A;  5G1K A;  3VSY A;  1IK3 A;  4FR9 A;  3NX0 A;  3UL5 A;  2C10 A;  4RNZ A;  4RNT A;  3CCE 3;  1UW1 A;  3G8Z A;  1A2P A;  9RNT A;  1EKM A;  3EBT A;  3U1W A;  4HJL B;  3CME 3;  4N3V A;  3KII A;  1BUJ A;  4XBT A;  1O7G B;  3NUV A;  4WYK A;  2UX0 A;  2MC8 A;  4NHF A;  4CCV A;  5RNT A;  3QK9 A;  3B7C A;  3DUK A;  6GSP A;  2WGO A;  4IT7 A;  3MKI A;  1RGC A;  2XSH B;  1W7C A;  5DRE A;  3SVA A;  1YJW 3;  1B27 A;  1K41 A;  4HM8 B;  3KSP A;  4R4K A;  2B24 B;  2XFS A;  4STD A;  3UJM A;  2E2T A;  3AHS A;  2BMQ B;  1MOL A;  2D1W A;  3GZX B;  2F98 A;  5IG4 A;  1I3F A;  3F8H A;  2CIU A;  3M8C A;  1RGH A;  3PGB A;  3G0K A;  1BRJ A;  1UCJ A;  1RCK A;  4G1M B;  5IEP A;  2C4B A;  2QIY A;  1TRQ A;  1TU5 A;  5D83 A;  1M9G A;  3I55 3;  1ZGX A;  2P0M A;  1TFO A;  3CCJ 3;  2B1X B;  2XR8 B;  1NB3 I;  1MGR A;  1JNQ A;  1BAO A;  4WFO A;  1SQW A;  4HM3 B;  1W2B 2;  3FG3 A;  1JV2 B;  4X2O A;  2QGU A;  3LT9 A;  1OCV A;  3KZT A;  4BL3 A;  1ASK A;  4ILF A;  1EUI C;  1TP6 A;  4R1K A;  4XM4 A;  5AEW B;  2IMJ A;  2Y73 A;  4CDL A;  3K9M C;  3BIR A;  3CCS 3;  1IT8 A;  1W6G A;  2F56 A;  3D5I A;  3NV0 B;  1JN5 B;  3GZY B;  5FW5 A;  5AEU B;  3NQZ A;  3Q2P A;  4N6L A;  1LVN A;  3N8B A;  2C11 A;  1X1U A;  1HZ1 A;  4OK0 A;  3VF1 A;  2JDI H;  2HOH A;  1NNV A;  4XBY A;  2OOV A;  2GU1 A;  4LEH A;  5CF1 A;  1ZO2 A;  1DE3 A;  5FGO A;  1DET A;  5AIH A;  1YJN 3;  1QMA A;  3AGN A;  1VQN 3;  3IJE B;  3K5T A;  1PYL A;  6RNT A;  1VQL 3;  7STD A;  2OTJ 3;  1UUV B;  1IQX A;  1CEW I;  2SAR A;  1DMM A;  1IVV A;  1B21 A;  1WQL B;  2Z7A A;  3BU4 A;  3K7C A;  1RGK A;  2CX0 A;  2CX1 A;  1X1Y A;  5CF2 A;  3CCQ 3;  3IPT A;  2KRT A;  1TUH A;  1RN4 A;  1EG9 B;  2RBI A;  3CC4 3;  2R4I A;  1MWS A;  4EBG A;  4J5G A;  1SJW A;  4HKV B;  1T2I A;  1VZZ A;  4O3V A;  1W6C A;  3V99 A;  4HAA A;  2I9W A;  1WMP A;  1K9M 4;  5DRV A;  3OWS A;  1BNS A;  2F4Y A;  3LTB A;  1Q82 4;  3F7X A;  1TJD A;  8CHO A;  1BNR A;  1RGL A;  4RBN A;  3CCU 3;  3D5G A;  2O3O A;  1I2E A;  2UUG C;  3GSP A;  3SLU A;  3OXA A;  1A2K A;  1ROV A;  2HMJ B;  4AKZ A;  2Z76 A;  1IYY A;  3J7Y d;  3KE7 A;  4LZI A;  1WNH A;  3G6E 3;  3OWU A;  1O7W B;  1FUT A; 
#chains in the Genus database with same CATH homology
 1RJO A;  4WHA A;  3FG4 A;  1KD1 4;  1HU9 A;  5IW9 A;  3CCL 3;  3T8N A;  2PNC A;  2QA4 3;  1S5A A;  2GXF A;  3EBY A;  1IV9 A;  1E97 A;  4JF8 A;  1W01 A;  4U13 A;  3GWR A;  1S72 3;  3NM7 A;  1Q40 A;  3SOA A;  3NBB A;  1YIT 3;  5ELU A;  4FCZ A;  2BO9 B;  3JUQ A;  1JB4 A;  1Q40 B;  1N5H A;  3LTA A;  1BUQ A;  5HGR A;  1W00 A;  3LTD A;  4FCJ A;  1YI2 3;  4L8O A;  3RGA A;  1R4C A;  3G71 3;  4HBR A;  2WOF A;  3CPO A;  3EN8 A;  2E2U A;  3MYT A;  4ZM8 A;  1T5Y A;  1JB5 A;  3A76 A;  2CG0 A;  5IEO A;  5EQL A;  2OQE A;  1VQ4 3;  3E99 A;  2FXT A;  2W6J H;  1DYU A;  1N8Q A;  3X3Z A;  3F7S A;  3CPW 2;  3F14 A;  2F99 A;  2YFL B;  4IPB A;  3NHX A;  2QEX 3;  1NO3 A;  1IVW A;  1F8N A;  3IMA B;  1JRQ A;  4PEJ A;  2BMR B;  3B8L A;  5JPU A;  3LT8 A;  1MNL A;  1GY7 A;  3S5C A;  4GB5 A;  4WYK B;  2YFI B;  4XDW A;  4MMY B;  2K54 A;  2BT3 A;  2KCD A;  3F40 A;  3LZA A;  1ROA A;  2A15 A;  3VGN A;  2XGN A;  3DM8 A;  3LH4 A;  2P09 A;  1RKY A;  1RRL A;  1OH0 A;  2XFT A;  3LML A;  1Z1S A;  1OF5 A;  1PFP A;  2CWU A;  2XF3 A;  3DY5 A;  1WMN A;  4O02 B;  4KFE A;  1VQ9 3;  4BTY A;  5LC7 A;  1QAF A;  1K73 4;  2YFJ B;  1V74 A;  3FCS B;  3HI7 A;  3HIG A;  3MSO A;  4LSO A;  1Q42 A;  2CFD A;  5I97 A;  1HKX A;  5AII A;  1OHP A;  2XGL A;  1GD3 A;  2W56 A;  1FGM A;  1K8A 4;  3S29 A;  2W56 B;  3RGR A;  3K0Z A;  1QVF 2;  3BLZ A;  2JQ5 A;  2CH9 A;  3FG1 A;  3EF8 A;  1SPU A;  3LXU X;  3PXM A;  5A0O B;  1UI7 A;  2WO0 A;  4N6O B;  4ORL A;  1KC8 4;  2O9U X;  2GEY A;  1OHO A;  5ELJ A;  4BTX A;  5G2G A;  1YIJ 3;  3FF0 A;  3X40 A;  4Q53 A;  2Q07 A;  2INX A;  4TX4 A;  3N54 B;  2BMO B;  4HM7 B;  4EXR A;  4HYZ A;  4R80 A;  2OCT A;  1QAL A;  2V1L A;  4AKY A;  3HII A;  3CC7 3;  2OWP A;  1U8C B;  1W02 A;  2E2V A;  2LQV A;  2P38 A;  3HK4 A;  3GRD A;  4J9A A;  5IG3 A;  1PU4 A;  3DGN A;  3JUN A;  2GBX B;  3KSE D;  1IDP A;  1W4N A;  3S28 A;  1Q86 4;  1N8R 4;  3NBR A;  3ALA A;  5JBS A;  3F8X A;  2L4V A;  4MMZ B;  3I56 3;  1VQP 3;  4HM2 B;  3G4S 3;  3CXC 2;  2CHC A;  3EE1 A;  4FMD A;  3OWY A;  1L5G B;  4NRE A;  4MMX B;  4R9K A;  2IA7 A;  5KP1 A;  3HX8 A;  3Q1C A;  3OV4 A;  1VQK 3;  3LYG A;  1EA2 A;  2CFG A;  1KSI A;  1SIH A;  4FMC A;  5LC6 A;  4K61 A;  3V98 A;  1QJG A;  3ROB A;  4HM4 B;  2IUK A;  5D82 A;  5STD A;  4N6T A;  5D81 A;  1UI8 A;  1AVK A;  3DGL A;  3U97 A;  3B4P A;  2F86 B;  1CYV A;  2XEP A;  1IVU A;  2W04 A;  3CNM A;  6STD A;  4EC6 A;  1GYB A;  3D3L A;  5IG5 A;  2P0X A;  2W9Q A;  3BNB A;  3EHC A;  3FLJ A;  4L8P A;  1C7H A;  2HMK B;  2CFW A;  3PZW A;  1NB5 I;  1LNH A;  2FNQ A;  1ISK A;  1K28 A;  4HM6 B;  3STD A;  3BB9 A;  3MHE A;  3RDE A;  3N9H A;  3SX1 A;  2CFL A;  1NDO B;  3CCM 3;  4HM1 B;  2HMN B;  1STF I;  5TGN A;  1YHQ 3;  1DVC A;  2FGT A;  3G16 A;  5EEO A;  3CD6 3;  2P05 A;  1W5Z A;  3WOD G;  1Q81 4;  3D9R A;  3EB8 A;  4RZM A;  1GY6 A;  2ZL8 A;  1O7P B;  1WMO A;  4MEI A;  4N6V 0;  5CLK A;  1FGT A;  3X41 A;  1FUW A;  4WP5 A;  1NU3 A;  3QRD A;  1NJI 4;  2CW9 A;  2CWV A;  1AVL A;  4GL6 A;  1RRH A;  3WMD A;  2GBW B;  2RGQ A;  3BNC A;  3O8Y A;  1IQ8 A;  4K1V A;  1QAK A;  2Z77 A;  3OX9 A;  3NXJ A;  1J2B A;  1US1 A;  3AMO A;  1A90 A;  4HVN A;  3BND A;  3L0R A;  3GZB A;  2LYX A;  3EJV A;  3MG1 A;  3PYJ A;  4HM0 B;  4N6U A;  1M1K 4;  4FMA A;  3I0Y A;  4K90 B;  2W2C A;  1DVD A;  1GS3 A;  3UNL A;  3KFQ C;  4BTW A;  2OOV C;  1VQ7 3;  4XDV A;  2WGQ A;  4K1U A;  3CC2 3;  3SXX A;  2XH9 A;  2BHM A;  4OVM A;  3ECF A;  1OF5 B;  3WOF B;  1GY5 A;  1KWI A;  2BNG A;  3NM2 A;  1E3V A;  2YX9 A;  4OUQ A;  3F9S A;  3EC9 A;  4X2H A;  1FGR A;  4KZ1 A;  1IT7 A;  3CNX A;  1IQY A;  2CK3 H;  5IG0 A;  3T8U A;  3X3X A;  1KQS 2;  3DGO A;  4MJD A;  1W6Y A;  2IUJ A;  4H3U A;  1N9J A;  4N6N B;  1GD4 A;  3CMA 3;  3V92 A;  1CYU A;  3CU3 A;  4HM5 B;  3OW2 2;  3WA2 X;  4KFF A;  2CFK A;  2MF7 A;  1IU7 A;  2GU3 A;  1RN7 A;  3JVC A;  2STD A;  5KP3 A;  4RNY A;  2CC3 A;  1N5P A;  3NBJ A;  2D42 A;  3WOE B;  3H3H A;  4R9L A;  3WA3 A;  1JKG A;  1YJ9 3;  1Y4K A;  1AV4 A;  1JKG B;  5KP4 A;  4J8T A;  3NV0 A;  1JN5 A;  4N6M A;  3FH1 A;  3Q90 A;  3FKA A;  3K63 A;  1OAC A;  4EV2 A;  3PS8 A;  1FA3 A;  5CXO A;  3PCR A;  5CK6 A;  1U5O A;  3EN1 B;  3GAX A;  3PCS A;  4EV5 A;  1OHS A;  3JUP A;  1D6Z A;  4KFD A;  2RFR A;  3GZR A;  1LXE A;  2HML B;  2ML6 A;  4XB5 A;  3KN4 A;  5BVB A;  1N9E A;  4HZB B;  3DXO A;  3S67 A;  3X42 A;  1VQ6 3;  5AYR B;  4LMI A;  2PZV A;  4JRF A;  3MG3 A;  3X3Y A;  1QVG 2;  3MWZ A;  5BXQ A;  1M90 4;  1M1X B;  1D6U A;  5AI1 A;  4LGQ A;  2OQE C;  2HMM B;  1YVB I;  1TIJ A;  3LOY A;  1YGE A;  1W2Z A;  3LTC A;  3CCV 3;  3EX9 A;  4HZ9 B;  3UL6 A;  4XBX A;  1ULI B;  4FMB A;  2W9P A;  5EVH A;  1IVX A;  3FGY A;  3DZL A;  2M7O A;  2CWT A;  3ER7 A;  1G96 A;  3HZP A;  1ZX2 A;  1Q7Y 4;  5IER A;  2HMO B;  2XSO B;  2ZDJ A;  2RCD A;  5JPP A;  1OGX A;  1CQS A;  2SBL A;  1LOX A;  4H61 A;  4WWU C;  2W03 A;  2W0Q A;  1E3R A;  3BNE A;  1WTH A;  1OUN A;  2ML5 A;  3S27 A;  1AR0 A;  1JB2 A;  2K0M A;  2RSX A;  4I4K A;  4EYC A;  3NQY A;  4IIA A;  1FGQ A;  5AIG A;  3SED A;  1JJ2 2;  1VQM 3;  1DMN A;  3UB1 A;  1ULJ B;  5AIF A;  3SOY A;  1A2V A;  1OGZ A;  3B4O A;  4O8S A;  3FF2 A;  2CG1 A;  3CCR 3;  1OPY A;  1A67 A;  2XRX B;  2Y74 A;  4KVH A;  1IV7 A;  1O7H B;  1UUW B;  1STD A;  2CKF B;  3KKG A;  2OTL 3;  3DMC A;  1D6Y A;  3T0U A;  1VQ5 3;  3TDG A;  5AYS C;  1VQO 3;  5IEN A;  1SII A;  5IF6 A;  3DGM A;  3WDG B;  1DMQ A;  3EQQ B;  3H51 A;  1O7M B;  3AMO B;  1NWW A;  4FCM A;  3MPH A;  4AEQ A;  1VQ8 3;  3JUM A;  1EQK A;  1TFK A;  2Z6B A;  4L7K A;  3MG2 A;  2WOH A;  3JUO A;  4QWT A;  1FGO A;  3FZW A;  2GEX A;  3FSD A;  1O7N B;  4O2H A;  2KXG A;  3VSY A;  1IK3 A;  4FR9 A;  3NX0 A;  3UL5 A;  2C10 A;  4RNZ A;  3CCE 3;  1UW1 A;  3G8Z A;  1EKM A;  3EBT A;  3U1W A;  4HJL B;  3CME 3;  4N3V A;  3KII A;  4XBT A;  1O7G B;  3NUV A;  4WYK A;  2UX0 A;  2MC8 A;  4NHF A;  4CCV A;  3QK9 A;  3B7C A;  3DUK A;  2WGO A;  4IT7 A;  3MKI A;  2XSH B;  1W7C A;  5DRE A;  3SVA A;  1YJW 3;  1K41 A;  4HM8 B;  3KSP A;  4R4K A;  2B24 B;  2XFS A;  4STD A;  3UJM A;  2E2T A;  2BMQ B;  1MOL A;  2D1W A;  3GZX B;  2F98 A;  5IG4 A;  3F8H A;  2CIU A;  3M8C A;  3PGB A;  3G0K A;  4G1M B;  5IEP A;  2QIY A;  1TU5 A;  5D83 A;  1M9G A;  3I55 3;  2P0M A;  1TFO A;  3CCJ 3;  2B1X B;  2XR8 B;  1NB3 I;  1JNQ A;  4WFO A;  1SQW A;  4HM3 B;  1W2B 2;  3FG3 A;  1JV2 B;  4X2O A;  2QGU A;  3LT9 A;  1OCV A;  3KZT A;  1ASK A;  4R1K A;  1TP6 A;  4XM4 A;  5AEW B;  2IMJ A;  2Y73 A;  4CDL A;  3K9M C;  3CCS 3;  1IT8 A;  1W6G A;  3NV0 B;  1JN5 B;  3GZY B;  5FW5 A;  5AEU B;  3NQZ A;  3Q2P A;  4N6L A;  1LVN A;  3N8B A;  2C11 A;  4OK0 A;  3VF1 A;  2JDI H;  4XBY A;  2OOV A;  2GU1 A;  4LEH A;  5CF1 A;  1ZO2 A;  5FGO A;  5AIH A;  1YJN 3;  1QMA A;  1VQN 3;  3IJE B;  3K5T A;  1VQL 3;  2OTJ 3;  7STD A;  1UUV B;  1IQX A;  1CEW I;  1DMM A;  1IVV A;  2Z7A A;  1WQL B;  5CF2 A;  3K7C A;  3CCQ 3;  3IPT A;  2KRT A;  1TUH A;  3CC4 3;  1EG9 B;  2R4I A;  4EBG A;  1SJW A;  4HKV B;  4O3V A;  1VZZ A;  1W6C A;  3V99 A;  2I9W A;  1WMP A;  1K9M 4;  5DRV A;  3OWS A;  1Q82 4;  3LTB A;  3F7X A;  8CHO A;  4RBN A;  3CCU 3;  2O3O A;  3SLU A;  3OXA A;  1A2K A;  1ROV A;  2HMJ B;  4AKZ A;  2Z76 A;  3J7Y d;  3KE7 A;  4LZI A;  1WNH A;  3G6E 3;  3OWU A;  1O7W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...