2GEYA

Crystal structure of aclr a putative hydroxylase from streptomyces galilaeus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
SMAERKALCLEMVAAWNRWDLSGIIKHWSPDIVHYSEDNEVSSADMVKLMEGGLKAFPDLQLEVKSIMAEEDRVALRITVTATHQGEFMGVQPTGQRVSWHLVEELRFVDGKVVEHWDVINMRPLLVRLGKLPDVPKVVLEASAKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AclR protein
publication title Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics
pubmed doi rcsb
source organism Streptomyces galilaeus
total genus 52
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2geyA00
4LGQA 2RGQA 3WMDA 5IERA 3NM2A 5STDA 1NU3A 3EF8A 4R9KA 6STDA 4LEHA 3EX9A 5BXQA 1JKGB 5HGRA 1STDA 1DMNA 3E99A 3ECFA 2W2CA 2IMJA 3NXJA 1EG9B 3STDA 1TP6A 4WYKA 1EA2A 5KP1A 3FLJA 4U13A 3H3HA 3HX8A 3RGRA 1OF5B 2INXA 5G2GA 1Q40B 2OWPA 3FH1A 2GBXB 3IPTA 3MG1A 1HKXA 3B7CA 4HM4B 5D83A 1O7HB 1A2KA 1JB4A 5IENA 4HM7B 1UUWB 1NWWA 3SEDA 5AEUB 5IF6A 3G8ZA 2RCDA 3GWRA 3RGAA 4R1KA 1O7WB 2QGUA 4X2OA 3VGNA 4FCJA 3G16A 2B24B 3A76A 3DM8A 3F40A 4H3UA 1O7GB 3MG2A 4XDWA 2BMRB 3B4OA 4Q53A 2B1XB 4KVHA 3F8HA 3OV4A 5CF1A 1ASKA 1OGXA 5CF2A 3SOYA 1JB5A 2CHCA 2XR8B 1GY5A 5KP4A 1E97A 5IG3A 1QJGA 3EBYA 5DREA 4XM4A 3UNLA 4ORLA 1ISKA 4I4KA 3SOAA 3D9RA 2HMKB 3JUQA 5FW5A 1GYBA 1OH0A 5IEOA 3KZTA 4IIAA 5JPPA 1VZZA 4XBYA 3NHXA 3CNMA 1W01A 3EBTA 2YFIB 1TUHA 4OVMA 1K41A 2XSOB 2A15A 3JUPA 3B8LA 1OCVA 4WP5A 3LZAA 4L8OA 1O7NB 4WWUC 5KP3A 3OWYA 1OF5A 4R9LA 4XBTA 1Q40A 5AIIA 2GXFA 4K1UA 1OHOA 2CKFB 5AIFA 4OUQA 3F8XA 4J8TA 1AR0A 3DMCA 3EQQB 3HK4A 1ULJB 3B4PA 3OWUA 1OHPA 5AIHA 4N3VA 2HMMB 3MKIA 3UJMA 2STDA 5IEPA 4L8PA 5DRVA 3I0YA 1JN5B 3FF2A 3CU3A 4MJDA 1E3VA 4X2HA 3F7SA 3FKAA 3LYGA 3H51A 3DZLA 3DUKA 3EJVA 4HM3B 5JPUA 2BMQB 1JB2A 1WQLB 4RZMA 2Z77A 3M8CA 1OUNA 3ER7A 3JUNA 2JQ5A 2GEYA 3GZBA 4HM5B 4XB5A 3FZWA 1W00A 1U5OA 1DMMA 3F14A 3NV0B 3MSOA 3T8NA 4L7KA 1OGZA 2K54A 4HM1B 4PEJA 3KKGA 1SJWA 7STDA 1BUQA 3VSYA 3GZRA 5IG4A 5D82A 2RFRA 1GY7A 2HMJB 1ULIB 5AEWB 4CDLA 1GS3A 4HM6B 4HM2B 1JKGA 1DMQA 3Q90A 3KSPA 5EVHA 3GZYB 5AI1A 5CXOA 4K1VA 4GB5A 1W6YA 3GZXB 2GBWB 4HJLB 5IG5A 1UUVB 2R4IA 4HM8B 5IG0A 3OWSA 3BLZA 3GRDA 3JUMA 3FF0A 1CQSA 1E3RA 3EN8A 4HZ9B 1QMAA 5BVBA 4HZBB 3F7XA 3T8UA 1O7MB 4HM0B 4WYKB 2GEXA 2Z76A 3JUOA 2XRXB 1C7HA 3CPOA 2YFJB 1JN5A 3FGYA 1OPYA 3OXAA 2UX0A 2F86B 4FCMA 4LMIA 3MHEA 2I9WA 2BNGA 4XDVA 5TGNA 1NDOB 3MYTA 3NBRA 2F98A 2Z7AA 2HMOB 1IDPA 2BMOB 3EHCA 3BB9A 3CNXA 2HMLB 4HVNA 3EC9A 2QIYA 2HMNB 1GY6A 1OHSA 5D81A 2PZVA 4STDA 3G0KA 2YFLB 3NV0A 3HZPA 1Q42A 4J9AA 3EN1B 3K0ZA 1W02A 4XBXA 3DXOA 1ZX2A 5AIGA 3OX9A 3ROBA 3FSDA 5CLKA 3S5CA 3F9SA 3K7CA 5CK6A 1ZO2A 3MG3A 3KE7A 1Z1SA 1S5AA 4HKVB 1O7PB 2XSHB 8CHOA 2F99A 3NUVA
chains in the Genus database with same CATH superfamily
3DY5A 1UCJA 4LGQA 5ELUA 2RGQA 1EEJA 1V57A 2OOVA 3WMDA 1MWTA 5IERA 1VQ93 1RTUA 5I97A 1I3FA 3NM2A 1B3SA 1BRHA 2KF4A 3X42A 5STDA 1NU3A 1GOYA 3K5TA 4K61A 1YIT3 1UUGB 3EF8A 1Q864 1LNHA 4R9KA 1FZUA 1T2HA 1X1UA 4BTWA 4H61A 6STDA 4LEHA 1N9EA 2C4BA 2F56A 4KZ1A 3S28A 3EX9A 5BXQA 1F8NA 2RNTA 1JKGB 5HGRA 1STDA 2MF7A 1RGFA 1J2BA 1VQ43 3MPHA 1DMNA 2LQVA 1MGRA 3E99A 3LOYA 3ECFA 2W2CA 1STFI 2IMJA 2CFLA 3G713 4TX4A 3NXJA 1EG9B 3STDA 1T2IA 1TP6A 1EA2A 4N6NB 4WYKA 4BL3A 5KP1A 1QVG2 3FLJA 2WOHA 2L4VA 1BANA 4U13A 3H3HA 3HX8A 1FGQA 2XGNA 3RGRA 1PU4A 1OF5B 1MNLA 2INXA 1WMOA 1JJ22 1RGAA 2O9UX 1Q40B 2OWPA 3IMAB 5G2GA 1BNFA 1N8R4 3FH1A 1W5ZA 1GD3A 1IQXA 2P05A 1VQ63 1RMSA 2GBXB 3D79A 4BTYA 2F5MA 3IPTA 2UGIA 3NBJA 3NQZA 4JRFA 1VQ53 3CD63 2CFWA 3HIGA 1YGEA 3MG1A 4R80A 4K90B 4O8SA 1I0XA 1FGOA 1BNJA 1IU7A 1HKXA 5IW9A 5JBSA 3B7CA 1EQKA 4HM4B 1UGIA 1V74A 5D83A 3WR2A 3S67A 3CCL3 1O7HB 1A2KA 3A5EA 1BSBA 3RDEA 2BT3A 1JB4A 1TTOA 4HM7B 5IENA 1Q824 1I3IA 1UUWB 1NWWA 3SEDA 4EC6A 5AEUB 1UI7A 4BL2A 5IF6A 2QA43 1KC84 2P38A 2YX9A 1NB5I 1RHLA 4KT3B 3G8ZA 1SPUA 2RCDA 2ZDJA 3GWRA 3Q3FA 4DKIA 2ZHXB 4EYCA 5EEOA 2CFDA 1BRKA 3I553 3RGAA 2BU4A 1U8CB 4BTXA 3DGLA 1RSNA 1GSPA 5A0OB 5G1KA 1IT8A 2PNCA 4R1KA 4N6TA 1O7WB 2QGUA 4X2OA 2CWUA 3VGNA 4FCJA 3G16A 3U97A 1B2SA 1BNEA 2RBIA 2B24B 3PS8A 3A76A 3DM8A 3F40A 4H3UA 4BIRA 3N8BA 3LTBA 1N5HA 3CC73 1O7GB 3MG2A 1RKYA 1WNHA 4XDWA 3PCSA 5HOHA 3KIIA 1HYFA 4WFOA 2GU1A 2BMRB 3B4OA 2M7OA 3RNTA 2W04A 1IV7A 4Q53A 2B1XB 3GAXA 4KVHA 4N6UA 3F8HA 3OV4A 4JF8A 5CF1A 1ASKA 3T0UA 1GD4A 1RGGA 1BSDA 1QVF2 3KFQC 1OGXA 1CYVA 5CF2A 2HOHA 3SOYA 3DGNA 1JB5A 2CHCA 2WGOA 3KSED 2XR8B 1JZDA 2Z6BA 2QEX3 1GY5A 5KP4A 1E97A 1LOXA 5IG3A 1KD14 1QJGA 1AQZA 1FUTA 3EBYA 3BIRA 2F5WA 2FNQA 1WMNA 1W2ZA 3G4S3 1TFKA 1YNVX 4RNZA 1V58A 5DREA 1IV9A 3NQYA 4XM4A 3CCR3 4GSPA 3UNLA 3DH2A 3AGNA 4ORLA 3N54B 1I8VA 1ISKA 4I4KA 3SOAA 1RGKA 3D9RA 3CCV3 1BUJA 2HMKB 1I2GA 1QALA 3JUQA 2SBLA 5FW5A 1VQ83 1RGCA 3IJEB 1RDSA 1GYBA 1OH0A 1GOVA 1MWRA 4I5QA 5IEOA 2F4YA 1LXEA 3KZTA 4IIAA 3CPW2 1GMRA 3I563 1A2PA 1TFOA 3NX0A 5JPPA 3URPA 1VZZA 1HZ1A 4O2HA 4XBYA 3X3ZA 3NHXA 2ML5A 1MOLA 3CNMA 1W2B2 1A67A 2H0GA 1K9M4 4MMZB 1W01A 3EBTA 4NREA 2YFIB 1IYYA 1YVBI 1TUHA 3FG4A 1LOYA 2P09A 1K41A 4OVMA 2XSOB 1BNRA 2A15A 1W6CA 2XEPA 3JUPA 4WHAA 3B8LA 1OCVA 4WP5A 2CH9A 3V92A 2OQEC 6RNTA 4N6OB 1YJW3 3LZAA 4L8OA 3N9HA 3SX1A 2IYJA 2ZA4A 1TU5A 1O7NB 1Q7HA 2W6JH 3K9MC 3OWYA 4WWUC 5KP3A 1SIHA 4O3VA 1OF5A 1Y4KA 4R9LA 4XBTA 3GSPA 9RNTA 1Q40A 3KN4A 4BU4A 1RRHA 2WO0A 1D6YA 4LZIA 5GSPA 5AIIA 1LQMB 2GXFA 1T3BA 4K1UA 1BVIA 1BSEA 3WDGB 1BIRA 2W03A 1OHOA 2LYXA 3HIIA 5BU4A 1BRSA 1UGHI 2CKFB 4QWTA 5AIFA 4EW5A 4OUQA 3CCS3 2CWTA 2IUKA 3NM7A 3UB1A 3F8XA 3X40A 4ZM8A 4J8TA 1X1YA 1M1XB 3BNEA 1AR0A 3DMCA 3EQQB 3LT9A 2XF3A 2P0MA 2JDIH 2ZL8A 3G6E3 1BU4A 1D6UA 3HK4A 3VF1A 4J5GA 1ULJB 3B4PA 3K63A 1UDII 3CMA3 1LOWA 3OWUA 1KQS2 1OHPA 1JV2B 3Q2PA 5AIHA 3WODG 4N3VA 1C54A 1G0TA 1ROVA 1NO3A 1YGWA 2HMMB 4HOHA 1SIIA 3MKIA 4RNTA 2STDA 1IVUA 1CEWI 3HOHA 3SYUA 3UJMA 2W56B 4N6V0 4L8PA 6GSPA 5DRVA 2C10A 3AGOA 1UI8A 1WTHA 5LC6A 3I0YA 2CWVA 1JRQA 1VQP3 1JN5B 3V99A 3FF2A 3CU3A 1MWUA 1RN7A 2Y73A 3FCSB 3S27A 2H0HA 2K3DA 1UCIA 2CW9A 4MJDA 5AYRB 1JZOA 1X1WA 1E3VA 2CX0A 4X2HA 3WA2X 3F7SA 1K734 1NJI4 3V98A 1YI23 1RN4A 3FKAA 1A90A 1Q7Y4 3D4AA 1RN1A 1AY7A 3LYGA 1I2EA 1IVXA 2IUJA 3H51A 2OCTA 2CK3H 1VQO3 3DZLA 3DUKA 3EB8A 3EJVA 4HM3B 5JPUA 1M904 2BMQB 5M19A 1JB2A 2E2VA 1DVCA 1WQLB 1YIJ3 1T5YA 4GHOA 4RZMA 1LVNA 3L0RA 2Z77A 1N5PA 3M8CA 1OUNA 1G96A 2XFTA 3EE1A 1RJOA 1BSAA 1BRGA 1IK3A 1I70A 3ER7A 3JUNA 4FMBA 1BGSA 2JQ5A 1RGLA 2GEYA 1EUIC 3OW22 3GZBA 3QRDA 2WGQA 4HM5B 1Q814 2KF6A 1YVSA 4XB5A 3FZWA 2CFGA 1W00A 4NHFA 1U5OA 3FG1A 1DMMA 3F14A 2OTJ3 1G02A 1B2XA 3NV0B 1BRIA 3MSOA 3T8NA 2C11A 4L7KA 1LNIA 3AMOB 5EQLA 4AEQA 1OGZA 2OOVC 1VQQA 1US1A 2K54A 4HM1B 4PEJA 3KKGA 1SJWA 4FMAA 4HYZA 7STDA 1BUQA 3TDGA 1B21A 3VSYA 3LT8A 3GZRA 1W4NA 2XFSA 5IG4A 5D82A 1QAFA 2RFRA 4RNYA 4G1MB 4IT7A 3PYJA 4CJNA 1N9JA 3X3YA 1GY7A 4EV2A 2W9PA 3D3LA 3MWZA 2HMJB 1ULIB 1JBSA 1K8A4 3NBBA 1UW1A 4GL6A 1FW7A 1B2UA 1TRPA 4J5KA 5AYSC 2KXGA 1BRJA 5AEWB 1LQGC 4CDLA 1GS3A 1JBTA 3LH4A 4HM6B 2IY2A 1R4YA 1JKGA 2RSXA 4HBRA 1DMQA 1HU9A 3Q90A 3QK9A 4HM2B 1W6GA 2IA7A 3KSPA 3CC23 3CCE3 1S723 2OTL3 1UCLA 5EVHA 1RNTA 3X41A 3GZYB 1WMPA 1FUSA 5AI1A 2UUGC 1I0VA 4LYLB 1M1K4 5CXOA 1B2MA 3PGBA 3U1WA 4EXRA 1BNGA 1VQL3 2BIRA 2Q07A 4K1VA 3CME3 4GB5A 3PXMA 1W6YA 4ILFA 1RCKA 3GZXB 5FGOA 2GBWB 3Q1CA 3SLUA 4HJLB 5IG5A 1LRAA 1MWSA 2CG0A 3CCQ3 1UUVB 2MC8A 2R4IA 1AV4A 4AKYA 1RNBA 1B20A 4MMYB 2H0IA 4HM8B 5IG0A 3BU4A 3OWSA 3DGOA 3BLZA 4CPKA 1VQK3 4KFFA 3GRDA 1X1XA 1PY3A 1K28A 4N6LA 1FGTA 3CCJ3 5LC7A 1I2FA 3FF0A 1CQSA 2AADA 2KCDA 3JUMA 2K0MA 3LTCA 3X3XA 1E3RA 3EN8A 1VQM3 1DE3A 1RLSA 4HZ9B 1QMAA 4KFDA 4HZBB 5BVBA 2KF3A 2D1WA 4KFEA 1GMQA 3WA3A 1ZS7A 1EKMA 3F7XA 3LMLA 2CG1A 1BNIA 3T8UA 8RNTA 1SQWA 3BNBA 1GOUA 1Q9EA 2E2UA 2BHMA 2Y74A 1O7MB 4FCZA 4HM0B 5ELJA 1YHQ3 3CC43 3CXC2 1VQN3 4WYKB 1A2VA 1MGWA 3D5IA 2CC3A 3SVAA 1RCLA 2W56A 3O8YA 2GEXA 4LSOA 1ZGXA 2Z76A 3CCU3 4OK0A 2OQEA 1NNVA 2XRXB 3FG3A 3JUOA 1C7HA 3CPOA 3PCRA 3WOEB 5BIRA 4CCVA 2YFJB 4NPBA 1NB3I 3ZFZA 1TRQA 1FGRA 1JN5A 3FGYA 1OPYA 4N6MA 1IT7A 1YJ93 3OXAA 2UX0A 2XH9A 3LTAA 1IQ8A 2F86B 3WOFB 3WHOA 4FCMA 4LMIA 3DGYA 2AAEA 3MHEA 2E2TA 2I9WA 2BNGA 2KAAA 1SARA 4XDVA 4FMCA 3D5GA 5TGNA 1NDOB 1UCKA 3BNCA 1OACA 3MYTA 1L5GB 1RGHA 1AVLA 2W9QA 1B27A 3NBRA 5M18A 3DGMA 2FGTA 4MEIA 2BO9B 2F98A 4R4KA 2Z7AA 2HMOB 1TJDA 1IDPA 1BNSA 1W7CA 3CCM3 1DVDA 2GU3A 3BNDA 2BMOB 4FR9A 3ZG5A 1PFPA 3EHCA 3BB9A 3KCHA 1N8QA 3CNXA 2HMLB 4HVNA 1BSCA 1CH0A 3LXUX 2W0QA 3EC9A 2QIYA 4IPBA 4RBNA 5IEPA 1FUWA 2HMNB 2KRTA 1GY6A 1FA3A 3JVCA 1OHSA 5D81A 2P0XA 2PZVA 1ROAA 5RNTA 1DYUA 3J7Yd 1BRNL 2CX1A 2V1LA 1CYUA 4STDA 2J8XB 3G0KA 1JBRA 2YFLB 3NV0A 3ZG0A 3HZPA 3AMOA 1Q42A 1BOXA 2FXTA 1IVWA 5M1AA 4J9AA 3HI7A 1AVKA 3EN1B 3S29A 2ML6A 3K0ZA 3AHWA 2CFKA 1W02A 4FMDA 4XBXA 2R41A 3DXOA 3UL5A 1TIJA 2CIUA 1ZX2A 1D6ZA 4HAAA 4O02B 5AIGA 1VQ73 3AHSA 3OX9A 3ROBA 2L1SA 3FSDA 3ALAA 5CLKA 3S5CA 5G1LA 2O3OA 3SXXA 3F9SA 1FGMA 3PZWA 4EBGA 3UL6A 4EV5A 3K7CA 1JNQA 5CK6A 1PYLA 1DETA 1KWIA 1ZO2A 2GSPA 4AKZA 3MG3A 4MMXB 7GSPA 3LTDA 1LOVA 3KE7A 1IQYA 1GMPA 1Z1SA 1S5AA 4HKVB 7RNTA 1R4CA 1RGEA 1RRLA 2D42A 1BAOA 1M9GA 1IVVA 2SARA 1O7PB 2KF5A 2XGLA 1QAKA 2XSHB 8CHOA 1KSIA 2F99A 3NUVA 1B2ZA 1FYSA 1YJN3 2WOFA
chains in the Genus database with same CATH topology
3DY5A 4LGQA 5ELUA 2RGQA 3WMDA 2OOVA 5IERA 1VQ93 5I97A 3NM2A 3X42A 5STDA 1NU3A 4K61A 3K5TA 1Q864 1YIT3 3EF8A 1LNHA 4R9KA 4BTWA 4H61A 6STDA 4LEHA 1N9EA 4KZ1A 3S28A 3EX9A 5BXQA 1F8NA 1JKGB 5HGRA 1STDA 2MF7A 1J2BA 1VQ43 3MPHA 1DMNA 2LQVA 3E99A 3LOYA 3ECFA 2W2CA 1STFI 2IMJA 2CFLA 3G713 4TX4A 3NXJA 1EG9B 3STDA 1TP6A 4N6NB 1EA2A 4WYKA 5KP1A 1QVG2 3FLJA 2WOHA 2L4VA 4U13A 3H3HA 3HX8A 1FGQA 2XGNA 3RGRA 1PU4A 1OF5B 1MNLA 2INXA 1WMOA 1JJ22 2O9UX 1Q40B 2OWPA 3IMAB 5G2GA 1N8R4 3FH1A 1W5ZA 1GD3A 1IQXA 2P05A 1VQ63 2GBXB 4BTYA 3IPTA 4JRFA 3NBJA 3NQZA 1VQ53 3CD63 2CFWA 3HIGA 1YGEA 3MG1A 4R80A 4K90B 4O8SA 1FGOA 1IU7A 1HKXA 5IW9A 5JBSA 3B7CA 1EQKA 4HM4B 5D83A 1V74A 3S67A 3CCL3 1O7HB 1A2KA 3RDEA 2BT3A 1JB4A 5IENA 4HM7B 1Q824 1UUWB 1NWWA 3SEDA 4EC6A 5AEUB 1UI7A 5IF6A 2QA43 1KC84 2P38A 2YX9A 1NB5I 3G8ZA 1SPUA 2RCDA 2ZDJA 3GWRA 4EYCA 5EEOA 2CFDA 3I553 3RGAA 1U8CB 4BTXA 3DGLA 5A0OB 1IT8A 2PNCA 4R1KA 4N6TA 1O7WB 2QGUA 4X2OA 2CWUA 3VGNA 4FCJA 3G16A 3U97A 2B24B 3PS8A 3A76A 3DM8A 3F40A 4H3UA 3N8BA 3LTBA 1N5HA 3CC73 1O7GB 3MG2A 1RKYA 1WNHA 4XDWA 3PCSA 3KIIA 4WFOA 2GU1A 3B4OA 2BMRB 2M7OA 2W04A 1IV7A 4Q53A 2B1XB 3GAXA 4KVHA 4N6UA 3F8HA 3OV4A 4JF8A 5CF1A 1ASKA 3T0UA 1GD4A 1QVF2 3KFQC 1OGXA 1CYVA 5CF2A 3SOYA 3DGNA 1JB5A 2CHCA 2WGOA 3KSED 2XR8B 2Z6BA 2QEX3 1GY5A 5KP4A 1E97A 1LOXA 5IG3A 1KD14 1QJGA 3EBYA 2FNQA 1WMNA 1W2ZA 3G4S3 1TFKA 4RNZA 5DREA 1IV9A 3NQYA 4XM4A 3CCR3 3UNLA 4ORLA 3N54B 1ISKA 4I4KA 3SOAA 3D9RA 3CCV3 2HMKB 3JUQA 1QALA 1VQ83 2SBLA 5FW5A 3IJEB 1GYBA 1OH0A 5IEOA 3KZTA 1LXEA 4IIAA 3CPW2 3I563 1TFOA 3NX0A 5JPPA 1VZZA 4O2HA 4XBYA 3X3ZA 3NHXA 2ML5A 1MOLA 3CNMA 1W2B2 1A67A 1K9M4 4MMZB 1W01A 3EBTA 4NREA 2YFIB 1YVBI 1TUHA 3FG4A 2P09A 1K41A 4OVMA 2XSOB 2A15A 1W6CA 2XEPA 3JUPA 4WHAA 3B8LA 1OCVA 4WP5A 2CH9A 3V92A 2OQEC 4N6OB 1YJW3 3LZAA 4L8OA 3N9HA 3SX1A 1TU5A 1O7NB 2W6JH 3K9MC 4WWUC 3OWYA 5KP3A 1SIHA 4O3VA 1OF5A 1Y4KA 4R9LA 4XBTA 1Q40A 3KN4A 1RRHA 2WO0A 1D6YA 4LZIA 5AIIA 2GXFA 4K1UA 3WDGB 2W03A 1OHOA 2LYXA 3HIIA 2CKFB 4QWTA 5AIFA 3CCS3 4OUQA 3CCU3 2CWTA 2IUKA 3NM7A 3UB1A 3F8XA 3X40A 4ZM8A 4J8TA 1M1XB 3BNEA 1AR0A 3DMCA 3EQQB 3LT9A 2XF3A 2P0MA 2JDIH 2ZL8A 3G6E3 1D6UA 3HK4A 3VF1A 1ULJB 3B4PA 3K63A 3CMA3 3OWUA 1KQS2 1OHPA 1JV2B 3Q2PA 5AIHA 3WODG 4N3VA 1ROVA 1NO3A 2HMMB 1SIIA 3MKIA 3UJMA 2STDA 1IVUA 1CEWI 5IEPA 2W56B 4N6V0 4L8PA 5DRVA 2C10A 1UI8A 1WTHA 5LC6A 3I0YA 2CWVA 1JRQA 1VQP3 1JN5B 3V99A 3FF2A 3CU3A 1RN7A 2Y73A 3S27A 3FCSB 2CW9A 4MJDA 5AYRB 1E3VA 4X2HA 3WA2X 1NJI4 3F7SA 1K734 3V98A 1YI23 3FKAA 1A90A 1Q7Y4 3LYGA 1IVXA 2IUJA 3H51A 2OCTA 2CK3H 1VQO3 3DZLA 3DUKA 3EB8A 3EJVA 4HM3B 5JPUA 1M904 2BMQB 1JB2A 2E2VA 1DVCA 1WQLB 1YIJ3 1T5YA 4RZMA 1LVNA 3L0RA 2Z77A 1N5PA 3M8CA 1OUNA 1G96A 2XFTA 3EE1A 1RJOA 1IK3A 4FMBA 3ER7A 3JUNA 2JQ5A 2GEYA 3OW22 3GZBA 3QRDA 2WGQA 4HM5B 1Q814 4XB5A 3FZWA 2CFGA 1W00A 4NHFA 1U5OA 3FG1A 1DMMA 3F14A 2OTJ3 3NV0B 3MSOA 3T8NA 2C11A 4L7KA 4AEQA 3AMOB 5EQLA 1OGZA 2OOVC 2K54A 1US1A 4HM1B 4PEJA 3KKGA 1SJWA 4FMAA 4HYZA 7STDA 1BUQA 3TDGA 3VSYA 3LT8A 3GZRA 1W4NA 2XFSA 5IG4A 5D82A 1QAFA 2RFRA 4RNYA 4G1MB 4IT7A 3PYJA 1N9JA 3X3YA 1GY7A 4EV2A 2W9PA 3D3LA 3MWZA 2HMJB 1ULIB 1K8A4 3NBBA 1UW1A 4GL6A 5AYSC 2KXGA 5AEWB 4CDLA 1GS3A 3LH4A 4HM6B 4HM2B 1JKGA 2RSXA 4HBRA 1DMQA 1HU9A 3Q90A 3QK9A 2MC8A 1W6GA 2IA7A 3KSPA 3CC23 3CCE3 1S723 2OTL3 5EVHA 3X41A 3GZYB 1WMPA 1M1K4 5AI1A 5CXOA 3PGBA 3U1WA 4EXRA 1VQL3 2Q07A 4K1VA 3CME3 4GB5A 3PXMA 1W6YA 3GZXB 5FGOA 2GBWB 3Q1CA 3SLUA 4HJLB 5IG5A 3CCQ3 2CG0A 1UUVB 2R4IA 1AV4A 4AKYA 4MMYB 4HM8B 5IG0A 3OWSA 3DGOA 3BLZA 1VQK3 4KFFA 3GRDA 1K28A 4N6LA 1FGTA 3CCJ3 5LC7A 3JUMA 3FF0A 1CQSA 2KCDA 3X3XA 2K0MA 3LTCA 1E3RA 3EN8A 1VQM3 4HZ9B 1QMAA 4KFDA 4HZBB 5BVBA 2D1WA 4KFEA 3WA3A 1EKMA 3F7XA 3LMLA 2CG1A 3T8UA 1SQWA 3BNBA 2E2UA 2Y74A 2BHMA 4FCZA 1O7MB 4HM0B 5ELJA 1YHQ3 3CC43 1VQN3 3CXC2 4WYKB 1A2VA 2CC3A 3SVAA 2W56A 3O8YA 2GEXA 4LSOA 2Z76A 4OK0A 2OQEA 3JUOA 2XRXB 3FG3A 1C7HA 3CPOA 3PCRA 3WOEB 4CCVA 2YFJB 1NB3I 1FGRA 1JN5A 3FGYA 1OPYA 4N6MA 1IT7A 1YJ93 3OXAA 2UX0A 2XH9A 3LTAA 1IQ8A 2F86B 3WOFB 4FCMA 4LMIA 3MHEA 2E2TA 2I9WA 2BNGA 4XDVA 4FMCA 5TGNA 1NDOB 3BNCA 1OACA 3MYTA 1L5GB 1AVLA 2W9QA 3NBRA 3DGMA 2FGTA 4MEIA 2BO9B 2F98A 4R4KA 2Z7AA 2HMOB 1DVDA 1IDPA 1W7CA 3CCM3 2GU3A 3BNDA 2BMOB 4FR9A 1PFPA 3EHCA 3BB9A 1N8QA 3CNXA 2HMLB 4HVNA 3LXUX 2W0QA 3EC9A 2QIYA 4IPBA 4RBNA 1FUWA 2HMNB 2KRTA 1GY6A 1FA3A 3JVCA 1OHSA 5D81A 2P0XA 2PZVA 1ROAA 3J7Yd 1DYUA 1CYUA 2V1LA 4STDA 3G0KA 2YFLB 3NV0A 3HZPA 3AMOA 1Q42A 2FXTA 1IVWA 4J9AA 3HI7A 1AVKA 3EN1B 3S29A 2ML6A 3K0ZA 2CFKA 1W02A 4FMDA 4XBXA 3DXOA 3UL5A 1TIJA 2CIUA 1ZX2A 1D6ZA 1VQ73 4O02B 5AIGA 3OX9A 3ROBA 3FSDA 5CLKA 3ALAA 3S5CA 2O3OA 3SXXA 3F9SA 1FGMA 3PZWA 4EBGA 3UL6A 4EV5A 3K7CA 1JNQA 5CK6A 1KWIA 1ZO2A 4AKZA 3MG3A 4MMXB 3LTDA 3KE7A 1IQYA 1Z1SA 1S5AA 4HKVB 1R4CA 1RRLA 2D42A 1M9GA 1IVVA 1O7PB 2XGLA 1QAKA 2XSHB 8CHOA 1KSIA 2F99A 3NUVA 1YJN3 2WOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LGQ A;  2RGQ A;  3WMD A;  5IER A;  3NM2 A;  5STD A;  1NU3 A;  3EF8 A;  4R9K A;  6STD A;  4LEH A;  3EX9 A;  5BXQ A;  1JKG B;  5HGR A;  1STD A;  1DMN A;  3E99 A;  3ECF A;  2W2C A;  2IMJ A;  3NXJ A;  1EG9 B;  3STD A;  1TP6 A;  4WYK A;  1EA2 A;  5KP1 A;  3FLJ A;  4U13 A;  3H3H A;  3HX8 A;  3RGR A;  1OF5 B;  2INX A;  5G2G A;  1Q40 B;  2OWP A;  3FH1 A;  2GBX B;  3IPT A;  3MG1 A;  1HKX A;  3B7C A;  4HM4 B;  5D83 A;  1O7H B;  1A2K A;  1JB4 A;  5IEN A;  4HM7 B;  1UUW B;  1NWW A;  3SED A;  5AEU B;  5IF6 A;  3G8Z A;  2RCD A;  3GWR A;  3RGA A;  4R1K A;  1O7W B;  2QGU A;  4X2O A;  3VGN A;  4FCJ A;  3G16 A;  2B24 B;  3A76 A;  3DM8 A;  3F40 A;  4H3U A;  1O7G B;  3MG2 A;  4XDW A;  2BMR B;  3B4O A;  4Q53 A;  2B1X B;  4KVH A;  3F8H A;  3OV4 A;  5CF1 A;  1ASK A;  1OGX A;  5CF2 A;  3SOY A;  1JB5 A;  2CHC A;  2XR8 B;  1GY5 A;  5KP4 A;  1E97 A;  5IG3 A;  1QJG A;  3EBY A;  5DRE A;  4XM4 A;  3UNL A;  4ORL A;  1ISK A;  4I4K A;  3SOA A;  3D9R A;  2HMK B;  3JUQ A;  5FW5 A;  1GYB A;  1OH0 A;  5IEO A;  3KZT A;  4IIA A;  5JPP A;  1VZZ A;  4XBY A;  3NHX A;  3CNM A;  1W01 A;  3EBT A;  2YFI B;  1TUH A;  4OVM A;  1K41 A;  2XSO B;  2A15 A;  3JUP A;  3B8L A;  1OCV A;  4WP5 A;  3LZA A;  4L8O A;  1O7N B;  4WWU C;  5KP3 A;  3OWY A;  1OF5 A;  4R9L A;  4XBT A;  1Q40 A;  5AII A;  2GXF A;  4K1U A;  1OHO A;  2CKF B;  5AIF A;  4OUQ A;  3F8X A;  4J8T A;  1AR0 A;  3DMC A;  3EQQ B;  3HK4 A;  1ULJ B;  3B4P A;  3OWU A;  1OHP A;  5AIH A;  4N3V A;  2HMM B;  3MKI A;  3UJM A;  2STD A;  5IEP A;  4L8P A;  5DRV A;  3I0Y A;  1JN5 B;  3FF2 A;  3CU3 A;  4MJD A;  1E3V A;  4X2H A;  3F7S A;  3FKA A;  3LYG A;  3H51 A;  3DZL A;  3DUK A;  3EJV A;  4HM3 B;  5JPU A;  2BMQ B;  1JB2 A;  1WQL B;  4RZM A;  2Z77 A;  3M8C A;  1OUN A;  3ER7 A;  3JUN A;  2JQ5 A;  2GEY A;  3GZB A;  4HM5 B;  4XB5 A;  3FZW A;  1W00 A;  1U5O A;  1DMM A;  3F14 A;  3NV0 B;  3MSO A;  3T8N A;  4L7K A;  1OGZ A;  2K54 A;  4HM1 B;  4PEJ A;  3KKG A;  1SJW A;  7STD A;  1BUQ A;  3VSY A;  3GZR A;  5IG4 A;  5D82 A;  2RFR A;  1GY7 A;  2HMJ B;  1ULI B;  5AEW B;  4CDL A;  1GS3 A;  4HM6 B;  4HM2 B;  1JKG A;  1DMQ A;  3Q90 A;  3KSP A;  5EVH A;  3GZY B;  5AI1 A;  5CXO A;  4K1V A;  4GB5 A;  1W6Y A;  3GZX B;  2GBW B;  4HJL B;  5IG5 A;  1UUV B;  2R4I A;  4HM8 B;  5IG0 A;  3OWS A;  3BLZ A;  3GRD A;  3JUM A;  3FF0 A;  1CQS A;  1E3R A;  3EN8 A;  4HZ9 B;  1QMA A;  5BVB A;  4HZB B;  3F7X A;  3T8U A;  1O7M B;  4HM0 B;  4WYK B;  2GEX A;  2Z76 A;  3JUO A;  2XRX B;  1C7H A;  3CPO A;  2YFJ B;  1JN5 A;  3FGY A;  1OPY A;  3OXA A;  2UX0 A;  2F86 B;  4FCM A;  4LMI A;  3MHE A;  2I9W A;  2BNG A;  4XDV A;  5TGN A;  1NDO B;  3MYT A;  3NBR A;  2F98 A;  2Z7A A;  2HMO B;  1IDP A;  2BMO B;  3EHC A;  3BB9 A;  3CNX A;  2HML B;  4HVN A;  3EC9 A;  2QIY A;  2HMN B;  1GY6 A;  1OHS A;  5D81 A;  2PZV A;  4STD A;  3G0K A;  2YFL B;  3NV0 A;  3HZP A;  1Q42 A;  4J9A A;  3EN1 B;  3K0Z A;  1W02 A;  4XBX A;  3DXO A;  1ZX2 A;  5AIG A;  3OX9 A;  3ROB A;  3FSD A;  5CLK A;  3S5C A;  3F9S A;  3K7C A;  5CK6 A;  1ZO2 A;  3MG3 A;  3KE7 A;  1Z1S A;  1S5A A;  4HKV B;  1O7P B;  2XSH B;  8CHO A;  2F99 A;  3NUV A; 
#chains in the Genus database with same CATH topology
 3DY5 A;  1UCJ A;  4LGQ A;  5ELU A;  2RGQ A;  1EEJ A;  1V57 A;  2OOV A;  3WMD A;  1MWT A;  5IER A;  1VQ9 3;  1RTU A;  5I97 A;  1I3F A;  3NM2 A;  1B3S A;  1BRH A;  2KF4 A;  3X42 A;  5STD A;  1NU3 A;  1GOY A;  3K5T A;  4K61 A;  1YIT 3;  1UUG B;  3EF8 A;  1Q86 4;  1LNH A;  4R9K A;  1FZU A;  1T2H A;  1X1U A;  4BTW A;  4H61 A;  6STD A;  4LEH A;  1N9E A;  2C4B A;  2F56 A;  4KZ1 A;  3S28 A;  3EX9 A;  5BXQ A;  1F8N A;  2RNT A;  1JKG B;  5HGR A;  1STD A;  2MF7 A;  1RGF A;  1J2B A;  1VQ4 3;  3MPH A;  1DMN A;  2LQV A;  1MGR A;  3E99 A;  3LOY A;  3ECF A;  2W2C A;  1STF I;  2IMJ A;  2CFL A;  3G71 3;  4TX4 A;  3NXJ A;  1EG9 B;  3STD A;  1T2I A;  1TP6 A;  1EA2 A;  4N6N B;  4WYK A;  4BL3 A;  5KP1 A;  1QVG 2;  3FLJ A;  2WOH A;  2L4V A;  1BAN A;  4U13 A;  3H3H A;  3HX8 A;  1FGQ A;  2XGN A;  3RGR A;  1PU4 A;  1OF5 B;  1MNL A;  2INX A;  1WMO A;  1JJ2 2;  1RGA A;  2O9U X;  1Q40 B;  2OWP A;  3IMA B;  5G2G A;  1BNF A;  1N8R 4;  3FH1 A;  1W5Z A;  1GD3 A;  1IQX A;  2P05 A;  1VQ6 3;  1RMS A;  2GBX B;  3D79 A;  4BTY A;  2F5M A;  3IPT A;  2UGI A;  3NBJ A;  3NQZ A;  4JRF A;  1VQ5 3;  3CD6 3;  2CFW A;  3HIG A;  1YGE A;  3MG1 A;  4R80 A;  4K90 B;  4O8S A;  1I0X A;  1FGO A;  1BNJ A;  1IU7 A;  1HKX A;  5IW9 A;  5JBS A;  3B7C A;  1EQK A;  4HM4 B;  1UGI A;  1V74 A;  5D83 A;  3WR2 A;  3S67 A;  3CCL 3;  1O7H B;  1A2K A;  3A5E A;  1BSB A;  3RDE A;  2BT3 A;  1JB4 A;  1TTO A;  4HM7 B;  5IEN A;  1Q82 4;  1I3I A;  1UUW B;  1NWW A;  3SED A;  4EC6 A;  5AEU B;  1UI7 A;  4BL2 A;  5IF6 A;  2QA4 3;  1KC8 4;  2P38 A;  2YX9 A;  1NB5 I;  1RHL A;  4KT3 B;  3G8Z A;  1SPU A;  2RCD A;  2ZDJ A;  3GWR A;  3Q3F A;  4DKI A;  2ZHX B;  4EYC A;  5EEO A;  2CFD A;  1BRK A;  3I55 3;  3RGA A;  2BU4 A;  1U8C B;  4BTX A;  3DGL A;  1RSN A;  1GSP A;  5A0O B;  5G1K A;  1IT8 A;  2PNC A;  4R1K A;  4N6T A;  1O7W B;  2QGU A;  4X2O A;  2CWU A;  3VGN A;  4FCJ A;  3G16 A;  3U97 A;  1B2S A;  1BNE A;  2RBI A;  2B24 B;  3PS8 A;  3A76 A;  3DM8 A;  3F40 A;  4H3U A;  4BIR A;  3N8B A;  3LTB A;  1N5H A;  3CC7 3;  1O7G B;  3MG2 A;  1RKY A;  1WNH A;  4XDW A;  3PCS A;  5HOH A;  3KII A;  1HYF A;  4WFO A;  2GU1 A;  2BMR B;  3B4O A;  2M7O A;  3RNT A;  2W04 A;  1IV7 A;  4Q53 A;  2B1X B;  3GAX A;  4KVH A;  4N6U A;  3F8H A;  3OV4 A;  4JF8 A;  5CF1 A;  1ASK A;  3T0U A;  1GD4 A;  1RGG A;  1BSD A;  1QVF 2;  3KFQ C;  1OGX A;  1CYV A;  5CF2 A;  2HOH A;  3SOY A;  3DGN A;  1JB5 A;  2CHC A;  2WGO A;  3KSE D;  2XR8 B;  1JZD A;  2Z6B A;  2QEX 3;  1GY5 A;  5KP4 A;  1E97 A;  1LOX A;  5IG3 A;  1KD1 4;  1QJG A;  1AQZ A;  1FUT A;  3EBY A;  3BIR A;  2F5W A;  2FNQ A;  1WMN A;  1W2Z A;  3G4S 3;  1TFK A;  1YNV X;  4RNZ A;  1V58 A;  5DRE A;  1IV9 A;  3NQY A;  4XM4 A;  3CCR 3;  4GSP A;  3UNL A;  3DH2 A;  3AGN A;  4ORL A;  3N54 B;  1I8V A;  1ISK A;  4I4K A;  3SOA A;  1RGK A;  3D9R A;  3CCV 3;  1BUJ A;  2HMK B;  1I2G A;  1QAL A;  3JUQ A;  2SBL A;  5FW5 A;  1VQ8 3;  1RGC A;  3IJE B;  1RDS A;  1GYB A;  1OH0 A;  1GOV A;  1MWR A;  4I5Q A;  5IEO A;  2F4Y A;  1LXE A;  3KZT A;  4IIA A;  3CPW 2;  1GMR A;  3I56 3;  1A2P A;  1TFO A;  3NX0 A;  5JPP A;  3URP A;  1VZZ A;  1HZ1 A;  4O2H A;  4XBY A;  3X3Z A;  3NHX A;  2ML5 A;  1MOL A;  3CNM A;  1W2B 2;  1A67 A;  2H0G A;  1K9M 4;  4MMZ B;  1W01 A;  3EBT A;  4NRE A;  2YFI B;  1IYY A;  1YVB I;  1TUH A;  3FG4 A;  1LOY A;  2P09 A;  1K41 A;  4OVM A;  2XSO B;  1BNR A;  2A15 A;  1W6C A;  2XEP A;  3JUP A;  4WHA A;  3B8L A;  1OCV A;  4WP5 A;  2CH9 A;  3V92 A;  2OQE C;  6RNT A;  4N6O B;  1YJW 3;  3LZA A;  4L8O A;  3N9H A;  3SX1 A;  2IYJ A;  2ZA4 A;  1TU5 A;  1O7N B;  1Q7H A;  2W6J H;  3K9M C;  3OWY A;  4WWU C;  5KP3 A;  1SIH A;  4O3V A;  1OF5 A;  1Y4K A;  4R9L A;  4XBT A;  3GSP A;  9RNT A;  1Q40 A;  3KN4 A;  4BU4 A;  1RRH A;  2WO0 A;  1D6Y A;  4LZI A;  5GSP A;  5AII A;  1LQM B;  2GXF A;  1T3B A;  4K1U A;  1BVI A;  1BSE A;  3WDG B;  1BIR A;  2W03 A;  1OHO A;  2LYX A;  3HII A;  5BU4 A;  1BRS A;  1UGH I;  2CKF B;  4QWT A;  5AIF A;  4EW5 A;  4OUQ A;  3CCS 3;  2CWT A;  2IUK A;  3NM7 A;  3UB1 A;  3F8X A;  3X40 A;  4ZM8 A;  4J8T A;  1X1Y A;  1M1X B;  3BNE A;  1AR0 A;  3DMC A;  3EQQ B;  3LT9 A;  2XF3 A;  2P0M A;  2JDI H;  2ZL8 A;  3G6E 3;  1BU4 A;  1D6U A;  3HK4 A;  3VF1 A;  4J5G A;  1ULJ B;  3B4P A;  3K63 A;  1UDI I;  3CMA 3;  1LOW A;  3OWU A;  1KQS 2;  1OHP A;  1JV2 B;  3Q2P A;  5AIH A;  3WOD G;  4N3V A;  1C54 A;  1G0T A;  1ROV A;  1NO3 A;  1YGW A;  2HMM B;  4HOH A;  1SII A;  3MKI A;  4RNT A;  2STD A;  1IVU A;  1CEW I;  3HOH A;  3SYU A;  3UJM A;  2W56 B;  4N6V 0;  4L8P A;  6GSP A;  5DRV A;  2C10 A;  3AGO A;  1UI8 A;  1WTH A;  5LC6 A;  3I0Y A;  2CWV A;  1JRQ A;  1VQP 3;  1JN5 B;  3V99 A;  3FF2 A;  3CU3 A;  1MWU A;  1RN7 A;  2Y73 A;  3FCS B;  3S27 A;  2H0H A;  2K3D A;  1UCI A;  2CW9 A;  4MJD A;  5AYR B;  1JZO A;  1X1W A;  1E3V A;  2CX0 A;  4X2H A;  3WA2 X;  3F7S A;  1K73 4;  1NJI 4;  3V98 A;  1YI2 3;  1RN4 A;  3FKA A;  1A90 A;  1Q7Y 4;  3D4A A;  1RN1 A;  1AY7 A;  3LYG A;  1I2E A;  1IVX A;  2IUJ A;  3H51 A;  2OCT A;  2CK3 H;  1VQO 3;  3DZL A;  3DUK A;  3EB8 A;  3EJV A;  4HM3 B;  5JPU A;  1M90 4;  2BMQ B;  5M19 A;  1JB2 A;  2E2V A;  1DVC A;  1WQL B;  1YIJ 3;  1T5Y A;  4GHO A;  4RZM A;  1LVN A;  3L0R A;  2Z77 A;  1N5P A;  3M8C A;  1OUN A;  1G96 A;  2XFT A;  3EE1 A;  1RJO A;  1BSA A;  1BRG A;  1IK3 A;  1I70 A;  3ER7 A;  3JUN A;  4FMB A;  1BGS A;  2JQ5 A;  1RGL A;  2GEY A;  1EUI C;  3OW2 2;  3GZB A;  3QRD A;  2WGQ A;  4HM5 B;  1Q81 4;  2KF6 A;  1YVS A;  4XB5 A;  3FZW A;  2CFG A;  1W00 A;  4NHF A;  1U5O A;  3FG1 A;  1DMM A;  3F14 A;  2OTJ 3;  1G02 A;  1B2X A;  3NV0 B;  1BRI A;  3MSO A;  3T8N A;  2C11 A;  4L7K A;  1LNI A;  3AMO B;  5EQL A;  4AEQ A;  1OGZ A;  2OOV C;  1VQQ A;  1US1 A;  2K54 A;  4HM1 B;  4PEJ A;  3KKG A;  1SJW A;  4FMA A;  4HYZ A;  7STD A;  1BUQ A;  3TDG A;  1B21 A;  3VSY A;  3LT8 A;  3GZR A;  1W4N A;  2XFS A;  5IG4 A;  5D82 A;  1QAF A;  2RFR A;  4RNY A;  4G1M B;  4IT7 A;  3PYJ A;  4CJN A;  1N9J A;  3X3Y A;  1GY7 A;  4EV2 A;  2W9P A;  3D3L A;  3MWZ A;  2HMJ B;  1ULI B;  1JBS A;  1K8A 4;  3NBB A;  1UW1 A;  4GL6 A;  1FW7 A;  1B2U A;  1TRP A;  4J5K A;  5AYS C;  2KXG A;  1BRJ A;  5AEW B;  1LQG C;  4CDL A;  1GS3 A;  1JBT A;  3LH4 A;  4HM6 B;  2IY2 A;  1R4Y A;  1JKG A;  2RSX A;  4HBR A;  1DMQ A;  1HU9 A;  3Q90 A;  3QK9 A;  4HM2 B;  1W6G A;  2IA7 A;  3KSP A;  3CC2 3;  3CCE 3;  1S72 3;  2OTL 3;  1UCL A;  5EVH A;  1RNT A;  3X41 A;  3GZY B;  1WMP A;  1FUS A;  5AI1 A;  2UUG C;  1I0V A;  4LYL B;  1M1K 4;  5CXO A;  1B2M A;  3PGB A;  3U1W A;  4EXR A;  1BNG A;  1VQL 3;  2BIR A;  2Q07 A;  4K1V A;  3CME 3;  4GB5 A;  3PXM A;  1W6Y A;  4ILF A;  1RCK A;  3GZX B;  5FGO A;  2GBW B;  3Q1C A;  3SLU A;  4HJL B;  5IG5 A;  1LRA A;  1MWS A;  2CG0 A;  3CCQ 3;  1UUV B;  2MC8 A;  2R4I A;  1AV4 A;  4AKY A;  1RNB A;  1B20 A;  4MMY B;  2H0I A;  4HM8 B;  5IG0 A;  3BU4 A;  3OWS A;  3DGO A;  3BLZ A;  4CPK A;  1VQK 3;  4KFF A;  3GRD A;  1X1X A;  1PY3 A;  1K28 A;  4N6L A;  1FGT A;  3CCJ 3;  5LC7 A;  1I2F A;  3FF0 A;  1CQS A;  2AAD A;  2KCD A;  3JUM A;  2K0M A;  3LTC A;  3X3X A;  1E3R A;  3EN8 A;  1VQM 3;  1DE3 A;  1RLS A;  4HZ9 B;  1QMA A;  4KFD A;  4HZB B;  5BVB A;  2KF3 A;  2D1W A;  4KFE A;  1GMQ A;  3WA3 A;  1ZS7 A;  1EKM A;  3F7X A;  3LML A;  2CG1 A;  1BNI A;  3T8U A;  8RNT A;  1SQW A;  3BNB A;  1GOU A;  1Q9E A;  2E2U A;  2BHM A;  2Y74 A;  1O7M B;  4FCZ A;  4HM0 B;  5ELJ A;  1YHQ 3;  3CC4 3;  3CXC 2;  1VQN 3;  4WYK B;  1A2V A;  1MGW A;  3D5I A;  2CC3 A;  3SVA A;  1RCL A;  2W56 A;  3O8Y A;  2GEX A;  4LSO A;  1ZGX A;  2Z76 A;  3CCU 3;  4OK0 A;  2OQE A;  1NNV A;  2XRX B;  3FG3 A;  3JUO A;  1C7H A;  3CPO A;  3PCR A;  3WOE B;  5BIR A;  4CCV A;  2YFJ B;  4NPB A;  1NB3 I;  3ZFZ A;  1TRQ A;  1FGR A;  1JN5 A;  3FGY A;  1OPY A;  4N6M A;  1IT7 A;  1YJ9 3;  3OXA A;  2UX0 A;  2XH9 A;  3LTA A;  1IQ8 A;  2F86 B;  3WOF B;  3WHO A;  4FCM A;  4LMI A;  3DGY A;  2AAE A;  3MHE A;  2E2T A;  2I9W A;  2BNG A;  2KAA A;  1SAR A;  4XDV A;  4FMC A;  3D5G A;  5TGN A;  1NDO B;  1UCK A;  3BNC A;  1OAC A;  3MYT A;  1L5G B;  1RGH A;  1AVL A;  2W9Q A;  1B27 A;  3NBR A;  5M18 A;  3DGM A;  2FGT A;  4MEI A;  2BO9 B;  2F98 A;  4R4K A;  2Z7A A;  2HMO B;  1TJD A;  1IDP A;  1BNS A;  1W7C A;  3CCM 3;  1DVD A;  2GU3 A;  3BND A;  2BMO B;  4FR9 A;  3ZG5 A;  1PFP A;  3EHC A;  3BB9 A;  3KCH A;  1N8Q A;  3CNX A;  2HML B;  4HVN A;  1BSC A;  1CH0 A;  3LXU X;  2W0Q A;  3EC9 A;  2QIY A;  4IPB A;  4RBN A;  5IEP A;  1FUW A;  2HMN B;  2KRT A;  1GY6 A;  1FA3 A;  3JVC A;  1OHS A;  5D81 A;  2P0X A;  2PZV A;  1ROA A;  5RNT A;  1DYU A;  3J7Y d;  1BRN L;  2CX1 A;  2V1L A;  1CYU A;  4STD A;  2J8X B;  3G0K A;  1JBR A;  2YFL B;  3NV0 A;  3ZG0 A;  3HZP A;  3AMO A;  1Q42 A;  1BOX A;  2FXT A;  1IVW A;  5M1A A;  4J9A A;  3HI7 A;  1AVK A;  3EN1 B;  3S29 A;  2ML6 A;  3K0Z A;  3AHW A;  2CFK A;  1W02 A;  4FMD A;  4XBX A;  2R41 A;  3DXO A;  3UL5 A;  1TIJ A;  2CIU A;  1ZX2 A;  1D6Z A;  4HAA A;  4O02 B;  5AIG A;  1VQ7 3;  3AHS A;  3OX9 A;  3ROB A;  2L1S A;  3FSD A;  3ALA A;  5CLK A;  3S5C A;  5G1L A;  2O3O A;  3SXX A;  3F9S A;  1FGM A;  3PZW A;  4EBG A;  3UL6 A;  4EV5 A;  3K7C A;  1JNQ A;  5CK6 A;  1PYL A;  1DET A;  1KWI A;  1ZO2 A;  2GSP A;  4AKZ A;  3MG3 A;  4MMX B;  7GSP A;  3LTD A;  1LOV A;  3KE7 A;  1IQY A;  1GMP A;  1Z1S A;  1S5A A;  4HKV B;  7RNT A;  1R4C A;  1RGE A;  1RRL A;  2D42 A;  1BAO A;  1M9G A;  1IVV A;  2SAR A;  1O7P B;  2KF5 A;  2XGL A;  1QAK A;  2XSH B;  8CHO A;  1KSI A;  2F99 A;  3NUV A;  1B2Z A;  1FYS A;  1YJN 3;  2WOF A; 
#chains in the Genus database with same CATH homology
 3DY5 A;  4LGQ A;  5ELU A;  2RGQ A;  3WMD A;  2OOV A;  5IER A;  1VQ9 3;  5I97 A;  3NM2 A;  3X42 A;  5STD A;  1NU3 A;  4K61 A;  3K5T A;  1Q86 4;  1YIT 3;  3EF8 A;  1LNH A;  4R9K A;  4BTW A;  4H61 A;  6STD A;  4LEH A;  1N9E A;  4KZ1 A;  3S28 A;  3EX9 A;  5BXQ A;  1F8N A;  1JKG B;  5HGR A;  1STD A;  2MF7 A;  1J2B A;  1VQ4 3;  3MPH A;  1DMN A;  2LQV A;  3E99 A;  3LOY A;  3ECF A;  2W2C A;  1STF I;  2IMJ A;  2CFL A;  3G71 3;  4TX4 A;  3NXJ A;  1EG9 B;  3STD A;  1TP6 A;  4N6N B;  1EA2 A;  4WYK A;  5KP1 A;  1QVG 2;  3FLJ A;  2WOH A;  2L4V A;  4U13 A;  3H3H A;  3HX8 A;  1FGQ A;  2XGN A;  3RGR A;  1PU4 A;  1OF5 B;  1MNL A;  2INX A;  1WMO A;  1JJ2 2;  2O9U X;  1Q40 B;  2OWP A;  3IMA B;  5G2G A;  1N8R 4;  3FH1 A;  1W5Z A;  1GD3 A;  1IQX A;  2P05 A;  1VQ6 3;  2GBX B;  4BTY A;  3IPT A;  4JRF A;  3NBJ A;  3NQZ A;  1VQ5 3;  3CD6 3;  2CFW A;  3HIG A;  1YGE A;  3MG1 A;  4R80 A;  4K90 B;  4O8S A;  1FGO A;  1IU7 A;  1HKX A;  5IW9 A;  5JBS A;  3B7C A;  1EQK A;  4HM4 B;  5D83 A;  1V74 A;  3S67 A;  3CCL 3;  1O7H B;  1A2K A;  3RDE A;  2BT3 A;  1JB4 A;  5IEN A;  4HM7 B;  1Q82 4;  1UUW B;  1NWW A;  3SED A;  4EC6 A;  5AEU B;  1UI7 A;  5IF6 A;  2QA4 3;  1KC8 4;  2P38 A;  2YX9 A;  1NB5 I;  3G8Z A;  1SPU A;  2RCD A;  2ZDJ A;  3GWR A;  4EYC A;  5EEO A;  2CFD A;  3I55 3;  3RGA A;  1U8C B;  4BTX A;  3DGL A;  5A0O B;  1IT8 A;  2PNC A;  4R1K A;  4N6T A;  1O7W B;  2QGU A;  4X2O A;  2CWU A;  3VGN A;  4FCJ A;  3G16 A;  3U97 A;  2B24 B;  3PS8 A;  3A76 A;  3DM8 A;  3F40 A;  4H3U A;  3N8B A;  3LTB A;  1N5H A;  3CC7 3;  1O7G B;  3MG2 A;  1RKY A;  1WNH A;  4XDW A;  3PCS A;  3KII A;  4WFO A;  2GU1 A;  3B4O A;  2BMR B;  2M7O A;  2W04 A;  1IV7 A;  4Q53 A;  2B1X B;  3GAX A;  4KVH A;  4N6U A;  3F8H A;  3OV4 A;  4JF8 A;  5CF1 A;  1ASK A;  3T0U A;  1GD4 A;  1QVF 2;  3KFQ C;  1OGX A;  1CYV A;  5CF2 A;  3SOY A;  3DGN A;  1JB5 A;  2CHC A;  2WGO A;  3KSE D;  2XR8 B;  2Z6B A;  2QEX 3;  1GY5 A;  5KP4 A;  1E97 A;  1LOX A;  5IG3 A;  1KD1 4;  1QJG A;  3EBY A;  2FNQ A;  1WMN A;  1W2Z A;  3G4S 3;  1TFK A;  4RNZ A;  5DRE A;  1IV9 A;  3NQY A;  4XM4 A;  3CCR 3;  3UNL A;  4ORL A;  3N54 B;  1ISK A;  4I4K A;  3SOA A;  3D9R A;  3CCV 3;  2HMK B;  3JUQ A;  1QAL A;  1VQ8 3;  2SBL A;  5FW5 A;  3IJE B;  1GYB A;  1OH0 A;  5IEO A;  3KZT A;  1LXE A;  4IIA A;  3CPW 2;  3I56 3;  1TFO A;  3NX0 A;  5JPP A;  1VZZ A;  4O2H A;  4XBY A;  3X3Z A;  3NHX A;  2ML5 A;  1MOL A;  3CNM A;  1W2B 2;  1A67 A;  1K9M 4;  4MMZ B;  1W01 A;  3EBT A;  4NRE A;  2YFI B;  1YVB I;  1TUH A;  3FG4 A;  2P09 A;  1K41 A;  4OVM A;  2XSO B;  2A15 A;  1W6C A;  2XEP A;  3JUP A;  4WHA A;  3B8L A;  1OCV A;  4WP5 A;  2CH9 A;  3V92 A;  2OQE C;  4N6O B;  1YJW 3;  3LZA A;  4L8O A;  3N9H A;  3SX1 A;  1TU5 A;  1O7N B;  2W6J H;  3K9M C;  4WWU C;  3OWY A;  5KP3 A;  1SIH A;  4O3V A;  1OF5 A;  1Y4K A;  4R9L A;  4XBT A;  1Q40 A;  3KN4 A;  1RRH A;  2WO0 A;  1D6Y A;  4LZI A;  5AII A;  2GXF A;  4K1U A;  3WDG B;  2W03 A;  1OHO A;  2LYX A;  3HII A;  2CKF B;  4QWT A;  5AIF A;  3CCS 3;  4OUQ A;  3CCU 3;  2CWT A;  2IUK A;  3NM7 A;  3UB1 A;  3F8X A;  3X40 A;  4ZM8 A;  4J8T A;  1M1X B;  3BNE A;  1AR0 A;  3DMC A;  3EQQ B;  3LT9 A;  2XF3 A;  2P0M A;  2JDI H;  2ZL8 A;  3G6E 3;  1D6U A;  3HK4 A;  3VF1 A;  1ULJ B;  3B4P A;  3K63 A;  3CMA 3;  3OWU A;  1KQS 2;  1OHP A;  1JV2 B;  3Q2P A;  5AIH A;  3WOD G;  4N3V A;  1ROV A;  1NO3 A;  2HMM B;  1SII A;  3MKI A;  3UJM A;  2STD A;  1IVU A;  1CEW I;  5IEP A;  2W56 B;  4N6V 0;  4L8P A;  5DRV A;  2C10 A;  1UI8 A;  1WTH A;  5LC6 A;  3I0Y A;  2CWV A;  1JRQ A;  1VQP 3;  1JN5 B;  3V99 A;  3FF2 A;  3CU3 A;  1RN7 A;  2Y73 A;  3S27 A;  3FCS B;  2CW9 A;  4MJD A;  5AYR B;  1E3V A;  4X2H A;  3WA2 X;  1NJI 4;  3F7S A;  1K73 4;  3V98 A;  1YI2 3;  3FKA A;  1A90 A;  1Q7Y 4;  3LYG A;  1IVX A;  2IUJ A;  3H51 A;  2OCT A;  2CK3 H;  1VQO 3;  3DZL A;  3DUK A;  3EB8 A;  3EJV A;  4HM3 B;  5JPU A;  1M90 4;  2BMQ B;  1JB2 A;  2E2V A;  1DVC A;  1WQL B;  1YIJ 3;  1T5Y A;  4RZM A;  1LVN A;  3L0R A;  2Z77 A;  1N5P A;  3M8C A;  1OUN A;  1G96 A;  2XFT A;  3EE1 A;  1RJO A;  1IK3 A;  4FMB A;  3ER7 A;  3JUN A;  2JQ5 A;  2GEY A;  3OW2 2;  3GZB A;  3QRD A;  2WGQ A;  4HM5 B;  1Q81 4;  4XB5 A;  3FZW A;  2CFG A;  1W00 A;  4NHF A;  1U5O A;  3FG1 A;  1DMM A;  3F14 A;  2OTJ 3;  3NV0 B;  3MSO A;  3T8N A;  2C11 A;  4L7K A;  4AEQ A;  3AMO B;  5EQL A;  1OGZ A;  2OOV C;  2K54 A;  1US1 A;  4HM1 B;  4PEJ A;  3KKG A;  1SJW A;  4FMA A;  4HYZ A;  7STD A;  1BUQ A;  3TDG A;  3VSY A;  3LT8 A;  3GZR A;  1W4N A;  2XFS A;  5IG4 A;  5D82 A;  1QAF A;  2RFR A;  4RNY A;  4G1M B;  4IT7 A;  3PYJ A;  1N9J A;  3X3Y A;  1GY7 A;  4EV2 A;  2W9P A;  3D3L A;  3MWZ A;  2HMJ B;  1ULI B;  1K8A 4;  3NBB A;  1UW1 A;  4GL6 A;  5AYS C;  2KXG A;  5AEW B;  4CDL A;  1GS3 A;  3LH4 A;  4HM6 B;  4HM2 B;  1JKG A;  2RSX A;  4HBR A;  1DMQ A;  1HU9 A;  3Q90 A;  3QK9 A;  2MC8 A;  1W6G A;  2IA7 A;  3KSP A;  3CC2 3;  3CCE 3;  1S72 3;  2OTL 3;  5EVH A;  3X41 A;  3GZY B;  1WMP A;  1M1K 4;  5AI1 A;  5CXO A;  3PGB A;  3U1W A;  4EXR A;  1VQL 3;  2Q07 A;  4K1V A;  3CME 3;  4GB5 A;  3PXM A;  1W6Y A;  3GZX B;  5FGO A;  2GBW B;  3Q1C A;  3SLU A;  4HJL B;  5IG5 A;  3CCQ 3;  2CG0 A;  1UUV B;  2R4I A;  1AV4 A;  4AKY A;  4MMY B;  4HM8 B;  5IG0 A;  3OWS A;  3DGO A;  3BLZ A;  1VQK 3;  4KFF A;  3GRD A;  1K28 A;  4N6L A;  1FGT A;  3CCJ 3;  5LC7 A;  3JUM A;  3FF0 A;  1CQS A;  2KCD A;  3X3X A;  2K0M A;  3LTC A;  1E3R A;  3EN8 A;  1VQM 3;  4HZ9 B;  1QMA A;  4KFD A;  4HZB B;  5BVB A;  2D1W A;  4KFE A;  3WA3 A;  1EKM A;  3F7X A;  3LML A;  2CG1 A;  3T8U A;  1SQW A;  3BNB A;  2E2U A;  2Y74 A;  2BHM A;  4FCZ A;  1O7M B;  4HM0 B;  5ELJ A;  1YHQ 3;  3CC4 3;  1VQN 3;  3CXC 2;  4WYK B;  1A2V A;  2CC3 A;  3SVA A;  2W56 A;  3O8Y A;  2GEX A;  4LSO A;  2Z76 A;  4OK0 A;  2OQE A;  3JUO A;  2XRX B;  3FG3 A;  1C7H A;  3CPO A;  3PCR A;  3WOE B;  4CCV A;  2YFJ B;  1NB3 I;  1FGR A;  1JN5 A;  3FGY A;  1OPY A;  4N6M A;  1IT7 A;  1YJ9 3;  3OXA A;  2UX0 A;  2XH9 A;  3LTA A;  1IQ8 A;  2F86 B;  3WOF B;  4FCM A;  4LMI A;  3MHE A;  2E2T A;  2I9W A;  2BNG A;  4XDV A;  4FMC A;  5TGN A;  1NDO B;  3BNC A;  1OAC A;  3MYT A;  1L5G B;  1AVL A;  2W9Q A;  3NBR A;  3DGM A;  2FGT A;  4MEI A;  2BO9 B;  2F98 A;  4R4K A;  2Z7A A;  2HMO B;  1DVD A;  1IDP A;  1W7C A;  3CCM 3;  2GU3 A;  3BND A;  2BMO B;  4FR9 A;  1PFP A;  3EHC A;  3BB9 A;  1N8Q A;  3CNX A;  2HML B;  4HVN A;  3LXU X;  2W0Q A;  3EC9 A;  2QIY A;  4IPB A;  4RBN A;  1FUW A;  2HMN B;  2KRT A;  1GY6 A;  1FA3 A;  3JVC A;  1OHS A;  5D81 A;  2P0X A;  2PZV A;  1ROA A;  3J7Y d;  1DYU A;  1CYU A;  2V1L A;  4STD A;  3G0K A;  2YFL B;  3NV0 A;  3HZP A;  3AMO A;  1Q42 A;  2FXT A;  1IVW A;  4J9A A;  3HI7 A;  1AVK A;  3EN1 B;  3S29 A;  2ML6 A;  3K0Z A;  2CFK A;  1W02 A;  4FMD A;  4XBX A;  3DXO A;  3UL5 A;  1TIJ A;  2CIU A;  1ZX2 A;  1D6Z A;  1VQ7 3;  4O02 B;  5AIG A;  3OX9 A;  3ROB A;  3FSD A;  5CLK A;  3ALA A;  3S5C A;  2O3O A;  3SXX A;  3F9S A;  1FGM A;  3PZW A;  4EBG A;  3UL6 A;  4EV5 A;  3K7C A;  1JNQ A;  5CK6 A;  1KWI A;  1ZO2 A;  4AKZ A;  3MG3 A;  4MMX B;  3LTD A;  3KE7 A;  1IQY A;  1Z1S A;  1S5A A;  4HKV B;  1R4C A;  1RRL A;  2D42 A;  1M9G A;  1IVV A;  1O7P B;  2XGL A;  1QAK A;  2XSH B;  8CHO A;  1KSI A;  2F99 A;  3NUV A;  1YJN 3;  2WOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...