1TJDA

The crystal structure of the reduced disulphide bond isomerase, dsbc, from escherichia coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
216
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbC
publication title Structure of the reduced disulfide-bond isomerase DsbC from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 70
structure length 216
sequence length 216
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1tjdA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tjdA02
6GSYA 1SKRB 1E2YA 3HD5A 2K18A 4MJBA 4OD7A 4EF0A 1LU4A 1Z6MA 4LMVA 2VLTA 1CQHA 2QC7A 5LNKe 3IAM2 1MD3A 1R26A 4I6XA 3FZAA 1PQNA 4G19A 3LJRA 2HZEB 1QQ2A 3HZ4A 4F82A 2HYXA 4JBBA 1ZYEA 5DQYA 4TR1A 1U87A 2FWHA 2AB6A 4AJ7A 2V6OA 3LFLA 4JEDA 2OE3A 4PURA 4HQZA 3CTGA 4K8MA 3E3EA 4QL9A 4WKWA 1F9MA 4OFMA 3GUSA 4K7NA 3W6GA 2YWIA 4PQ1A 3UJ1A 2VLVA 2H8LA 1WJKA 3HJPA 4WXTA 2X8HA 4F03A 2YWMA 1PSQA 4XHMA 4GSTA 2K8VA 1XPVA 4BA7A 1TOFA 9GSSA 1KTEA 5KN2A 2J9HA 2CAQA 4YAVA 3P2AA 4IHUA 3GMFA 2GVPA 2IJYA 4I2TA 2H0HA 2N5FA 3NOFA 3QR6A 4NPBA 4WF4A 2MMZA 4ZXGA 3DYRA 2VOCA 1YF0A 4HDEA 3HKRA 3C73A 2F9SA 1PA3A 2AUVA 2D2ZA 1ERUA 1PKWA 1H75A 1T7PB 4O5RA 1KNGA 2QSIA 3TOTA 4EO3A 5A4VA 2IYJA 4QL7A 1TRWA 4PGTA 2DSAA 4YAPA 3TJFA 2IMIA 4JR4A 5B8AA 3UARA 5HFGA 1RK4A 4AF2A 4WBJA 2A4VA 2H6YA 4IN0A 2WB9A 4ZB6A 3MDKA 4FYUA 4GQFA 4POKA 1YKAA 1MDKA 2WFCA 1QK8A 1ERTA 4I97A 3TCOA 4EUYA 4OMVA 3LG6A 1K0NA 2L5OA 2LQOA 5CRWA 2LRTA 3TRPA 3F4SA 3DGQA 3FRCA 1G7OA 4XRAA 2DBCA 4AJ8A 1WRYA 3HY2A 1EV4A 4OCEA 3GKXA 2REMA 3UOMA 5DALA 5E4WA 1GULA 4POBA 3RPPA 3J7Yb 1LJRA 1O85A 1XWGA 1FW1A 3C1RA 3DMLA 2H1DA 1DBYA 3ZRDA 1M2DA 1YEPA 1Z3EA 1O81A 1TK0B 3BOAA 1K3LA 3E9JB 1SENA 4HI7A 1GSYA 4V2LA 3EC3A 2VCXA 4PNFA 2OE0A 4XRDA 5CREA 4IQAA 2VCVA 1ZMAA 1XVWA 5IMZA 2L6CA 4TXOA 1FVKA 2X99A 3F4RA 3LXZA 1Q4JA 3EU3A 4GXZA 3ED3A 2OACA 3BCIA 6GSWA 4F2IA 2GZPA 2H1AA 1I5GA 3CBUA 4NAXA 4CDOA 3GKNA 4GSNA 4BWQA 3DRNA 2H71A 2GSQA 2GT5A 1O73A 3WGEA 19GSA 3HCZA 1WE0A 3GV1A 3IA1A 1BEDA 3GIXA 5DAKB 3WYWA 1G6WA 2MYGA 2GQKA 5JCGA 1HYUA 1OC9A 2DMMA 5F0GA 5B6MA 4BVYA 3GSSA 3KJYA 3KMOA 4PUFC 4Q5RA 1EEJA 3L9VA 2ON7A 6GSTA 4YQMA 2LUSA 1U3IA 2QKEA 4XS4B 4EL1A 3PGTA 1UN2A 2GT6A 5G30A 5ID2A 2VCTA 4ZB8A 3IDVA 2O7KA 1GL8A 4KX4A 4ZILA 5CRGA 1AQVA 4POMA 2VD1A 3JCML 2ES7A 2C0EA 2EIRA 1FVJA 1F2EA 2JZRA 4J56E 2PVQA 2VM1A 1M99A 3LYKA 1USBA 2M80A 4MF6A 5IMCA 4OWYA 4JU5A 1NHYA 1WWJA 5D73A 1XOBA 4LLRA 2C3QA 3APQA 4KSMA 1T1VA 1FB6A 4ZL7A 3EWLA 5KEJA 3F6FA 3H4KA 5JCWA 1URMA 4IKHA 4KCEA 3GX8A 4KA0A 5CRHA 2CA8A 1M9BA 1YJ6A 2H72A 4TR3A 2VO4A 2H19A 3I69A 13GSA 2X8CA 3BD2A 1M2AA 4ZB9A 2G2QA 4D73B 3ME8A 4ACSA 2YOIA 3H93A 4KAEA 5DQSA 2F51A 1S3CA 1UA5A 2GS3A 1EZKA 5F06A 2GQMA 3M0FA 3ISOA 4K7IA 5J9CA 3UVHA 2Z9SA 1BJXA 4CW9A 3IPZA 5A5KA 1DSBA 4ZIJA 2GZYA 1Z5YE 16GSA 4GF0A 2YZHA 3IOSA 3FK8A 1XZOA 2ZUPA 1GSDA 3U6VA 1U88A 1I9DA 2H6XA 2O85A 1HQOA 2IY2A 4FO5A 3C71A 5D9TA 3Q18A 4L0WA 4K7OA 1SYXA 2LTKA 2LJKA 4MF7A 1DE2A 4YQVA 1RW1A 4RUVA 2MBSA 4ECBA 3P90A 3WGDA 1GRXA 4WR5A 5IO2A 1EP7A 2GSTA 1SYRA 3APSA 4ZBDA 2DJ2A 3UBLA 2FA4A 2MMOA 3TKSE 2YN1A 5DVBA 2K9FA 3A2VA 1FHEA 2H0GA 1A2LA 4OFNA 5COHA 2AHEA 3VURA 5ELGA 3LQ7A 2FY6A 4Q5NA 3TJKA 1WOUA 2CAIA 5CP1A 3TB2A 1O7UA 4ML1A 5DCGA 3WGXA 1B9YC 1F37A 3M9KA 3ERWA 1SKWB 2FNOA 4LA1A 1T4YA 1TU7A 3ZL5A 1XW9A 4JE1A 3DWVA 2B7JA 1ZZYA 2YJHA 2GTUA 3FZ4A 4KW6A 3HVXA 4HU7A 1SJZA 3VK9A 3UL3A 4MZBA 6GSXA 3ZFBA 2CVDA 1XOAA 2LRCA 2LKUA 3UIWA 1XWKA 1BQ7A 3FEUA 1Z7RA 5J4UA 4J57E 2E0QA 3VLNA 1TRSA 2LQQA 3VWUA 4MZCA 4EC0A 1X9WB 2ON5A 4O92A 2N5BA 3ZVJA 1SJIA 2EIOA 3GRXA 2VCZA 4N0ZA 4EKZA 1U3AA 2R37A 2H6ZA 4EDYA 3IV4A 4E8HA 3M3MA 1JZDA 1O6JA 1K0OA 3ZZXA 3CSJA 1H4OA 1K0MA 3O6TA 4V2MA 4OO4A 2LNTA 3I9V2 1AC1A 5G31A 4DSQA 3SWLA 5A4UA 3N9JA 2BMXA 3GA4A 5AIVA 3HA9A 1GLQA 1A24A 4N10A 5ECNB 4EE0A 4F9ZA 2FD3A 1EOHA 3QPMA 5GSTA 1MDJA 3KP8A 3S9FA 4ML6A 3MNGA 17GSA 4I5QA 2VIMA 5IMDA 1A2JA 2H0IA 2YJ7A 1R5AA 1S3AA 2IWTA 2GZZA 1TW9A 1Z9HA 5F05A 1XXUA 1FG4A 1Y6EA 3EMXA 2C80A 3VWWA 2VCWA 2C3TA 3RHCA 2PVOC 3ZITA 3BBYA 1QXHA 1TTZA 3GHAA 1PL2A 4MPGA 1XIYA 3QOUA 2WRTA 2YNXA 3ZYWA 2YCDA 2OE1A 4AGSA 5IQYA 3TOUA 5B8BA 3GN3A 1PL1A 3IBHA 1TI3A 3I43A 4ID0A 6GSUA 4X1UA 4MCUA 5DJMA 3US3A 1V58A 4KCAA 2H66A 1UVZA 3HZ8A 3W8SA 2IMFA 2FWGA 1F3BA 1ZL9A 4KDUA 4NWYA 3DXBA 3D6IA 3RHBA 1TK8B 3TJJA 2J23A 1ABAA 4HZ4A 2E2MA 1G6YA 2WGRA 2A2RA 2L59A 2IMEA 2HZFA 4N30A 1YKCA 2F8AA 2PMTA 4OFTA 4IW9A 1FOVA 2AYTA 5IIZA 1EWXA 4ILFA 4MZWA 3GTUA 3I6AA 4DVCA 4DSSB 5H5SA 3F3RA 5EVOA 3QAGA 4XIHA 3GSTA 2C0DA 3UEMA 1VRSD 4GTUA 2P5RA 2R6KA 5G1KA 1PMTA 3DVWA 4KUNA 2LSTA 1VGLA 1X5EA 3MWHA 4KDYA 4WF5A 1O8WA 2PGTA 1XWAA 2HSYA 1XCCA 3L9UA 2CT6A 2IMDA 1YZXA 2I4AA 1GSSA 4GSSA 1B9XC 5IPHA 1X5DA 1EV9A 2K6VA 2F3MA 4KNDA 3GH6A 5FT3A 1OE7A 3HJMA 3VWXA 5ECSA 3LSZA 4ECCA 2YWOA 2PERA 2CX4A 3MSZA 4G2EA 3EINA 4IQ1A 5ECMB 2QGVA 2VL9A 22GSA 3QAVA 1HNAA 5ECIB 4FYBA 3TUEA 2B1KA 2GGTA 1LBKA 3FYGA 5CRDA 3FR9A 3H1NA 1C72A 3L78A 2JSZA 2YANA 1YEXA 1KEBA 3KM6A 4NHZA 2IFQB 3QDNA 2R2JA 1TK5B 1EOGA 3F6DA 1VF3A 1QUWA 2C3NA 3F63A 4IGJA 2C0FA 2H1GA 3WT1A 1R5PA 2DJJA 3CYNA 3D0ZA 1EP8A 5B7CA 5LD0A 4KB3A 4DSRA 4LL4B 5IOWA 5GAPD 5G5EA 4KSOA 3TKPA 2JU5A 5GAND 2B1LA 2R5GA 2GSSA 2HI7A 2HZEA 2GSRA 1XVQA 3TDGA 1OAZA 2L57A 5DDLA 2YV9A 4IJ3A 1JHBA 3IK7A 3GL5A 2RLIA 1VF2A 3ME7A 1M0UA 2FGXA 1GSQA 1M2BA 1EGRA 3FHKA 5CO3A 5EL8A 1GNWA 3ZFLA 4RI6A 4RQRA 3GKKA 1BG5A 5KN1A 4K2DA 2OBIA 1WP0A 4IP1A 2DJ0A 3L4NA 4HJ2A 5ECLB 4GLTA 2R4VA 4X43A 1X9MB 2MBTA 1Z6NA 3IE3A 2DJ1A 2JZTA 2RUFA 1ML6A 1W89A 1R7HA 1SD9A 4MLYA 3TGZA 2RUEA 2HE3A 4Z7XA 3BJ5A 4V1Ap 1MTCA 3KTLA 4K6XA 2B5XA 1SL0B 4TR1B 3VFIA 1VF1A 5D93A 2HNLA 1Q98A 4MDCA 1XWBA 2OADA 1SK2A 1B4QA 1V98A 1PN9A 2B5YA 1YF1A 1YQ1A 3C1SA 3VI5A 2L5LA 5D9XA 1UC7A 1M9AA 3ZVJD 3TRXA 1HD2A 4ECJA 1V2AA 4BPYA 3IXRA 4XS6A 3KZQA 11GSA 2VL2A 1ZCPA 2FHEA 2LJAA 3Q19A 3RPNA 3FW2A 1AQXA 2CZ3A 1GH2A 3DIEA 2DIYA 4HS1A 1AXDA 1GTIA 3ZIVA 2WS2A 1JZWA 2XHFA 5FHIA 5CNWA 2VLUA 4DEJA 3NZNA 1ILOA 3QAWA 3PINA 2JSYA 1J9BA 2JL4A 3FY7A 1B48A 4Q5QA 3KMNA 1JLWA 1GWCA 2DJKA 5ECKB 4OCFA 1GLPA 3DVXA 2OA7A 4TW5A 5C04A 2EIQA 3EMPA 2DLXA 18GSA 3U5RE 1TRVA 1SU9A 4K0NA 5IOXA 1E6BA 1TI1A 1GTBA 4H86A 4IBPA 4MJCA 3APOA 3KH7A 3TKRA 3CRTA 1K0BA 2MZCA 3M9JA 1GTUA 4HOJA 3KGKA 1SD8A 5D8IA 3HXSA 4MA9A 4K9ZA 2VCQA 2R3XA 5J41A 5DALB 5AISA 4TVEA 4TR0A 1F6MC 4MABA 5DAKA 2H70A 4E8EA 3KIJA 2HRNA 4OO5A 3IRAA 3GKMA 1ZOFA 3RDWA 2LNSA 1SKSB 1AUCA 3A3TA 2CX3A 1ST9A 4PX1A 1X5CA 2OKAA 2V41A 1PRXA 3R2QA 4N0VA 2XC2A 4ULXA 3KP9A 1QMVA 4O7HA 4XS4A 4N11A 2CVBA 4NXIA 4G10A 1OVNA 1TRUA 1ON4A 5F8BA 4L5OA 3J7Yk 1ACVA 3UAPA 2RM6A 5L71A 4TXOB 2IN3A 4TOPA 2MMNA 2PWJA 1NSWA 2ALBA 2L6DA 5EY6A 4L8EA 3TKSA 2XBIA 4HQSA 5IMVA 5G5FA 4NHWA 1SL1B 2FUG2 2WCIA 4GCIA 3QD9A 2M72A 1PD21 2JZSA 1OC9B 1V9WA 3DEXA 3F3QA 1PX6A 3KEBA 1XW5A 2GLRA 2NPBA 3K8NA 2IIYA 2CVKA 4L0UA 2OJLA 3EE2A 1ERVA 10GSA 4PNGA 2MMAA 3G7JA 4F0BA 4FYCA 2NDOA 4IJIA 5CYYA 2PN8A 1AIUA 4K0GA 4PXOA 1SJ6A 1A0RP 3H8QA 5ID2B 2AV4A 4K1FA 4WEYA 1YDKA 5D96A 2I9HA 3ZIJA 2KP2A 5ECPB 4D73A 1SK0A 5IM9A 3GFKA 5JCUA 3LWAA 3VPTA 3D4MA 1R4WA 5G1LA 2JADA 2BJXA 1K0DA 3TJBA 3WT2A 3GYKA 1GSUA 3W8JA 3LORA 4F0CA 2P0GA 4MH3A 2B6MA 2K8SA 2I81A 3O3TA 2HFDA 3KXOA 3TJGA 2NVLA 2RIIA 3TRQA 2I1UA 3C7MA 4MJAA 2P5QA 3ZMKA 3CMIA 3GURA 5H5QA 4ZBBA 1EEMA 5HFIA 1AQWA 4TKYA 3UBKA 1OYJA 2HSHA 3VPQA 3OR5A 1NHOA 4XCSA 3G7YA 2YV7A 1TKDB 2LRNA 2I3YA 5HQPA 3IK9A 2KLXA 4EXJA 2LEGA 5J3RA 3P8WA 2N5AA 2FLSA 1THOA 4O32A 3ERGA 1N2AA 1GUHA 3WD6A 1V40A 1CQGA 2GDRA 2LS5A 1J0FA 1IYIA 4BWSA 5J9BA 2HRFA 4GQCA 2H75A 2VAFA 4WBRD 4PUAA 2YP6A 2A2SA 4Q5FA 3FR6A 3CSHA 1K3YA 4J2FA 5ECRB 4HUAA 4TRXA 2VUPA 2KUCA 1GNEA 2E2GA 3EU4A 1BX9A 1JLVA 1GUKA 1GP1A 2XPDA 1B4PA 5F07A 3F0IA 2L4QA 4LMWA 1QGVA 1X9SB 1FB0A 3LYPA 5HR2A 3GX0A 3LEFA 1PKZA 4V2NA 1G7EA 1GTAA 3FZ5A 5D9VA 2FWFA 4RI7A 2FA8A 4MP4A 4EDZA 2VL2C 4YQUA 3UMAA 3FR3A 5LCZA 1FO5A 3ZREA 2CV4A 4I8BA 5E59A 3L9SA 2YZUA 4LL1B 4I2UA 3DD3A 4KE3A 4KGIA 3VI7A 4NV5A 1PGTA 4ECIA 2V1MA 2B3SA 2WULA 3EURA 4PQIA 1WPIA 3TKQA 1XWCA 3D21A 3E0UA 1HNBA 4HJMA 4TXVA 3C8EA 3ZLPA 4YH2A 5CAXA 4JR6A 1JZOA 5HR0A 3IAS2 1M7TA 2M46A 1FAAA 5ECOB 2KP1A 3HJOA 1XW6A 2V32A 2WDUA 1XBSA 5DCHA 2NTOA 3M8NA 5IPGA 1G0TA 5B6NA 4PQHA 3KD0A 2E7PA 4BVXA 2X8GA 4MH2A 4EVMA 2YWNA 3KTBA 1TP9A 2XPEA 3V1WA 5ECQB 1QFNA 2WJUA 3CTFA 2CZ2A 1JFUA 1OC8A 1A8YA 2VM2A 1X0RA 3A5WA 5ECHB 5KN0A 3LGCA 5IMFA 4ISDA 1TJDA 3O76A 20GSA 2H30A 1MD4A 3F8UA 1T4ZA 1J08A 1BAYA 2NBSA 3GL3A 1TU8A 3BCKA 2PPTA 1SL2B 2HLSA 1OE8A 4QQ7A 3KH9A 4ZL8A 5AGYA 4HZ2A 5JWQB 5EPFA 3GNJA 2H73A 3N5OA 1RQMA 5D9WA 1ZGNA 2TRXA 2H01A 2KOKA 4KH7A 4MPFA 2IPAA 2FCHA 1A8LA 4KDXA 2TRCP 4MMMA 2H74A 3NIVA 4JRRA 3M1GA 14GSA 2F8FA 4P3YB 2CQ9A 1VF4A 3HDCA 2FWEA 2H76A 2LJRA 2JACA 2O89A 1GSFA 3ZMLA 3CSIA 2X64A 3Q6OA 3G9BA 4XTSA 3GH9A 5IO0A 1KBNA 4HEA2 2PU9C 5IMAA 4IP6A 3HVSA 5H5RA 3TKSC 1ERWA 4NMUA 2G0FA 2IMKA 4FIWA 3G7IA 3D5JA 4HU9A 1GUMA 2PUKC 3HVVA 4MK3A 5GSSA 2L4CA 3IC4A 5AIXA 4WETA 1BYEA 5HR1A 1MEKA 4IVFA 1A23A 3QFBC 3L0HA 1OKTA 4TR4A 1A0FA 5DBQA 2KHPA 5FWGA 4WR4A 1F3AA 4FH8A 1T8EB 1K3OA 5G2ZA 2H1BA 4L5LA 1W4VA 2V6KA 3HHVA 1XFLA 3IR4A 1DUGA 2ZCTA 4MF5A 3F4TA 2HT9A 2VD0A 4MJEA 5HR3A 5JWOB 2B5EA 3A2XA 1V57A 1WIKA 8GSSA 1S3DA 4CHSA 7GSSA 4ZBAA 4DSSA 2GQLA 2V2GA 1TDIA 2DMLA 2AAWA 1MDIA 3Q74A 1THXA 3SBCA 1NW2A 4NV2A 1NM3A 2B7KA 3EVIA 1GSEA 1OKDA 3A2WA 1AAZA 4XS1A 2XBQA 1HNCA 3PR8A 5J5NA 3EYTA 1K0AA 3FKFA 2DJ3A 4GRFA 4ZL9A 5ELAA 4AJ6A 3QFAC 5A4WA 3DKSA 4X0XA 6GSVA 4BL7A 2LV3A 3VWVA 3H79A 2AJQB 3FZ9A 1O8XA 1JZRA 5DJLA 4G9HA 3GTUB 2WZ9A 5GZZB 1B8XA 2O87A 1Z7PA 3D4TA 1T00A 3KCMA 2IFQA 2EC4A 3LXTA 2OBKA 1AW9A 2DIZA 3IHQA 1PX7A 3CRUA 3RAZA 5JWRB 2VL3A 3CXGA 3UVTA 2O8VB 3PH9A 5KN3A 4RQXA 1SK1A 1DE1A 2C4JA 3P7XA 3D22A 1N8JA 2C8UA 2DC5A 1ZYQB 1A2MA 5ENUA 2IL3A 1U6TA 4JZQA 5AN1A 3QCPA 1TXXA 3ERFA 1EGOA 4IELA 4IS0A 2ZNMA 2YPMA 2C1YA 3AY8A 3F9UA 3MAKA 4POLA 1T3BA 3HYPA 3RBTA 2BTOT 4GWRA 6GSSA 12GSA 1YY7A 5C00A 3QMXA 4V1Ag 3ZTLA 2RM5A 5INYA 4TN8A 2HXKA 2PBJA 2P31A 1WMJA 2TIRA 1IYHA 2C0GA 1K0CA 1Y25A 1OC3A 5HFKA 5ABRA
chains in the Genus database with same CATH superfamily
6GSYA 1SKRB 1IDPA 5AYRB 1E2YA 3HD5A 2K18A 4MJBA 4OD7A 3J7Yd 4BL3A 4EF0A 1LU4A 1Z6MA 4LMVA 2VLTA 1CQHA 2QC7A 2XFTA 5LNKe 3IAM2 1MD3A 1R26A 1B3SA 3FZAA 1PQNA 4I6XA 4G19A 3LJRA 2HZEB 1TUHA 1QQ2A 2W6JH 3HZ4A 4F82A 2HYXA 1S5AA 3URPA 3WOEB 4JBBA 1ZYEA 1I8VA 5DQYA 4TR1A 4Q53A 1U87A 2FWHA 2AB6A 4AJ7A 2V6OA 3LFLA 4JEDA 1RMSA 2OE3A 4PURA 2CHCA 4HQZA 3CTGA 4K8MA 3E3EA 4QL9A 4WKWA 1F9MA 4OFMA 3GUSA 1I2EA 4K7NA 3W6GA 5IG3A 4KFFA 2W03A 1JKGB 1BAOA 2YWIA 4PQ1A 3UJ1A 2VLVA 2HMOB 2SBLA 2H8LA 1WJKA 3HJPA 3CCL3 4WXTA 2X8HA 4F03A 2YWMA 4H61A 3PCRA 1PSQA 4XHMA 4LMIA 4GSTA 2K8VA 3CCU3 1XPVA 4BA7A 4ICYA 3DGLA 1TOFA 2X4AA 9GSSA 1KTEA 5KN2A 2J9HA 2CAQA 3RGRA 4YAVA 3P2AA 1CQSA 3L0RA 4IHUA 2BMQB 3GMFA 2GVPA 1OHSA 2IJYA 3NOFA 2H0HA 2N5FA 3QR6A 4I2TA 4NPBA 4WF4A 4HM7B 2XGLA 2MMZA 5D81A 4ZXGA 4WP5A 4HM3B 3DYRA 4HM6B 2VOCA 1YF0A 3CC73 4WHAA 3FH1A 2XR8B 1VQ63 1JB2A 4HDEA 4G1MB 3C73A 2F9SA 3HKRA 4IT7A 1PA3A 4O3VA 5TGNA 2AUVA 2D2ZA 1ERUA 3V92A 3N8BA 1PKWA 1H75A 1T7PB 4O5RA 1KNGA 2QSIA 3TOTA 4EO3A 1FOHA 2Z77A 5A4VA 2IYJA 4QL7A 1TRWA 4PGTA 2DSAA 2RCDA 3EN8A 4YKGA 3FKAA 4YAPA 3TJFA 2F86B 2IMIA 2WGQA 4JR4A 5B8AA 1GY5A 5STDA 1GMRA 1OACA 3UARA 5HFGA 1RK4A 4AF2A 1BRNL 2A4VA 2H6YA 4IN0A 4WBJA 1W5ZA 2WB9A 5DRVA 2V1LA 4ZB6A 3MDKA 4FYUA 4GQFA 4POKA 2Z7AA 2R0CA 1YKAA 1MDKA 3DGOA 2WFCA 1QK8A 3ER7A 3A5IA 1ERTA 4I97A 3TCOA 1B21A 4EUYA 1YIT3 4OMVA 3LG6A 1ISKA 1K0NA 2L5OA 2LQOA 4CJNA 5CRWA 2LRTA 2OTJ3 3TRPA 3F4SA 3DGQA 3FRCA 1G7OA 2DBCA 4XRAA 4HJLB 4MJDA 4AJ8A 1BNGA 1WRYA 4K1UA 3HY2A 1EV4A 1S3RA 3KCHA 4OCEA 3GKXA 5I97A 2REMA 3UOMA 5DALA 5E4WA 1GULA 2XEPA 1E97A 4POBA 3RPPA 3J7Yb 2CFWA 1LJRA 1O85A 3CCV3 1XWGA 1FW1A 1O7MB 1GSPA 3C1RA 1CYVA 3DMLA 1I3FA 2H1DA 1DBYA 3ZRDA 1M2DA 4ZM8A 1YEPA 1QMAA 3G8ZA 1Z3EA 1O81A 1JB4A 1RKYA 1TK0B 3BOAA 3SEDA 1W00A 1K3LA 3E9JB 1M3IA 1SENA 1X1WA 4HI7A 2W04A 1GSYA 1MOLA 2CK3H 4V2LA 1STDA 3K63A 3EC3A 2VCXA 3ZFZA 2OE0A 4PNFA 1TRPA 4Z2RA 4XRDA 1FA3A 3OW22 5CREA 2P38A 4IQAA 2VCVA 1ZMAA 4N6TA 3CCE3 1XVWA 1YJ93 5IMZA 4KFEA 2L6CA 6GSPA 5IG0A 4TXOA 1FVKA 2X99A 3F4RA 3EN1B 3LXZA 1Q4JA 3EU3A 1SQWA 4GXZA 2IUJA 3ED3A 5A0OB 2OACA 3BCIA 6GSWA 1VQO3 2GZPA 2H1AA 4F2IA 1I5GA 3CBUA 4XBYA 4NAXA 4CDOA 3GKNA 4GSNA 4A5PA 4BWQA 1IU7A 2H71A 2GSQA 3DRNA 2GT5A 1O73A 3FG1A 3WGEA 19GSA 3HCZA 1WE0A 3GV1A 3IA1A 1BEDA 3GIXA 5DAKB 3FLJA 1LXEA 3WYWA 1G6WA 2MYGA 1ZYPA 2GQKA 5JCGA 3BLZA 1Y4KA 1HYUA 1BRHA 1OC9A 1PY3A 3DY5A 2DMMA 5F0GA 5B6MA 4BVYA 1FW7A 3GSSA 4HSCX 3KJYA 1BUQA 1JBRA 3KMOA 4PUFC 1BNFA 3NX0A 4Q5RA 3AHWA 1YGWA 3GZYB 1EEJA 3L9VA 2ON7A 6GSTA 3CNMA 4YQMA 2LUSA 1U3IA 2QKEA 4XS4B 4EL1A 3PGTA 2I9WA 3NV0A 2XFSA 3CD63 1UN2A 2GT6A 5G30A 5ID2A 4DKIA 2VCTA 4ZB8A 4HM1B 2P09A 2CFLA 3AMOB 3DGNA 3IDVA 2O7KA 1GL8A 4KX4A 4ZILA 3ALAA 5CRGA 1AQVA 1X1YA 1Q40A 2XSOB 4POMA 3CU3A 2VD1A 3JCML 2W2CA 5D83A 2ES7A 2C0EA 2EIRA 2JDIH 1RGEA 2CG0A 1FVJA 1QALA 1F2EA 2JZRA 2E2UA 3NBJA 4J56E 2PVQA 1UI7A 2QA1A 1M99A 2VM1A 3LYKA 1USBA 2GEXA 2M80A 4MF6A 1TFOA 7GSPA 5IMCA 4OWYA 3K5TA 2RGQA 4JU5A 1Q7Y4 1NHYA 1WWJA 1BANA 5D73A 1BSEA 1XOBA 4LLRA 2C3QA 3APQA 4KSMA 2XSHB 2Q07A 1T1VA 1U5OA 1FB6A 3SXXA 4ZL7A 3EWLA 2ML5A 5KEJA 3F6FA 2OCTA 3H4KA 2BU4A 5JCWA 1K8A4 1URMA 2OOVC 4O02B 4IKHA 3EB8A 3GX8A 4KCEA 4KA0A 5CRHA 2CA8A 1M9BA 1YJ6A 2H72A 4TR3A 3LT8A 2VO4A 2H19A 1ROVA 13GSA 2X8CA 1Q864 3I69A 4AKZA 1KSIA 3SLUA 3BD2A 1M2AA 3MSOA 4ZB9A 2G2QA 2FGTA 4D73B 3ME8A 1MGRA 3S28A 4ACSA 2YOIA 3H93A 4KAEA 5DQSA 1STFI 2F51A 1S3CA 3PZWA 4WFOA 1UA5A 2GS3A 1EZKA 4KF9A 5F06A 2GQMA 3M0FA 3ISOA 4K7IA 5J9CA 3UVHA 2Z9SA 3AHSA 5AYSC 1BJXA 1WQLB 1AY7A 4CW9A 3IPZA 3WDGB 5A5KA 1DSBA 4ZIJA 2GZYA 1AV4A 2MC8A 4CDLA 1Z5YE 1Q7HA 16GSA 4GF0A 4HYZA 1T5YA 3NBRA 5HGRA 1XG8A 2YZHA 3IOSA 3F9SA 3FK8A 1XZOA 2ZUPA 1GSDA 1JRQA 3U6VA 3PYJA 2OQEC 1U88A 1I9DA 2H6XA 2O85A 1HQOA 2IY2A 3OWSA 1W7CA 4FO5A 3KE7A 3C71A 5D9TA 4GSPA 3Q18A 4L0WA 4K7OA 1O7HB 2GBWB 1SYXA 1T2IA 2LTKA 2LJKA 4EW5A 4MF7A 1DE2A 4YQVA 1RW1A 4RUVA 1MWTA 2MBSA 3Q2PA 4ECBA 3E99A 1YJN3 3P90A 1B2SA 3WGDA 1GRXA 1LOYA 4L7KA 4WR5A 4Z2UA 1BNSA 5IO2A 1KQS2 1VQQA 1EP7A 2GSTA 3FGYA 1SYRA 1E3VA 3APSA 1W6CA 3KSED 5ELJA 4ZBDA 5FW5A 2DJ2A 3UBLA 2FA4A 2MMOA 1DE3A 3TKSE 2YN1A 5DVBA 2K9FA 3A2VA 1JV2B 1FHEA 2H0GA 1A2LA 4OFNA 5COHA 2AHEA 3VURA 5ELGA 3LQ7A 2FY6A 3F40A 4Q5NA 1RJOA 3TJKA 1WOUA 2CAIA 5CP1A 1FGTA 3TB2A 3HZPA 4RNYA 3B4PA 1O7UA 4X2OA 4ML1A 2ZL8A 3T8NA 3DUKA 5DCGA 3WGXA 1B9YC 1F37A 3M9KA 1UCLA 3ERWA 1SKWB 2FNOA 4LA1A 1T4YA 1TU7A 3ZL5A 3CXC2 3SOAA 5AIIA 1XW9A 4GB5A 2UX0A 1VQ73 3DWVA 4JE1A 2B7JA 1ZZYA 2YJHA 2GTUA 3FZ4A 4KW6A 2P05A 3M8CA 3HVXA 3UJMA 3DMCA 4HU7A 1SJZA 3VK9A 2W56B 3UL3A 2ML6A 1ZX2A 2GXFA 1FGOA 4MZBA 6GSXA 1TTOA 3ZFBA 3STDA 2CVDA 1BNJA 1XOAA 2LRCA 2LKUA 3UIWA 1XWKA 2HMMB 1BQ7A 1W4NA 4NREA 3FEUA 1Z7RA 2K3DA 3S67A 5J4UA 4J57E 2CH9A 1MNLA 2E0QA 3VLNA 1RLSA 3X3YA 2F99A 1TRSA 1QAFA 2LQQA 3RNTA 3VWUA 4MZCA 1RCLA 4EC0A 1FGMA 1X9WB 2ON5A 4O92A 2N5BA 3CCQ3 3ZVJA 3ECFA 1SJIA 2EIOA 3GRXA 4K5SA 2VCZA 4N0ZA 4EKZA 1U3AA 2R37A 1N5HA 2H6ZA 4EDYA 3IV4A 4E8HA 1YI23 3M3MA 3D4AA 1JZDA 1O6JA 3U97A 1K0OA 1MWRA 3ZZXA 2YFLB 3IMAB 4CY8A 3DZLA 3CSJA 1H4OA 3VF1A 1K0MA 3O6TA 5BVBA 4V2MA 1DYUA 4OO4A 4NHFA 3IJEB 1RCKA 1AVKA 5M18A 2LNTA 3I9V2 4G0IA 1AC1A 5G31A 1IT7A 4DSQA 4CCVA 2YFIB 3SWLA 5A4UA 4BVXB 3N9JA 7RNTA 2BMXA 3EJVA 3OV4A 4J8TA 1RRHA 3GA4A 1RN4A 5AIVA 3X42A 3HA9A 1EQKA 4XDWA 1BSAA 1GLQA 1A24A 4HM4B 1CH0A 4N10A 1O7GB 5ECNB 4EE0A 2C10A 2GBXB 4F9ZA 1OCVA 7STDA 1OF5B 2FD3A 1EOHA 3QPMA 5GSTA 1MDJA 3KP8A 3S9FA 4ML6A 3MNGA 3MWZA 3NQZA 17GSA 1TFKA 3LZAA 4I5QA 2VIMA 2F5WA 5IMDA 1OH0A 3D5IA 1A2JA 2H0IA 2YJ7A 3GWRA 1R5AA 3CNXA 1S3AA 1VQ43 4HM2B 4O5QA 1YNVX 2IWTA 2GZZA 1TW9A 4TX4A 4EC6A 1Z9HA 5LC6A 5F05A 1RGFA 1BSDA 1VQM3 1XXUA 1RNTA 3UNLA 1OPYA 1FG4A 1B2MA 3I553 1Y6EA 3EMXA 2C80A 4XB5A 3VWWA 4FCZA 3H3HA 4KVHA 2VCWA 3NM7A 2C3TA 3GAXA 3RHCA 2PVOC 3ZITA 3BBYA 1QXHA 4YKFA 5JPUA 5CLKA 3JUOA 1TTZA 3LYGA 3MKIA 3GHAA 4L8OA 2CC3A 1PL2A 3SX1A 4MPGA 1XIYA 3QOUA 1RGAA 1SJWA 2WRTA 2YNXA 3ZYWA 5CK6A 1FUWA 2YCDA 2OE1A 4AGSA 5IQYA 1TRQA 1UUVB 1EKMA 3TOUA 5B8BA 1V74A 3GN3A 4GHOA 2HOHA 1PL1A 3IBHA 1TI3A 1JN5B 3I43A 1RRLA 4ID0A 3HI7A 1NNVA 6GSUA 3AGNA 4X1UA 4MCUA 3HK4A 1M1K4 1FGRA 5DJMA 3US3A 5CXOA 1V58A 4KCAA 1A2PA 3JUPA 2H66A 5IERA 1UVZA 2KF5A 3HZ8A 3W8SA 2IMFA 3KKGA 4XBTA 4RNZA 2FWGA 5BIRA 3WODG 2BMRB 3DGMA 3G713 1F3BA 1ZL9A 4KDUA 1W6YA 2HMNB 4NWYA 3DXBA 2OWPA 3D6IA 3RHBA 1TK8B 3TJJA 2J23A 2W0QA 1ABAA 4HZ4A 2E2MA 1G6YA 2WGRA 1US1A 2A2RA 2L59A 2IMEA 2HZFA 4N30A 1YKCA 2F8AA 2PMTA 1RGHA 3GSPA 3EBTA 1ULJB 4OFTA 4IW9A 1FOVA 1MGWA 3IHGA 2AYTA 5IIZA 3VGNA 1EWXA 4ILFA 1OUNA 3FG4A 4MZWA 2Y74A 3AGOA 3JUQA 3GTUA 3I6AA 3GZXB 4DVCA 4DSSB 5H5SA 3F3RA 4LEHA 5EVOA 3QAGA 4XIHA 3GSTA 2C0DA 1NO3A 1VQP3 3UEMA 1EG9B 4FR9A 1VRSD 4GTUA 1Q42A 2P5RA 2R6KA 5G1KA 4R9LA 1PMTA 1X1XA 4K61A 3DVWA 4KUNA 3D79A 3KZTA 1NJI4 2LSTA 1VGLA 1GOUA 1X5EA 3MWHA 4KDYA 3MYTA 4WF5A 1I0XA 1BRSA 1O8WA 2PGTA 3G16A 1K28A 1XWAA 3BNEA 1GS3A 1AVLA 2HSYA 1XCCA 1YJW3 3L9UA 2JQ5A 1WTHA 2CT6A 2IMDA 1YZXA 1BRJA 1RGLA 3N54B 3CCJ3 2I4AA 1GSSA 4GSSA 3A5EA 2UGIA 3U1WA 1B9XC 2R4IA 3GZRA 5IPHA 3HIGA 1X5DA 1EV9A 2K6VA 2F3MA 4BL7B 1B20A 1SARA 4KNDA 3GH6A 2E2TA 2CW9A 4BTYA 1OE7A 5FT3A 1S723 3HJMA 3VWXA 5ECSA 4MEIA 3LSZA 1NB3I 3ZG5A 4ECCA 2YWOA 2PERA 9RNTA 2CX4A 3MSZA 4G2EA 3EINA 4IQ1A 5ECMB 5IEOA 2QGVA 1QVF2 1D6ZA 2VL9A 22GSA 3QAVA 1HNAA 5ECIB 4FYBA 5EQLA 3TUEA 2B1KA 2D1WA 2XH9A 1IT8A 2GGTA 1A2KA 1C54A 1LBKA 3FYGA 1SIIA 5CRDA 3FR9A 3H1NA 1C72A 1YHQ3 3L78A 2JSZA 2YANA 1YEXA 1KEBA 2A15A 3KM6A 3N9HA 2IFQB 4NHZA 3K9MC 3QDNA 3KSPA 2R2JA 1TK5B 1EOGA 3F6DA 1VF3A 4GL6A 1QUWA 1VQN3 2STDA 2C3NA 2F56A 1HKXA 1SIHA 3FZWA 4HZ9B 3F63A 4H3UA 4IGJA 2C0FA 3FF0A 2H1GA 1R5PA 3WT1A 3BNBA 4O8SA 2DJJA 3CYNA 3D0ZA 1EP8A 1F8NA 5B7CA 5LD0A 4KB3A 5IW9A 1CYUA 4DSRA 3EQQB 4LL4B 4EIQA 1UGHI 4WWUC 5IOWA 5GAPD 5G5EA 4KSOA 3TKPA 2JU5A 5GAND 1Q814 3DH2A 2B1LA 3KIIA 2R5GA 3WOFB 2GSSA 2HI7A 2HZEA 2GSRA 1XVQA 3TDGA 1OAZA 2L57A 3EBYA 5BXQA 3JUNA 3B7CA 5DDLA 2BNGA 2YV9A 4IJ3A 1JHBA 1A2VA 3HVNA 4X4JA 3IK7A 2P0XA 3JVCA 1BNRA 3GL5A 2RLIA 1VF2A 3ME7A 1M0UA 1A90A 2FGXA 1PFPA 1GSQA 1W01A 4HBRA 1M2BA 1EGRA 3MG3A 3FHKA 5CO3A 5EL8A 3CCS3 1OHPA 1GNWA 3ZFLA 1N8R4 4J9AA 1JKGA 4RI6A 1BSBA 2KXGA 4RQRA 2C4BA 3GKKA 1BG5A 5KN1A 4BTXA 4N6V0 4K2DA 4O2HA 5JPPA 2OBIA 1WP0A 4IP1A 4WYKB 1PFOA 2DJ0A 1VQL3 3L4NA 4HJ2A 2BT3A 5ECLB 2KRTA 4GLTA 2R4VA 4X43A 2UZ8A 1ZO2A 1GMPA 3GZBA 2CX0A 1X9MB 2MBTA 1Z6NA 3IE3A 2DJ1A 2JZTA 1I3IA 2RUFA 1ML6A 1W89A 1R7HA 4FQUA 1Q824 3EC9A 1YGEA 1SD9A 2PNCA 1BNEA 4MLYA 3TGZA 1O7NB 2RUEA 2HE3A 4Z7XA 3CCR3 3BJ5A 2RBIA 4V1Ap 1K734 3CPW2 4LSOA 1MTCA 3KTLA 4K6XA 3RDEA 2B5XA 3JUMA 1SL0B 4TR1B 1LVNA 3CME3 3R3EA 3VFIA 1VF1A 3K0ZA 1VQK3 5AEUB 5D93A 2YFJB 2HNLA 3NHXA 1Q98A 4MDCA 1XWBA 1IVWA 2OADA 1SK2A 1GY6A 1B4QA 1V98A 1PN9A 2B5YA 1YF1A 1YQ1A 3C1SA 3EF8A 2L5LA 3VI5A 5D9XA 3NQYA 1UC7A 2Z6BA 3SOYA 1UUWB 2F5MA 1N8QA 1M9AA 3ZVJD 3TRXA 1HD2A 4ECJA 2OTL3 1V2AA 4BPYA 3IXRA 4XS6A 3G0KA 3KZQA 11GSA 2VL2A 1ZCPA 2LQVA 2FHEA 2HMLB 2LJAA 3Q19A 3RPNA 3FW2A 1AQXA 2CZ3A 1W6GA 1GH2A 2RFRA 1W2B2 3DIEA 2DIYA 2HSMA 4HS1A 1AXDA 1GTIA 2B24B 5LC7A 3ZIVA 2WS2A 1JZWA 5HOHA 2XHFA 5M19A 5FHIA 5CNWA 2W9PA 1JB5A 1PYLA 1KWIA 2VLUA 4DEJA 3MHEA 3T8UA 3NZNA 1ILOA 3QAWA 2DKHA 1G02A 3PINA 1X1UA 2CWTA 1M9GA 2JSYA 1J9BA 2HRAA 2JL4A 3FY7A 1B48A 4Q5QA 1IQ8A 3KMNA 1JLWA 3RGAA 3B4OA 3LH4A 1FYSA 1VZZA 1GWCA 1FGQA 2DJKA 5ECKB 4K90B 4N6MA 4OCFA 2R41A 1GLPA 2QIYA 3DVXA 2OA7A 4TW5A 5G2GA 2EIQA 3EMPA 5C04A 2DLXA 18GSA 3U5RE 1IVUA 1SU9A 1TRVA 1VQ53 1N9EA 4K0NA 1IV7A 5IOXA 1E6BA 2CIUA 1TI1A 1GTBA 4H86A 4IBPA 4MJCA 2QA2A 3APOA 1BOXA 2CFDA 4MMZB 2IMJA 2AAEA 3KH7A 3TKRA 3CRTA 1DMMA 1K0BA 3S27A 3WA3A 1IQYA 2MZCA 3M9JA 1GTUA 4HOJA 3KGKA 3DXOA 1SD8A 1FZUA 5D8IA 3HXSA 3PGBA 5JBSA 4MA9A 4K9ZA 2VCQA 2R3XA 5J41A 5DALB 5AISA 4TVEA 4TR0A 1F6MC 3WMDA 1OHOA 4AKYA 3Q90A 4MABA 5DAKA 2H70A 4E8EA 1D6YA 1UW1A 2CWVA 4IPBA 3KIJA 4QWTA 3B8LA 1N9JA 2UUGC 2HRNA 4OO5A 3IRAA 3GKMA 3OXAA 1ZOFA 3RDWA 1DMQA 1RNBA 5ELUA 2LNSA 8CHOA 1SKSB 1AUCA 3A3TA 2CX3A 1ST9A 4PX1A 1X5CA 2OKAA 2V41A 3BNDA 1PRXA 3R2QA 4N0VA 2XC2A 4ULXA 3KP9A 5CF1A 1QMVA 4O7HA 1LNHA 4XS4A 4N11A 3CC43 3FSDA 3NXJA 2CVBA 3KFQC 3NM2A 4NXIA 4BTWA 4G10A 4I4KA 1OVNA 1TRUA 1NDOB 1ON4A 5F8BA 2BIRA 4HAAA 4L5OA 4HM5B 3J7Yk 3AMOA 1ACVA 4AEQA 3UAPA 2RM6A 5L71A 3F7XA 4FMCA 4TXOB 2IN3A 4TOPA 2MMNA 1DMNA 2PWJA 1NWWA 5KOWA 3D5GA 4HZBB 3GRDA 1NSWA 2ALBA 2L6DA 1QAKA 3LTAA 5AIHA 5EY6A 4L8EA 4CPKA 1WMOA 3TKSA 2XBIA 4HQSA 5IMVA 3NUVA 5G5FA 4G0KA 4NHWA 1SL1B 1IQXA 2FUG2 2WCIA 4LZIA 4GCIA 3DGYA 3QD9A 2M72A 1PD21 2JZSA 3K7CA 1OC9B 1V9WA 4MNNA 3DEXA 3F3QA 4BVYB 1PX6A 3KEBA 1XW5A 2GLRA 2NPBA 2SARA 3K8NA 2A4HA 2IIYA 2CVKA 4L0UA 2OJLA 3EE2A 4XM4A 1ERVA 10GSA 4L8PA 5EEOA 4PNGA 2MMAA 5AIGA 3G7JA 4F0BA 3V99A 4FYCA 2NDOA 4IJIA 5CYYA 3NV0B 2PN8A 1IV9A 4STDA 1RTUA 1AIUA 1GOYA 4K0GA 4PXOA 1SJ6A 5BMUA 1A0RP 1EA2A 3H8QA 5ID2B 3EE1A 4O5UA 1GY7A 2AV4A 4K1FA 4WEYA 5D82A 2CFGA 1UUGB 1YDKA 3G6E3 3SVAA 5D96A 2I9HA 4X2HA 2HMKB 3ZIJA 2KP2A 5ECPB 1Q40B 4D73A 8RNTA 1SK0A 5IM9A 2OQEA 3GFKA 5JCUA 3CQFA 1LRAA 3LWAA 3VPTA 3D4MA 1R4WA 5G1LA 2JADA 2BJXA 1K0DA 3TJBA 3WT2A 3OX9A 3GYKA 4Z2TA 2FXTA 1GSUA 3W8JA 3LORA 4F0CA 3FG3A 1KD14 2P0GA 4MH3A 2B6MA 5GSPA 1N5PA 2K8SA 2CWUA 3X41A 4BL2A 2I81A 3O3TA 2HFDA 3KXOA 3TJGA 1W02A 2NVLA 2RIIA 4N6UA 1DVDA 2I1UA 3TRQA 3LTCA 2K0MA 3IPTA 4MMXB 1HU9A 4K2XA 3C7MA 2RSXA 4MJAA 2P5QA 3ZMKA 1ZYNA 3CMIA 3GURA 1BIRA 5H5QA 3UB1A 4ZBBA 1EEMA 5HFIA 1AQWA 4TKYA 3UBKA 1OYJA 2HSHA 3VPQA 3LMLA 1Z1SA 1DETA 3OR5A 4OVMA 1NHOA 4EV5A 4XCSA 3FF2A 3G7YA 2RNTA 3BU4A 2YV7A 3NBBA 1TKDB 2LRNA 2I3YA 5HQPA 3IK9A 3LTDA 2KLXA 3DM8A 4HVNA 4EBGA 4EXJA 2WOFA 2FNQA 2LEGA 5J3RA 3P8WA 2R0PA 2N5AA 2FLSA 1THOA 4O32A 1OGZA 3ERGA 2WO0A 1JBSA 1N2AA 3S29A 1GUHA 1JJ22 3WD6A 1V40A 1BRKA 1CQGA 2AADA 2GDRA 2LS5A 1J0FA 1IYIA 4BWSA 5J9BA 5KP3A 4N6NB 4EXRA 1AR0A 2HRFA 1O7WB 4GQCA 2H75A 2KF4A 1Q9EA 2VAFA 1BGSA 1I0VA 2GU1A 1BVIA 2W9QA 2B1XB 4WBRD 4PUAA 2YP6A 1RGGA 2A2SA 3MYDA 4Q5FA 1WMPA 3QRDA 3CSHA 3FR6A 3F14A 1K3YA 4J2FA 5ECRB 4HUAA 4TRXA 2VUPA 2KUCA 1GNEA 2E2GA 1O7PB 3EU4A 5DREA 3LTBA 3HOHA 1BX9A 1JLVA 1GUKA 1GP1A 2XPDA 1B4PA 5F07A 3F0IA 3CC23 4K1VA 2L4QA 1BUJA 1QGVA 2A2PA 2KF6A 4LMWA 1X9SB 1M1XB 1FB0A 3LYPA 5KP4A 5HR2A 1A67A 2DKIA 3GX0A 3LEFA 1PKZA 4V2NA 2P0MA 2CFKA 1CEWI 1G7EA 1GTAA 3FZ5A 4G0LA 5D9VA 2FWFA 4RI7A 2W56A 2FA8A 4MP4A 4EDZA 2VL2C 4YQUA 3UMAA 2BHMA 3FR3A 5LCZA 2KCDA 3CPOA 2D42A 3ZREA 1FO5A 2CV4A 4I8BA 5E59A 3L9SA 4HM0B 2YZUA 4LL1B 4I2UA 2QA43 4HM8B 3DD3A 4KE3A 3X40A 4JF8A 4KGIA 3VI7A 1AQZA 5IF6A 2Y73A 1B2UA 4NV5A 1PGTA 3FMWA 4ECIA 2XRXB 2LYXA 2V1MA 3D3LA 5EVHA 2B3SA 2WULA 1SPUA 3EURA 1WPIA 4PQIA 3TKQA 1XWCA 1LNIA 3CCM3 3D21A 2E2VA 3E0UA 1HNBA 4HJMA 4TXVA 3C8EA 3ZLPA 6STDA 4YH2A 5CAXA 4JR6A 2IA7A 1JZOA 5HR0A 3IAS2 3LXUX 1M7TA 2M46A 1FAAA 5ECOB 1M3JA 4XBXA 2KP1A 3HJOA 4RBNA 1XW6A 3BB9A 3UL6A 2V32A 1UCJA 2WDUA 2R0GA 5AEWB 1XBSA 3F8HA 5DCHA 1LOWA 2NTOA 3M8NA 1ROAA 1VQ83 5IPGA 1G0TA 2HMJB 4PQHA 5B6NA 3KD0A 2E7PA 3IC8A 4BVXA 2X8GA 1BNIA 4MH2A 4EVMA 1UCKA 2YWNA 3KTBA 1TP9A 2XPEA 3V1WA 1R4CA 5ECQB 1QFNA 2WJUA 4FMDA 3F8XA 2C11A 3CTFA 2CZ2A 1JFUA 5CF2A 1OF5A 1OC8A 4CY6A 1A8YA 1B27A 2VM2A 1X0RA 3A5WA 5ECHB 1HYFA 3MG1A 4EYCA 5KN0A 1OGXA 1YIJ3 3LGCA 4ISDA 5IMFA 1JBTA 1TJDA 1BRIA 3O76A 20GSA 2H30A 1MD4A 3F8UA 5AIFA 4KZ1A 1T4ZA 1J08A 4USSA 1G96A 2XF3A 1BAYA 4J5GA 2NBSA 3GL3A 1TU8A 3BCKA 1IVVA 2PPTA 4EV2A 1SL2B 4R1KA 2HLSA 1OE8A 1WNHA 4QQ7A 3WA2X 3KH9A 4ZL8A 5AGYA 1VQ93 4HZ2A 5JWQB 5EPFA 3GNJA 2H73A 3I0YA 1B2XA 4BIKA 1BRGA 3N5OA 1RQMA 5D9WA 1ZGNA 2TRXA 3PCSA 2H01A 2KOKA 1QVG2 3HX8A 3ZG0A 4KH7A 4MPFA 5M1AA 2IPAA 3ROBA 2IUKA 2FCHA 4K5RA 1R4YA 1A8LA 3BIRA 4KDXA 2TRCP 1YVBI 4ORLA 4MMMA 3EX9A 4RZMA 2H74A 3NIVA 4JRRA 1TU5A 3M1GA 5AI1A 3EHCA 1GD3A 3V98A 14GSA 2F8FA 4P3YB 2CQ9A 1VF4A 4FMBA 1PU4A 3HDCA 2CG1A 1BU4A 2FWEA 2H76A 2LJRA 2JACA 2KAAA 4HKVB 2O89A 1GSFA 3ZMLA 3CSIA 2X64A 3LW9A 3Q6OA 1IVXA 5IG5A 3G9BA 4XTSA 3GH9A 3Q1CA 1HZ1A 5BU4A 1KBNA 5IO0A 4HEA2 2PU9C 5IMAA 1LOXA 4HOHA 1JN5A 4IP6A 4EIPA 2Z76A 3HVSA 1UCIA 2MF7A 5H5RA 3TKSC 4LGQA 1ERWA 2F98A 4NMUA 3A76A 1L5GB 2G0FA 4IIAA 2IMKA 2QGUA 4FIWA 3G7IA 3D5JA 4HU9A 1GUMA 2PUKC 1I2GA 1UDII 3HVVA 4MK3A 5GSSA 2L4CA 3IC4A 1JNQA 4WETA 5AIXA 1BYEA 5HR1A 3BNCA 1MEKA 1GOVA 4IVFA 1LQGC 3G4S3 3X3XA 1KC84 1A23A 3QFBC 3L0HA 1OKTA 4TR4A 2K54A 1A0FA 3PPUA 2KHPA 5DBQA 4N3VA 2BO9B 5FWGA 4WR4A 1FUTA 1MWSA 3MPHA 1F3AA 4FH8A 1T8EB 1K3OA 2KF3A 2L1SA 2H1BA 4L5LA 5G2ZA 2GSPA 1W4VA 2V6KA 1XFLA 3PXMA 3HHVA 3IR4A 1DUGA 2ZCTA 4MF5A 1RGKA 1GYBA 1MWUA 3F4TA 1DVCA 2HT9A 3EPTA 3O8YA 2VD0A 4MJEA 5HR3A 5JWOB 2B5EA 6RNTA 3A2XA 2ZA4A 1V57A 1WIKA 8GSSA 1S3DA 1QJGA 1W2ZA 4CHSA 7GSSA 3WR2A 4ZBAA 1T2HA 4DSSA 5IENA 2GQLA 2V2GA 1TDIA 2DMLA 2AAWA 1MDIA 1RDSA 3Q74A 2GU3A 4JRFA 4BU4A 1U8CB 4FCMA 1THXA 3SBCA 3CMA3 1NW2A 4NV2A 1NM3A 2X49A 1K9M4 1B2ZA 4R9KA 1EUIC 2B7KA 1M904 1RGCA 5IG4A 3EVIA 3H51A 3MIXA 4PTSA 3WHOA 1GSEA 4N6OB 1OKDA 3A2WA 2L4VA 1AAZA 1RN1A 2XBQA 4R80A 1HNCA 3PR8A 4XS1A 5J5NA 1LQMB 2GEYA 3EYTA 1ASKA 1K0AA 5IEPA 4XDVA 3FKFA 3VSYA 2CX1A 2DJ3A 2QEX3 4GRFA 5ELAA 4AJ6A 4ZL9A 3QFAC 5A4WA 4LYLB 1TIJA 3Q3FA 3F7SA 5RNTA 3DKSA 1ULIB 4X0XA 6GSVA 1ZS7A 4BL7A 2LV3A 1FUSA 1IK3A 4U13A 2HRKA 3VWVA 1I2FA 4BIRA 3H79A 2F4YA 2INXA 2BMOB 2YX9A 2AJQB 3FZ9A 1O8XA 1JZRA 5DJLA 4G9HA 3HIIA 5KP1A 3GTUB 1C7HA 1BSCA 2WZ9A 4FCJA 5GZZB 5KOXA 1E3RA 1B8XA 1K41A 2O87A 4R4KA 1Z7PA 3D4TA 1GMQA 1T00A 3KCMA 1PN0A 2EC4A 2IFQA 3LXTA 4J5KA 4KT3B 2OBKA 3KN4A 1AW9A 3OWYA 2DIZA 3IHQA 3T0UA 1PX7A 3CRUA 3S5CA 3RAZA 1RSNA 1LOVA 5JWRB 2VL3A 3CXGA 3UVTA 2O8VB 4OK0A 3PH9A 5KN3A 3D9RA 1GD4A 3FCSB 4N6LA 4RQXA 1SK1A 1DE1A 2C4JA 3P7XA 1I70A 1YVSA 3D22A 2WGOA 1N8JA 2C8UA 2CKFB 2DC5A 1D6UA 2J8XB 1ZYQB 1A2MA 5ENUA 2IL3A 2ZDJA 1WMNA 1U6TA 4JZQA 5AN1A 1J2BA 3QCPA 4RNTA 3OWUA 1TXXA 3ERFA 3QK9A 2O9UX 1RN7A 1ZGXA 1EGOA 3UL5A 1UGIA 4KFDA 4IELA 4IS0A 2ZNMA 2YPMA 2C1YA 5FGOA 3AY8A 3F9UA 1NB5I 3MAKA 4POLA 3I563 3MG2A 3SYUA 3LOYA 1UI8A 2OOVA 1T3BA 3HYPA 3RBTA 2BTOT 4GWRA 4PEJA 6GSSA 12GSA 1YY7A 2WOHA 5C00A 2XGNA 3QMXA 4V1Ag 4MMYB 2M7OA 1IYYA 3ZTLA 3X3ZA 2RM5A 5INYA 4FMAA 4TN8A 2HXKA 2PBJA 2P31A 4OUQA 1NU3A 1WMJA 4WYKA 2TIRA 3PS8A 2O3OA 3LT9A 1IYHA 2C0GA 5BRTA 1TP6A 1RHLA 2ZHXB 1K0CA 1Y25A 1OC3A 2PZVA 5HFKA 5ABRA
chains in the Genus database with same CATH topology
6GSYA 1SKRB 1E2YA 3HD5A 2K18A 4MJBA 4OD7A 4EF0A 1LU4A 1Z6MA 4LMVA 2VLTA 1CQHA 2QC7A 5LNKe 3IAM2 1MD3A 1R26A 4I6XA 3FZAA 1PQNA 4G19A 3LJRA 2HZEB 1QQ2A 3HZ4A 4F82A 2HYXA 4JBBA 1ZYEA 5DQYA 4TR1A 1U87A 2FWHA 2AB6A 4AJ7A 2V6OA 3LFLA 4JEDA 2OE3A 4PURA 4HQZA 3CTGA 4K8MA 3E3EA 4QL9A 4WKWA 1F9MA 4OFMA 3GUSA 4K7NA 3W6GA 2YWIA 4PQ1A 3UJ1A 2VLVA 2H8LA 1WJKA 3HJPA 4WXTA 2X8HA 4F03A 2YWMA 1PSQA 4XHMA 4GSTA 2K8VA 1XPVA 4BA7A 4ICYA 1TOFA 2X4AA 9GSSA 1KTEA 5KN2A 2J9HA 2CAQA 4YAVA 3P2AA 4IHUA 3GMFA 2GVPA 2IJYA 4I2TA 2H0HA 2N5FA 3NOFA 3QR6A 4NPBA 4WF4A 2MMZA 4ZXGA 3DYRA 2VOCA 1YF0A 4HDEA 3HKRA 3C73A 2F9SA 1PA3A 2AUVA 2D2ZA 1ERUA 1PKWA 1H75A 1T7PB 4O5RA 1KNGA 2QSIA 3TOTA 4EO3A 1FOHA 5A4VA 2IYJA 4QL7A 1TRWA 4PGTA 2DSAA 4YKGA 4YAPA 3TJFA 2IMIA 4JR4A 5B8AA 3UARA 5HFGA 1RK4A 4AF2A 4WBJA 2A4VA 2H6YA 4IN0A 2WB9A 4ZB6A 3MDKA 4FYUA 4GQFA 4POKA 2R0CA 1YKAA 1MDKA 2WFCA 1QK8A 3A5IA 1ERTA 4I97A 3TCOA 4EUYA 4OMVA 3LG6A 1K0NA 2L5OA 2LQOA 5CRWA 2LRTA 3TRPA 3F4SA 3DGQA 3FRCA 1G7OA 4XRAA 2DBCA 4AJ8A 1WRYA 3HY2A 1EV4A 4OCEA 3GKXA 2REMA 3UOMA 5DALA 5E4WA 1GULA 4POBA 3RPPA 3J7Yb 1LJRA 1O85A 1XWGA 1FW1A 3C1RA 3DMLA 2H1DA 1DBYA 3ZRDA 1M2DA 1YEPA 1Z3EA 1O81A 1TK0B 3BOAA 1K3LA 3E9JB 1SENA 4HI7A 1GSYA 4V2LA 3EC3A 2VCXA 4PNFA 2OE0A 4Z2RA 4XRDA 5CREA 4IQAA 2VCVA 1ZMAA 1XVWA 5IMZA 2L6CA 4TXOA 1FVKA 2X99A 3F4RA 3LXZA 1Q4JA 3EU3A 4GXZA 3ED3A 2OACA 3BCIA 6GSWA 4F2IA 2GZPA 2H1AA 1I5GA 3CBUA 4NAXA 4CDOA 3GKNA 4GSNA 4A5PA 4BWQA 3DRNA 2H71A 2GSQA 2GT5A 1O73A 3WGEA 19GSA 3HCZA 1WE0A 3GV1A 3IA1A 1BEDA 3GIXA 5DAKB 3WYWA 1G6WA 2MYGA 1ZYPA 2GQKA 5JCGA 1HYUA 1OC9A 2DMMA 5F0GA 5B6MA 4BVYA 3GSSA 3KJYA 3KMOA 4PUFC 4Q5RA 1EEJA 3L9VA 2ON7A 6GSTA 4YQMA 2LUSA 1U3IA 2QKEA 4XS4B 4EL1A 3PGTA 1UN2A 2GT6A 5G30A 5ID2A 2VCTA 4ZB8A 3IDVA 2O7KA 1GL8A 4KX4A 4ZILA 5CRGA 1AQVA 4POMA 2VD1A 3JCML 2ES7A 2C0EA 2EIRA 1FVJA 1F2EA 2JZRA 4J56E 2PVQA 2QA1A 2VM1A 1M99A 3LYKA 1USBA 2M80A 4MF6A 5IMCA 4OWYA 4JU5A 1NHYA 1WWJA 5D73A 1XOBA 4LLRA 2C3QA 3APQA 4KSMA 1T1VA 1FB6A 4ZL7A 3EWLA 5KEJA 3F6FA 3H4KA 5JCWA 1URMA 4IKHA 4KCEA 3GX8A 4KA0A 5CRHA 2CA8A 1M9BA 1YJ6A 2H72A 4TR3A 2VO4A 2H19A 3I69A 13GSA 2X8CA 3BD2A 1M2AA 4ZB9A 2G2QA 4D73B 3ME8A 4ACSA 2YOIA 3H93A 4KAEA 5DQSA 2F51A 1S3CA 1UA5A 2GS3A 1EZKA 4KF9A 5F06A 2GQMA 3M0FA 3ISOA 4K7IA 5J9CA 3UVHA 2Z9SA 1BJXA 4CW9A 3IPZA 5A5KA 1DSBA 4ZIJA 2GZYA 1Z5YE 16GSA 4GF0A 2YZHA 3IOSA 3FK8A 1XZOA 2ZUPA 1GSDA 3U6VA 1U88A 1I9DA 2H6XA 2O85A 1HQOA 2IY2A 4FO5A 3C71A 5D9TA 3Q18A 4L0WA 4K7OA 1SYXA 2LTKA 2LJKA 4MF7A 1DE2A 4YQVA 1RW1A 4RUVA 2MBSA 4ECBA 3P90A 3WGDA 1GRXA 4WR5A 4Z2UA 5IO2A 1EP7A 2GSTA 1SYRA 3APSA 4ZBDA 2DJ2A 3UBLA 2FA4A 2MMOA 3TKSE 2YN1A 5DVBA 2K9FA 3A2VA 1FHEA 2H0GA 1A2LA 4OFNA 5COHA 2AHEA 3VURA 5ELGA 3LQ7A 2FY6A 4Q5NA 3TJKA 1WOUA 2CAIA 5CP1A 3TB2A 1O7UA 4ML1A 5DCGA 3WGXA 1B9YC 1F37A 3M9KA 3ERWA 1SKWB 2FNOA 4LA1A 1T4YA 1TU7A 3ZL5A 1XW9A 4JE1A 3DWVA 2B7JA 1ZZYA 2YJHA 2GTUA 3FZ4A 4KW6A 3HVXA 4HU7A 1SJZA 3VK9A 3UL3A 4MZBA 6GSXA 3ZFBA 2CVDA 1XOAA 2LRCA 2LKUA 3UIWA 1XWKA 1BQ7A 3FEUA 1Z7RA 5J4UA 4J57E 2E0QA 3VLNA 1TRSA 2LQQA 3VWUA 4MZCA 4EC0A 1X9WB 2ON5A 4O92A 2N5BA 3ZVJA 1SJIA 2EIOA 3GRXA 4K5SA 2VCZA 4N0ZA 4EKZA 1U3AA 2R37A 2H6ZA 4EDYA 3IV4A 4E8HA 3M3MA 1JZDA 1O6JA 1K0OA 3ZZXA 4CY8A 3CSJA 1H4OA 1K0MA 3O6TA 4V2MA 4OO4A 2LNTA 3I9V2 4G0IA 1AC1A 5G31A 4DSQA 3SWLA 5A4UA 4BVXB 3N9JA 2BMXA 3GA4A 5AIVA 3HA9A 1GLQA 1A24A 4N10A 5ECNB 4EE0A 4F9ZA 2FD3A 1EOHA 3QPMA 5GSTA 1MDJA 3KP8A 3S9FA 4ML6A 3MNGA 17GSA 4I5QA 2VIMA 5IMDA 1A2JA 2H0IA 2YJ7A 1R5AA 1S3AA 4O5QA 2IWTA 2GZZA 1TW9A 1Z9HA 5F05A 1XXUA 1FG4A 1Y6EA 3EMXA 2C80A 3VWWA 2VCWA 2C3TA 3RHCA 2PVOC 3ZITA 3BBYA 1QXHA 4YKFA 1TTZA 3GHAA 1PL2A 4MPGA 1XIYA 3QOUA 2WRTA 2YNXA 3ZYWA 2YCDA 2OE1A 4AGSA 5IQYA 3TOUA 5B8BA 3GN3A 1PL1A 3IBHA 1TI3A 3I43A 4ID0A 6GSUA 4X1UA 4MCUA 5DJMA 3US3A 1V58A 4KCAA 2H66A 1UVZA 3HZ8A 3W8SA 2IMFA 2FWGA 1F3BA 1ZL9A 4KDUA 4NWYA 3DXBA 3D6IA 3RHBA 1TK8B 3TJJA 2J23A 1ABAA 4HZ4A 2E2MA 1G6YA 2WGRA 2A2RA 2L59A 2IMEA 2HZFA 4N30A 1YKCA 2F8AA 2PMTA 4OFTA 4IW9A 1FOVA 3IHGA 2AYTA 5IIZA 1EWXA 4ILFA 4MZWA 3GTUA 3I6AA 4DVCA 4DSSB 5H5SA 3F3RA 5EVOA 3QAGA 4XIHA 3GSTA 2C0DA 3UEMA 1VRSD 4GTUA 2P5RA 2R6KA 5G1KA 1PMTA 3DVWA 4KUNA 2LSTA 1VGLA 1X5EA 3MWHA 4KDYA 4WF5A 1O8WA 2PGTA 1XWAA 2HSYA 1XCCA 3L9UA 2CT6A 2IMDA 1YZXA 2I4AA 1GSSA 4GSSA 1B9XC 5IPHA 1X5DA 1EV9A 2K6VA 2F3MA 4BL7B 4KNDA 3GH6A 5FT3A 1OE7A 3HJMA 3VWXA 5ECSA 3LSZA 4ECCA 2YWOA 2PERA 2CX4A 3MSZA 4G2EA 3EINA 4IQ1A 5ECMB 2QGVA 2VL9A 22GSA 3QAVA 1HNAA 5ECIB 4FYBA 3TUEA 2B1KA 2GGTA 1LBKA 3FYGA 5CRDA 3FR9A 3H1NA 1C72A 3L78A 2JSZA 2YANA 1YEXA 1KEBA 3KM6A 4NHZA 2IFQB 3QDNA 2R2JA 1TK5B 1EOGA 3F6DA 1VF3A 1QUWA 2C3NA 3F63A 4IGJA 2C0FA 2H1GA 3WT1A 1R5PA 2DJJA 3CYNA 3D0ZA 1EP8A 5B7CA 5LD0A 4KB3A 4DSRA 4LL4B 4EIQA 5IOWA 5GAPD 5G5EA 4KSOA 3TKPA 2JU5A 5GAND 2B1LA 2R5GA 2GSSA 2HI7A 2HZEA 2GSRA 1XVQA 3TDGA 1OAZA 2L57A 5DDLA 2YV9A 4IJ3A 1JHBA 4X4JA 3IK7A 3GL5A 2RLIA 1VF2A 3ME7A 1M0UA 2FGXA 1GSQA 1M2BA 1EGRA 3FHKA 5CO3A 5EL8A 1GNWA 3ZFLA 4RI6A 4RQRA 3GKKA 1BG5A 5KN1A 4K2DA 2OBIA 1WP0A 4IP1A 2DJ0A 3L4NA 4HJ2A 5ECLB 4GLTA 2R4VA 4X43A 2UZ8A 1X9MB 2MBTA 1Z6NA 3IE3A 2DJ1A 2JZTA 2RUFA 1ML6A 1W89A 1R7HA 4FQUA 1SD9A 4MLYA 3TGZA 2RUEA 2HE3A 4Z7XA 3BJ5A 4V1Ap 1MTCA 3KTLA 4K6XA 2B5XA 1SL0B 4TR1B 3R3EA 3VFIA 1VF1A 5D93A 2HNLA 1Q98A 4MDCA 1XWBA 2OADA 1SK2A 1B4QA 1V98A 1PN9A 2B5YA 1YF1A 1YQ1A 3C1SA 3VI5A 2L5LA 5D9XA 1UC7A 1M9AA 3ZVJD 3TRXA 1HD2A 4ECJA 1V2AA 4BPYA 3IXRA 4XS6A 3KZQA 11GSA 2VL2A 1ZCPA 2FHEA 2LJAA 3Q19A 3RPNA 3FW2A 1AQXA 2CZ3A 1GH2A 3DIEA 2DIYA 2HSMA 4HS1A 1AXDA 1GTIA 3ZIVA 2WS2A 1JZWA 2XHFA 5FHIA 5CNWA 2VLUA 4DEJA 3NZNA 1ILOA 3QAWA 2DKHA 3PINA 2JSYA 1J9BA 2HRAA 2JL4A 3FY7A 1B48A 4Q5QA 3KMNA 1JLWA 1GWCA 2DJKA 5ECKB 4OCFA 1GLPA 3DVXA 2OA7A 4TW5A 5C04A 2EIQA 3EMPA 2DLXA 18GSA 3U5RE 1TRVA 1SU9A 4K0NA 5IOXA 1E6BA 1TI1A 1GTBA 4H86A 4IBPA 4MJCA 2QA2A 3APOA 3KH7A 3TKRA 3CRTA 1K0BA 2MZCA 3M9JA 1GTUA 4HOJA 3KGKA 1SD8A 5D8IA 3HXSA 4MA9A 4K9ZA 2VCQA 2R3XA 5J41A 5DALB 5AISA 4TVEA 4TR0A 1F6MC 4MABA 5DAKA 2H70A 4E8EA 3KIJA 2HRNA 4OO5A 3IRAA 3GKMA 1ZOFA 3RDWA 2LNSA 1SKSB 1AUCA 3A3TA 2CX3A 1ST9A 4PX1A 1X5CA 2OKAA 2V41A 1PRXA 3R2QA 4N0VA 2XC2A 4ULXA 3KP9A 1QMVA 4O7HA 4XS4A 4N11A 2CVBA 4NXIA 4G10A 1OVNA 1TRUA 1ON4A 5F8BA 4L5OA 3J7Yk 1ACVA 3UAPA 2RM6A 5L71A 4TXOB 2IN3A 4TOPA 2MMNA 2PWJA 5KOWA 1NSWA 2ALBA 2L6DA 5EY6A 4L8EA 3TKSA 2XBIA 4HQSA 5IMVA 5G5FA 4G0KA 4NHWA 1SL1B 2FUG2 2WCIA 4GCIA 3QD9A 2M72A 1PD21 2JZSA 1OC9B 1V9WA 4MNNA 3DEXA 3F3QA 4BVYB 1PX6A 3KEBA 1XW5A 2GLRA 2NPBA 3K8NA 2A4HA 2IIYA 2CVKA 4L0UA 2OJLA 3EE2A 1ERVA 10GSA 4PNGA 2MMAA 3G7JA 4F0BA 4FYCA 2NDOA 4IJIA 5CYYA 2PN8A 1AIUA 4K0GA 4PXOA 1SJ6A 5BMUA 1A0RP 3H8QA 5ID2B 4O5UA 2AV4A 4K1FA 4WEYA 1YDKA 5D96A 2I9HA 3ZIJA 2KP2A 5ECPB 4D73A 1SK0A 5IM9A 3GFKA 5JCUA 3LWAA 3VPTA 3D4MA 1R4WA 5G1LA 2JADA 2BJXA 1K0DA 3TJBA 3WT2A 3GYKA 4Z2TA 1GSUA 3W8JA 3LORA 4F0CA 2P0GA 4MH3A 2B6MA 2K8SA 2I81A 3O3TA 2HFDA 3KXOA 3TJGA 2NVLA 2RIIA 3TRQA 2I1UA 4K2XA 3C7MA 4MJAA 2P5QA 3ZMKA 1ZYNA 3CMIA 3GURA 5H5QA 4ZBBA 1EEMA 5HFIA 1AQWA 4TKYA 3UBKA 1OYJA 2HSHA 3VPQA 3OR5A 1NHOA 4XCSA 3G7YA 2YV7A 1TKDB 2LRNA 2I3YA 5HQPA 3IK9A 2KLXA 4EXJA 2LEGA 5J3RA 3P8WA 2R0PA 2N5AA 2FLSA 1THOA 4O32A 3ERGA 1N2AA 1GUHA 3WD6A 1V40A 1CQGA 2GDRA 2LS5A 1J0FA 1IYIA 4BWSA 5J9BA 2HRFA 4GQCA 2H75A 2VAFA 4WBRD 4PUAA 2YP6A 2A2SA 3MYDA 4Q5FA 3FR6A 3CSHA 1K3YA 4J2FA 5ECRB 4HUAA 4TRXA 2VUPA 2KUCA 1GNEA 2E2GA 3EU4A 1BX9A 1JLVA 1GUKA 1GP1A 2XPDA 1B4PA 5F07A 3F0IA 2L4QA 4LMWA 1QGVA 2A2PA 1X9SB 1FB0A 3LYPA 5HR2A 2DKIA 3GX0A 3LEFA 1PKZA 4V2NA 1G7EA 1GTAA 3FZ5A 4G0LA 5D9VA 2FWFA 4RI7A 2FA8A 4MP4A 4EDZA 2VL2C 4YQUA 3UMAA 3FR3A 5LCZA 1FO5A 3ZREA 2CV4A 4I8BA 5E59A 3L9SA 2YZUA 4LL1B 4I2UA 3DD3A 4KE3A 4KGIA 3VI7A 4NV5A 1PGTA 3FMWA 4ECIA 2V1MA 2B3SA 2WULA 3EURA 4PQIA 1WPIA 3TKQA 1XWCA 3D21A 3E0UA 1HNBA 4HJMA 4TXVA 3C8EA 3ZLPA 4YH2A 5CAXA 4JR6A 1JZOA 5HR0A 3IAS2 1M7TA 2M46A 1FAAA 5ECOB 2KP1A 3HJOA 1XW6A 2V32A 2WDUA 2R0GA 1XBSA 5DCHA 2NTOA 3M8NA 5IPGA 1G0TA 5B6NA 4PQHA 3KD0A 2E7PA 3IC8A 4BVXA 2X8GA 4MH2A 4EVMA 2YWNA 3KTBA 1TP9A 2XPEA 3V1WA 5ECQB 1QFNA 2WJUA 3CTFA 2CZ2A 1JFUA 1OC8A 4CY6A 1A8YA 2VM2A 1X0RA 3A5WA 5ECHB 5KN0A 3LGCA 5IMFA 4ISDA 1TJDA 3O76A 20GSA 2H30A 1MD4A 3F8UA 1T4ZA 1J08A 4USSA 1BAYA 2NBSA 3GL3A 1TU8A 3BCKA 2PPTA 1SL2B 2HLSA 1OE8A 4QQ7A 3KH9A 4ZL8A 5AGYA 4HZ2A 5JWQB 5EPFA 3GNJA 2H73A 3N5OA 1RQMA 5D9WA 1ZGNA 2TRXA 2H01A 2KOKA 4KH7A 4MPFA 2IPAA 2FCHA 4K5RA 1A8LA 4KDXA 2TRCP 4MMMA 2H74A 3NIVA 4JRRA 3M1GA 14GSA 2F8FA 4P3YB 2CQ9A 1VF4A 3HDCA 2FWEA 2H76A 2LJRA 2JACA 2O89A 1GSFA 3ZMLA 3CSIA 2X64A 3LW9A 3Q6OA 3G9BA 4XTSA 3GH9A 5IO0A 1KBNA 4HEA2 2PU9C 5IMAA 4IP6A 4EIPA 3HVSA 5H5RA 3TKSC 1ERWA 4NMUA 2G0FA 2IMKA 4FIWA 3G7IA 3D5JA 4HU9A 1GUMA 2PUKC 3HVVA 4MK3A 5GSSA 2L4CA 3IC4A 4WETA 5AIXA 1BYEA 5HR1A 1MEKA 4IVFA 1A23A 3QFBC 3L0HA 1OKTA 4TR4A 1A0FA 3PPUA 2KHPA 5DBQA 5FWGA 4WR4A 1F3AA 4FH8A 1T8EB 1K3OA 5G2ZA 2H1BA 4L5LA 1W4VA 2V6KA 3HHVA 1XFLA 3IR4A 1DUGA 2ZCTA 4MF5A 3F4TA 2HT9A 3EPTA 2VD0A 4MJEA 5HR3A 5JWOB 2B5EA 3A2XA 1V57A 1WIKA 8GSSA 1S3DA 4CHSA 7GSSA 4ZBAA 4DSSA 2GQLA 2V2GA 1TDIA 2DMLA 2AAWA 1MDIA 3Q74A 1THXA 3SBCA 1NW2A 4NV2A 1NM3A 2X49A 2B7KA 3EVIA 4PTSA 3MIXA 1GSEA 1OKDA 3A2WA 1AAZA 4XS1A 2XBQA 1HNCA 3PR8A 5J5NA 3EYTA 1K0AA 3FKFA 2DJ3A 4GRFA 4ZL9A 5ELAA 4AJ6A 3QFAC 5A4WA 3DKSA 4X0XA 6GSVA 4BL7A 2LV3A 2HRKA 3VWVA 3H79A 2AJQB 3FZ9A 1O8XA 1JZRA 5DJLA 4G9HA 3GTUB 2WZ9A 5GZZB 5KOXA 1B8XA 2O87A 1Z7PA 3D4TA 1T00A 3KCMA 1PN0A 2EC4A 2IFQA 3LXTA 2OBKA 1AW9A 2DIZA 3IHQA 1PX7A 3CRUA 3RAZA 5JWRB 2VL3A 3CXGA 3UVTA 2O8VB 3PH9A 5KN3A 4RQXA 1SK1A 1DE1A 2C4JA 3P7XA 3D22A 1N8JA 2C8UA 2DC5A 1ZYQB 1A2MA 5ENUA 2IL3A 1U6TA 4JZQA 5AN1A 3QCPA 1TXXA 3ERFA 1EGOA 4IELA 4IS0A 2ZNMA 2YPMA 2C1YA 3AY8A 3F9UA 3MAKA 4POLA 1T3BA 3HYPA 3RBTA 2BTOT 4GWRA 6GSSA 12GSA 1YY7A 5C00A 3QMXA 4V1Ag 3ZTLA 2RM5A 5INYA 4TN8A 2HXKA 2PBJA 2P31A 1WMJA 2TIRA 1IYHA 2C0GA 5BRTA 1K0CA 1Y25A 1OC3A 5HFKA 5ABRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSY A;  1SKR B;  1E2Y A;  3HD5 A;  2K18 A;  4MJB A;  4OD7 A;  4EF0 A;  1LU4 A;  1Z6M A;  4LMV A;  2VLT A;  1CQH A;  2QC7 A;  5LNK e;  3IAM 2;  1MD3 A;  1R26 A;  4I6X A;  3FZA A;  1PQN A;  4G19 A;  3LJR A;  2HZE B;  1QQ2 A;  3HZ4 A;  4F82 A;  2HYX A;  4JBB A;  1ZYE A;  5DQY A;  4TR1 A;  1U87 A;  2FWH A;  2AB6 A;  4AJ7 A;  2V6O A;  3LFL A;  4JED A;  2OE3 A;  4PUR A;  4HQZ A;  3CTG A;  4K8M A;  3E3E A;  4QL9 A;  4WKW A;  1F9M A;  4OFM A;  3GUS A;  4K7N A;  3W6G A;  2YWI A;  4PQ1 A;  3UJ1 A;  2VLV A;  2H8L A;  1WJK A;  3HJP A;  4WXT A;  2X8H A;  4F03 A;  2YWM A;  1PSQ A;  4XHM A;  4GST A;  2K8V A;  1XPV A;  4BA7 A;  1TOF A;  9GSS A;  1KTE A;  5KN2 A;  2J9H A;  2CAQ A;  4YAV A;  3P2A A;  4IHU A;  3GMF A;  2GVP A;  2IJY A;  4I2T A;  2H0H A;  2N5F A;  3NOF A;  3QR6 A;  4NPB A;  4WF4 A;  2MMZ A;  4ZXG A;  3DYR A;  2VOC A;  1YF0 A;  4HDE A;  3HKR A;  3C73 A;  2F9S A;  1PA3 A;  2AUV A;  2D2Z A;  1ERU A;  1PKW A;  1H75 A;  1T7P B;  4O5R A;  1KNG A;  2QSI A;  3TOT A;  4EO3 A;  5A4V A;  2IYJ A;  4QL7 A;  1TRW A;  4PGT A;  2DSA A;  4YAP A;  3TJF A;  2IMI A;  4JR4 A;  5B8A A;  3UAR A;  5HFG A;  1RK4 A;  4AF2 A;  4WBJ A;  2A4V A;  2H6Y A;  4IN0 A;  2WB9 A;  4ZB6 A;  3MDK A;  4FYU A;  4GQF A;  4POK A;  1YKA A;  1MDK A;  2WFC A;  1QK8 A;  1ERT A;  4I97 A;  3TCO A;  4EUY A;  4OMV A;  3LG6 A;  1K0N A;  2L5O A;  2LQO A;  5CRW A;  2LRT A;  3TRP A;  3F4S A;  3DGQ A;  3FRC A;  1G7O A;  4XRA A;  2DBC A;  4AJ8 A;  1WRY A;  3HY2 A;  1EV4 A;  4OCE A;  3GKX A;  2REM A;  3UOM A;  5DAL A;  5E4W A;  1GUL A;  4POB A;  3RPP A;  3J7Y b;  1LJR A;  1O85 A;  1XWG A;  1FW1 A;  3C1R A;  3DML A;  2H1D A;  1DBY A;  3ZRD A;  1M2D A;  1YEP A;  1Z3E A;  1O81 A;  1TK0 B;  3BOA A;  1K3L A;  3E9J B;  1SEN A;  4HI7 A;  1GSY A;  4V2L A;  3EC3 A;  2VCX A;  4PNF A;  2OE0 A;  4XRD A;  5CRE A;  4IQA A;  2VCV A;  1ZMA A;  1XVW A;  5IMZ A;  2L6C A;  4TXO A;  1FVK A;  2X99 A;  3F4R A;  3LXZ A;  1Q4J A;  3EU3 A;  4GXZ A;  3ED3 A;  2OAC A;  3BCI A;  6GSW A;  4F2I A;  2GZP A;  2H1A A;  1I5G A;  3CBU A;  4NAX A;  4CDO A;  3GKN A;  4GSN A;  4BWQ A;  3DRN A;  2H71 A;  2GSQ A;  2GT5 A;  1O73 A;  3WGE A;  19GS A;  3HCZ A;  1WE0 A;  3GV1 A;  3IA1 A;  1BED A;  3GIX A;  5DAK B;  3WYW A;  1G6W A;  2MYG A;  2GQK A;  5JCG A;  1HYU A;  1OC9 A;  2DMM A;  5F0G A;  5B6M A;  4BVY A;  3GSS A;  3KJY A;  3KMO A;  4PUF C;  4Q5R A;  1EEJ A;  3L9V A;  2ON7 A;  6GST A;  4YQM A;  2LUS A;  1U3I A;  2QKE A;  4XS4 B;  4EL1 A;  3PGT A;  1UN2 A;  2GT6 A;  5G30 A;  5ID2 A;  2VCT A;  4ZB8 A;  3IDV A;  2O7K A;  1GL8 A;  4KX4 A;  4ZIL A;  5CRG A;  1AQV A;  4POM A;  2VD1 A;  3JCM L;  2ES7 A;  2C0E A;  2EIR A;  1FVJ A;  1F2E A;  2JZR A;  4J56 E;  2PVQ A;  2VM1 A;  1M99 A;  3LYK A;  1USB A;  2M80 A;  4MF6 A;  5IMC A;  4OWY A;  4JU5 A;  1NHY A;  1WWJ A;  5D73 A;  1XOB A;  4LLR A;  2C3Q A;  3APQ A;  4KSM A;  1T1V A;  1FB6 A;  4ZL7 A;  3EWL A;  5KEJ A;  3F6F A;  3H4K A;  5JCW A;  1URM A;  4IKH A;  4KCE A;  3GX8 A;  4KA0 A;  5CRH A;  2CA8 A;  1M9B A;  1YJ6 A;  2H72 A;  4TR3 A;  2VO4 A;  2H19 A;  3I69 A;  13GS A;  2X8C A;  3BD2 A;  1M2A A;  4ZB9 A;  2G2Q A;  4D73 B;  3ME8 A;  4ACS A;  2YOI A;  3H93 A;  4KAE A;  5DQS A;  2F51 A;  1S3C A;  1UA5 A;  2GS3 A;  1EZK A;  5F06 A;  2GQM A;  3M0F A;  3ISO A;  4K7I A;  5J9C A;  3UVH A;  2Z9S A;  1BJX A;  4CW9 A;  3IPZ A;  5A5K A;  1DSB A;  4ZIJ A;  2GZY A;  1Z5Y E;  16GS A;  4GF0 A;  2YZH A;  3IOS A;  3FK8 A;  1XZO A;  2ZUP A;  1GSD A;  3U6V A;  1U88 A;  1I9D A;  2H6X A;  2O85 A;  1HQO A;  2IY2 A;  4FO5 A;  3C71 A;  5D9T A;  3Q18 A;  4L0W A;  4K7O A;  1SYX A;  2LTK A;  2LJK A;  4MF7 A;  1DE2 A;  4YQV A;  1RW1 A;  4RUV A;  2MBS A;  4ECB A;  3P90 A;  3WGD A;  1GRX A;  4WR5 A;  5IO2 A;  1EP7 A;  2GST A;  1SYR A;  3APS A;  4ZBD A;  2DJ2 A;  3UBL A;  2FA4 A;  2MMO A;  3TKS E;  2YN1 A;  5DVB A;  2K9F A;  3A2V A;  1FHE A;  2H0G A;  1A2L A;  4OFN A;  5COH A;  2AHE A;  3VUR A;  5ELG A;  3LQ7 A;  2FY6 A;  4Q5N A;  3TJK A;  1WOU A;  2CAI A;  5CP1 A;  3TB2 A;  1O7U A;  4ML1 A;  5DCG A;  3WGX A;  1B9Y C;  1F37 A;  3M9K A;  3ERW A;  1SKW B;  2FNO A;  4LA1 A;  1T4Y A;  1TU7 A;  3ZL5 A;  1XW9 A;  4JE1 A;  3DWV A;  2B7J A;  1ZZY A;  2YJH A;  2GTU A;  3FZ4 A;  4KW6 A;  3HVX A;  4HU7 A;  1SJZ A;  3VK9 A;  3UL3 A;  4MZB A;  6GSX A;  3ZFB A;  2CVD A;  1XOA A;  2LRC A;  2LKU A;  3UIW A;  1XWK A;  1BQ7 A;  3FEU A;  1Z7R A;  5J4U A;  4J57 E;  2E0Q A;  3VLN A;  1TRS A;  2LQQ A;  3VWU A;  4MZC A;  4EC0 A;  1X9W B;  2ON5 A;  4O92 A;  2N5B A;  3ZVJ A;  1SJI A;  2EIO A;  3GRX A;  2VCZ A;  4N0Z A;  4EKZ A;  1U3A A;  2R37 A;  2H6Z A;  4EDY A;  3IV4 A;  4E8H A;  3M3M A;  1JZD A;  1O6J A;  1K0O A;  3ZZX A;  3CSJ A;  1H4O A;  1K0M A;  3O6T A;  4V2M A;  4OO4 A;  2LNT A;  3I9V 2;  1AC1 A;  5G31 A;  4DSQ A;  3SWL A;  5A4U A;  3N9J A;  2BMX A;  3GA4 A;  5AIV A;  3HA9 A;  1GLQ A;  1A24 A;  4N10 A;  5ECN B;  4EE0 A;  4F9Z A;  2FD3 A;  1EOH A;  3QPM A;  5GST A;  1MDJ A;  3KP8 A;  3S9F A;  4ML6 A;  3MNG A;  17GS A;  4I5Q A;  2VIM A;  5IMD A;  1A2J A;  2H0I A;  2YJ7 A;  1R5A A;  1S3A A;  2IWT A;  2GZZ A;  1TW9 A;  1Z9H A;  5F05 A;  1XXU A;  1FG4 A;  1Y6E A;  3EMX A;  2C80 A;  3VWW A;  2VCW A;  2C3T A;  3RHC A;  2PVO C;  3ZIT A;  3BBY A;  1QXH A;  1TTZ A;  3GHA A;  1PL2 A;  4MPG A;  1XIY A;  3QOU A;  2WRT A;  2YNX A;  3ZYW A;  2YCD A;  2OE1 A;  4AGS A;  5IQY A;  3TOU A;  5B8B A;  3GN3 A;  1PL1 A;  3IBH A;  1TI3 A;  3I43 A;  4ID0 A;  6GSU A;  4X1U A;  4MCU A;  5DJM A;  3US3 A;  1V58 A;  4KCA A;  2H66 A;  1UVZ A;  3HZ8 A;  3W8S A;  2IMF A;  2FWG A;  1F3B A;  1ZL9 A;  4KDU A;  4NWY A;  3DXB A;  3D6I A;  3RHB A;  1TK8 B;  3TJJ A;  2J23 A;  1ABA A;  4HZ4 A;  2E2M A;  1G6Y A;  2WGR A;  2A2R A;  2L59 A;  2IME A;  2HZF A;  4N30 A;  1YKC A;  2F8A A;  2PMT A;  4OFT A;  4IW9 A;  1FOV A;  2AYT A;  5IIZ A;  1EWX A;  4ILF A;  4MZW A;  3GTU A;  3I6A A;  4DVC A;  4DSS B;  5H5S A;  3F3R A;  5EVO A;  3QAG A;  4XIH A;  3GST A;  2C0D A;  3UEM A;  1VRS D;  4GTU A;  2P5R A;  2R6K A;  5G1K A;  1PMT A;  3DVW A;  4KUN A;  2LST A;  1VGL A;  1X5E A;  3MWH A;  4KDY A;  4WF5 A;  1O8W A;  2PGT A;  1XWA A;  2HSY A;  1XCC A;  3L9U A;  2CT6 A;  2IMD A;  1YZX A;  2I4A A;  1GSS A;  4GSS A;  1B9X C;  5IPH A;  1X5D A;  1EV9 A;  2K6V A;  2F3M A;  4KND A;  3GH6 A;  5FT3 A;  1OE7 A;  3HJM A;  3VWX A;  5ECS A;  3LSZ A;  4ECC A;  2YWO A;  2PER A;  2CX4 A;  3MSZ A;  4G2E A;  3EIN A;  4IQ1 A;  5ECM B;  2QGV A;  2VL9 A;  22GS A;  3QAV A;  1HNA A;  5ECI B;  4FYB A;  3TUE A;  2B1K A;  2GGT A;  1LBK A;  3FYG A;  5CRD A;  3FR9 A;  3H1N A;  1C72 A;  3L78 A;  2JSZ A;  2YAN A;  1YEX A;  1KEB A;  3KM6 A;  4NHZ A;  2IFQ B;  3QDN A;  2R2J A;  1TK5 B;  1EOG A;  3F6D A;  1VF3 A;  1QUW A;  2C3N A;  3F63 A;  4IGJ A;  2C0F A;  2H1G A;  3WT1 A;  1R5P A;  2DJJ A;  3CYN A;  3D0Z A;  1EP8 A;  5B7C A;  5LD0 A;  4KB3 A;  4DSR A;  4LL4 B;  5IOW A;  5GAP D;  5G5E A;  4KSO A;  3TKP A;  2JU5 A;  5GAN D;  2B1L A;  2R5G A;  2GSS A;  2HI7 A;  2HZE A;  2GSR A;  1XVQ A;  3TDG A;  1OAZ A;  2L57 A;  5DDL A;  2YV9 A;  4IJ3 A;  1JHB A;  3IK7 A;  3GL5 A;  2RLI A;  1VF2 A;  3ME7 A;  1M0U A;  2FGX A;  1GSQ A;  1M2B A;  1EGR A;  3FHK A;  5CO3 A;  5EL8 A;  1GNW A;  3ZFL A;  4RI6 A;  4RQR A;  3GKK A;  1BG5 A;  5KN1 A;  4K2D A;  2OBI A;  1WP0 A;  4IP1 A;  2DJ0 A;  3L4N A;  4HJ2 A;  5ECL B;  4GLT A;  2R4V A;  4X43 A;  1X9M B;  2MBT A;  1Z6N A;  3IE3 A;  2DJ1 A;  2JZT A;  2RUF A;  1ML6 A;  1W89 A;  1R7H A;  1SD9 A;  4MLY A;  3TGZ A;  2RUE A;  2HE3 A;  4Z7X A;  3BJ5 A;  4V1A p;  1MTC A;  3KTL A;  4K6X A;  2B5X A;  1SL0 B;  4TR1 B;  3VFI A;  1VF1 A;  5D93 A;  2HNL A;  1Q98 A;  4MDC A;  1XWB A;  2OAD A;  1SK2 A;  1B4Q A;  1V98 A;  1PN9 A;  2B5Y A;  1YF1 A;  1YQ1 A;  3C1S A;  3VI5 A;  2L5L A;  5D9X A;  1UC7 A;  1M9A A;  3ZVJ D;  3TRX A;  1HD2 A;  4ECJ A;  1V2A A;  4BPY A;  3IXR A;  4XS6 A;  3KZQ A;  11GS A;  2VL2 A;  1ZCP A;  2FHE A;  2LJA A;  3Q19 A;  3RPN A;  3FW2 A;  1AQX A;  2CZ3 A;  1GH2 A;  3DIE A;  2DIY A;  4HS1 A;  1AXD A;  1GTI A;  3ZIV A;  2WS2 A;  1JZW A;  2XHF A;  5FHI A;  5CNW A;  2VLU A;  4DEJ A;  3NZN A;  1ILO A;  3QAW A;  3PIN A;  2JSY A;  1J9B A;  2JL4 A;  3FY7 A;  1B48 A;  4Q5Q A;  3KMN A;  1JLW A;  1GWC A;  2DJK A;  5ECK B;  4OCF A;  1GLP A;  3DVX A;  2OA7 A;  4TW5 A;  5C04 A;  2EIQ A;  3EMP A;  2DLX A;  18GS A;  3U5R E;  1TRV A;  1SU9 A;  4K0N A;  5IOX A;  1E6B A;  1TI1 A;  1GTB A;  4H86 A;  4IBP A;  4MJC A;  3APO A;  3KH7 A;  3TKR A;  3CRT A;  1K0B A;  2MZC A;  3M9J A;  1GTU A;  4HOJ A;  3KGK A;  1SD8 A;  5D8I A;  3HXS A;  4MA9 A;  4K9Z A;  2VCQ A;  2R3X A;  5J41 A;  5DAL B;  5AIS A;  4TVE A;  4TR0 A;  1F6M C;  4MAB A;  5DAK A;  2H70 A;  4E8E A;  3KIJ A;  2HRN A;  4OO5 A;  3IRA A;  3GKM A;  1ZOF A;  3RDW A;  2LNS A;  1SKS B;  1AUC A;  3A3T A;  2CX3 A;  1ST9 A;  4PX1 A;  1X5C A;  2OKA A;  2V41 A;  1PRX A;  3R2Q A;  4N0V A;  2XC2 A;  4ULX A;  3KP9 A;  1QMV A;  4O7H A;  4XS4 A;  4N11 A;  2CVB A;  4NXI A;  4G10 A;  1OVN A;  1TRU A;  1ON4 A;  5F8B A;  4L5O A;  3J7Y k;  1ACV A;  3UAP A;  2RM6 A;  5L71 A;  4TXO B;  2IN3 A;  4TOP A;  2MMN A;  2PWJ A;  1NSW A;  2ALB A;  2L6D A;  5EY6 A;  4L8E A;  3TKS A;  2XBI A;  4HQS A;  5IMV A;  5G5F A;  4NHW A;  1SL1 B;  2FUG 2;  2WCI A;  4GCI A;  3QD9 A;  2M72 A;  1PD2 1;  2JZS A;  1OC9 B;  1V9W A;  3DEX A;  3F3Q A;  1PX6 A;  3KEB A;  1XW5 A;  2GLR A;  2NPB A;  3K8N A;  2IIY A;  2CVK A;  4L0U A;  2OJL A;  3EE2 A;  1ERV A;  10GS A;  4PNG A;  2MMA A;  3G7J A;  4F0B A;  4FYC A;  2NDO A;  4IJI A;  5CYY A;  2PN8 A;  1AIU A;  4K0G A;  4PXO A;  1SJ6 A;  1A0R P;  3H8Q A;  5ID2 B;  2AV4 A;  4K1F A;  4WEY A;  1YDK A;  5D96 A;  2I9H A;  3ZIJ A;  2KP2 A;  5ECP B;  4D73 A;  1SK0 A;  5IM9 A;  3GFK A;  5JCU A;  3LWA A;  3VPT A;  3D4M A;  1R4W A;  5G1L A;  2JAD A;  2BJX A;  1K0D A;  3TJB A;  3WT2 A;  3GYK A;  1GSU A;  3W8J A;  3LOR A;  4F0C A;  2P0G A;  4MH3 A;  2B6M A;  2K8S A;  2I81 A;  3O3T A;  2HFD A;  3KXO A;  3TJG A;  2NVL A;  2RII A;  3TRQ A;  2I1U A;  3C7M A;  4MJA A;  2P5Q A;  3ZMK A;  3CMI A;  3GUR A;  5H5Q A;  4ZBB A;  1EEM A;  5HFI A;  1AQW A;  4TKY A;  3UBK A;  1OYJ A;  2HSH A;  3VPQ A;  3OR5 A;  1NHO A;  4XCS A;  3G7Y A;  2YV7 A;  1TKD B;  2LRN A;  2I3Y A;  5HQP A;  3IK9 A;  2KLX A;  4EXJ A;  2LEG A;  5J3R A;  3P8W A;  2N5A A;  2FLS A;  1THO A;  4O32 A;  3ERG A;  1N2A A;  1GUH A;  3WD6 A;  1V40 A;  1CQG A;  2GDR A;  2LS5 A;  1J0F A;  1IYI A;  4BWS A;  5J9B A;  2HRF A;  4GQC A;  2H75 A;  2VAF A;  4WBR D;  4PUA A;  2YP6 A;  2A2S A;  4Q5F A;  3FR6 A;  3CSH A;  1K3Y A;  4J2F A;  5ECR B;  4HUA A;  4TRX A;  2VUP A;  2KUC A;  1GNE A;  2E2G A;  3EU4 A;  1BX9 A;  1JLV A;  1GUK A;  1GP1 A;  2XPD A;  1B4P A;  5F07 A;  3F0I A;  2L4Q A;  4LMW A;  1QGV A;  1X9S B;  1FB0 A;  3LYP A;  5HR2 A;  3GX0 A;  3LEF A;  1PKZ A;  4V2N A;  1G7E A;  1GTA A;  3FZ5 A;  5D9V A;  2FWF A;  4RI7 A;  2FA8 A;  4MP4 A;  4EDZ A;  2VL2 C;  4YQU A;  3UMA A;  3FR3 A;  5LCZ A;  1FO5 A;  3ZRE A;  2CV4 A;  4I8B A;  5E59 A;  3L9S A;  2YZU A;  4LL1 B;  4I2U A;  3DD3 A;  4KE3 A;  4KGI A;  3VI7 A;  4NV5 A;  1PGT A;  4ECI A;  2V1M A;  2B3S A;  2WUL A;  3EUR A;  4PQI A;  1WPI A;  3TKQ A;  1XWC A;  3D21 A;  3E0U A;  1HNB A;  4HJM A;  4TXV A;  3C8E A;  3ZLP A;  4YH2 A;  5CAX A;  4JR6 A;  1JZO A;  5HR0 A;  3IAS 2;  1M7T A;  2M46 A;  1FAA A;  5ECO B;  2KP1 A;  3HJO A;  1XW6 A;  2V32 A;  2WDU A;  1XBS A;  5DCH A;  2NTO A;  3M8N A;  5IPG A;  1G0T A;  5B6N A;  4PQH A;  3KD0 A;  2E7P A;  4BVX A;  2X8G A;  4MH2 A;  4EVM A;  2YWN A;  3KTB A;  1TP9 A;  2XPE A;  3V1W A;  5ECQ B;  1QFN A;  2WJU A;  3CTF A;  2CZ2 A;  1JFU A;  1OC8 A;  1A8Y A;  2VM2 A;  1X0R A;  3A5W A;  5ECH B;  5KN0 A;  3LGC A;  5IMF A;  4ISD A;  1TJD A;  3O76 A;  20GS A;  2H30 A;  1MD4 A;  3F8U A;  1T4Z A;  1J08 A;  1BAY A;  2NBS A;  3GL3 A;  1TU8 A;  3BCK A;  2PPT A;  1SL2 B;  2HLS A;  1OE8 A;  4QQ7 A;  3KH9 A;  4ZL8 A;  5AGY A;  4HZ2 A;  5JWQ B;  5EPF A;  3GNJ A;  2H73 A;  3N5O A;  1RQM A;  5D9W A;  1ZGN A;  2TRX A;  2H01 A;  2KOK A;  4KH7 A;  4MPF A;  2IPA A;  2FCH A;  1A8L A;  4KDX A;  2TRC P;  4MMM A;  2H74 A;  3NIV A;  4JRR A;  3M1G A;  14GS A;  2F8F A;  4P3Y B;  2CQ9 A;  1VF4 A;  3HDC A;  2FWE A;  2H76 A;  2LJR A;  2JAC A;  2O89 A;  1GSF A;  3ZML A;  3CSI A;  2X64 A;  3Q6O A;  3G9B A;  4XTS A;  3GH9 A;  5IO0 A;  1KBN A;  4HEA 2;  2PU9 C;  5IMA A;  4IP6 A;  3HVS A;  5H5R A;  3TKS C;  1ERW A;  4NMU A;  2G0F A;  2IMK A;  4FIW A;  3G7I A;  3D5J A;  4HU9 A;  1GUM A;  2PUK C;  3HVV A;  4MK3 A;  5GSS A;  2L4C A;  3IC4 A;  5AIX A;  4WET A;  1BYE A;  5HR1 A;  1MEK A;  4IVF A;  1A23 A;  3QFB C;  3L0H A;  1OKT A;  4TR4 A;  1A0F A;  5DBQ A;  2KHP A;  5FWG A;  4WR4 A;  1F3A A;  4FH8 A;  1T8E B;  1K3O A;  5G2Z A;  2H1B A;  4L5L A;  1W4V A;  2V6K A;  3HHV A;  1XFL A;  3IR4 A;  1DUG A;  2ZCT A;  4MF5 A;  3F4T A;  2HT9 A;  2VD0 A;  4MJE A;  5HR3 A;  5JWO B;  2B5E A;  3A2X A;  1V57 A;  1WIK A;  8GSS A;  1S3D A;  4CHS A;  7GSS A;  4ZBA A;  4DSS A;  2GQL A;  2V2G A;  1TDI A;  2DML A;  2AAW A;  1MDI A;  3Q74 A;  1THX A;  3SBC A;  1NW2 A;  4NV2 A;  1NM3 A;  2B7K A;  3EVI A;  1GSE A;  1OKD A;  3A2W A;  1AAZ A;  4XS1 A;  2XBQ A;  1HNC A;  3PR8 A;  5J5N A;  3EYT A;  1K0A A;  3FKF A;  2DJ3 A;  4GRF A;  4ZL9 A;  5ELA A;  4AJ6 A;  3QFA C;  5A4W A;  3DKS A;  4X0X A;  6GSV A;  4BL7 A;  2LV3 A;  3VWV A;  3H79 A;  2AJQ B;  3FZ9 A;  1O8X A;  1JZR A;  5DJL A;  4G9H A;  3GTU B;  2WZ9 A;  5GZZ B;  1B8X A;  2O87 A;  1Z7P A;  3D4T A;  1T00 A;  3KCM A;  2IFQ A;  2EC4 A;  3LXT A;  2OBK A;  1AW9 A;  2DIZ A;  3IHQ A;  1PX7 A;  3CRU A;  3RAZ A;  5JWR B;  2VL3 A;  3CXG A;  3UVT A;  2O8V B;  3PH9 A;  5KN3 A;  4RQX A;  1SK1 A;  1DE1 A;  2C4J A;  3P7X A;  3D22 A;  1N8J A;  2C8U A;  2DC5 A;  1ZYQ B;  1A2M A;  5ENU A;  2IL3 A;  1U6T A;  4JZQ A;  5AN1 A;  3QCP A;  1TXX A;  3ERF A;  1EGO A;  4IEL A;  4IS0 A;  2ZNM A;  2YPM A;  2C1Y A;  3AY8 A;  3F9U A;  3MAK A;  4POL A;  1T3B A;  3HYP A;  3RBT A;  2BTO T;  4GWR A;  6GSS A;  12GS A;  1YY7 A;  5C00 A;  3QMX A;  4V1A g;  3ZTL A;  2RM5 A;  5INY A;  4TN8 A;  2HXK A;  2PBJ A;  2P31 A;  1WMJ A;  2TIR A;  1IYH A;  2C0G A;  1K0C A;  1Y25 A;  1OC3 A;  5HFK A;  5ABR A; 
#chains in the Genus database with same CATH topology
 6GSY A;  1SKR B;  1IDP A;  5AYR B;  1E2Y A;  3HD5 A;  2K18 A;  4MJB A;  4OD7 A;  3J7Y d;  4BL3 A;  4EF0 A;  1LU4 A;  1Z6M A;  4LMV A;  2VLT A;  1CQH A;  2QC7 A;  2XFT A;  5LNK e;  3IAM 2;  1MD3 A;  1R26 A;  1B3S A;  3FZA A;  1PQN A;  4I6X A;  4G19 A;  3LJR A;  2HZE B;  1TUH A;  1QQ2 A;  2W6J H;  3HZ4 A;  4F82 A;  2HYX A;  1S5A A;  3URP A;  3WOE B;  4JBB A;  1ZYE A;  1I8V A;  5DQY A;  4TR1 A;  4Q53 A;  1U87 A;  2FWH A;  2AB6 A;  4AJ7 A;  2V6O A;  3LFL A;  4JED A;  1RMS A;  2OE3 A;  4PUR A;  2CHC A;  4HQZ A;  3CTG A;  4K8M A;  3E3E A;  4QL9 A;  4WKW A;  1F9M A;  4OFM A;  3GUS A;  1I2E A;  4K7N A;  3W6G A;  5IG3 A;  4KFF A;  2W03 A;  1JKG B;  1BAO A;  2YWI A;  4PQ1 A;  3UJ1 A;  2VLV A;  2HMO B;  2SBL A;  2H8L A;  1WJK A;  3HJP A;  3CCL 3;  4WXT A;  2X8H A;  4F03 A;  2YWM A;  4H61 A;  3PCR A;  1PSQ A;  4XHM A;  4LMI A;  4GST A;  2K8V A;  3CCU 3;  1XPV A;  4BA7 A;  4ICY A;  3DGL A;  1TOF A;  2X4A A;  9GSS A;  1KTE A;  5KN2 A;  2J9H A;  2CAQ A;  3RGR A;  4YAV A;  3P2A A;  1CQS A;  3L0R A;  4IHU A;  2BMQ B;  3GMF A;  2GVP A;  1OHS A;  2IJY A;  3NOF A;  2H0H A;  2N5F A;  3QR6 A;  4I2T A;  4NPB A;  4WF4 A;  4HM7 B;  2XGL A;  2MMZ A;  5D81 A;  4ZXG A;  4WP5 A;  4HM3 B;  3DYR A;  4HM6 B;  2VOC A;  1YF0 A;  3CC7 3;  4WHA A;  3FH1 A;  2XR8 B;  1VQ6 3;  1JB2 A;  4HDE A;  4G1M B;  3C73 A;  2F9S A;  3HKR A;  4IT7 A;  1PA3 A;  4O3V A;  5TGN A;  2AUV A;  2D2Z A;  1ERU A;  3V92 A;  3N8B A;  1PKW A;  1H75 A;  1T7P B;  4O5R A;  1KNG A;  2QSI A;  3TOT A;  4EO3 A;  1FOH A;  2Z77 A;  5A4V A;  2IYJ A;  4QL7 A;  1TRW A;  4PGT A;  2DSA A;  2RCD A;  3EN8 A;  4YKG A;  3FKA A;  4YAP A;  3TJF A;  2F86 B;  2IMI A;  2WGQ A;  4JR4 A;  5B8A A;  1GY5 A;  5STD A;  1GMR A;  1OAC A;  3UAR A;  5HFG A;  1RK4 A;  4AF2 A;  1BRN L;  2A4V A;  2H6Y A;  4IN0 A;  4WBJ A;  1W5Z A;  2WB9 A;  5DRV A;  2V1L A;  4ZB6 A;  3MDK A;  4FYU A;  4GQF A;  4POK A;  2Z7A A;  2R0C A;  1YKA A;  1MDK A;  3DGO A;  2WFC A;  1QK8 A;  3ER7 A;  3A5I A;  1ERT A;  4I97 A;  3TCO A;  1B21 A;  4EUY A;  1YIT 3;  4OMV A;  3LG6 A;  1ISK A;  1K0N A;  2L5O A;  2LQO A;  4CJN A;  5CRW A;  2LRT A;  2OTJ 3;  3TRP A;  3F4S A;  3DGQ A;  3FRC A;  1G7O A;  2DBC A;  4XRA A;  4HJL B;  4MJD A;  4AJ8 A;  1BNG A;  1WRY A;  4K1U A;  3HY2 A;  1EV4 A;  1S3R A;  3KCH A;  4OCE A;  3GKX A;  5I97 A;  2REM A;  3UOM A;  5DAL A;  5E4W A;  1GUL A;  2XEP A;  1E97 A;  4POB A;  3RPP A;  3J7Y b;  2CFW A;  1LJR A;  1O85 A;  3CCV 3;  1XWG A;  1FW1 A;  1O7M B;  1GSP A;  3C1R A;  1CYV A;  3DML A;  1I3F A;  2H1D A;  1DBY A;  3ZRD A;  1M2D A;  4ZM8 A;  1YEP A;  1QMA A;  3G8Z A;  1Z3E A;  1O81 A;  1JB4 A;  1RKY A;  1TK0 B;  3BOA A;  3SED A;  1W00 A;  1K3L A;  3E9J B;  1M3I A;  1SEN A;  1X1W A;  4HI7 A;  2W04 A;  1GSY A;  1MOL A;  2CK3 H;  4V2L A;  1STD A;  3K63 A;  3EC3 A;  2VCX A;  3ZFZ A;  2OE0 A;  4PNF A;  1TRP A;  4Z2R A;  4XRD A;  1FA3 A;  3OW2 2;  5CRE A;  2P38 A;  4IQA A;  2VCV A;  1ZMA A;  4N6T A;  3CCE 3;  1XVW A;  1YJ9 3;  5IMZ A;  4KFE A;  2L6C A;  6GSP A;  5IG0 A;  4TXO A;  1FVK A;  2X99 A;  3F4R A;  3EN1 B;  3LXZ A;  1Q4J A;  3EU3 A;  1SQW A;  4GXZ A;  2IUJ A;  3ED3 A;  5A0O B;  2OAC A;  3BCI A;  6GSW A;  1VQO 3;  2GZP A;  2H1A A;  4F2I A;  1I5G A;  3CBU A;  4XBY A;  4NAX A;  4CDO A;  3GKN A;  4GSN A;  4A5P A;  4BWQ A;  1IU7 A;  2H71 A;  2GSQ A;  3DRN A;  2GT5 A;  1O73 A;  3FG1 A;  3WGE A;  19GS A;  3HCZ A;  1WE0 A;  3GV1 A;  3IA1 A;  1BED A;  3GIX A;  5DAK B;  3FLJ A;  1LXE A;  3WYW A;  1G6W A;  2MYG A;  1ZYP A;  2GQK A;  5JCG A;  3BLZ A;  1Y4K A;  1HYU A;  1BRH A;  1OC9 A;  1PY3 A;  3DY5 A;  2DMM A;  5F0G A;  5B6M A;  4BVY A;  1FW7 A;  3GSS A;  4HSC X;  3KJY A;  1BUQ A;  1JBR A;  3KMO A;  4PUF C;  1BNF A;  3NX0 A;  4Q5R A;  3AHW A;  1YGW A;  3GZY B;  1EEJ A;  3L9V A;  2ON7 A;  6GST A;  3CNM A;  4YQM A;  2LUS A;  1U3I A;  2QKE A;  4XS4 B;  4EL1 A;  3PGT A;  2I9W A;  3NV0 A;  2XFS A;  3CD6 3;  1UN2 A;  2GT6 A;  5G30 A;  5ID2 A;  4DKI A;  2VCT A;  4ZB8 A;  4HM1 B;  2P09 A;  2CFL A;  3AMO B;  3DGN A;  3IDV A;  2O7K A;  1GL8 A;  4KX4 A;  4ZIL A;  3ALA A;  5CRG A;  1AQV A;  1X1Y A;  1Q40 A;  2XSO B;  4POM A;  3CU3 A;  2VD1 A;  3JCM L;  2W2C A;  5D83 A;  2ES7 A;  2C0E A;  2EIR A;  2JDI H;  1RGE A;  2CG0 A;  1FVJ A;  1QAL A;  1F2E A;  2JZR A;  2E2U A;  3NBJ A;  4J56 E;  2PVQ A;  1UI7 A;  2QA1 A;  1M99 A;  2VM1 A;  3LYK A;  1USB A;  2GEX A;  2M80 A;  4MF6 A;  1TFO A;  7GSP A;  5IMC A;  4OWY A;  3K5T A;  2RGQ A;  4JU5 A;  1Q7Y 4;  1NHY A;  1WWJ A;  1BAN A;  5D73 A;  1BSE A;  1XOB A;  4LLR A;  2C3Q A;  3APQ A;  4KSM A;  2XSH B;  2Q07 A;  1T1V A;  1U5O A;  1FB6 A;  3SXX A;  4ZL7 A;  3EWL A;  2ML5 A;  5KEJ A;  3F6F A;  2OCT A;  3H4K A;  2BU4 A;  5JCW A;  1K8A 4;  1URM A;  2OOV C;  4O02 B;  4IKH A;  3EB8 A;  3GX8 A;  4KCE A;  4KA0 A;  5CRH A;  2CA8 A;  1M9B A;  1YJ6 A;  2H72 A;  4TR3 A;  3LT8 A;  2VO4 A;  2H19 A;  1ROV A;  13GS A;  2X8C A;  1Q86 4;  3I69 A;  4AKZ A;  1KSI A;  3SLU A;  3BD2 A;  1M2A A;  3MSO A;  4ZB9 A;  2G2Q A;  2FGT A;  4D73 B;  3ME8 A;  1MGR A;  3S28 A;  4ACS A;  2YOI A;  3H93 A;  4KAE A;  5DQS A;  1STF I;  2F51 A;  1S3C A;  3PZW A;  4WFO A;  1UA5 A;  2GS3 A;  1EZK A;  4KF9 A;  5F06 A;  2GQM A;  3M0F A;  3ISO A;  4K7I A;  5J9C A;  3UVH A;  2Z9S A;  3AHS A;  5AYS C;  1BJX A;  1WQL B;  1AY7 A;  4CW9 A;  3IPZ A;  3WDG B;  5A5K A;  1DSB A;  4ZIJ A;  2GZY A;  1AV4 A;  2MC8 A;  4CDL A;  1Z5Y E;  1Q7H A;  16GS A;  4GF0 A;  4HYZ A;  1T5Y A;  3NBR A;  5HGR A;  1XG8 A;  2YZH A;  3IOS A;  3F9S A;  3FK8 A;  1XZO A;  2ZUP A;  1GSD A;  1JRQ A;  3U6V A;  3PYJ A;  2OQE C;  1U88 A;  1I9D A;  2H6X A;  2O85 A;  1HQO A;  2IY2 A;  3OWS A;  1W7C A;  4FO5 A;  3KE7 A;  3C71 A;  5D9T A;  4GSP A;  3Q18 A;  4L0W A;  4K7O A;  1O7H B;  2GBW B;  1SYX A;  1T2I A;  2LTK A;  2LJK A;  4EW5 A;  4MF7 A;  1DE2 A;  4YQV A;  1RW1 A;  4RUV A;  1MWT A;  2MBS A;  3Q2P A;  4ECB A;  3E99 A;  1YJN 3;  3P90 A;  1B2S A;  3WGD A;  1GRX A;  1LOY A;  4L7K A;  4WR5 A;  4Z2U A;  1BNS A;  5IO2 A;  1KQS 2;  1VQQ A;  1EP7 A;  2GST A;  3FGY A;  1SYR A;  1E3V A;  3APS A;  1W6C A;  3KSE D;  5ELJ A;  4ZBD A;  5FW5 A;  2DJ2 A;  3UBL A;  2FA4 A;  2MMO A;  1DE3 A;  3TKS E;  2YN1 A;  5DVB A;  2K9F A;  3A2V A;  1JV2 B;  1FHE A;  2H0G A;  1A2L A;  4OFN A;  5COH A;  2AHE A;  3VUR A;  5ELG A;  3LQ7 A;  2FY6 A;  3F40 A;  4Q5N A;  1RJO A;  3TJK A;  1WOU A;  2CAI A;  5CP1 A;  1FGT A;  3TB2 A;  3HZP A;  4RNY A;  3B4P A;  1O7U A;  4X2O A;  4ML1 A;  2ZL8 A;  3T8N A;  3DUK A;  5DCG A;  3WGX A;  1B9Y C;  1F37 A;  3M9K A;  1UCL A;  3ERW A;  1SKW B;  2FNO A;  4LA1 A;  1T4Y A;  1TU7 A;  3ZL5 A;  3CXC 2;  3SOA A;  5AII A;  1XW9 A;  4GB5 A;  2UX0 A;  1VQ7 3;  3DWV A;  4JE1 A;  2B7J A;  1ZZY A;  2YJH A;  2GTU A;  3FZ4 A;  4KW6 A;  2P05 A;  3M8C A;  3HVX A;  3UJM A;  3DMC A;  4HU7 A;  1SJZ A;  3VK9 A;  2W56 B;  3UL3 A;  2ML6 A;  1ZX2 A;  2GXF A;  1FGO A;  4MZB A;  6GSX A;  1TTO A;  3ZFB A;  3STD A;  2CVD A;  1BNJ A;  1XOA A;  2LRC A;  2LKU A;  3UIW A;  1XWK A;  2HMM B;  1BQ7 A;  1W4N A;  4NRE A;  3FEU A;  1Z7R A;  2K3D A;  3S67 A;  5J4U A;  4J57 E;  2CH9 A;  1MNL A;  2E0Q A;  3VLN A;  1RLS A;  3X3Y A;  2F99 A;  1TRS A;  1QAF A;  2LQQ A;  3RNT A;  3VWU A;  4MZC A;  1RCL A;  4EC0 A;  1FGM A;  1X9W B;  2ON5 A;  4O92 A;  2N5B A;  3CCQ 3;  3ZVJ A;  3ECF A;  1SJI A;  2EIO A;  3GRX A;  4K5S A;  2VCZ A;  4N0Z A;  4EKZ A;  1U3A A;  2R37 A;  1N5H A;  2H6Z A;  4EDY A;  3IV4 A;  4E8H A;  1YI2 3;  3M3M A;  3D4A A;  1JZD A;  1O6J A;  3U97 A;  1K0O A;  1MWR A;  3ZZX A;  2YFL B;  3IMA B;  4CY8 A;  3DZL A;  3CSJ A;  1H4O A;  3VF1 A;  1K0M A;  3O6T A;  5BVB A;  4V2M A;  1DYU A;  4OO4 A;  4NHF A;  3IJE B;  1RCK A;  1AVK A;  5M18 A;  2LNT A;  3I9V 2;  4G0I A;  1AC1 A;  5G31 A;  1IT7 A;  4DSQ A;  4CCV A;  2YFI B;  3SWL A;  5A4U A;  4BVX B;  3N9J A;  7RNT A;  2BMX A;  3EJV A;  3OV4 A;  4J8T A;  1RRH A;  3GA4 A;  1RN4 A;  5AIV A;  3X42 A;  3HA9 A;  1EQK A;  4XDW A;  1BSA A;  1GLQ A;  1A24 A;  4HM4 B;  1CH0 A;  4N10 A;  1O7G B;  5ECN B;  4EE0 A;  2C10 A;  2GBX B;  4F9Z A;  1OCV A;  7STD A;  1OF5 B;  2FD3 A;  1EOH A;  3QPM A;  5GST A;  1MDJ A;  3KP8 A;  3S9F A;  4ML6 A;  3MNG A;  3MWZ A;  3NQZ A;  17GS A;  1TFK A;  3LZA A;  4I5Q A;  2VIM A;  2F5W A;  5IMD A;  1OH0 A;  3D5I A;  1A2J A;  2H0I A;  2YJ7 A;  3GWR A;  1R5A A;  3CNX A;  1S3A A;  1VQ4 3;  4HM2 B;  4O5Q A;  1YNV X;  2IWT A;  2GZZ A;  1TW9 A;  4TX4 A;  4EC6 A;  1Z9H A;  5LC6 A;  5F05 A;  1RGF A;  1BSD A;  1VQM 3;  1XXU A;  1RNT A;  3UNL A;  1OPY A;  1FG4 A;  1B2M A;  3I55 3;  1Y6E A;  3EMX A;  2C80 A;  4XB5 A;  3VWW A;  4FCZ A;  3H3H A;  4KVH A;  2VCW A;  3NM7 A;  2C3T A;  3GAX A;  3RHC A;  2PVO C;  3ZIT A;  3BBY A;  1QXH A;  4YKF A;  5JPU A;  5CLK A;  3JUO A;  1TTZ A;  3LYG A;  3MKI A;  3GHA A;  4L8O A;  2CC3 A;  1PL2 A;  3SX1 A;  4MPG A;  1XIY A;  3QOU A;  1RGA A;  1SJW A;  2WRT A;  2YNX A;  3ZYW A;  5CK6 A;  1FUW A;  2YCD A;  2OE1 A;  4AGS A;  5IQY A;  1TRQ A;  1UUV B;  1EKM A;  3TOU A;  5B8B A;  1V74 A;  3GN3 A;  4GHO A;  2HOH A;  1PL1 A;  3IBH A;  1TI3 A;  1JN5 B;  3I43 A;  1RRL A;  4ID0 A;  3HI7 A;  1NNV A;  6GSU A;  3AGN A;  4X1U A;  4MCU A;  3HK4 A;  1M1K 4;  1FGR A;  5DJM A;  3US3 A;  5CXO A;  1V58 A;  4KCA A;  1A2P A;  3JUP A;  2H66 A;  5IER A;  1UVZ A;  2KF5 A;  3HZ8 A;  3W8S A;  2IMF A;  3KKG A;  4XBT A;  4RNZ A;  2FWG A;  5BIR A;  3WOD G;  2BMR B;  3DGM A;  3G71 3;  1F3B A;  1ZL9 A;  4KDU A;  1W6Y A;  2HMN B;  4NWY A;  3DXB A;  2OWP A;  3D6I A;  3RHB A;  1TK8 B;  3TJJ A;  2J23 A;  2W0Q A;  1ABA A;  4HZ4 A;  2E2M A;  1G6Y A;  2WGR A;  1US1 A;  2A2R A;  2L59 A;  2IME A;  2HZF A;  4N30 A;  1YKC A;  2F8A A;  2PMT A;  1RGH A;  3GSP A;  3EBT A;  1ULJ B;  4OFT A;  4IW9 A;  1FOV A;  1MGW A;  3IHG A;  2AYT A;  5IIZ A;  3VGN A;  1EWX A;  4ILF A;  1OUN A;  3FG4 A;  4MZW A;  2Y74 A;  3AGO A;  3JUQ A;  3GTU A;  3I6A A;  3GZX B;  4DVC A;  4DSS B;  5H5S A;  3F3R A;  4LEH A;  5EVO A;  3QAG A;  4XIH A;  3GST A;  2C0D A;  1NO3 A;  1VQP 3;  3UEM A;  1EG9 B;  4FR9 A;  1VRS D;  4GTU A;  1Q42 A;  2P5R A;  2R6K A;  5G1K A;  4R9L A;  1PMT A;  1X1X A;  4K61 A;  3DVW A;  4KUN A;  3D79 A;  3KZT A;  1NJI 4;  2LST A;  1VGL A;  1GOU A;  1X5E A;  3MWH A;  4KDY A;  3MYT A;  4WF5 A;  1I0X A;  1BRS A;  1O8W A;  2PGT A;  3G16 A;  1K28 A;  1XWA A;  3BNE A;  1GS3 A;  1AVL A;  2HSY A;  1XCC A;  1YJW 3;  3L9U A;  2JQ5 A;  1WTH A;  2CT6 A;  2IMD A;  1YZX A;  1BRJ A;  1RGL A;  3N54 B;  3CCJ 3;  2I4A A;  1GSS A;  4GSS A;  3A5E A;  2UGI A;  3U1W A;  1B9X C;  2R4I A;  3GZR A;  5IPH A;  3HIG A;  1X5D A;  1EV9 A;  2K6V A;  2F3M A;  4BL7 B;  1B20 A;  1SAR A;  4KND A;  3GH6 A;  2E2T A;  2CW9 A;  4BTY A;  1OE7 A;  5FT3 A;  1S72 3;  3HJM A;  3VWX A;  5ECS A;  4MEI A;  3LSZ A;  1NB3 I;  3ZG5 A;  4ECC A;  2YWO A;  2PER A;  9RNT A;  2CX4 A;  3MSZ A;  4G2E A;  3EIN A;  4IQ1 A;  5ECM B;  5IEO A;  2QGV A;  1QVF 2;  1D6Z A;  2VL9 A;  22GS A;  3QAV A;  1HNA A;  5ECI B;  4FYB A;  5EQL A;  3TUE A;  2B1K A;  2D1W A;  2XH9 A;  1IT8 A;  2GGT A;  1A2K A;  1C54 A;  1LBK A;  3FYG A;  1SII A;  5CRD A;  3FR9 A;  3H1N A;  1C72 A;  1YHQ 3;  3L78 A;  2JSZ A;  2YAN A;  1YEX A;  1KEB A;  2A15 A;  3KM6 A;  3N9H A;  2IFQ B;  4NHZ A;  3K9M C;  3QDN A;  3KSP A;  2R2J A;  1TK5 B;  1EOG A;  3F6D A;  1VF3 A;  4GL6 A;  1QUW A;  1VQN 3;  2STD A;  2C3N A;  2F56 A;  1HKX A;  1SIH A;  3FZW A;  4HZ9 B;  3F63 A;  4H3U A;  4IGJ A;  2C0F A;  3FF0 A;  2H1G A;  1R5P A;  3WT1 A;  3BNB A;  4O8S A;  2DJJ A;  3CYN A;  3D0Z A;  1EP8 A;  1F8N A;  5B7C A;  5LD0 A;  4KB3 A;  5IW9 A;  1CYU A;  4DSR A;  3EQQ B;  4LL4 B;  4EIQ A;  1UGH I;  4WWU C;  5IOW A;  5GAP D;  5G5E A;  4KSO A;  3TKP A;  2JU5 A;  5GAN D;  1Q81 4;  3DH2 A;  2B1L A;  3KII A;  2R5G A;  3WOF B;  2GSS A;  2HI7 A;  2HZE A;  2GSR A;  1XVQ A;  3TDG A;  1OAZ A;  2L57 A;  3EBY A;  5BXQ A;  3JUN A;  3B7C A;  5DDL A;  2BNG A;  2YV9 A;  4IJ3 A;  1JHB A;  1A2V A;  3HVN A;  4X4J A;  3IK7 A;  2P0X A;  3JVC A;  1BNR A;  3GL5 A;  2RLI A;  1VF2 A;  3ME7 A;  1M0U A;  1A90 A;  2FGX A;  1PFP A;  1GSQ A;  1W01 A;  4HBR A;  1M2B A;  1EGR A;  3MG3 A;  3FHK A;  5CO3 A;  5EL8 A;  3CCS 3;  1OHP A;  1GNW A;  3ZFL A;  1N8R 4;  4J9A A;  1JKG A;  4RI6 A;  1BSB A;  2KXG A;  4RQR A;  2C4B A;  3GKK A;  1BG5 A;  5KN1 A;  4BTX A;  4N6V 0;  4K2D A;  4O2H A;  5JPP A;  2OBI A;  1WP0 A;  4IP1 A;  4WYK B;  1PFO A;  2DJ0 A;  1VQL 3;  3L4N A;  4HJ2 A;  2BT3 A;  5ECL B;  2KRT A;  4GLT A;  2R4V A;  4X43 A;  2UZ8 A;  1ZO2 A;  1GMP A;  3GZB A;  2CX0 A;  1X9M B;  2MBT A;  1Z6N A;  3IE3 A;  2DJ1 A;  2JZT A;  1I3I A;  2RUF A;  1ML6 A;  1W89 A;  1R7H A;  4FQU A;  1Q82 4;  3EC9 A;  1YGE A;  1SD9 A;  2PNC A;  1BNE A;  4MLY A;  3TGZ A;  1O7N B;  2RUE A;  2HE3 A;  4Z7X A;  3CCR 3;  3BJ5 A;  2RBI A;  4V1A p;  1K73 4;  3CPW 2;  4LSO A;  1MTC A;  3KTL A;  4K6X A;  3RDE A;  2B5X A;  3JUM A;  1SL0 B;  4TR1 B;  1LVN A;  3CME 3;  3R3E A;  3VFI A;  1VF1 A;  3K0Z A;  1VQK 3;  5AEU B;  5D93 A;  2YFJ B;  2HNL A;  3NHX A;  1Q98 A;  4MDC A;  1XWB A;  1IVW A;  2OAD A;  1SK2 A;  1GY6 A;  1B4Q A;  1V98 A;  1PN9 A;  2B5Y A;  1YF1 A;  1YQ1 A;  3C1S A;  3EF8 A;  2L5L A;  3VI5 A;  5D9X A;  3NQY A;  1UC7 A;  2Z6B A;  3SOY A;  1UUW B;  2F5M A;  1N8Q A;  1M9A A;  3ZVJ D;  3TRX A;  1HD2 A;  4ECJ A;  2OTL 3;  1V2A A;  4BPY A;  3IXR A;  4XS6 A;  3G0K A;  3KZQ A;  11GS A;  2VL2 A;  1ZCP A;  2LQV A;  2FHE A;  2HML B;  2LJA A;  3Q19 A;  3RPN A;  3FW2 A;  1AQX A;  2CZ3 A;  1W6G A;  1GH2 A;  2RFR A;  1W2B 2;  3DIE A;  2DIY A;  2HSM A;  4HS1 A;  1AXD A;  1GTI A;  2B24 B;  5LC7 A;  3ZIV A;  2WS2 A;  1JZW A;  5HOH A;  2XHF A;  5M19 A;  5FHI A;  5CNW A;  2W9P A;  1JB5 A;  1PYL A;  1KWI A;  2VLU A;  4DEJ A;  3MHE A;  3T8U A;  3NZN A;  1ILO A;  3QAW A;  2DKH A;  1G02 A;  3PIN A;  1X1U A;  2CWT A;  1M9G A;  2JSY A;  1J9B A;  2HRA A;  2JL4 A;  3FY7 A;  1B48 A;  4Q5Q A;  1IQ8 A;  3KMN A;  1JLW A;  3RGA A;  3B4O A;  3LH4 A;  1FYS A;  1VZZ A;  1GWC A;  1FGQ A;  2DJK A;  5ECK B;  4K90 B;  4N6M A;  4OCF A;  2R41 A;  1GLP A;  2QIY A;  3DVX A;  2OA7 A;  4TW5 A;  5G2G A;  2EIQ A;  3EMP A;  5C04 A;  2DLX A;  18GS A;  3U5R E;  1IVU A;  1SU9 A;  1TRV A;  1VQ5 3;  1N9E A;  4K0N A;  1IV7 A;  5IOX A;  1E6B A;  2CIU A;  1TI1 A;  1GTB A;  4H86 A;  4IBP A;  4MJC A;  2QA2 A;  3APO A;  1BOX A;  2CFD A;  4MMZ B;  2IMJ A;  2AAE A;  3KH7 A;  3TKR A;  3CRT A;  1DMM A;  1K0B A;  3S27 A;  3WA3 A;  1IQY A;  2MZC A;  3M9J A;  1GTU A;  4HOJ A;  3KGK A;  3DXO A;  1SD8 A;  1FZU A;  5D8I A;  3HXS A;  3PGB A;  5JBS A;  4MA9 A;  4K9Z A;  2VCQ A;  2R3X A;  5J41 A;  5DAL B;  5AIS A;  4TVE A;  4TR0 A;  1F6M C;  3WMD A;  1OHO A;  4AKY A;  3Q90 A;  4MAB A;  5DAK A;  2H70 A;  4E8E A;  1D6Y A;  1UW1 A;  2CWV A;  4IPB A;  3KIJ A;  4QWT A;  3B8L A;  1N9J A;  2UUG C;  2HRN A;  4OO5 A;  3IRA A;  3GKM A;  3OXA A;  1ZOF A;  3RDW A;  1DMQ A;  1RNB A;  5ELU A;  2LNS A;  8CHO A;  1SKS B;  1AUC A;  3A3T A;  2CX3 A;  1ST9 A;  4PX1 A;  1X5C A;  2OKA A;  2V41 A;  3BND A;  1PRX A;  3R2Q A;  4N0V A;  2XC2 A;  4ULX A;  3KP9 A;  5CF1 A;  1QMV A;  4O7H A;  1LNH A;  4XS4 A;  4N11 A;  3CC4 3;  3FSD A;  3NXJ A;  2CVB A;  3KFQ C;  3NM2 A;  4NXI A;  4BTW A;  4G10 A;  4I4K A;  1OVN A;  1TRU A;  1NDO B;  1ON4 A;  5F8B A;  2BIR A;  4HAA A;  4L5O A;  4HM5 B;  3J7Y k;  3AMO A;  1ACV A;  4AEQ A;  3UAP A;  2RM6 A;  5L71 A;  3F7X A;  4FMC A;  4TXO B;  2IN3 A;  4TOP A;  2MMN A;  1DMN A;  2PWJ A;  1NWW A;  5KOW A;  3D5G A;  4HZB B;  3GRD A;  1NSW A;  2ALB A;  2L6D A;  1QAK A;  3LTA A;  5AIH A;  5EY6 A;  4L8E A;  4CPK A;  1WMO A;  3TKS A;  2XBI A;  4HQS A;  5IMV A;  3NUV A;  5G5F A;  4G0K A;  4NHW A;  1SL1 B;  1IQX A;  2FUG 2;  2WCI A;  4LZI A;  4GCI A;  3DGY A;  3QD9 A;  2M72 A;  1PD2 1;  2JZS A;  3K7C A;  1OC9 B;  1V9W A;  4MNN A;  3DEX A;  3F3Q A;  4BVY B;  1PX6 A;  3KEB A;  1XW5 A;  2GLR A;  2NPB A;  2SAR A;  3K8N A;  2A4H A;  2IIY A;  2CVK A;  4L0U A;  2OJL A;  3EE2 A;  4XM4 A;  1ERV A;  10GS A;  4L8P A;  5EEO A;  4PNG A;  2MMA A;  5AIG A;  3G7J A;  4F0B A;  3V99 A;  4FYC A;  2NDO A;  4IJI A;  5CYY A;  3NV0 B;  2PN8 A;  1IV9 A;  4STD A;  1RTU A;  1AIU A;  1GOY A;  4K0G A;  4PXO A;  1SJ6 A;  5BMU A;  1A0R P;  1EA2 A;  3H8Q A;  5ID2 B;  3EE1 A;  4O5U A;  1GY7 A;  2AV4 A;  4K1F A;  4WEY A;  5D82 A;  2CFG A;  1UUG B;  1YDK A;  3G6E 3;  3SVA A;  5D96 A;  2I9H A;  4X2H A;  2HMK B;  3ZIJ A;  2KP2 A;  5ECP B;  1Q40 B;  4D73 A;  8RNT A;  1SK0 A;  5IM9 A;  2OQE A;  3GFK A;  5JCU A;  3CQF A;  1LRA A;  3LWA A;  3VPT A;  3D4M A;  1R4W A;  5G1L A;  2JAD A;  2BJX A;  1K0D A;  3TJB A;  3WT2 A;  3OX9 A;  3GYK A;  4Z2T A;  2FXT A;  1GSU A;  3W8J A;  3LOR A;  4F0C A;  3FG3 A;  1KD1 4;  2P0G A;  4MH3 A;  2B6M A;  5GSP A;  1N5P A;  2K8S A;  2CWU A;  3X41 A;  4BL2 A;  2I81 A;  3O3T A;  2HFD A;  3KXO A;  3TJG A;  1W02 A;  2NVL A;  2RII A;  4N6U A;  1DVD A;  2I1U A;  3TRQ A;  3LTC A;  2K0M A;  3IPT A;  4MMX B;  1HU9 A;  4K2X A;  3C7M A;  2RSX A;  4MJA A;  2P5Q A;  3ZMK A;  1ZYN A;  3CMI A;  3GUR A;  1BIR A;  5H5Q A;  3UB1 A;  4ZBB A;  1EEM A;  5HFI A;  1AQW A;  4TKY A;  3UBK A;  1OYJ A;  2HSH A;  3VPQ A;  3LML A;  1Z1S A;  1DET A;  3OR5 A;  4OVM A;  1NHO A;  4EV5 A;  4XCS A;  3FF2 A;  3G7Y A;  2RNT A;  3BU4 A;  2YV7 A;  3NBB A;  1TKD B;  2LRN A;  2I3Y A;  5HQP A;  3IK9 A;  3LTD A;  2KLX A;  3DM8 A;  4HVN A;  4EBG A;  4EXJ A;  2WOF A;  2FNQ A;  2LEG A;  5J3R A;  3P8W A;  2R0P A;  2N5A A;  2FLS A;  1THO A;  4O32 A;  1OGZ A;  3ERG A;  2WO0 A;  1JBS A;  1N2A A;  3S29 A;  1GUH A;  1JJ2 2;  3WD6 A;  1V40 A;  1BRK A;  1CQG A;  2AAD A;  2GDR A;  2LS5 A;  1J0F A;  1IYI A;  4BWS A;  5J9B A;  5KP3 A;  4N6N B;  4EXR A;  1AR0 A;  2HRF A;  1O7W B;  4GQC A;  2H75 A;  2KF4 A;  1Q9E A;  2VAF A;  1BGS A;  1I0V A;  2GU1 A;  1BVI A;  2W9Q A;  2B1X B;  4WBR D;  4PUA A;  2YP6 A;  1RGG A;  2A2S A;  3MYD A;  4Q5F A;  1WMP A;  3QRD A;  3CSH A;  3FR6 A;  3F14 A;  1K3Y A;  4J2F A;  5ECR B;  4HUA A;  4TRX A;  2VUP A;  2KUC A;  1GNE A;  2E2G A;  1O7P B;  3EU4 A;  5DRE A;  3LTB A;  3HOH A;  1BX9 A;  1JLV A;  1GUK A;  1GP1 A;  2XPD A;  1B4P A;  5F07 A;  3F0I A;  3CC2 3;  4K1V A;  2L4Q A;  1BUJ A;  1QGV A;  2A2P A;  2KF6 A;  4LMW A;  1X9S B;  1M1X B;  1FB0 A;  3LYP A;  5KP4 A;  5HR2 A;  1A67 A;  2DKI A;  3GX0 A;  3LEF A;  1PKZ A;  4V2N A;  2P0M A;  2CFK A;  1CEW I;  1G7E A;  1GTA A;  3FZ5 A;  4G0L A;  5D9V A;  2FWF A;  4RI7 A;  2W56 A;  2FA8 A;  4MP4 A;  4EDZ A;  2VL2 C;  4YQU A;  3UMA A;  2BHM A;  3FR3 A;  5LCZ A;  2KCD A;  3CPO A;  2D42 A;  3ZRE A;  1FO5 A;  2CV4 A;  4I8B A;  5E59 A;  3L9S A;  4HM0 B;  2YZU A;  4LL1 B;  4I2U A;  2QA4 3;  4HM8 B;  3DD3 A;  4KE3 A;  3X40 A;  4JF8 A;  4KGI A;  3VI7 A;  1AQZ A;  5IF6 A;  2Y73 A;  1B2U A;  4NV5 A;  1PGT A;  3FMW A;  4ECI A;  2XRX B;  2LYX A;  2V1M A;  3D3L A;  5EVH A;  2B3S A;  2WUL A;  1SPU A;  3EUR A;  1WPI A;  4PQI A;  3TKQ A;  1XWC A;  1LNI A;  3CCM 3;  3D21 A;  2E2V A;  3E0U A;  1HNB A;  4HJM A;  4TXV A;  3C8E A;  3ZLP A;  6STD A;  4YH2 A;  5CAX A;  4JR6 A;  2IA7 A;  1JZO A;  5HR0 A;  3IAS 2;  3LXU X;  1M7T A;  2M46 A;  1FAA A;  5ECO B;  1M3J A;  4XBX A;  2KP1 A;  3HJO A;  4RBN A;  1XW6 A;  3BB9 A;  3UL6 A;  2V32 A;  1UCJ A;  2WDU A;  2R0G A;  5AEW B;  1XBS A;  3F8H A;  5DCH A;  1LOW A;  2NTO A;  3M8N A;  1ROA A;  1VQ8 3;  5IPG A;  1G0T A;  2HMJ B;  4PQH A;  5B6N A;  3KD0 A;  2E7P A;  3IC8 A;  4BVX A;  2X8G A;  1BNI A;  4MH2 A;  4EVM A;  1UCK A;  2YWN A;  3KTB A;  1TP9 A;  2XPE A;  3V1W A;  1R4C A;  5ECQ B;  1QFN A;  2WJU A;  4FMD A;  3F8X A;  2C11 A;  3CTF A;  2CZ2 A;  1JFU A;  5CF2 A;  1OF5 A;  1OC8 A;  4CY6 A;  1A8Y A;  1B27 A;  2VM2 A;  1X0R A;  3A5W A;  5ECH B;  1HYF A;  3MG1 A;  4EYC A;  5KN0 A;  1OGX A;  1YIJ 3;  3LGC A;  4ISD A;  5IMF A;  1JBT A;  1TJD A;  1BRI A;  3O76 A;  20GS A;  2H30 A;  1MD4 A;  3F8U A;  5AIF A;  4KZ1 A;  1T4Z A;  1J08 A;  4USS A;  1G96 A;  2XF3 A;  1BAY A;  4J5G A;  2NBS A;  3GL3 A;  1TU8 A;  3BCK A;  1IVV A;  2PPT A;  4EV2 A;  1SL2 B;  4R1K A;  2HLS A;  1OE8 A;  1WNH A;  4QQ7 A;  3WA2 X;  3KH9 A;  4ZL8 A;  5AGY A;  1VQ9 3;  4HZ2 A;  5JWQ B;  5EPF A;  3GNJ A;  2H73 A;  3I0Y A;  1B2X A;  4BIK A;  1BRG A;  3N5O A;  1RQM A;  5D9W A;  1ZGN A;  2TRX A;  3PCS A;  2H01 A;  2KOK A;  1QVG 2;  3HX8 A;  3ZG0 A;  4KH7 A;  4MPF A;  5M1A A;  2IPA A;  3ROB A;  2IUK A;  2FCH A;  4K5R A;  1R4Y A;  1A8L A;  3BIR A;  4KDX A;  2TRC P;  1YVB I;  4ORL A;  4MMM A;  3EX9 A;  4RZM A;  2H74 A;  3NIV A;  4JRR A;  1TU5 A;  3M1G A;  5AI1 A;  3EHC A;  1GD3 A;  3V98 A;  14GS A;  2F8F A;  4P3Y B;  2CQ9 A;  1VF4 A;  4FMB A;  1PU4 A;  3HDC A;  2CG1 A;  1BU4 A;  2FWE A;  2H76 A;  2LJR A;  2JAC A;  2KAA A;  4HKV B;  2O89 A;  1GSF A;  3ZML A;  3CSI A;  2X64 A;  3LW9 A;  3Q6O A;  1IVX A;  5IG5 A;  3G9B A;  4XTS A;  3GH9 A;  3Q1C A;  1HZ1 A;  5BU4 A;  1KBN A;  5IO0 A;  4HEA 2;  2PU9 C;  5IMA A;  1LOX A;  4HOH A;  1JN5 A;  4IP6 A;  4EIP A;  2Z76 A;  3HVS A;  1UCI A;  2MF7 A;  5H5R A;  3TKS C;  4LGQ A;  1ERW A;  2F98 A;  4NMU A;  3A76 A;  1L5G B;  2G0F A;  4IIA A;  2IMK A;  2QGU A;  4FIW A;  3G7I A;  3D5J A;  4HU9 A;  1GUM A;  2PUK C;  1I2G A;  1UDI I;  3HVV A;  4MK3 A;  5GSS A;  2L4C A;  3IC4 A;  1JNQ A;  4WET A;  5AIX A;  1BYE A;  5HR1 A;  3BNC A;  1MEK A;  1GOV A;  4IVF A;  1LQG C;  3G4S 3;  3X3X A;  1KC8 4;  1A23 A;  3QFB C;  3L0H A;  1OKT A;  4TR4 A;  2K54 A;  1A0F A;  3PPU A;  2KHP A;  5DBQ A;  4N3V A;  2BO9 B;  5FWG A;  4WR4 A;  1FUT A;  1MWS A;  3MPH A;  1F3A A;  4FH8 A;  1T8E B;  1K3O A;  2KF3 A;  2L1S A;  2H1B A;  4L5L A;  5G2Z A;  2GSP A;  1W4V A;  2V6K A;  1XFL A;  3PXM A;  3HHV A;  3IR4 A;  1DUG A;  2ZCT A;  4MF5 A;  1RGK A;  1GYB A;  1MWU A;  3F4T A;  1DVC A;  2HT9 A;  3EPT A;  3O8Y A;  2VD0 A;  4MJE A;  5HR3 A;  5JWO B;  2B5E A;  6RNT A;  3A2X A;  2ZA4 A;  1V57 A;  1WIK A;  8GSS A;  1S3D A;  1QJG A;  1W2Z A;  4CHS A;  7GSS A;  3WR2 A;  4ZBA A;  1T2H A;  4DSS A;  5IEN A;  2GQL A;  2V2G A;  1TDI A;  2DML A;  2AAW A;  1MDI A;  1RDS A;  3Q74 A;  2GU3 A;  4JRF A;  4BU4 A;  1U8C B;  4FCM A;  1THX A;  3SBC A;  3CMA 3;  1NW2 A;  4NV2 A;  1NM3 A;  2X49 A;  1K9M 4;  1B2Z A;  4R9K A;  1EUI C;  2B7K A;  1M90 4;  1RGC A;  5IG4 A;  3EVI A;  3H51 A;  3MIX A;  4PTS A;  3WHO A;  1GSE A;  4N6O B;  1OKD A;  3A2W A;  2L4V A;  1AAZ A;  1RN1 A;  2XBQ A;  4R80 A;  1HNC A;  3PR8 A;  4XS1 A;  5J5N A;  1LQM B;  2GEY A;  3EYT A;  1ASK A;  1K0A A;  5IEP A;  4XDV A;  3FKF A;  3VSY A;  2CX1 A;  2DJ3 A;  2QEX 3;  4GRF A;  5ELA A;  4AJ6 A;  4ZL9 A;  3QFA C;  5A4W A;  4LYL B;  1TIJ A;  3Q3F A;  3F7S A;  5RNT A;  3DKS A;  1ULI B;  4X0X A;  6GSV A;  1ZS7 A;  4BL7 A;  2LV3 A;  1FUS A;  1IK3 A;  4U13 A;  2HRK A;  3VWV A;  1I2F A;  4BIR A;  3H79 A;  2F4Y A;  2INX A;  2BMO B;  2YX9 A;  2AJQ B;  3FZ9 A;  1O8X A;  1JZR A;  5DJL A;  4G9H A;  3HII A;  5KP1 A;  3GTU B;  1C7H A;  1BSC A;  2WZ9 A;  4FCJ A;  5GZZ B;  5KOX A;  1E3R A;  1B8X A;  1K41 A;  2O87 A;  4R4K A;  1Z7P A;  3D4T A;  1GMQ A;  1T00 A;  3KCM A;  1PN0 A;  2EC4 A;  2IFQ A;  3LXT A;  4J5K A;  4KT3 B;  2OBK A;  3KN4 A;  1AW9 A;  3OWY A;  2DIZ A;  3IHQ A;  3T0U A;  1PX7 A;  3CRU A;  3S5C A;  3RAZ A;  1RSN A;  1LOV A;  5JWR B;  2VL3 A;  3CXG A;  3UVT A;  2O8V B;  4OK0 A;  3PH9 A;  5KN3 A;  3D9R A;  1GD4 A;  3FCS B;  4N6L A;  4RQX A;  1SK1 A;  1DE1 A;  2C4J A;  3P7X A;  1I70 A;  1YVS A;  3D22 A;  2WGO A;  1N8J A;  2C8U A;  2CKF B;  2DC5 A;  1D6U A;  2J8X B;  1ZYQ B;  1A2M A;  5ENU A;  2IL3 A;  2ZDJ A;  1WMN A;  1U6T A;  4JZQ A;  5AN1 A;  1J2B A;  3QCP A;  4RNT A;  3OWU A;  1TXX A;  3ERF A;  3QK9 A;  2O9U X;  1RN7 A;  1ZGX A;  1EGO A;  3UL5 A;  1UGI A;  4KFD A;  4IEL A;  4IS0 A;  2ZNM A;  2YPM A;  2C1Y A;  5FGO A;  3AY8 A;  3F9U A;  1NB5 I;  3MAK A;  4POL A;  3I56 3;  3MG2 A;  3SYU A;  3LOY A;  1UI8 A;  2OOV A;  1T3B A;  3HYP A;  3RBT A;  2BTO T;  4GWR A;  4PEJ A;  6GSS A;  12GS A;  1YY7 A;  2WOH A;  5C00 A;  2XGN A;  3QMX A;  4V1A g;  4MMY B;  2M7O A;  1IYY A;  3ZTL A;  3X3Z A;  2RM5 A;  5INY A;  4FMA A;  4TN8 A;  2HXK A;  2PBJ A;  2P31 A;  4OUQ A;  1NU3 A;  1WMJ A;  4WYK A;  2TIR A;  3PS8 A;  2O3O A;  3LT9 A;  1IYH A;  2C0G A;  5BRT A;  1TP6 A;  1RHL A;  2ZHX B;  1K0C A;  1Y25 A;  1OC3 A;  2PZV A;  5HFK A;  5ABR A; 
#chains in the Genus database with same CATH homology
 6GSY A;  1SKR B;  1E2Y A;  3HD5 A;  2K18 A;  4MJB A;  4OD7 A;  4EF0 A;  1LU4 A;  1Z6M A;  4LMV A;  2VLT A;  1CQH A;  2QC7 A;  5LNK e;  3IAM 2;  1MD3 A;  1R26 A;  4I6X A;  3FZA A;  1PQN A;  4G19 A;  3LJR A;  2HZE B;  1QQ2 A;  3HZ4 A;  4F82 A;  2HYX A;  4JBB A;  1ZYE A;  5DQY A;  4TR1 A;  1U87 A;  2FWH A;  2AB6 A;  4AJ7 A;  2V6O A;  3LFL A;  4JED A;  2OE3 A;  4PUR A;  4HQZ A;  3CTG A;  4K8M A;  3E3E A;  4QL9 A;  4WKW A;  1F9M A;  4OFM A;  3GUS A;  4K7N A;  3W6G A;  2YWI A;  4PQ1 A;  3UJ1 A;  2VLV A;  2H8L A;  1WJK A;  3HJP A;  4WXT A;  2X8H A;  4F03 A;  2YWM A;  1PSQ A;  4XHM A;  4GST A;  2K8V A;  1XPV A;  4BA7 A;  4ICY A;  1TOF A;  2X4A A;  9GSS A;  1KTE A;  5KN2 A;  2J9H A;  2CAQ A;  4YAV A;  3P2A A;  4IHU A;  3GMF A;  2GVP A;  2IJY A;  4I2T A;  2H0H A;  2N5F A;  3NOF A;  3QR6 A;  4NPB A;  4WF4 A;  2MMZ A;  4ZXG A;  3DYR A;  2VOC A;  1YF0 A;  4HDE A;  3HKR A;  3C73 A;  2F9S A;  1PA3 A;  2AUV A;  2D2Z A;  1ERU A;  1PKW A;  1H75 A;  1T7P B;  4O5R A;  1KNG A;  2QSI A;  3TOT A;  4EO3 A;  1FOH A;  5A4V A;  2IYJ A;  4QL7 A;  1TRW A;  4PGT A;  2DSA A;  4YKG A;  4YAP A;  3TJF A;  2IMI A;  4JR4 A;  5B8A A;  3UAR A;  5HFG A;  1RK4 A;  4AF2 A;  4WBJ A;  2A4V A;  2H6Y A;  4IN0 A;  2WB9 A;  4ZB6 A;  3MDK A;  4FYU A;  4GQF A;  4POK A;  2R0C A;  1YKA A;  1MDK A;  2WFC A;  1QK8 A;  3A5I A;  1ERT A;  4I97 A;  3TCO A;  4EUY A;  4OMV A;  3LG6 A;  1K0N A;  2L5O A;  2LQO A;  5CRW A;  2LRT A;  3TRP A;  3F4S A;  3DGQ A;  3FRC A;  1G7O A;  4XRA A;  2DBC A;  4AJ8 A;  1WRY A;  3HY2 A;  1EV4 A;  4OCE A;  3GKX A;  2REM A;  3UOM A;  5DAL A;  5E4W A;  1GUL A;  4POB A;  3RPP A;  3J7Y b;  1LJR A;  1O85 A;  1XWG A;  1FW1 A;  3C1R A;  3DML A;  2H1D A;  1DBY A;  3ZRD A;  1M2D A;  1YEP A;  1Z3E A;  1O81 A;  1TK0 B;  3BOA A;  1K3L A;  3E9J B;  1SEN A;  4HI7 A;  1GSY A;  4V2L A;  3EC3 A;  2VCX A;  4PNF A;  2OE0 A;  4Z2R A;  4XRD A;  5CRE A;  4IQA A;  2VCV A;  1ZMA A;  1XVW A;  5IMZ A;  2L6C A;  4TXO A;  1FVK A;  2X99 A;  3F4R A;  3LXZ A;  1Q4J A;  3EU3 A;  4GXZ A;  3ED3 A;  2OAC A;  3BCI A;  6GSW A;  4F2I A;  2GZP A;  2H1A A;  1I5G A;  3CBU A;  4NAX A;  4CDO A;  3GKN A;  4GSN A;  4A5P A;  4BWQ A;  3DRN A;  2H71 A;  2GSQ A;  2GT5 A;  1O73 A;  3WGE A;  19GS A;  3HCZ A;  1WE0 A;  3GV1 A;  3IA1 A;  1BED A;  3GIX A;  5DAK B;  3WYW A;  1G6W A;  2MYG A;  1ZYP A;  2GQK A;  5JCG A;  1HYU A;  1OC9 A;  2DMM A;  5F0G A;  5B6M A;  4BVY A;  3GSS A;  3KJY A;  3KMO A;  4PUF C;  4Q5R A;  1EEJ A;  3L9V A;  2ON7 A;  6GST A;  4YQM A;  2LUS A;  1U3I A;  2QKE A;  4XS4 B;  4EL1 A;  3PGT A;  1UN2 A;  2GT6 A;  5G30 A;  5ID2 A;  2VCT A;  4ZB8 A;  3IDV A;  2O7K A;  1GL8 A;  4KX4 A;  4ZIL A;  5CRG A;  1AQV A;  4POM A;  2VD1 A;  3JCM L;  2ES7 A;  2C0E A;  2EIR A;  1FVJ A;  1F2E A;  2JZR A;  4J56 E;  2PVQ A;  2QA1 A;  2VM1 A;  1M99 A;  3LYK A;  1USB A;  2M80 A;  4MF6 A;  5IMC A;  4OWY A;  4JU5 A;  1NHY A;  1WWJ A;  5D73 A;  1XOB A;  4LLR A;  2C3Q A;  3APQ A;  4KSM A;  1T1V A;  1FB6 A;  4ZL7 A;  3EWL A;  5KEJ A;  3F6F A;  3H4K A;  5JCW A;  1URM A;  4IKH A;  4KCE A;  3GX8 A;  4KA0 A;  5CRH A;  2CA8 A;  1M9B A;  1YJ6 A;  2H72 A;  4TR3 A;  2VO4 A;  2H19 A;  3I69 A;  13GS A;  2X8C A;  3BD2 A;  1M2A A;  4ZB9 A;  2G2Q A;  4D73 B;  3ME8 A;  4ACS A;  2YOI A;  3H93 A;  4KAE A;  5DQS A;  2F51 A;  1S3C A;  1UA5 A;  2GS3 A;  1EZK A;  4KF9 A;  5F06 A;  2GQM A;  3M0F A;  3ISO A;  4K7I A;  5J9C A;  3UVH A;  2Z9S A;  1BJX A;  4CW9 A;  3IPZ A;  5A5K A;  1DSB A;  4ZIJ A;  2GZY A;  1Z5Y E;  16GS A;  4GF0 A;  2YZH A;  3IOS A;  3FK8 A;  1XZO A;  2ZUP A;  1GSD A;  3U6V A;  1U88 A;  1I9D A;  2H6X A;  2O85 A;  1HQO A;  2IY2 A;  4FO5 A;  3C71 A;  5D9T A;  3Q18 A;  4L0W A;  4K7O A;  1SYX A;  2LTK A;  2LJK A;  4MF7 A;  1DE2 A;  4YQV A;  1RW1 A;  4RUV A;  2MBS A;  4ECB A;  3P90 A;  3WGD A;  1GRX A;  4WR5 A;  4Z2U A;  5IO2 A;  1EP7 A;  2GST A;  1SYR A;  3APS A;  4ZBD A;  2DJ2 A;  3UBL A;  2FA4 A;  2MMO A;  3TKS E;  2YN1 A;  5DVB A;  2K9F A;  3A2V A;  1FHE A;  2H0G A;  1A2L A;  4OFN A;  5COH A;  2AHE A;  3VUR A;  5ELG A;  3LQ7 A;  2FY6 A;  4Q5N A;  3TJK A;  1WOU A;  2CAI A;  5CP1 A;  3TB2 A;  1O7U A;  4ML1 A;  5DCG A;  3WGX A;  1B9Y C;  1F37 A;  3M9K A;  3ERW A;  1SKW B;  2FNO A;  4LA1 A;  1T4Y A;  1TU7 A;  3ZL5 A;  1XW9 A;  4JE1 A;  3DWV A;  2B7J A;  1ZZY A;  2YJH A;  2GTU A;  3FZ4 A;  4KW6 A;  3HVX A;  4HU7 A;  1SJZ A;  3VK9 A;  3UL3 A;  4MZB A;  6GSX A;  3ZFB A;  2CVD A;  1XOA A;  2LRC A;  2LKU A;  3UIW A;  1XWK A;  1BQ7 A;  3FEU A;  1Z7R A;  5J4U A;  4J57 E;  2E0Q A;  3VLN A;  1TRS A;  2LQQ A;  3VWU A;  4MZC A;  4EC0 A;  1X9W B;  2ON5 A;  4O92 A;  2N5B A;  3ZVJ A;  1SJI A;  2EIO A;  3GRX A;  4K5S A;  2VCZ A;  4N0Z A;  4EKZ A;  1U3A A;  2R37 A;  2H6Z A;  4EDY A;  3IV4 A;  4E8H A;  3M3M A;  1JZD A;  1O6J A;  1K0O A;  3ZZX A;  4CY8 A;  3CSJ A;  1H4O A;  1K0M A;  3O6T A;  4V2M A;  4OO4 A;  2LNT A;  3I9V 2;  4G0I A;  1AC1 A;  5G31 A;  4DSQ A;  3SWL A;  5A4U A;  4BVX B;  3N9J A;  2BMX A;  3GA4 A;  5AIV A;  3HA9 A;  1GLQ A;  1A24 A;  4N10 A;  5ECN B;  4EE0 A;  4F9Z A;  2FD3 A;  1EOH A;  3QPM A;  5GST A;  1MDJ A;  3KP8 A;  3S9F A;  4ML6 A;  3MNG A;  17GS A;  4I5Q A;  2VIM A;  5IMD A;  1A2J A;  2H0I A;  2YJ7 A;  1R5A A;  1S3A A;  4O5Q A;  2IWT A;  2GZZ A;  1TW9 A;  1Z9H A;  5F05 A;  1XXU A;  1FG4 A;  1Y6E A;  3EMX A;  2C80 A;  3VWW A;  2VCW A;  2C3T A;  3RHC A;  2PVO C;  3ZIT A;  3BBY A;  1QXH A;  4YKF A;  1TTZ A;  3GHA A;  1PL2 A;  4MPG A;  1XIY A;  3QOU A;  2WRT A;  2YNX A;  3ZYW A;  2YCD A;  2OE1 A;  4AGS A;  5IQY A;  3TOU A;  5B8B A;  3GN3 A;  1PL1 A;  3IBH A;  1TI3 A;  3I43 A;  4ID0 A;  6GSU A;  4X1U A;  4MCU A;  5DJM A;  3US3 A;  1V58 A;  4KCA A;  2H66 A;  1UVZ A;  3HZ8 A;  3W8S A;  2IMF A;  2FWG A;  1F3B A;  1ZL9 A;  4KDU A;  4NWY A;  3DXB A;  3D6I A;  3RHB A;  1TK8 B;  3TJJ A;  2J23 A;  1ABA A;  4HZ4 A;  2E2M A;  1G6Y A;  2WGR A;  2A2R A;  2L59 A;  2IME A;  2HZF A;  4N30 A;  1YKC A;  2F8A A;  2PMT A;  4OFT A;  4IW9 A;  1FOV A;  3IHG A;  2AYT A;  5IIZ A;  1EWX A;  4ILF A;  4MZW A;  3GTU A;  3I6A A;  4DVC A;  4DSS B;  5H5S A;  3F3R A;  5EVO A;  3QAG A;  4XIH A;  3GST A;  2C0D A;  3UEM A;  1VRS D;  4GTU A;  2P5R A;  2R6K A;  5G1K A;  1PMT A;  3DVW A;  4KUN A;  2LST A;  1VGL A;  1X5E A;  3MWH A;  4KDY A;  4WF5 A;  1O8W A;  2PGT A;  1XWA A;  2HSY A;  1XCC A;  3L9U A;  2CT6 A;  2IMD A;  1YZX A;  2I4A A;  1GSS A;  4GSS A;  1B9X C;  5IPH A;  1X5D A;  1EV9 A;  2K6V A;  2F3M A;  4BL7 B;  4KND A;  3GH6 A;  5FT3 A;  1OE7 A;  3HJM A;  3VWX A;  5ECS A;  3LSZ A;  4ECC A;  2YWO A;  2PER A;  2CX4 A;  3MSZ A;  4G2E A;  3EIN A;  4IQ1 A;  5ECM B;  2QGV A;  2VL9 A;  22GS A;  3QAV A;  1HNA A;  5ECI B;  4FYB A;  3TUE A;  2B1K A;  2GGT A;  1LBK A;  3FYG A;  5CRD A;  3FR9 A;  3H1N A;  1C72 A;  3L78 A;  2JSZ A;  2YAN A;  1YEX A;  1KEB A;  3KM6 A;  4NHZ A;  2IFQ B;  3QDN A;  2R2J A;  1TK5 B;  1EOG A;  3F6D A;  1VF3 A;  1QUW A;  2C3N A;  3F63 A;  4IGJ A;  2C0F A;  2H1G A;  3WT1 A;  1R5P A;  2DJJ A;  3CYN A;  3D0Z A;  1EP8 A;  5B7C A;  5LD0 A;  4KB3 A;  4DSR A;  4LL4 B;  4EIQ A;  5IOW A;  5GAP D;  5G5E A;  4KSO A;  3TKP A;  2JU5 A;  5GAN D;  2B1L A;  2R5G A;  2GSS A;  2HI7 A;  2HZE A;  2GSR A;  1XVQ A;  3TDG A;  1OAZ A;  2L57 A;  5DDL A;  2YV9 A;  4IJ3 A;  1JHB A;  4X4J A;  3IK7 A;  3GL5 A;  2RLI A;  1VF2 A;  3ME7 A;  1M0U A;  2FGX A;  1GSQ A;  1M2B A;  1EGR A;  3FHK A;  5CO3 A;  5EL8 A;  1GNW A;  3ZFL A;  4RI6 A;  4RQR A;  3GKK A;  1BG5 A;  5KN1 A;  4K2D A;  2OBI A;  1WP0 A;  4IP1 A;  2DJ0 A;  3L4N A;  4HJ2 A;  5ECL B;  4GLT A;  2R4V A;  4X43 A;  2UZ8 A;  1X9M B;  2MBT A;  1Z6N A;  3IE3 A;  2DJ1 A;  2JZT A;  2RUF A;  1ML6 A;  1W89 A;  1R7H A;  4FQU A;  1SD9 A;  4MLY A;  3TGZ A;  2RUE A;  2HE3 A;  4Z7X A;  3BJ5 A;  4V1A p;  1MTC A;  3KTL A;  4K6X A;  2B5X A;  1SL0 B;  4TR1 B;  3R3E A;  3VFI A;  1VF1 A;  5D93 A;  2HNL A;  1Q98 A;  4MDC A;  1XWB A;  2OAD A;  1SK2 A;  1B4Q A;  1V98 A;  1PN9 A;  2B5Y A;  1YF1 A;  1YQ1 A;  3C1S A;  3VI5 A;  2L5L A;  5D9X A;  1UC7 A;  1M9A A;  3ZVJ D;  3TRX A;  1HD2 A;  4ECJ A;  1V2A A;  4BPY A;  3IXR A;  4XS6 A;  3KZQ A;  11GS A;  2VL2 A;  1ZCP A;  2FHE A;  2LJA A;  3Q19 A;  3RPN A;  3FW2 A;  1AQX A;  2CZ3 A;  1GH2 A;  3DIE A;  2DIY A;  2HSM A;  4HS1 A;  1AXD A;  1GTI A;  3ZIV A;  2WS2 A;  1JZW A;  2XHF A;  5FHI A;  5CNW A;  2VLU A;  4DEJ A;  3NZN A;  1ILO A;  3QAW A;  2DKH A;  3PIN A;  2JSY A;  1J9B A;  2HRA A;  2JL4 A;  3FY7 A;  1B48 A;  4Q5Q A;  3KMN A;  1JLW A;  1GWC A;  2DJK A;  5ECK B;  4OCF A;  1GLP A;  3DVX A;  2OA7 A;  4TW5 A;  5C04 A;  2EIQ A;  3EMP A;  2DLX A;  18GS A;  3U5R E;  1TRV A;  1SU9 A;  4K0N A;  5IOX A;  1E6B A;  1TI1 A;  1GTB A;  4H86 A;  4IBP A;  4MJC A;  2QA2 A;  3APO A;  3KH7 A;  3TKR A;  3CRT A;  1K0B A;  2MZC A;  3M9J A;  1GTU A;  4HOJ A;  3KGK A;  1SD8 A;  5D8I A;  3HXS A;  4MA9 A;  4K9Z A;  2VCQ A;  2R3X A;  5J41 A;  5DAL B;  5AIS A;  4TVE A;  4TR0 A;  1F6M C;  4MAB A;  5DAK A;  2H70 A;  4E8E A;  3KIJ A;  2HRN A;  4OO5 A;  3IRA A;  3GKM A;  1ZOF A;  3RDW A;  2LNS A;  1SKS B;  1AUC A;  3A3T A;  2CX3 A;  1ST9 A;  4PX1 A;  1X5C A;  2OKA A;  2V41 A;  1PRX A;  3R2Q A;  4N0V A;  2XC2 A;  4ULX A;  3KP9 A;  1QMV A;  4O7H A;  4XS4 A;  4N11 A;  2CVB A;  4NXI A;  4G10 A;  1OVN A;  1TRU A;  1ON4 A;  5F8B A;  4L5O A;  3J7Y k;  1ACV A;  3UAP A;  2RM6 A;  5L71 A;  4TXO B;  2IN3 A;  4TOP A;  2MMN A;  2PWJ A;  5KOW A;  1NSW A;  2ALB A;  2L6D A;  5EY6 A;  4L8E A;  3TKS A;  2XBI A;  4HQS A;  5IMV A;  5G5F A;  4G0K A;  4NHW A;  1SL1 B;  2FUG 2;  2WCI A;  4GCI A;  3QD9 A;  2M72 A;  1PD2 1;  2JZS A;  1OC9 B;  1V9W A;  4MNN A;  3DEX A;  3F3Q A;  4BVY B;  1PX6 A;  3KEB A;  1XW5 A;  2GLR A;  2NPB A;  3K8N A;  2A4H A;  2IIY A;  2CVK A;  4L0U A;  2OJL A;  3EE2 A;  1ERV A;  10GS A;  4PNG A;  2MMA A;  3G7J A;  4F0B A;  4FYC A;  2NDO A;  4IJI A;  5CYY A;  2PN8 A;  1AIU A;  4K0G A;  4PXO A;  1SJ6 A;  5BMU A;  1A0R P;  3H8Q A;  5ID2 B;  4O5U A;  2AV4 A;  4K1F A;  4WEY A;  1YDK A;  5D96 A;  2I9H A;  3ZIJ A;  2KP2 A;  5ECP B;  4D73 A;  1SK0 A;  5IM9 A;  3GFK A;  5JCU A;  3LWA A;  3VPT A;  3D4M A;  1R4W A;  5G1L A;  2JAD A;  2BJX A;  1K0D A;  3TJB A;  3WT2 A;  3GYK A;  4Z2T A;  1GSU A;  3W8J A;  3LOR A;  4F0C A;  2P0G A;  4MH3 A;  2B6M A;  2K8S A;  2I81 A;  3O3T A;  2HFD A;  3KXO A;  3TJG A;  2NVL A;  2RII A;  3TRQ A;  2I1U A;  4K2X A;  3C7M A;  4MJA A;  2P5Q A;  3ZMK A;  1ZYN A;  3CMI A;  3GUR A;  5H5Q A;  4ZBB A;  1EEM A;  5HFI A;  1AQW A;  4TKY A;  3UBK A;  1OYJ A;  2HSH A;  3VPQ A;  3OR5 A;  1NHO A;  4XCS A;  3G7Y A;  2YV7 A;  1TKD B;  2LRN A;  2I3Y A;  5HQP A;  3IK9 A;  2KLX A;  4EXJ A;  2LEG A;  5J3R A;  3P8W A;  2R0P A;  2N5A A;  2FLS A;  1THO A;  4O32 A;  3ERG A;  1N2A A;  1GUH A;  3WD6 A;  1V40 A;  1CQG A;  2GDR A;  2LS5 A;  1J0F A;  1IYI A;  4BWS A;  5J9B A;  2HRF A;  4GQC A;  2H75 A;  2VAF A;  4WBR D;  4PUA A;  2YP6 A;  2A2S A;  3MYD A;  4Q5F A;  3FR6 A;  3CSH A;  1K3Y A;  4J2F A;  5ECR B;  4HUA A;  4TRX A;  2VUP A;  2KUC A;  1GNE A;  2E2G A;  3EU4 A;  1BX9 A;  1JLV A;  1GUK A;  1GP1 A;  2XPD A;  1B4P A;  5F07 A;  3F0I A;  2L4Q A;  4LMW A;  1QGV A;  2A2P A;  1X9S B;  1FB0 A;  3LYP A;  5HR2 A;  2DKI A;  3GX0 A;  3LEF A;  1PKZ A;  4V2N A;  1G7E A;  1GTA A;  3FZ5 A;  4G0L A;  5D9V A;  2FWF A;  4RI7 A;  2FA8 A;  4MP4 A;  4EDZ A;  2VL2 C;  4YQU A;  3UMA A;  3FR3 A;  5LCZ A;  1FO5 A;  3ZRE A;  2CV4 A;  4I8B A;  5E59 A;  3L9S A;  2YZU A;  4LL1 B;  4I2U A;  3DD3 A;  4KE3 A;  4KGI A;  3VI7 A;  4NV5 A;  1PGT A;  3FMW A;  4ECI A;  2V1M A;  2B3S A;  2WUL A;  3EUR A;  4PQI A;  1WPI A;  3TKQ A;  1XWC A;  3D21 A;  3E0U A;  1HNB A;  4HJM A;  4TXV A;  3C8E A;  3ZLP A;  4YH2 A;  5CAX A;  4JR6 A;  1JZO A;  5HR0 A;  3IAS 2;  1M7T A;  2M46 A;  1FAA A;  5ECO B;  2KP1 A;  3HJO A;  1XW6 A;  2V32 A;  2WDU A;  2R0G A;  1XBS A;  5DCH A;  2NTO A;  3M8N A;  5IPG A;  1G0T A;  5B6N A;  4PQH A;  3KD0 A;  2E7P A;  3IC8 A;  4BVX A;  2X8G A;  4MH2 A;  4EVM A;  2YWN A;  3KTB A;  1TP9 A;  2XPE A;  3V1W A;  5ECQ B;  1QFN A;  2WJU A;  3CTF A;  2CZ2 A;  1JFU A;  1OC8 A;  4CY6 A;  1A8Y A;  2VM2 A;  1X0R A;  3A5W A;  5ECH B;  5KN0 A;  3LGC A;  5IMF A;  4ISD A;  1TJD A;  3O76 A;  20GS A;  2H30 A;  1MD4 A;  3F8U A;  1T4Z A;  1J08 A;  4USS A;  1BAY A;  2NBS A;  3GL3 A;  1TU8 A;  3BCK A;  2PPT A;  1SL2 B;  2HLS A;  1OE8 A;  4QQ7 A;  3KH9 A;  4ZL8 A;  5AGY A;  4HZ2 A;  5JWQ B;  5EPF A;  3GNJ A;  2H73 A;  3N5O A;  1RQM A;  5D9W A;  1ZGN A;  2TRX A;  2H01 A;  2KOK A;  4KH7 A;  4MPF A;  2IPA A;  2FCH A;  4K5R A;  1A8L A;  4KDX A;  2TRC P;  4MMM A;  2H74 A;  3NIV A;  4JRR A;  3M1G A;  14GS A;  2F8F A;  4P3Y B;  2CQ9 A;  1VF4 A;  3HDC A;  2FWE A;  2H76 A;  2LJR A;  2JAC A;  2O89 A;  1GSF A;  3ZML A;  3CSI A;  2X64 A;  3LW9 A;  3Q6O A;  3G9B A;  4XTS A;  3GH9 A;  5IO0 A;  1KBN A;  4HEA 2;  2PU9 C;  5IMA A;  4IP6 A;  4EIP A;  3HVS A;  5H5R A;  3TKS C;  1ERW A;  4NMU A;  2G0F A;  2IMK A;  4FIW A;  3G7I A;  3D5J A;  4HU9 A;  1GUM A;  2PUK C;  3HVV A;  4MK3 A;  5GSS A;  2L4C A;  3IC4 A;  4WET A;  5AIX A;  1BYE A;  5HR1 A;  1MEK A;  4IVF A;  1A23 A;  3QFB C;  3L0H A;  1OKT A;  4TR4 A;  1A0F A;  3PPU A;  2KHP A;  5DBQ A;  5FWG A;  4WR4 A;  1F3A A;  4FH8 A;  1T8E B;  1K3O A;  5G2Z A;  2H1B A;  4L5L A;  1W4V A;  2V6K A;  3HHV A;  1XFL A;  3IR4 A;  1DUG A;  2ZCT A;  4MF5 A;  3F4T A;  2HT9 A;  3EPT A;  2VD0 A;  4MJE A;  5HR3 A;  5JWO B;  2B5E A;  3A2X A;  1V57 A;  1WIK A;  8GSS A;  1S3D A;  4CHS A;  7GSS A;  4ZBA A;  4DSS A;  2GQL A;  2V2G A;  1TDI A;  2DML A;  2AAW A;  1MDI A;  3Q74 A;  1THX A;  3SBC A;  1NW2 A;  4NV2 A;  1NM3 A;  2X49 A;  2B7K A;  3EVI A;  4PTS A;  3MIX A;  1GSE A;  1OKD A;  3A2W A;  1AAZ A;  4XS1 A;  2XBQ A;  1HNC A;  3PR8 A;  5J5N A;  3EYT A;  1K0A A;  3FKF A;  2DJ3 A;  4GRF A;  4ZL9 A;  5ELA A;  4AJ6 A;  3QFA C;  5A4W A;  3DKS A;  4X0X A;  6GSV A;  4BL7 A;  2LV3 A;  2HRK A;  3VWV A;  3H79 A;  2AJQ B;  3FZ9 A;  1O8X A;  1JZR A;  5DJL A;  4G9H A;  3GTU B;  2WZ9 A;  5GZZ B;  5KOX A;  1B8X A;  2O87 A;  1Z7P A;  3D4T A;  1T00 A;  3KCM A;  1PN0 A;  2EC4 A;  2IFQ A;  3LXT A;  2OBK A;  1AW9 A;  2DIZ A;  3IHQ A;  1PX7 A;  3CRU A;  3RAZ A;  5JWR B;  2VL3 A;  3CXG A;  3UVT A;  2O8V B;  3PH9 A;  5KN3 A;  4RQX A;  1SK1 A;  1DE1 A;  2C4J A;  3P7X A;  3D22 A;  1N8J A;  2C8U A;  2DC5 A;  1ZYQ B;  1A2M A;  5ENU A;  2IL3 A;  1U6T A;  4JZQ A;  5AN1 A;  3QCP A;  1TXX A;  3ERF A;  1EGO A;  4IEL A;  4IS0 A;  2ZNM A;  2YPM A;  2C1Y A;  3AY8 A;  3F9U A;  3MAK A;  4POL A;  1T3B A;  3HYP A;  3RBT A;  2BTO T;  4GWR A;  6GSS A;  12GS A;  1YY7 A;  5C00 A;  3QMX A;  4V1A g;  3ZTL A;  2RM5 A;  5INY A;  4TN8 A;  2HXK A;  2PBJ A;  2P31 A;  1WMJ A;  2TIR A;  1IYH A;  2C0G A;  5BRT A;  1K0C A;  1Y25 A;  1OC3 A;  5HFK A;  5ABR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...