1TJDA

The crystal structure of the reduced disulphide bond isomerase, dsbc, from escherichia coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
216
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbC
publication title Structure of the reduced disulfide-bond isomerase DsbC from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 216
sequence length 216
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1tjdA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tjdA02
5AN1A 4YAPA 4TR3A 2H6ZA 3TKSA 2XBQA 4MPGA 4WF4A 4POMA 2KUCA 5ENUA 2OE1A 1GUMA 4LMVA 2DLXA 1XW6A 3FZ4A 1GSDA 2IY2A 2X99A 3TRPA 5E4WA 2XBIA 3O6TA 1Y25A 2X8CA 2YWMA 3GV1A 5HR2A 2ON5A 3TOUA 2GZPA 1GH2A 1ZZYA 1A0FA 1K0CA 2IMKA 1GP1A 2I4AA 2R2JA 1OE7A 2YZHA 3KMOA 2IN3A 4IKHA 2GQKA 2KP2A 3M3MA 1TRWA 1SD8A 3IV4A 1WIKA 2L5LA 2VIMA 2V32A 3KTLA 5INYA 1JFUA 1K3OA 3GYKA 5J3RA 1O73A 3O76A 1F3AA 2LRTA 3KIJA 4EVMA 2OE0A 3CBUA 5B6MA 2QKEA 1HNCA 1TK8B 1SJ6A 1Z6MA 2LUSA 3H4KA 4ISDA 1A24A 3FYGA 2YOIA 1HD2A 3TDGA 1WWJA 4E8HA 5LCZA 2P0GA 1MDJA 1WMJA 3ZITA 4GF0A 1YF1A 5LD0A 1MEKA 1HYUA 4IBPA 2JZTA 4KDUA 4EL1A 5ECMB 2CV4A 5G30A 3VI5A 3G9BA 1YJ6A 1S3DA 1OVNA 4JR6A 2CAIA 3FZ5A 2CVDA 1X5EA 1PSQA 2C0GA 3BOAA 1T4ZA 1K0DA 3TKSC 1G7EA 4X43A 1Z5YE 4MCUA 5IMDA 5A4UA 4JRRA 3EU3A 1KNGA 2OACA 3ERFA 2HZFA 1QFNA 1QXHA 4GSSA 3M9KA 2FA8A 3VPQA 3FY7A 4WEYA 2L57A 1VRSD 4OMVA 5G1KA 1XWCA 2VO4A 5FHIA 2JU5A 2N5AA 3GKXA 1F37A 2DJKA 5COHA 1AQWA 4K2DA 3LORA 3MDKA 2VL2A 5J9CA 3LSZA 3DKSA 4FYCA 1ERVA 1Z7RA 1AIUA 1XWKA 4CW9A 5EVOA 4HEA2 4F0BA 2CZ2A 1PD21 2YWNA 1B9YC 4NPBA 2JSZA 4IJIA 2PVOC 3KH9A 3IXRA 1PKZA 1Z6NA 5G5FA 1B4PA 3P7XA 1ILOA 3WGEA 3DVXA 5IQYA 3ME8A 5B8BA 3QD9A 3I43A 4J57E 4XIHA 2H0HA 5HR0A 4L0WA 3GX0A 2HE3A 4XS1A 2F3MA 2AV4A 2WZ9A 3LFLA 4DEJA 3QAWA 6GSTA 4OD7A 5CP1A 3G7JA 4POBA 2PBJA 1EEJA 1VF3A 1SD9A 2LQQA 5ELAA 5B6NA 2MMOA 2HRFA 2XPDA 5IMVA 2HSHA 1K0AA 2YV7A 1O81A 2OJLA 4OO4A 3W6GA 4KW6A 2G2QA 1TW9A 3IBHA 2LQOA 3CSHA 1PN9A 1VGLA 3HYPA 2FNOA 1V40A 1AQVA 5F06A 5C00A 4GLTA 1M2AA 2JADA 4TRXA 3UIWA 13GSA 1GSQA 4RUVA 2NTOA 1T00A 4TVEA 4EE0A 5KN1A 4LL4B 1YEPA 4ACSA 11GSA 5DCGA 3W8JA 1EOGA 1YY7A 5J41A 2VCZA 2IMIA 3CSJA 1C72A 1TDIA 3HJPA 3QFAC 5IO0A 4F03A 1N8JA 4TXVA 4HZ2A 4Q5QA 1HNAA 1SKRB 1J0FA 3SBCA 3C8EA 1MD3A 4HQSA 5JWOB 5CYYA 1FVJA 5GAPD 1K0BA 3A3TA 4RI6A 2E0QA 1J08A 5H5SA 3F4SA 2RLIA 1T8EB 3LG6A 1E2YA 1O8WA 3C7MA 1KEBA 2YN1A 4N11A 2IMDA 1TJDA 4Q5FA 1O6JA 1M9AA 4H86A 1M99A 5ECHB 3F6DA 3HVVA 2I9HA 2GLRA 1A8YA 3EINA 1M2DA 3IK7A 1DBYA 1U6TA 1NHOA 5KEJA 3ISOA 3ZRDA 1XOBA 2C0FA 5IOWA 4TR1A 1V9WA 4NMUA 2PPTA 1EEMA 4KCAA 3RDWA 4WXTA 4Q5NA 3E0UA 4MJEA 4ECCA 2YJHA 2FY6A 3ZTLA 2D2ZA 2VLUA 2HI7A 4AJ8A 1IYIA 3H79A 4PQHA 5DALA 2M72A 4Z7XA 3UBLA 3QDNA 2LRCA 4MJCA 2EIOA 1V58A 1TI3A 2H66A 3EE2A 3L78A 2H1BA 3GKMA 3IPZA 3PR8A 3GX8A 4I97A 5CRGA 2DIZA 5ECPB 1NW2A 5A5KA 2C8UA 4V1Ap 4DSQA 2IFQB 4OO5A 3M9JA 2NPBA 2IMFA 1PMTA 4LLRA 5B7CA 3VURA 4N10A 3APQA 2F8FA 4ZL9A 1O7UA 4MH3A 5A4WA 2GQMA 4FYUA 1ST9A 1FB6A 2L5OA 5IPGA 12GSA 3ZVJD 1GSFA 1E6BA 4FIWA 2PGTA 1UA5A 3F8UA 2B7KA 1U87A 2BJXA 3LXZA 1XWAA 4IJ3A 5C04A 3DVWA 3D4TA 1A8LA 2VL3A 1GRXA 2K8SA 3ZFBA 4K7IA 2Z9SA 4O32A 1FO5A 2C3QA 4MLYA 3L9SA 2YPMA 4RQXA 2AHEA 2FCHA 5E59A 4K8MA 1GL8A 1N2AA 1SJZA 1Z9HA 4GTUA 4YH2A 2ALBA 1ERTA 3LWAA 3APOA 3LYKA 4I2UA 1SKSB 3RBTA 1F9MA 1SL1B 5JCGA 1TRSA 3BJ5A 1NHYA 1A2MA 1PKWA 4ID0A 4NWYA 1TKDB 1TP9A 2IPAA 2F8AA 2LJRA 4DSSA 1S3AA 3TKQA 1XWBA 5F05A 2CA8A 3EWLA 2VL9A 2NVLA 5G31A 3UARA 4NXIA 2GQLA 5F07A 1V98A 1RK4A 2GT6A 1AXDA 4N30A 5DBQA 2O8VB 4XHMA 5G5EA 4TOPA 4MDCA 8GSSA 3OR5A 1T1VA 4TR1B 4ECIA 5DDLA 2KHPA 1LJRA 2LNSA 1HNBA 6GSXA 3MWHA 3TJBA 4EO3A 4WBRD 2RUFA 1PX7A 5L71A 4OWYA 4FYBA 2B1KA 6GSYA 3LXTA 1GTIA 1FOVA 1TU7A 19GSA 2DJ3A 4MMMA 4DSRA 3RHCA 3LGCA 3UJ1A 5ECLB 1R7HA 1ZCPA 5DALB 2A2SA 2R3XA 3US3A 3A2WA 1K0MA 3IE3A 1XW5A 2H74A 5GZZB 4WBJA 2M80A 2VOCA 4IS0A 4XRDA 2YP6A 2LJKA 5IOXA 1A0RP 3L4NA 4IGJA 4X0XA 1XOAA 2PVQA 1GSSA 3ZFLA 3TUEA 4MH2A 3RPPA 1TOFA 5CNWA 1BEDA 3F0IA 3EC3A 2AUVA 2LKUA 4KNDA 3UVTA 4J56E 1GULA 2F9SA 5GAND 2IWTA 4LMWA 1HQOA 4WKWA 2YV9A 2RM5A 4MF7A 1TTZA 2P5RA 2RIIA 3P2AA 1V2AA 5AIVA 3WGDA 3ZVJA 5IO2A 2C3NA 4K6XA 4EUYA 2H1GA 2C0DA 2R6KA 3NOFA 3HKRA 2R37A 3KM6A 4HUAA 1X9SB 3APSA 2H76A 2A2RA 3QFBC 4OFNA 2I81A 3QR6A 1XVQA 4KSOA 3TJGA 2VCXA 1TK5B 5EPFA 3WD6A 4IN0A 3VWWA 1GTUA 1ABAA 3GIXA 2HZEA 2VM2A 3KD0A 4WR5A 4HU9A 2RM6A 3CTGA 2WULA 2O89A 2I1UA 2H70A 3ED3A 4KCEA 2XPEA 3FK8A 4BVXA 1ZYQB 1CQGA 4PUFC 4YQVA 3Q74A 4PXOA 3ERWA 4IQAA 2KP1A 3TJKA 3ZMLA 3GURA 1PL1A 1OC9A 3IR4A 4F9ZA 1IYHA 3D4MA 2JSYA 1SK1A 1PX6A 2H71A 4HI7A 2IJYA 2H01A 1ML6A 3HCZA 1OAZA 3KTBA 1X0RA 3VWVA 1TRUA 1W4VA 3HXSA 1T7PB 5AISA 4DSSB 1SU9A 4MZBA 1GUHA 3QMXA 4GWRA 3F63A 1Q4JA 4KDXA 3TB2A 3IAS2 2V41A 4G10A 2OBIA 3TKSE 7GSSA 4XRAA 1K3YA 4L0UA 1YEXA 3GMFA 3L9UA 4CHSA 3FRCA 3F4RA 1PQNA 2X64A 3TJJA 4PUAA 2ES7A 1PL2A 3KH7A 4MJBA 2FD3A 3IA1A 2CZ3A 2GTUA 2IFQA 5EY6A 3FZAA 3IRAA 2P31A 2V6OA 2L6CA 3BBYA 2K18A 3PGTA 4ZBAA 1THOA 4JE1A 5IIZA 3K8NA 5ECNB 2FLSA 5HFIA 3VI7A 4PGTA 3N5OA 2LV3A 1GUKA 9GSSA 4K7OA 1FW1A 3I69A 4ZL7A 2FWGA 3J7Yb 2VL2C 2PU9C 4MJAA 5DCHA 3GL3A 2AJQB 4RQRA 4ZB8A 2GS3A 3I6AA 4TR0A 1R4WA 3GKNA 1TK0B 2ZNMA 22GSA 3LJRA 2DBCA 1EGOA 2VLVA 5AIXA 4GSTA 1ZGNA 2PERA 3LQ7A 3FEUA 2V1MA 1GTAA 4TKYA 5KN3A 2L6DA 1WRYA 2L4QA 1S3CA 2REMA 4K7NA 3DMLA 3QPMA 4PNGA 1Z7PA 4K9ZA 1TU8A 2LRNA 4NHZA 1TRVA 3ERGA 3GA4A 2XC2A 4G19A 18GSA 1F6MC 17GSA 1F3BA 1K3LA 3IOSA 3M1GA 1SL2B 1QQ2A 3H1NA 1NSWA 2HZEB 3RHBA 5D9XA 4PQIA 1EV9A 2WJUA 2VCTA 4POLA 1OKTA 1M2BA 3CSIA 2TRXA 3GTUA 5JCWA 3SWLA 2HXKA 3U5RE 4N0ZA 5HFKA 4IVFA 5ECIB 1PGTA 2PN8A 1XZOA 2I3YA 1BG5A 2IYJA 4F2IA 2LNTA 3C1RA 1OC9B 1ON4A 2FUG2 1KBNA 3KXOA 1JLWA 3R2QA 2DJ0A 2C0EA 2OA7A 2H8LA 1ERUA 4GCIA 5IM9A 2YNXA 5D9WA 2KLXA 1QGVA 4HJ2A 1CQHA 5IMFA 2GSQA 2OBKA 4MK3A 5JWRB 1FB0A 4O92A 5HFGA 3ZZXA 2H1DA 5HR1A 2VCQA 2QSIA 4MA9A 2WB9A 1SYRA 3HDCA 4TXOA 1GTBA 3W8SA 5ECQB 1GSEA 3J7Yk 2PMTA 3VPTA 1JZOA 3M8NA 3EMPA 2L4CA 2BTOT 3UBKA 5D96A 4IELA 4N0VA 2JZRA 4XS6A 3ZIJA 2QC7A 5J5NA 1BJXA 3KZQA 1SL0B 2GVPA 2PWJA 4YQMA 2TRCP 3ZMKA 1ZL9A 2DC5A 2C80A 4BL7A 2MMAA 3MNGA 1ERWA 2K6VA 2WS2A 4EKZA 2H6YA 4LL1B 4JU5A 1EP8A 5FWGA 5DAKA 4BPYA 2H75A 2VM1A 3BCKA 4V1Ag 1DE2A 2K9FA 4NV2A 4MF5A 3CTFA 2LJAA 5D73A 1T3BA 1ZMAA 1AC1A 1WOUA 3WT2A 3DRNA 1XW9A 4PQ1A 4QL9A 2HNLA 3P8WA 2QGVA 3GFKA 3EU4A 4ILFA 2B1LA 3GHAA 4YAVA 1OKDA 3L0HA 2KOKA 1XPVA 1TI1A 3DYRA 2IL3A 5J9BA 1Q98A 2CX4A 3CRTA 3PINA 1WPIA 1I9DA 4BWSA 2P5QA 2HYXA 4POKA 4WF5A 2ZUPA 3N9JA 1XFLA 14GSA 3H93A 1GNEA 4JBBA 6GSWA 5CREA 1WJKA 5FT3A 4WETA 3VLNA 3HHVA 2WRTA 3GNJA 2E2MA 4ECBA 1X5DA 1G0TA 1ZOFA 4JR4A 4AJ6A 4X1UA 4YQUA 1YZXA 3MSZA 1GLQA 3GTUB 1EV4A 4AGSA 1EOHA 1U3AA 4EC0A 4V2LA 5ABRA 4G2EA 2NDOA 1YDKA 5F8BA 2OADA 6GSSA 3GSTA 3RPNA 2MZCA 1GNWA 2HLSA 4GXZA 4EDZA 2FWHA 4GQFA 5HQPA 2ZCTA 3VFIA 4BWQA 5DJMA 5CRWA 4HZ4A 1THXA 1F2EA 5ELGA 2AB6A 3F6FA 4HOJA 4O5RA 3TRQA 3DXBA 1M7TA 3DEXA 5DVBA 1MDIA 4P3YB 3KCMA 3WGXA 2H0IA 4XCSA 1GSYA 1V57A 5CRHA 1VF1A 2CVBA 1Y6EA 1WP0A 4TXOB 1OE8A 3TGZA 5JWQB 2CAQA 1OYJA 3F3QA 5AGYA 3L9VA 1AQXA 2EC4A 1A23A 3CYNA 4ZILA 4TN8A 5DQYA 2BMXA 4TR4A 2HT9A 1EP7A 1K0OA 4HJMA 3S9FA 2IIYA 16GSA 1M9BA 1MD4A 2WGRA 1X9MB 4V2NA 4CDOA 3CXGA 2H73A 2CX3A 3I9V2 3Q19A 4KDYA 4PURA 3DGQA 4F82A 1FHEA 2B6MA 2JZSA 1X9WB 5B8AA 2YWIA 3IC4A 5DAKB 3GUSA 1YQ1A 4HDEA 2GZZA 3V1WA 3A2XA 4ZB6A 4NHWA 1USBA 5DJLA 3ZREA 3NIVA 1XXUA 4GQCA 4L5LA 4OFTA 3C1SA 5KN0A 1DSBA 5ECKB 4KAEA 3IK9A 4I8BA 2J23A 4I5QA 3KP9A 2TIRA 5F0GA 1K0NA 4G9HA 5JCUA 2FA4A 3F9UA 3TRXA 3DIEA 2R4VA 4PNFA 3UL3A 2E2GA 3G7YA 4XS4A 4WR4A 4D73A 4ZXGA 4FO5A 2LS5A 1VF2A 3HZ4A 3HJOA 4KB3A 2B5YA 3UMAA 2WCIA 2DJJA 4V2MA 2H0GA 2LEGA 4F0CA 1WE0A 4L8EA 2NBSA 4NAXA 2YZUA 1PA3A 4ZBBA 4K1FA 5IMAA 4L5OA 6GSVA 5D9TA 4KH7A 2H19A 1OC8A 1RQMA 5ECOB 2X8HA 2PUKC 1Z3EA 1R5AA 2MBSA 4OFMA 3P90A 2MMNA 2VD1A 2H30A 20GSA 1SJIA 3GH6A 4ZL8A 2LTKA 2H72A 4KSMA 3O3TA 1JZRA 3LYPA 3UVHA 3WYWA 3GN3A 4MZCA 3FZ9A 2N5BA 3BCIA 1JZWA 3KP8A 1I5GA 5D9VA 4MP4A 5ECSA 2VAFA 1MDKA 5H5QA 2R5GA 1XCCA 2MMZA 2B5XA 3FKFA 1W89A 1GWCA 2IMEA 2VUPA 2N5FA 3TOTA 1X5CA 4DVCA 3EVIA 4O7HA 1YKAA 2EIRA 3CRUA 3DWVA 1ZYEA 2AYTA 2VCWA 1QUWA 3UEMA 5D8IA 4GSNA 5LNKe 1GSUA 1QMVA 3D0ZA 2GGTA 2A4VA 1J9BA 3VWUA 3HA9A 2OKAA 2EIQA 2CVKA 4BVYA 2HSYA 5GSTA 3U6VA 2YCDA 1O8XA 1PRXA 4FH8A 1B48A 1T4YA 2B3SA 3QAGA 5IPHA 4MABA 3QAVA 3ME7A 4HQZA 5GSSA 5ID2A 3Q6OA 3GSSA 1SENA 3QCPA 4AJ7A 2VLTA 1LBKA 4ECJA 3G7IA 2DJ2A 3JCML 4ZIJA 3AY8A 4K0NA 2J9HA 1UC7A 5CRDA 2B5EA 2HFDA 5D93A 3LEFA 1B4QA 3GH9A 1G7OA 2B7JA 1A2LA 3D6IA 2G0FA 3F4TA 5HR3A 3GRXA 3GKKA 1URMA 4EF0A 2DMLA 2WFCA 1AUCA 1R26A 3D21A 4ZBDA 1BQ7A 3ZLPA 1SK0A 3A2VA 2F51A 4IQ1A 3GL5A 2CQ9A 2VCVA 4XS4B 2JL4A 3E9JB 4D73B 4TW5A 3HZ8A 1O85A 5IMCA 3FW2A 4HS1A 3CMIA 1QK8A 2WDUA 4MZWA 3TKRA 1EWXA 1FAAA 2V6KA 5ECRB 1KTEA 3TCOA 4IW9A 1SKWB 1XWGA 4KA0A 2RUEA 3ZIVA 1BYEA 2VD0A 5A4VA 3KMNA 1OC3A 3BD2A 4IHUA 4EDYA 4QL7A 2O85A 5EL8A 1G6WA 4JEDA 1XBSA 3IDVA 3HD5A 2GSSA 4MF6A 5G1LA 1YKCA 2DJ1A 2YANA 2FWEA 4GRFA 1A2JA 4IP6A 1UVZA 5G2ZA 1JZDA 1UN2A 4MPFA 1SK2A 2LSTA 1JLVA 1M0UA 3D22A 3KGKA 3WT1A 2GDRA 4E8EA 4KX4A 2E7PA 2H6XA 5J4UA 1U3IA 4EXJA 2C4JA 2ON7A 4NV5A 3EMXA 3D5JA 3TJFA 2FWFA 3EYTA 10GSA 4Q5RA 3VK9A 2XHFA 5CAXA 1AAZA 1DE1A 1R5PA 1MTCA 3EURA 2GSRA 3E3EA 1JHBA 3TKPA 1EGRA 3A5WA 2C1YA 2L59A 3M0FA 2K8VA 3NZNA 5IMZA 1TXXA 1LU4A 4BA7A 3ZL5A 3KJYA 2DMMA 3FR9A 1ACVA 4PX1A 3C73A 3HVXA 1RW1A 2O7KA 1DUGA 3FR6A 3HJMA 1FG4A 1G6YA 3H8QA 3VWXA 1SYXA 4ML1A 3QOUA 2GT5A 3HY2A 4KUNA 3ZYWA 3PH9A 4K0GA 2X8GA 3RAZA 4I2TA 2AAWA 2H1AA 2DIYA 4J2FA 1EZKA 5DQSA 2FHEA 3DD3A 2HRNA 1H4OA 1VF4A 2DSAA 4OCFA 4IP1A 2O87A 1YF0A 2OE3A 6GSUA 1B8XA 4HU7A 3FHKA 4ULXA 4XTSA 4LA1A 2JACA 2M46A 2C3TA 5CO3A 4JZQA 5ID2B 3C71A 3FR3A 3UOMA 4QQ7A 1XIYA 1AW9A 3KEBA 4OCEA 1XVWA 4AF2A 2GSTA 2YJ7A 1H75A 1NM3A 4KGIA 2YWOA 1BX9A 4ML6A 1GLPA 4RI7A 4ZB9A 4I6XA 2FGXA 3UAPA 2MYGA 3IHQA 3Q18A 1FVKA 1BAYA 3F3RA 3IAM2 2CT6A 5H5RA 4KE3A 1B9XC 5KN2A 2GZYA 3HVSA 2MBTA 1U88A 3MAKA 2V2GA
chains in the Genus database with same CATH superfamily
2KF5A 3F40A 3NUVA 2OCTA 5AN1A 4YAPA 2DKHA 4TR3A 4FQUA 2ML5A 3S29A 2H6ZA 3TKSA 2ZDJA 2XBQA 4MPGA 4WF4A 1RRLA 3LZAA 6GSPA 4POMA 2KUCA 1FUSA 5ENUA 5LC6A 3LMLA 2OE1A 1GUMA 4LMVA 1RGHA 1HZ1A 2RFRA 2DLXA 5CF1A 4BTXA 1XW6A 3FZ4A 1GSDA 3MYTA 2IY2A 2X99A 3TRPA 1M9GA 5E4WA 1GMQA 2JQ5A 1JB2A 3DUKA 2XBIA 3O6TA 1Y25A 2X8CA 2YWMA 3GV1A 5HR2A 2ON5A 3TOUA 2GZPA 1SIIA 4HM3B 1GH2A 1BRJA 1RSNA 1ZZYA 1A0FA 1RRHA 5IG3A 1K0CA 1MWSA 2IMKA 1UGHI 1GP1A 2I4AA 2R2JA 1OE7A 1Q864 1E3RA 2YZHA 3FLJA 3KMOA 2IN3A 2E2UA 4IKHA 2GQKA 1EA2A 1OGZA 3UL6A 2KP2A 3M3MA 1TRWA 3CPOA 1SD8A 3IV4A 1WIKA 1Q42A 2L5LA 2VIMA 2V32A 3KTLA 5INYA 1JFUA 3LTAA 1K3OA 3GYKA 5J3RA 1TP6A 1O73A 1KC84 3O76A 1F3AA 5IG4A 2FXTA 1I70A 3BLZA 2LRTA 3KIJA 4EVMA 2OE0A 3CBUA 1LOVA 5B6MA 4L8OA 5D81A 2QKEA 1W02A 1FYSA 1NO3A 1HNCA 3D5GA 1SJ6A 1Z6MA 1TK8B 2LUSA 1VZZA 3H4KA 4ISDA 2CWUA 4EXRA 1A24A 1FUWA 3FYGA 5BVBA 2YOIA 4HVNA 3TDGA 1HKXA 1HD2A 1WWJA 3CCU3 4E8HA 5LCZA 4KT3B 2ZA4A 1MDJA 2P0GA 1WMJA 3ZITA 4GF0A 3CME3 1YF1A 5LD0A 1MEKA 1HYUA 4IBPA 2JZTA 4KDUA 4EL1A 5ECMB 2L4VA 2KXGA 2CV4A 5G30A 4WHAA 3VI5A 3G9BA 1YJ6A 1S3DA 1OVNA 4JR6A 3MPHA 2CAIA 3FZ5A 2CVDA 3LTDA 2QA1A 1E3VA 1X5EA 1PSQA 4EW5A 2C0GA 1O7WB 3BOAA 1T4ZA 1K0DA 3TKSC 1G7EA 4X43A 1Z5YE 3CCE3 4MCUA 3FZWA 1RCKA 5IMDA 2AAEA 4JRRA 3EU3A 5A4UA 1YI23 1N5PA 1FA3A 5AIGA 1KNGA 2OACA 3ERFA 1D6YA 2HZFA 1CQSA 3KSPA 1QFNA 1QXHA 1KWIA 4FMBA 3CCS3 4GSSA 1DVDA 3CQFA 3NBBA 3M9KA 2OOVA 3JUQA 3UNLA 2FA8A 3NHXA 3VPQA 1BNFA 3FY7A 4L7KA 2BIRA 4WEYA 2L57A 1VRSD 4OMVA 1LQMB 5G1KA 1XWCA 3G0KA 2VO4A 5FHIA 2JU5A 2N5AA 3GKXA 1F37A 1Q9EA 2DJKA 5COHA 2UGIA 1K41A 1LOXA 3NM7A 1AQWA 4K2DA 4XDVA 5CK6A 3LORA 3EHCA 3MDKA 1ULJB 2VL2A 5J9CA 4X4JA 3LSZA 1MNLA 1X1WA 3DKSA 4FYCA 3K9MC 1ERVA 1Z7RA 1AIUA 1XWKA 4CW9A 5EVOA 4HEA2 4F0BA 2CZ2A 4K5SA 5HOHA 1B27A 2YX9A 1PD21 4N3VA 4NREA 2YWNA 1B9YC 2P05A 4NPBA 3HI7A 3BNCA 2JSZA 2BMRB 4IJIA 2PVOC 3KH9A 3IXRA 1PKZA 1BNIA 5IF6A 1M1XB 1Z6NA 4KFFA 5G5FA 1JBRA 1B4PA 3P7XA 4O5UA 1ILOA 3WGEA 3WA3A 3DVXA 5IQYA 3ME8A 1RMSA 5B8BA 2PZVA 3AHWA 2RGQA 3CCJ3 3QD9A 3X3YA 2BO9B 3I43A 3EX9A 4J57E 4XIHA 3OWUA 2H0HA 5HR0A 4L0WA 5CLKA 3KE7A 1SIHA 3GX0A 2HE3A 1YGWA 4XS1A 2F3MA 2AV4A 2WZ9A 2KF3A 3LFLA 3LTBA 1IVWA 4DEJA 3QAWA 4N6MA 2GXFA 4HZBB 6GSTA 4OD7A 4GHOA 4XBTA 5CP1A 3G7JA 4POBA 2RNTA 2PBJA 1EEJA 1VF3A 4EYCA 1CYUA 1SD9A 2LQQA 5ELAA 5B6NA 2MMOA 2HRFA 2XPDA 1BANA 3S67A 5IMVA 2HSHA 1K0AA 2YV7A 1O81A 2OJLA 4OO4A 3W6GA 4KW6A 2G2QA 1TW9A 3IBHA 2LQOA 3CSHA 1PN9A 1DVCA 1QVG2 3BNEA 1VGLA 3HYPA 3DGMA 2FNOA 1V40A 1AQVA 3PS8A 4O5QA 5F06A 4GLTA 5C00A 1M2AA 2JADA 4TRXA 3UIWA 13GSA 1GSQA 4RUVA 5KP1A 2NTOA 1T00A 2CHCA 4TVEA 1BNJA 4EE0A 5KN1A 4LL4B 2CH9A 1YEPA 4ACSA 11GSA 5DCGA 2STDA 1O7GB 1DETA 3OX9A 3W8JA 4WYKA 1GOUA 1TTOA 2BMQB 1EOGA 1YY7A 4JF8A 1YJ93 5J41A 2VCZA 1K28A 2IMIA 1PU4A 3CSJA 1C72A 3GZBA 1JNQA 1TDIA 3S28A 3HJPA 4FCJA 3QFAC 5IO0A 4F03A 1N8JA 4TXVA 4HZ2A 4Q5QA 1HNAA 1SKRB 1J0FA 2CG1A 3F9SA 2IUKA 3M8CA 3X40A 3C8EA 3SBCA 2QEX3 1MD3A 2M7OA 1GS3A 4HQSA 5JWOB 4Z2TA 5CYYA 3LW9A 1FVJA 5GAPD 4Q53A 3GZRA 1K0BA 3A3TA 3SOAA 4RI6A 2E0QA 1J08A 5H5SA 2P0MA 3HVNA 4XM4A 3F4SA 3B8LA 1MWTA 2RLIA 3CC73 3BIRA 3Q3FA 1IDPA 3X42A 2R41A 1T8EB 3LG6A 1E2YA 1O8WA 3C7MA 1KEBA 2YN1A 4N11A 2IMDA 4MMYB 1TJDA 4Q5FA 3DMCA 1O6JA 1M9AA 2CFWA 4H86A 2RBIA 1M99A 5ECHB 1GOYA 4JRFA 3F6DA 4K1UA 3HVVA 2I9HA 3F8XA 2GLRA 1I0XA 1A8YA 2O3OA 3EINA 1M2DA 3IK7A 1EG9B 2D1WA 1DBYA 1U6TA 2OQEA 3UL5A 1M3IA 1NHOA 4BVXB 5KEJA 3ISOA 1LXEA 1BRSA 3EPTA 3ZRDA 1XOBA 3D4AA 2ZHXB 2C0FA 1YIJ3 4MMXB 1IVUA 5IOWA 4TR1A 1OPYA 4XBYA 1V9WA 4NMUA 2PPTA 1RKYA 1EEMA 4IPBA 4KCAA 3RDWA 3HX8A 4WXTA 4Q5NA 3E0UA 4MJEA 4HYZA 4ECCA 1LRAA 2YJHA 2FY6A 3EBYA 3ZTLA 2D2ZA 1IK3A 3IMAB 2VLUA 2HI7A 4AJ8A 1IYIA 3H79A 4PQHA 5DALA 2M72A 4Z7XA 3UBLA 1W6GA 4ORLA 3QDNA 5JBSA 2LRCA 4MJCA 2EIOA 1V58A 1AQZA 3G4S3 1TI3A 2H66A 3EE2A 4G0LA 4XBXA 3L78A 3KZTA 2H1BA 3GKMA 1RJOA 4Z2UA 4N6V0 1A67A 3IPZA 3PR8A 3V92A 3GX8A 4I97A 5CRGA 1ASKA 3WOEB 2DIZA 5ECPB 1NW2A 3GZYB 3B4PA 5A5KA 3OWSA 2C8UA 2CC3A 4V1Ap 1PYLA 4R9LA 1WQLB 4DSQA 2OTL3 2J8XB 2IFQB 4OO5A 3MIXA 3DY5A 3M9JA 1WNHA 2NPBA 2IMFA 1PMTA 5EEOA 4A5PA 4LLRA 5B7CA 3VURA 1CH0A 3OV4A 4N10A 2CFLA 1YGEA 1ZO2A 3APQA 2F8FA 4ZL9A 1TRQA 4CY8A 1O7UA 1RNBA 4MH3A 5A4WA 2GQMA 7RNTA 1FGQA 5AIHA 4FYUA 3CNXA 2W56A 1FB6A 1ST9A 4YKFA 4N6LA 2L5OA 5IPGA 5AI1A 12GSA 3ZVJD 1GSFA 1E6BA 1OACA 4FIWA 2PGTA 1UA5A 1STFI 3F8UA 2K0MA 4EBGA 2B7KA 1B20A 1U87A 1HU9A 2BJXA 4O8SA 4LZIA 4K2XA 3LXZA 1RN4A 5JPPA 1XWAA 4IJ3A 5C04A 4PEJA 3RDEA 5RNTA 3DVWA 3D4TA 1A8LA 2VL3A 1GRXA 2K8SA 3ZFBA 4K7IA 2Z9SA 4O32A 1BIRA 1FO5A 2C3QA 4MLYA 3L9SA 2Q07A 4K90B 2GEXA 2YPMA 2INXA 4RQXA 1W6YA 2AHEA 2FCHA 8RNTA 1GY7A 2Z6BA 5E59A 2HMNB 4K8MA 1GL8A 4KFEA 1N2AA 1SJZA 1Z9HA 1BSCA 4GTUA 4YH2A 2WGQA 2ALBA 3X3ZA 1ERTA 4H61A 3LWAA 3APOA 1D6ZA 3VGNA 3LYKA 4I2UA 3AHSA 2D42A 3T8NA 3GZXB 4MEIA 3CCQ3 1I3IA 3RBTA 1F9MA 1SKSB 1SL1B 2GSPA 3DH2A 4J8TA 5JCGA 4FMAA 1TRSA 1B2XA 3CPW2 3BJ5A 1Q40A 1NHYA 1A2MA 1PKWA 4ID0A 3BNBA 4NWYA 3AGNA 3PCRA 1M3JA 5LC7A 1S723 1TP9A 1JKGA 2F8AA 2IPAA 1TKDB 2LJRA 4DSSA 1S3AA 3UJMA 2WGOA 3TKQA 1TU5A 1BUJA 1XWBA 1X1UA 5F05A 4HM4B 1VQ53 2CA8A 3EWLA 2VL9A 2NVLA 3EJVA 5G31A 5A0OB 3UARA 2HRAA 4NXIA 2GQLA 2CX1A 3Q90A 5F07A 1V98A 1RK4A 2GT6A 1AXDA 3EC9A 2HSMA 4N30A 5DBQA 2O8VB 4XHMA 3D79A 1WMNA 3FCSB 5G5EA 2CFKA 4TOPA 1OF5A 1UUGB 4RBNA 4MDCA 8GSSA 1BNSA 3OR5A 1AR0A 3T0UA 3ZG0A 1T1VA 2P38A 4TR1B 4ECIA 5DDLA 2KHPA 1LJRA 2LNSA 4N6NB 3SOYA 1HNBA 3G16A 2GBXB 3MWHA 6GSXA 4CY6A 2BHMA 3TJBA 4EO3A 4WBRD 4LEHA 2RUFA 2CFDA 1PX7A 2Z7AA 1IVXA 5L71A 4OWYA 4FYBA 1VQK3 1SQWA 1L5GB 2B1KA 6GSYA 3LXTA 5BXQA 1GTIA 3K7CA 3WODG 2E2TA 1TU7A 1K9M4 1FOVA 19GSA 2DJ3A 1YVBI 5AIIA 4MMMA 4DSRA 3RHCA 3LGCA 3UJ1A 5ECLB 1UDII 1QALA 1O7PB 1R7HA 1ZCPA 5DALB 2A2SA 2R3XA 3US3A 3A2WA 1K0MA 3SX1A 3IE3A 1XW5A 2H74A 1B2ZA 4WBJA 5GZZB 2M80A 3WOFB 2VOCA 4IS0A 4XRDA 1MGRA 2YP6A 2IA7A 3PCSA 2LJKA 1A0RP 5IOXA 3QK9A 3L4NA 4IGJA 5AIFA 3A76A 3X3XA 4X0XA 1W6CA 1XOAA 2PVQA 2KAAA 1GSSA 3ZFLA 3TUEA 3CNMA 4MH2A 4FCZA 3RPPA 1TOFA 5CNWA 1BEDA 3F0IA 3EC3A 1RN1A 5KP3A 2AUVA 5I97A 2LKUA 4KNDA 3UVTA 4J56E 4EIQA 1Q824 1U8CB 1GULA 2F9SA 1I8VA 1R4YA 1B2MA 5GAND 2ML6A 2IWTA 4LMWA 2BMOB 1HQOA 4WKWA 1RNTA 1Z1SA 2FGTA 2YV9A 2RM5A 4MF7A 3SLUA 2GU3A 1TTZA 3BB9A 3KSED 2P5RA 4K61A 5M1AA 2RIIA 3P2AA 7GSPA 1V2AA 5AIVA 3WGDA 2W56B 2PNCA 3ZVJA 2A2PA 5IO2A 3AGOA 2C3NA 4K6XA 4EUYA 2H1GA 2C0DA 4BTYA 1FW7A 2R6KA 4HOHA 3NOFA 1GSPA 3HKRA 1R4CA 2R37A 1RGKA 3KM6A 4HUAA 1X9SB 1FZUA 2F86B 3APSA 2H76A 1LVNA 2LYXA 2A2RA 3QFBC 3OXAA 4OFNA 2I81A 3QR6A 1XVQA 4O2HA 4G0KA 4KSOA 4XDWA 3TJGA 2VCXA 1TK5B 5EPFA 3UB1A 3WD6A 1BRGA 5JPUA 1JV2B 4IN0A 3VWWA 1GTUA 1ABAA 3GIXA 2HZEA 2VM2A 1DMMA 3KD0A 4WR5A 4HU9A 3NM2A 2RM6A 2A15A 2WULA 3LT9A 3CTGA 2CKFB 2O89A 2I1UA 2H70A 3ED3A 4KCEA 4IT7A 4EV2A 2XPEA 1GD4A 3FK8A 4BVXA 1ZYQB 1CQGA 4PUFC 4YQVA 3Q74A 4PXOA 2Z76A 5BRTA 3ERWA 4IQAA 2KF4A 1LOWA 4HM6B 2KP1A 4GB5A 3TJKA 4LYLB 3ZMLA 3GURA 1IQYA 1PL1A 1SPUA 1JBSA 1OC9A 3IR4A 4F9ZA 1IYHA 3D4MA 1FUTA 2F98A 2JSYA 1SK1A 1PX6A 3RGAA 1UI8A 2H71A 4HI7A 1JBTA 2H01A 2IJYA 1ML6A 3HCZA 1Q40B 3R3EA 1OAZA 3KTBA 1X0RA 3VWVA 3D3LA 1TRUA 1I2FA 1JKGB 1W4VA 3HXSA 1T7PB 5AISA 4DSSB 4R9KA 1SU9A 4MZBA 1GUHA 3QMXA 4GWRA 3F63A 1Q4JA 4KDXA 3TB2A 3IAS2 2B24B 1W4NA 2V41A 5TGNA 4G10A 3FF0A 2OBIA 3TKSE 1RGLA 1I3FA 4LSOA 3WMDA 5G2GA 4L8PA 7GSSA 4XRAA 1K3YA 4L0UA 1YEXA 3GMFA 3L9UA 4CHSA 3FRCA 3F4RA 3STDA 1PQNA 4OVMA 1IU7A 4HM0B 2X64A 3TJJA 4PUAA 2ES7A 1PL2A 4H3UA 3KH7A 4MJBA 3FF2A 2XSHB 1PFOA 2FD3A 1OF5B 3IA1A 2CZ3A 1ZX2A 2GTUA 2IFQA 5EY6A 1VQ93 1IVVA 3FZAA 3IRAA 2P31A 1UCIA 2V6OA 2L6CA 4LGQA 2HMKB 4DKIA 3BBYA 2K18A 3NBJA 3GAXA 7STDA 3CMA3 3PGTA 4ZBAA 1W00A 2OOVC 3ER7A 1TFKA 1THOA 4JE1A 1NNVA 3N8BA 2HOHA 2WOFA 5IIZA 3MG1A 2XSOB 4QWTA 3K8NA 4K5RA 5ECNB 2FLSA 5HFIA 3VI7A 4YKGA 4PGTA 2I9WA 3N5OA 2XF3A 1NJI4 2LV3A 1GUKA 3IJEB 9GSSA 1I0VA 4K7OA 1NB5I 1FW1A 3I69A 4ZL7A 2FWGA 3J7Yb 1BOXA 1KQS2 2VL2C 2CWVA 1M904 2PU9C 3X41A 4MJAA 4BL3A 5DCHA 2FNQA 1I2EA 3GL3A 2AJQB 4RQRA 2P0XA 3FMWA 3OWYA 2XGNA 4ZB8A 1GMPA 1OCVA 2GS3A 4MJDA 3NQZA 3I6AA 2X49A 4KFDA 4TR0A 1R4WA 3S5CA 3GKNA 1TK0B 1DMQA 2ZNMA 22GSA 2HMJB 3LJRA 3DGYA 2DBCA 1EGOA 2VLVA 2RSXA 2HRKA 5AIXA 3A5IA 5IEOA 1I2GA 1ZGNA 4GSTA 2PERA 3LQ7A 1RTUA 3FEUA 2V1MA 3AMOB 1BNEA 1GTAA 1A90A 4TKYA 4RNZA 5KN3A 2L6DA 4IIAA 1WRYA 1UUWB 3EE1A 2L4QA 1S3CA 1XG8A 3I563 2CG0A 2REMA 4K7NA 4X2OA 3F7XA 3DMLA 3QPMA 4PNGA 5IERA 1Z7PA 4K9ZA 1CYVA 1FGRA 1TU8A 1S5AA 2LRNA 2W0QA 3PPUA 4NHZA 1TRVA 3ERGA 1BSDA 3Q2PA 1EKMA 3GA4A 1JN5B 2XC2A 1OHOA 1YVSA 4G19A 18GSA 2YFLB 4CJNA 1RGFA 3B4OA 1F6MC 1BRHA 4FCMA 2R0GA 17GSA 1F3BA 2F56A 3DM8A 1K3LA 3IOSA 4HJLB 4AEQA 3M1GA 1SL2B 1QQ2A 3MG3A 2W6JH 3H1NA 1B21A 1NSWA 2HZEB 3RHBA 5D9XA 1K734 4PQIA 4HSCX 1W5ZA 1EV9A 2WJUA 2VCTA 5IENA 4POLA 1OKTA 1M2BA 4XB5A 3QRDA 1W01A 3CSIA 1X1XA 2TRXA 3GTUA 5JCWA 3SWLA 2HXKA 3U5RE 4N0ZA 5HFKA 4IVFA 5ECIB 3G6E3 5KP4A 1PGTA 2PN8A 1XZOA 2I3YA 1BG5A 3MHEA 3DZLA 1E97A 2IYJA 4F2IA 1BUQA 2LNTA 3C1RA 1OC9B 1ON4A 4WWUC 1JRQA 2FUG2 5FGOA 1KBNA 3KXOA 3SVAA 1JLWA 3R2QA 2DJ0A 1DE3A 2C0EA 2XGLA 2OA7A 2H8LA 3CXC2 1ERUA 1RDSA 1KD14 4GCIA 3H51A 2MF7A 5IM9A 2YNXA 5D9WA 1VQL3 2KLXA 1QGVA 4HJ2A 1CQHA 5IMFA 3FGYA 2GSQA 1BNRA 3SYUA 2OBKA 3SXXA 4MK3A 5JWRB 3JUPA 1FB0A 4O92A 5HFGA 1IV7A 1VQM3 1AVLA 1STDA 3ZZXA 2H1DA 4J5KA 5HR1A 4HZ9B 1J2BA 2VCQA 1GY5A 2XEPA 3ZFZA 3O8YA 2QSIA 1YJN3 2WB9A 1SYRA 4MA9A 3HDCA 1UI7A 4TXOA 5KOWA 4AKZA 3D5IA 1GTBA 2XR8B 3ROBA 2W9QA 3RNTA 3W8SA 3HZPA 3VSYA 5ECQB 1OUNA 1GSEA 3J7Yk 3PYJA 2PMTA 3VPTA 1JZOA 3M8NA 3EMPA 1W7CA 2L4CA 2BTOT 3UBKA 5D96A 1GD3A 4J9AA 4IELA 4N0VA 2JZRA 3DGOA 4XS6A 4CCVA 4G0IA 3ZIJA 2F5WA 2QC7A 5J5NA 1BJXA 3KZQA 1SL0B 2GVPA 2PWJA 1LQGC 2K54A 4YQMA 2TRCP 3ZMKA 2OQEC 1ZL9A 3I0YA 2DC5A 2C80A 4BL7A 1T2HA 1RGGA 5BU4A 2MMAA 5FW5A 3MNGA 4I4KA 1ERWA 4Z2RA 2K6VA 2WS2A 1IYYA 4EKZA 2GU1A 3ECFA 2QA2A 2H6YA 4LL1B 4JU5A 1EP8A 5FWGA 5DAKA 4BPYA 2H75A 2VM1A 4EC6A 3BCKA 3LYGA 4V1Ag 3GSPA 1DE2A 1BRIA 2K9FA 4NV2A 3EN8A 5BIRA 4HKVB 3F8HA 4MF5A 1RLSA 5AYRB 3CTFA 2LJAA 2K3DA 5STDA 1N8R4 3FSDA 1BRKA 3NXJA 5D73A 1T3BA 1ZMAA 4N6UA 3CU3A 1AC1A 3KKGA 1BAOA 1WOUA 3WT2A 3DRNA 2HMOB 3MKIA 1XW9A 4PQ1A 3MG2A 4QL9A 4USSA 2HNLA 2QA43 3P8WA 1ZYPA 3IPTA 2QGVA 2JDIH 3GFKA 3EU4A 1LNIA 4ILFA 2B1LA 3GHAA 4YAVA 1IT8A 1OKDA 2F99A 3VF1A 4HM8B 1NB3I 3I553 3L0HA 2KOKA 1XPVA 1TI1A 1RCLA 2XH9A 3DYRA 2IL3A 5J9BA 3NQYA 1Q98A 2R0PA 2CX4A 1OH0A 4BL2A 3CCV3 3CRTA 3PINA 1WPIA 1I9DA 4BWSA 2P5QA 2HYXA 4POKA 1LOYA 4WF5A 1N5HA 2ZUPA 4J5GA 2O9UX 3N9JA 1XFLA 14GSA 3H93A 1GNEA 4JBBA 1Y4KA 5CREA 6GSWA 3KN4A 4G1MB 1WJKA 5FT3A 4WETA 3VLNA 3HHVA 2WRTA 3GNJA 2A4HA 2E2MA 4ECBA 4MMZB 1FGOA 1VQO3 1X5DA 1G0TA 4R1KA 1ZOFA 1ZS7A 4JR4A 3MSOA 1SJWA 4AJ6A 4X1UA 4YQUA 1YZXA 3MSZA 1GLQA 1BVIA 3GTUB 1EV4A 1OHSA 4AGSA 1EOHA 4KVHA 1U3AA 4EC0A 4V2LA 5ABRA 4G2EA 3G713 2NDOA 1YDKA 5F8BA 1BRNL 2OADA 3V98A 6GSSA 3GSTA 3RPNA 1U5OA 4GL6A 2MZCA 1GNWA 2HLSA 4GXZA 4EDZA 1HYFA 3G8ZA 3JUMA 2FWHA 4GQFA 2UUGC 2GEYA 5HQPA 2ZCTA 1IQXA 1QAKA 2BNGA 3J7Yd 3VFIA 3L0RA 2R4IA 4BWQA 2AADA 5DJMA 3LT8A 5CRWA 2SARA 4HZ4A 2CWTA 1THXA 1F2EA 5ELGA 2AB6A 3F6FA 4HOJA 4O5RA 3TRQA 5CXOA 3DXBA 1M7TA 3DEXA 1UCKA 3U1WA 5DVBA 1MDIA 4P3YB 3KCMA 1LNHA 1T2IA 1ROVA 3WGXA 1O7MB 2H0IA 4XCSA 1GSYA 2RCDA 1V57A 3E99A 5CRHA 2KCDA 1VF1A 1DYUA 2CVBA 1Y6EA 1AV4A 2Y74A 1PFPA 1WP0A 1OE8A 4TXOB 3TGZA 5ELUA 1JB5A 3F14A 5JWQB 3FG3A 2CAQA 3CC43 1N9EA 1OYJA 3F3QA 3WR2A 3CCR3 1O7NB 5AGYA 3L9VA 3BU4A 1AQXA 2EC4A 1A23A 3CYNA 3PXMA 1BGSA 3AMOA 4ZILA 4TN8A 5DQYA 5ELJA 3WHOA 2BMXA 4TR4A 2HT9A 1EP7A 2CX0A 1DMNA 1K0OA 4HJMA 3S9FA 1MWRA 4N6OB 2IIYA 16GSA 1IT7A 1M9BA 1MD4A 2WGRA 1X9MB 4CDLA 1FGTA 3KCHA 4V2NA 4CDOA 3CXGA 1Q7Y4 2H73A 1QJGA 3N54B 1JN5A 4BL7B 5IW9A 1YHQ3 2CX3A 3I9V2 3Q19A 4KDYA 4PURA 3DGQA 4F82A 1FHEA 3DGNA 1IQ8A 2B6MA 2JZSA 3NV0A 1N8QA 1X9WB 5B8AA 1D6UA 2YWIA 3IC4A 5DAKB 3GUSA 2Y73A 1YQ1A 4HDEA 2GZZA 2WOHA 3V1WA 3LXUX 3A2XA 4ZB6A 4NHWA 1USBA 5DJLA 3ZREA 1BNGA 3NIVA 1XXUA 4GQCA 4L5LA 2V1LA 3CD63 4OFTA 3C1SA 5KN0A 4O02B 4WFOA 1DSBA 2CK3H 5ECKB 3IK9A 4I8BA 4KAEA 2J23A 4I5QA 2W9PA 3EN1B 5AYSC 1C54A 3KP9A 2TIRA 5F0GA 1K0NA 4G9HA 1QVF2 5JCUA 1UUVB 2FA4A 3F9UA 3TRXA 1UCLA 4NHFA 3DIEA 2R4VA 4PNFA 3RGRA 3UL3A 2E2GA 3G7YA 4XS4A 2DKIA 2R0CA 1JJ22 4WR4A 4D73A 3HK4A 4ZXGA 4FO5A 2LS5A 1VF2A 3HZ4A 2XFTA 1OGXA 3HJOA 4KB3A 2B5YA 4HM1B 3UMAA 2XRXB 4R80A 2WCIA 2DJJA 4V2MA 2H0GA 2LEGA 3U97A 1AY7A 1VQ73 4F0CA 1WE0A 4L8EA 2OWPA 2NBSA 1MWUA 1KSIA 3DGLA 1UW1A 4NAXA 2YZUA 1PA3A 4ZBBA 5IEPA 4K1FA 3FG4A 3IC8A 5IMAA 4HM7B 1OHPA 1UGIA 4L5OA 6GSVA 1IV9A 3KIIA 5D9TA 4KH7A 2H19A 1OC8A 1RQMA 5ECOB 2X8HA 2CFGA 2PUKC 1Z3EA 1BSAA 1R5AA 1WTHA 2MBSA 4OFMA 1A2PA 1BSBA 3P90A 1VQ83 2MMNA 1US1A 4ZM8A 1GY6A 2VD1A 4FMCA 2H30A 20GSA 1SJIA 1G02A 4STDA 3GH6A 4ZL8A 2LTKA 1NWWA 2KF6A 2H72A 3URPA 4KSMA 1GYBA 5CF2A 3O3TA 2LQVA 1JZRA 5KOXA 3BNDA 3LYPA 3NX0A 1K8A4 3UVHA 3WYWA 4HAAA 3GN3A 4MZCA 3FZ9A 5DREA 1BSEA 2N5BA 3BCIA 1JZWA 3IHGA 5EVHA 3KP8A 1I5GA 4HM2B 5D9VA 2KRTA 4FMDA 4MP4A 5ECSA 8CHOA 1A2KA 1ROAA 2VAFA 4EIPA 3V99A 3JUNA 1MDKA 3LH4A 5H5QA 1GOVA 2R5GA 1UCJA 1XCCA 2MMZA 2B5XA 4K1VA 2L1SA 3FKFA 1MOLA 1GWCA 1W89A 3EBTA 2IMEA 2VUPA 2N5FA 3TOTA 4R4KA 3CCL3 1M1K4 1X5CA 1PY3A 4DVCA 1A2VA 2HMLB 3HIIA 3EVIA 2CIUA 4O7HA 1YKAA 2EIRA 3CRUA 3H3HA 3DWVA 6STDA 1ZYEA 1MGWA 5HGRA 2AYTA 2VCWA 1QUWA 3UEMA 5M19A 5D8IA 4GSNA 2W04A 5LNKe 1GSUA 1QMAA 1QMVA 3D0ZA 4GSPA 2GGTA 2A4VA 1J9BA 3GWRA 3WA2X 3HA9A 3VWUA 2OKAA 2EIQA 3K5TA 3FH1A 3EF8A 1VQQA 2C4BA 1QAFA 2P09A 2CVKA 4BVYA 2HSYA 5GSTA 3U6VA 2YCDA 1O8XA 1PRXA 4FH8A 1B48A 1T4YA 2B3SA 3QAGA 5IPHA 4MABA 4BIKA 2YFIB 3QAVA 3NV0B 3ME7A 4MNNA 4HQZA 5GSSA 1RGAA 3Q6OA 5ID2A 3GSSA 3B7CA 1SENA 2WO0A 4BIRA 1TIJA 3QCPA 1Q814 4AJ7A 1RHLA 2VLTA 1LBKA 3MWZA 4ECJA 3G7IA 2DJ2A 3JCML 4ZIJA 3AY8A 4K0NA 2E2VA 2J9HA 3SEDA 1UC7A 4OK0A 2B5EA 4WP5A 2HFDA 3MYDA 4RNYA 5CRDA 5D93A 3LEFA 1V74A 1B4QA 3GH9A 1G7OA 2B7JA 1A2LA 3D6IA 2G0FA 3F4TA 5HR3A 3GRXA 3GKKA 3OW22 1URMA 4EF0A 2DMLA 2WFCA 1AUCA 1R26A 3D21A 4ZBDA 1BQ7A 3ZLPA 3HIGA 1SK0A 3A2VA 1T5YA 3DXOA 1ZYNA 2F51A 5D83A 4IQ1A 3GL5A 1G96A 1VQ43 2CQ9A 4X2HA 1FOHA 2VCVA 4XS4B 1W2ZA 2JL4A 3E9JB 4D73B 4TW5A 4BTWA 2F4YA 1NDOB 5AEWB 3HZ8A 1O85A 5IMCA 3FW2A 4HS1A 1ULIB 3JUOA 4BU4A 3CMIA 1B2SA 1QK8A 3NBRA 2YFJB 2WDUA 4LMIA 1PN0A 4MZWA 3TKRA 1EWXA 2QGUA 3D9RA 1FAAA 2C11A 2V6KA 5ECRB 1KTEA 3TCOA 4IW9A 1SKWB 1XWGA 4KA0A 2W2CA 2RUEA 2OTJ3 1NU3A 3ZIVA 1TRPA 1BYEA 2VD0A 5A4VA 3KMNA 1OC3A 3BD2A 4IHUA 4EDYA 4QL7A 2IMJA 3F7SA 1VQP3 1G6WA 2O85A 5EL8A 1EUIC 1YIT3 1W2B2 4JEDA 1VQN3 1XBSA 2SBLA 1O7HB 1RGEA 3IDVA 5AEUB 3HD5A 2GSSA 4MF6A 5G1LA 1YKCA 3K0ZA 2DJ1A 5BMUA 2QIYA 3A5EA 2YANA 2FWEA 4GRFA 1A2JA 4IP6A 1UVZA 5G2ZA 1JZDA 1B3SA 1UN2A 3JVCA 4MPFA 1SK2A 2LSTA 2BT3A 5GSPA 1JLVA 1M0UA 3D22A 3KGKA 3WT1A 1S3RA 2CW9A 2GDRA 4O3VA 4E8EA 4KX4A 2E7PA 2GBWB 1RN7A 6RNTA 2H6XA 5J4UA 1U3IA 4EXJA 4EV5A 2C4JA 2ON7A 4NV5A 3EMXA 1WMOA 1BU4A 3D5JA 9RNTA 3TJFA 2Z77A 2FWFA 1SARA 3EYTA 10GSA 4Q5RA 5D82A 3VK9A 5DRVA 2XHFA 5CAXA 1TUHA 2UX0A 1AAZA 1DE1A 4AKYA 1C7HA 1R5PA 1MTCA 3EURA 2IUJA 2GSRA 4OUQA 3E3EA 4TX4A 3TKPA 1JHBA 1EGRA 3A5WA 3LTCA 3FKAA 1F8NA 2C1YA 2L59A 3M0FA 2K8VA 3NZNA 2XFSA 1TXXA 1LU4A 5IMZA 3ZL5A 4BA7A 3CC23 3KJYA 2DMMA 1B2UA 3FR9A 1ACVA 1GMRA 2ZL8A 4PX1A 3C73A 4FR9A 3HVXA 3CCM3 3EB8A 1JB4A 3FG1A 1RW1A 1DUGA 2O7KA 3FR6A 3HJMA 1FG4A 3GRDA 3WDGB 4KF9A 1G6YA 4HM5B 3H8QA 1RGCA 4HBRA 1ZGXA 1ISKA 2F5MA 2X4AA 1AVKA 2B1XB 3VWXA 4CPKA 2W03A 3EQQB 1SYXA 1FGMA 1N9JA 4ML1A 4RNTA 3QOUA 2GT5A 3PGBA 5M18A 3K63A 3HY2A 4KUNA 3ZYWA 2C10A 3PH9A 4K0GA 2X8GA 3RAZA 1WMPA 4WYKB 4I2TA 2AAWA 2H1AA 2DIYA 4J2FA 1EZKA 3S27A 1YJW3 5DQSA 2FHEA 1EQKA 1CEWI 3DD3A 5IG0A 2HRNA 1H4OA 1VF4A 4N6TA 2DSAA 4OCFA 4ICYA 4KZ1A 4PTSA 4BVYB 4IP1A 1Q7HA 3ALAA 2O87A 1YF0A 2UZ8A 2OE3A 6GSUA 1B8XA 4HU7A 3FHKA 4ULXA 4XTSA 4LA1A 3Q1CA 2JACA 2M46A 3T8UA 2C3TA 5CO3A 4JZQA 5ID2B 3C71A 2BU4A 3FR3A 1X1YA 3UOMA 4QQ7A 1XIYA 2MC8A 1AW9A 3KEBA 1XVWA 4OCEA 4AF2A 2GSTA 1YNVX 5IG5A 2YJ7A 1VQ63 1H75A 1NM3A 4KGIA 2YWOA 1BX9A 4RZMA 4ML6A 1GLPA 4RI7A 1TFOA 4ZB9A 5EQLA 3PZWA 4I6XA 2FGXA 3UAPA 4U13A 2HMMB 2MYGA 3IHQA 3Q18A 3ZG5A 3HOHA 1FVKA 1BAYA 3F3RA 3IAM2 3KFQC 2CT6A 3N9HA 5H5RA 4KE3A 3LOYA 1B9XC 5KN2A 2GZYA 3HVSA 2MBTA 1U88A 3MAKA 2V2GA
chains in the Genus database with same CATH topology
5AN1A 4YAPA 2DKHA 4TR3A 4FQUA 2H6ZA 3TKSA 2XBQA 4MPGA 4WF4A 4POMA 2KUCA 5ENUA 2OE1A 1GUMA 4LMVA 2DLXA 1XW6A 3FZ4A 1GSDA 2IY2A 2X99A 3TRPA 5E4WA 2XBIA 3O6TA 1Y25A 2X8CA 2YWMA 3GV1A 5HR2A 2ON5A 3TOUA 2GZPA 1GH2A 1ZZYA 1A0FA 1K0CA 2IMKA 1GP1A 2I4AA 2R2JA 1OE7A 2YZHA 3KMOA 2IN3A 4IKHA 2GQKA 2KP2A 3M3MA 1TRWA 1SD8A 3IV4A 1WIKA 2L5LA 2VIMA 2V32A 3KTLA 5INYA 1JFUA 1K3OA 3GYKA 5J3RA 1O73A 3O76A 1F3AA 2LRTA 3KIJA 4EVMA 2OE0A 3CBUA 5B6MA 2QKEA 1HNCA 1TK8B 1SJ6A 1Z6MA 2LUSA 3H4KA 4ISDA 1A24A 3FYGA 2YOIA 1HD2A 3TDGA 1WWJA 4E8HA 5LCZA 2P0GA 1MDJA 1WMJA 3ZITA 4GF0A 1YF1A 5LD0A 1MEKA 1HYUA 4IBPA 2JZTA 4KDUA 4EL1A 5ECMB 2CV4A 5G30A 3VI5A 3G9BA 1YJ6A 1S3DA 1OVNA 4JR6A 2CAIA 3FZ5A 2CVDA 2QA1A 1X5EA 1PSQA 2C0GA 3BOAA 1T4ZA 1K0DA 3TKSC 1G7EA 4X43A 1Z5YE 4MCUA 5IMDA 5A4UA 4JRRA 3EU3A 1KNGA 2OACA 3ERFA 2HZFA 1QFNA 1QXHA 4GSSA 3M9KA 2FA8A 3VPQA 3FY7A 4WEYA 2L57A 1VRSD 4OMVA 5G1KA 1XWCA 2VO4A 5FHIA 2JU5A 2N5AA 3GKXA 1F37A 2DJKA 5COHA 1AQWA 4K2DA 3LORA 3MDKA 2VL2A 5J9CA 4X4JA 3LSZA 3DKSA 4FYCA 1ERVA 1Z7RA 1AIUA 1XWKA 4CW9A 5EVOA 4HEA2 4F0BA 2CZ2A 4K5SA 1PD21 2YWNA 1B9YC 4NPBA 2JSZA 4IJIA 2PVOC 3KH9A 3IXRA 1PKZA 1Z6NA 5G5FA 1B4PA 3P7XA 4O5UA 1ILOA 3WGEA 3DVXA 5IQYA 3ME8A 5B8BA 3QD9A 3I43A 4J57E 4XIHA 2H0HA 5HR0A 4L0WA 3GX0A 2HE3A 4XS1A 2F3MA 2AV4A 2WZ9A 3LFLA 4DEJA 3QAWA 6GSTA 4OD7A 5CP1A 3G7JA 4POBA 2PBJA 1EEJA 1VF3A 1SD9A 2LQQA 5ELAA 5B6NA 2MMOA 2HRFA 2XPDA 5IMVA 2HSHA 1K0AA 2YV7A 1O81A 2OJLA 4OO4A 3W6GA 4KW6A 2G2QA 1TW9A 3IBHA 2LQOA 3CSHA 1PN9A 1VGLA 3HYPA 2FNOA 1V40A 1AQVA 4O5QA 5F06A 5C00A 4GLTA 1M2AA 2JADA 4TRXA 3UIWA 13GSA 1GSQA 4RUVA 2NTOA 1T00A 4TVEA 4EE0A 5KN1A 4LL4B 1YEPA 4ACSA 11GSA 5DCGA 3W8JA 1EOGA 1YY7A 5J41A 2VCZA 2IMIA 3CSJA 1C72A 1TDIA 3HJPA 3QFAC 5IO0A 4F03A 1N8JA 4TXVA 4HZ2A 4Q5QA 1HNAA 1SKRB 1J0FA 3SBCA 3C8EA 1MD3A 4HQSA 5JWOB 4Z2TA 5CYYA 3LW9A 1FVJA 5GAPD 1K0BA 3A3TA 4RI6A 2E0QA 1J08A 5H5SA 3F4SA 2RLIA 1T8EB 3LG6A 1E2YA 1O8WA 3C7MA 1KEBA 2YN1A 4N11A 2IMDA 1TJDA 4Q5FA 1O6JA 1M9AA 4H86A 1M99A 5ECHB 3F6DA 3HVVA 2I9HA 2GLRA 1A8YA 3EINA 1M2DA 3IK7A 1DBYA 1U6TA 1NHOA 4BVXB 5KEJA 3ISOA 3EPTA 3ZRDA 1XOBA 2C0FA 5IOWA 4TR1A 1V9WA 4NMUA 2PPTA 1EEMA 4KCAA 3RDWA 4WXTA 4Q5NA 3E0UA 4MJEA 4ECCA 2YJHA 2FY6A 3ZTLA 2D2ZA 2VLUA 2HI7A 4AJ8A 1IYIA 3H79A 4PQHA 5DALA 2M72A 4Z7XA 3UBLA 3QDNA 2LRCA 4MJCA 2EIOA 1V58A 1TI3A 2H66A 3EE2A 4G0LA 3L78A 2H1BA 3GKMA 4Z2UA 3IPZA 3PR8A 3GX8A 4I97A 5CRGA 2DIZA 5ECPB 1NW2A 5A5KA 2C8UA 4V1Ap 4DSQA 2IFQB 4OO5A 3MIXA 3M9JA 2NPBA 2IMFA 1PMTA 4A5PA 4LLRA 5B7CA 3VURA 4N10A 3APQA 2F8FA 4ZL9A 4CY8A 1O7UA 4MH3A 5A4WA 2GQMA 4FYUA 1ST9A 1FB6A 4YKFA 2L5OA 5IPGA 12GSA 3ZVJD 1GSFA 1E6BA 4FIWA 2PGTA 1UA5A 3F8UA 2B7KA 1U87A 2BJXA 4K2XA 3LXZA 1XWAA 4IJ3A 5C04A 3DVWA 3D4TA 1A8LA 2VL3A 1GRXA 2K8SA 3ZFBA 4K7IA 2Z9SA 4O32A 1FO5A 2C3QA 4MLYA 3L9SA 2YPMA 4RQXA 2AHEA 2FCHA 5E59A 4K8MA 1GL8A 1N2AA 1SJZA 1Z9HA 4GTUA 4YH2A 2ALBA 1ERTA 3LWAA 3APOA 3LYKA 4I2UA 1SKSB 3RBTA 1F9MA 1SL1B 5JCGA 1TRSA 3BJ5A 1NHYA 1A2MA 1PKWA 4ID0A 4NWYA 1TKDB 1TP9A 2IPAA 2F8AA 2LJRA 4DSSA 1S3AA 3TKQA 1XWBA 5F05A 2CA8A 3EWLA 2VL9A 2NVLA 5G31A 3UARA 2HRAA 4NXIA 2GQLA 5F07A 1V98A 1RK4A 2GT6A 1AXDA 2HSMA 4N30A 5DBQA 2O8VB 4XHMA 5G5EA 4TOPA 4MDCA 8GSSA 3OR5A 1T1VA 4TR1B 4ECIA 5DDLA 2KHPA 1LJRA 2LNSA 1HNBA 6GSXA 3MWHA 4CY6A 3TJBA 4EO3A 4WBRD 2RUFA 1PX7A 5L71A 4OWYA 4FYBA 2B1KA 6GSYA 3LXTA 1GTIA 1FOVA 1TU7A 19GSA 2DJ3A 4MMMA 4DSRA 3RHCA 3LGCA 3UJ1A 5ECLB 1R7HA 1ZCPA 5DALB 2A2SA 2R3XA 3US3A 3A2WA 1K0MA 3IE3A 1XW5A 2H74A 5GZZB 4WBJA 2M80A 2VOCA 4IS0A 4XRDA 2YP6A 2LJKA 5IOXA 1A0RP 3L4NA 4IGJA 4X0XA 1XOAA 2PVQA 1GSSA 3ZFLA 3TUEA 4MH2A 3RPPA 1TOFA 5CNWA 1BEDA 3F0IA 3EC3A 2AUVA 2LKUA 4KNDA 3UVTA 4J56E 4EIQA 1GULA 2F9SA 5GAND 2IWTA 4LMWA 1HQOA 4WKWA 2YV9A 2RM5A 4MF7A 1TTZA 2P5RA 2RIIA 3P2AA 1V2AA 5AIVA 3WGDA 3ZVJA 5IO2A 2A2PA 2C3NA 4K6XA 4EUYA 2H1GA 2C0DA 2R6KA 3NOFA 3HKRA 2R37A 3KM6A 4HUAA 1X9SB 3APSA 2H76A 2A2RA 3QFBC 4OFNA 2I81A 3QR6A 1XVQA 4G0KA 4KSOA 3TJGA 2VCXA 1TK5B 5EPFA 3WD6A 4IN0A 3VWWA 1GTUA 1ABAA 3GIXA 2HZEA 2VM2A 3KD0A 4WR5A 4HU9A 2RM6A 3CTGA 2WULA 2O89A 2I1UA 2H70A 3ED3A 4KCEA 2XPEA 3FK8A 4BVXA 1ZYQB 1CQGA 4PUFC 4YQVA 3Q74A 4PXOA 5BRTA 3ERWA 4IQAA 2KP1A 3TJKA 3ZMLA 3GURA 1PL1A 1OC9A 3IR4A 4F9ZA 1IYHA 3D4MA 2JSYA 1SK1A 1PX6A 2H71A 4HI7A 2IJYA 2H01A 1ML6A 3HCZA 3R3EA 1OAZA 3KTBA 1X0RA 3VWVA 1TRUA 1W4VA 3HXSA 1T7PB 5AISA 4DSSB 1SU9A 4MZBA 1GUHA 3QMXA 4GWRA 3F63A 1Q4JA 4KDXA 3TB2A 3IAS2 2V41A 4G10A 2OBIA 3TKSE 7GSSA 4XRAA 1K3YA 4L0UA 1YEXA 3GMFA 3L9UA 4CHSA 3FRCA 3F4RA 1PQNA 2X64A 3TJJA 4PUAA 2ES7A 1PL2A 3KH7A 4MJBA 2FD3A 3IA1A 2CZ3A 2GTUA 2IFQA 5EY6A 3FZAA 3IRAA 2P31A 2V6OA 2L6CA 3BBYA 2K18A 3PGTA 4ZBAA 1THOA 4JE1A 5IIZA 3K8NA 4K5RA 5ECNB 2FLSA 5HFIA 3VI7A 4YKGA 4PGTA 3N5OA 2LV3A 1GUKA 9GSSA 4K7OA 1FW1A 3I69A 4ZL7A 2FWGA 3J7Yb 2VL2C 2PU9C 4MJAA 5DCHA 3GL3A 2AJQB 4RQRA 3FMWA 4ZB8A 2GS3A 3I6AA 2X49A 4TR0A 1R4WA 3GKNA 1TK0B 2ZNMA 22GSA 3LJRA 2DBCA 1EGOA 2VLVA 2HRKA 5AIXA 3A5IA 4GSTA 1ZGNA 2PERA 3LQ7A 3FEUA 2V1MA 1GTAA 4TKYA 5KN3A 2L6DA 1WRYA 2L4QA 1S3CA 2REMA 4K7NA 3DMLA 3QPMA 4PNGA 1Z7PA 4K9ZA 1TU8A 2LRNA 3PPUA 4NHZA 1TRVA 3ERGA 3GA4A 2XC2A 4G19A 18GSA 1F6MC 2R0GA 17GSA 1F3BA 1K3LA 3IOSA 3M1GA 1SL2B 1QQ2A 3H1NA 1NSWA 2HZEB 3RHBA 5D9XA 4PQIA 1EV9A 2WJUA 2VCTA 4POLA 1OKTA 1M2BA 3CSIA 2TRXA 3GTUA 5JCWA 3SWLA 2HXKA 3U5RE 4N0ZA 5HFKA 4IVFA 5ECIB 1PGTA 2PN8A 1XZOA 2I3YA 1BG5A 2IYJA 4F2IA 2LNTA 3C1RA 1OC9B 1ON4A 2FUG2 1KBNA 3KXOA 1JLWA 3R2QA 2DJ0A 2C0EA 2OA7A 2H8LA 1ERUA 4GCIA 5IM9A 2YNXA 5D9WA 2KLXA 1QGVA 4HJ2A 1CQHA 5IMFA 2GSQA 2OBKA 4MK3A 5JWRB 1FB0A 4O92A 5HFGA 3ZZXA 2H1DA 5HR1A 2VCQA 2QSIA 4MA9A 2WB9A 1SYRA 3HDCA 4TXOA 5KOWA 1GTBA 3W8SA 5ECQB 1GSEA 3J7Yk 2PMTA 3VPTA 1JZOA 3M8NA 3EMPA 2L4CA 2BTOT 3UBKA 5D96A 4IELA 4N0VA 2JZRA 4XS6A 4G0IA 3ZIJA 2QC7A 5J5NA 1BJXA 3KZQA 1SL0B 2GVPA 2PWJA 4YQMA 2TRCP 3ZMKA 1ZL9A 2DC5A 2C80A 4BL7A 2MMAA 3MNGA 1ERWA 4Z2RA 2K6VA 2WS2A 4EKZA 2QA2A 2H6YA 4LL1B 4JU5A 1EP8A 5FWGA 5DAKA 4BPYA 2H75A 2VM1A 3BCKA 4V1Ag 1DE2A 2K9FA 4NV2A 4MF5A 3CTFA 2LJAA 5D73A 1T3BA 1ZMAA 1AC1A 1WOUA 3WT2A 3DRNA 1XW9A 4PQ1A 4QL9A 4USSA 2HNLA 3P8WA 1ZYPA 2QGVA 3GFKA 3EU4A 4ILFA 2B1LA 3GHAA 4YAVA 1OKDA 3L0HA 2KOKA 1XPVA 1TI1A 3DYRA 2IL3A 5J9BA 1Q98A 2R0PA 2CX4A 3CRTA 3PINA 1WPIA 1I9DA 4BWSA 2P5QA 2HYXA 4POKA 4WF5A 2ZUPA 3N9JA 1XFLA 14GSA 3H93A 1GNEA 4JBBA 6GSWA 5CREA 1WJKA 5FT3A 4WETA 3VLNA 3HHVA 2WRTA 3GNJA 2A4HA 2E2MA 4ECBA 1X5DA 1G0TA 1ZOFA 4JR4A 4AJ6A 4X1UA 4YQUA 1YZXA 3MSZA 1GLQA 3GTUB 1EV4A 4AGSA 1EOHA 1U3AA 4EC0A 4V2LA 5ABRA 4G2EA 2NDOA 1YDKA 5F8BA 2OADA 6GSSA 3GSTA 3RPNA 2MZCA 1GNWA 2HLSA 4GXZA 4EDZA 2FWHA 4GQFA 5HQPA 2ZCTA 3VFIA 4BWQA 5DJMA 5CRWA 4HZ4A 1THXA 1F2EA 5ELGA 2AB6A 3F6FA 4HOJA 4O5RA 3TRQA 3DXBA 1M7TA 3DEXA 5DVBA 1MDIA 4P3YB 3KCMA 3WGXA 2H0IA 4XCSA 1GSYA 1V57A 5CRHA 1VF1A 2CVBA 1Y6EA 1WP0A 4TXOB 1OE8A 3TGZA 5JWQB 2CAQA 1OYJA 3F3QA 5AGYA 3L9VA 1AQXA 2EC4A 1A23A 3CYNA 4ZILA 4TN8A 5DQYA 2BMXA 4TR4A 2HT9A 1EP7A 1K0OA 4HJMA 3S9FA 2IIYA 16GSA 1M9BA 1MD4A 2WGRA 1X9MB 4V2NA 4CDOA 3CXGA 2H73A 4BL7B 2CX3A 3I9V2 3Q19A 4KDYA 4PURA 3DGQA 4F82A 1FHEA 2B6MA 2JZSA 1X9WB 5B8AA 2YWIA 3IC4A 5DAKB 3GUSA 1YQ1A 4HDEA 2GZZA 3V1WA 3A2XA 4ZB6A 4NHWA 1USBA 5DJLA 3ZREA 3NIVA 1XXUA 4GQCA 4L5LA 4OFTA 3C1SA 5KN0A 1DSBA 5ECKB 4KAEA 3IK9A 4I8BA 2J23A 4I5QA 3KP9A 2TIRA 5F0GA 1K0NA 4G9HA 5JCUA 2FA4A 3F9UA 3TRXA 3DIEA 2R4VA 4PNFA 3UL3A 2E2GA 3G7YA 4XS4A 2DKIA 2R0CA 4WR4A 4D73A 4ZXGA 4FO5A 2LS5A 1VF2A 3HZ4A 3HJOA 4KB3A 2B5YA 3UMAA 2WCIA 2DJJA 4V2MA 2H0GA 2LEGA 4F0CA 1WE0A 4L8EA 2NBSA 4NAXA 2YZUA 1PA3A 4ZBBA 4K1FA 3IC8A 5IMAA 4L5OA 6GSVA 5D9TA 4KH7A 2H19A 1OC8A 1RQMA 5ECOB 2X8HA 2PUKC 1Z3EA 1R5AA 2MBSA 4OFMA 3P90A 2MMNA 2VD1A 2H30A 20GSA 1SJIA 3GH6A 4ZL8A 2LTKA 2H72A 4KSMA 3O3TA 1JZRA 5KOXA 3LYPA 3UVHA 3WYWA 3GN3A 4MZCA 3FZ9A 2N5BA 3BCIA 1JZWA 3IHGA 3KP8A 1I5GA 5D9VA 4MP4A 5ECSA 2VAFA 4EIPA 1MDKA 5H5QA 2R5GA 1XCCA 2MMZA 2B5XA 3FKFA 1W89A 1GWCA 2IMEA 2VUPA 2N5FA 3TOTA 1X5CA 4DVCA 3EVIA 4O7HA 1YKAA 2EIRA 3CRUA 3DWVA 1ZYEA 2AYTA 2VCWA 1QUWA 3UEMA 5D8IA 4GSNA 5LNKe 1GSUA 1QMVA 3D0ZA 2GGTA 2A4VA 1J9BA 3VWUA 3HA9A 2OKAA 2EIQA 2CVKA 4BVYA 2HSYA 5GSTA 3U6VA 2YCDA 1O8XA 1PRXA 4FH8A 1B48A 1T4YA 2B3SA 3QAGA 5IPHA 4MABA 3QAVA 3ME7A 4MNNA 4HQZA 5GSSA 5ID2A 3Q6OA 3GSSA 1SENA 3QCPA 4AJ7A 2VLTA 1LBKA 4ECJA 3G7IA 2DJ2A 3JCML 4ZIJA 3AY8A 4K0NA 2J9HA 1UC7A 5CRDA 2B5EA 2HFDA 3MYDA 5D93A 3LEFA 1B4QA 3GH9A 1G7OA 2B7JA 1A2LA 3D6IA 2G0FA 3F4TA 5HR3A 3GRXA 3GKKA 1URMA 4EF0A 2DMLA 2WFCA 1AUCA 1R26A 3D21A 4ZBDA 1BQ7A 3ZLPA 1SK0A 3A2VA 1ZYNA 2F51A 4IQ1A 3GL5A 2CQ9A 1FOHA 2VCVA 4XS4B 2JL4A 3E9JB 4D73B 4TW5A 3HZ8A 1O85A 5IMCA 3FW2A 4HS1A 3CMIA 1QK8A 2WDUA 4MZWA 1PN0A 3TKRA 1EWXA 1FAAA 2V6KA 5ECRB 1KTEA 3TCOA 4IW9A 1SKWB 1XWGA 4KA0A 2RUEA 3ZIVA 1BYEA 2VD0A 5A4VA 3KMNA 1OC3A 3BD2A 4IHUA 4EDYA 4QL7A 2O85A 5EL8A 1G6WA 4JEDA 1XBSA 3IDVA 3HD5A 2GSSA 4MF6A 5G1LA 1YKCA 2DJ1A 5BMUA 2YANA 2FWEA 4GRFA 1A2JA 4IP6A 1UVZA 5G2ZA 1JZDA 1UN2A 4MPFA 1SK2A 2LSTA 1JLVA 1M0UA 3D22A 3KGKA 3WT1A 2GDRA 4E8EA 4KX4A 2E7PA 2H6XA 5J4UA 1U3IA 4EXJA 2C4JA 2ON7A 4NV5A 3EMXA 3D5JA 3TJFA 2FWFA 3EYTA 10GSA 4Q5RA 3VK9A 2XHFA 5CAXA 1AAZA 1DE1A 1R5PA 1MTCA 3EURA 2GSRA 3E3EA 1JHBA 3TKPA 1EGRA 3A5WA 2C1YA 2L59A 3M0FA 2K8VA 3NZNA 5IMZA 1TXXA 1LU4A 4BA7A 3ZL5A 3KJYA 2DMMA 3FR9A 1ACVA 4PX1A 3C73A 3HVXA 1RW1A 2O7KA 1DUGA 3FR6A 3HJMA 1FG4A 4KF9A 1G6YA 3H8QA 2X4AA 3VWXA 1SYXA 4ML1A 3QOUA 2GT5A 3HY2A 4KUNA 3ZYWA 3PH9A 4K0GA 2X8GA 3RAZA 4I2TA 2AAWA 2H1AA 2DIYA 4J2FA 1EZKA 5DQSA 2FHEA 3DD3A 2HRNA 1H4OA 1VF4A 2DSAA 4OCFA 4ICYA 4PTSA 4BVYB 4IP1A 2O87A 1YF0A 2UZ8A 2OE3A 6GSUA 1B8XA 4HU7A 3FHKA 4ULXA 4XTSA 4LA1A 2JACA 2M46A 2C3TA 5CO3A 4JZQA 5ID2B 3C71A 3FR3A 3UOMA 4QQ7A 1XIYA 1AW9A 3KEBA 4OCEA 1XVWA 4AF2A 2GSTA 2YJ7A 1H75A 1NM3A 4KGIA 2YWOA 1BX9A 4ML6A 1GLPA 4RI7A 4ZB9A 4I6XA 2FGXA 3UAPA 2MYGA 3IHQA 3Q18A 1FVKA 1BAYA 3F3RA 3IAM2 2CT6A 5H5RA 4KE3A 1B9XC 5KN2A 2GZYA 3HVSA 2MBTA 1U88A 3MAKA 2V2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN1 A;  4YAP A;  4TR3 A;  2H6Z A;  3TKS A;  2XBQ A;  4MPG A;  4WF4 A;  4POM A;  2KUC A;  5ENU A;  2OE1 A;  1GUM A;  4LMV A;  2DLX A;  1XW6 A;  3FZ4 A;  1GSD A;  2IY2 A;  2X99 A;  3TRP A;  5E4W A;  2XBI A;  3O6T A;  1Y25 A;  2X8C A;  2YWM A;  3GV1 A;  5HR2 A;  2ON5 A;  3TOU A;  2GZP A;  1GH2 A;  1ZZY A;  1A0F A;  1K0C A;  2IMK A;  1GP1 A;  2I4A A;  2R2J A;  1OE7 A;  2YZH A;  3KMO A;  2IN3 A;  4IKH A;  2GQK A;  2KP2 A;  3M3M A;  1TRW A;  1SD8 A;  3IV4 A;  1WIK A;  2L5L A;  2VIM A;  2V32 A;  3KTL A;  5INY A;  1JFU A;  1K3O A;  3GYK A;  5J3R A;  1O73 A;  3O76 A;  1F3A A;  2LRT A;  3KIJ A;  4EVM A;  2OE0 A;  3CBU A;  5B6M A;  2QKE A;  1HNC A;  1TK8 B;  1SJ6 A;  1Z6M A;  2LUS A;  3H4K A;  4ISD A;  1A24 A;  3FYG A;  2YOI A;  1HD2 A;  3TDG A;  1WWJ A;  4E8H A;  5LCZ A;  2P0G A;  1MDJ A;  1WMJ A;  3ZIT A;  4GF0 A;  1YF1 A;  5LD0 A;  1MEK A;  1HYU A;  4IBP A;  2JZT A;  4KDU A;  4EL1 A;  5ECM B;  2CV4 A;  5G30 A;  3VI5 A;  3G9B A;  1YJ6 A;  1S3D A;  1OVN A;  4JR6 A;  2CAI A;  3FZ5 A;  2CVD A;  1X5E A;  1PSQ A;  2C0G A;  3BOA A;  1T4Z A;  1K0D A;  3TKS C;  1G7E A;  4X43 A;  1Z5Y E;  4MCU A;  5IMD A;  5A4U A;  4JRR A;  3EU3 A;  1KNG A;  2OAC A;  3ERF A;  2HZF A;  1QFN A;  1QXH A;  4GSS A;  3M9K A;  2FA8 A;  3VPQ A;  3FY7 A;  4WEY A;  2L57 A;  1VRS D;  4OMV A;  5G1K A;  1XWC A;  2VO4 A;  5FHI A;  2JU5 A;  2N5A A;  3GKX A;  1F37 A;  2DJK A;  5COH A;  1AQW A;  4K2D A;  3LOR A;  3MDK A;  2VL2 A;  5J9C A;  3LSZ A;  3DKS A;  4FYC A;  1ERV A;  1Z7R A;  1AIU A;  1XWK A;  4CW9 A;  5EVO A;  4HEA 2;  4F0B A;  2CZ2 A;  1PD2 1;  2YWN A;  1B9Y C;  4NPB A;  2JSZ A;  4IJI A;  2PVO C;  3KH9 A;  3IXR A;  1PKZ A;  1Z6N A;  5G5F A;  1B4P A;  3P7X A;  1ILO A;  3WGE A;  3DVX A;  5IQY A;  3ME8 A;  5B8B A;  3QD9 A;  3I43 A;  4J57 E;  4XIH A;  2H0H A;  5HR0 A;  4L0W A;  3GX0 A;  2HE3 A;  4XS1 A;  2F3M A;  2AV4 A;  2WZ9 A;  3LFL A;  4DEJ A;  3QAW A;  6GST A;  4OD7 A;  5CP1 A;  3G7J A;  4POB A;  2PBJ A;  1EEJ A;  1VF3 A;  1SD9 A;  2LQQ A;  5ELA A;  5B6N A;  2MMO A;  2HRF A;  2XPD A;  5IMV A;  2HSH A;  1K0A A;  2YV7 A;  1O81 A;  2OJL A;  4OO4 A;  3W6G A;  4KW6 A;  2G2Q A;  1TW9 A;  3IBH A;  2LQO A;  3CSH A;  1PN9 A;  1VGL A;  3HYP A;  2FNO A;  1V40 A;  1AQV A;  5F06 A;  5C00 A;  4GLT A;  1M2A A;  2JAD A;  4TRX A;  3UIW A;  13GS A;  1GSQ A;  4RUV A;  2NTO A;  1T00 A;  4TVE A;  4EE0 A;  5KN1 A;  4LL4 B;  1YEP A;  4ACS A;  11GS A;  5DCG A;  3W8J A;  1EOG A;  1YY7 A;  5J41 A;  2VCZ A;  2IMI A;  3CSJ A;  1C72 A;  1TDI A;  3HJP A;  3QFA C;  5IO0 A;  4F03 A;  1N8J A;  4TXV A;  4HZ2 A;  4Q5Q A;  1HNA A;  1SKR B;  1J0F A;  3SBC A;  3C8E A;  1MD3 A;  4HQS A;  5JWO B;  5CYY A;  1FVJ A;  5GAP D;  1K0B A;  3A3T A;  4RI6 A;  2E0Q A;  1J08 A;  5H5S A;  3F4S A;  2RLI A;  1T8E B;  3LG6 A;  1E2Y A;  1O8W A;  3C7M A;  1KEB A;  2YN1 A;  4N11 A;  2IMD A;  1TJD A;  4Q5F A;  1O6J A;  1M9A A;  4H86 A;  1M99 A;  5ECH B;  3F6D A;  3HVV A;  2I9H A;  2GLR A;  1A8Y A;  3EIN A;  1M2D A;  3IK7 A;  1DBY A;  1U6T A;  1NHO A;  5KEJ A;  3ISO A;  3ZRD A;  1XOB A;  2C0F A;  5IOW A;  4TR1 A;  1V9W A;  4NMU A;  2PPT A;  1EEM A;  4KCA A;  3RDW A;  4WXT A;  4Q5N A;  3E0U A;  4MJE A;  4ECC A;  2YJH A;  2FY6 A;  3ZTL A;  2D2Z A;  2VLU A;  2HI7 A;  4AJ8 A;  1IYI A;  3H79 A;  4PQH A;  5DAL A;  2M72 A;  4Z7X A;  3UBL A;  3QDN A;  2LRC A;  4MJC A;  2EIO A;  1V58 A;  1TI3 A;  2H66 A;  3EE2 A;  3L78 A;  2H1B A;  3GKM A;  3IPZ A;  3PR8 A;  3GX8 A;  4I97 A;  5CRG A;  2DIZ A;  5ECP B;  1NW2 A;  5A5K A;  2C8U A;  4V1A p;  4DSQ A;  2IFQ B;  4OO5 A;  3M9J A;  2NPB A;  2IMF A;  1PMT A;  4LLR A;  5B7C A;  3VUR A;  4N10 A;  3APQ A;  2F8F A;  4ZL9 A;  1O7U A;  4MH3 A;  5A4W A;  2GQM A;  4FYU A;  1ST9 A;  1FB6 A;  2L5O A;  5IPG A;  12GS A;  3ZVJ D;  1GSF A;  1E6B A;  4FIW A;  2PGT A;  1UA5 A;  3F8U A;  2B7K A;  1U87 A;  2BJX A;  3LXZ A;  1XWA A;  4IJ3 A;  5C04 A;  3DVW A;  3D4T A;  1A8L A;  2VL3 A;  1GRX A;  2K8S A;  3ZFB A;  4K7I A;  2Z9S A;  4O32 A;  1FO5 A;  2C3Q A;  4MLY A;  3L9S A;  2YPM A;  4RQX A;  2AHE A;  2FCH A;  5E59 A;  4K8M A;  1GL8 A;  1N2A A;  1SJZ A;  1Z9H A;  4GTU A;  4YH2 A;  2ALB A;  1ERT A;  3LWA A;  3APO A;  3LYK A;  4I2U A;  1SKS B;  3RBT A;  1F9M A;  1SL1 B;  5JCG A;  1TRS A;  3BJ5 A;  1NHY A;  1A2M A;  1PKW A;  4ID0 A;  4NWY A;  1TKD B;  1TP9 A;  2IPA A;  2F8A A;  2LJR A;  4DSS A;  1S3A A;  3TKQ A;  1XWB A;  5F05 A;  2CA8 A;  3EWL A;  2VL9 A;  2NVL A;  5G31 A;  3UAR A;  4NXI A;  2GQL A;  5F07 A;  1V98 A;  1RK4 A;  2GT6 A;  1AXD A;  4N30 A;  5DBQ A;  2O8V B;  4XHM A;  5G5E A;  4TOP A;  4MDC A;  8GSS A;  3OR5 A;  1T1V A;  4TR1 B;  4ECI A;  5DDL A;  2KHP A;  1LJR A;  2LNS A;  1HNB A;  6GSX A;  3MWH A;  3TJB A;  4EO3 A;  4WBR D;  2RUF A;  1PX7 A;  5L71 A;  4OWY A;  4FYB A;  2B1K A;  6GSY A;  3LXT A;  1GTI A;  1FOV A;  1TU7 A;  19GS A;  2DJ3 A;  4MMM A;  4DSR A;  3RHC A;  3LGC A;  3UJ1 A;  5ECL B;  1R7H A;  1ZCP A;  5DAL B;  2A2S A;  2R3X A;  3US3 A;  3A2W A;  1K0M A;  3IE3 A;  1XW5 A;  2H74 A;  5GZZ B;  4WBJ A;  2M80 A;  2VOC A;  4IS0 A;  4XRD A;  2YP6 A;  2LJK A;  5IOX A;  1A0R P;  3L4N A;  4IGJ A;  4X0X A;  1XOA A;  2PVQ A;  1GSS A;  3ZFL A;  3TUE A;  4MH2 A;  3RPP A;  1TOF A;  5CNW A;  1BED A;  3F0I A;  3EC3 A;  2AUV A;  2LKU A;  4KND A;  3UVT A;  4J56 E;  1GUL A;  2F9S A;  5GAN D;  2IWT A;  4LMW A;  1HQO A;  4WKW A;  2YV9 A;  2RM5 A;  4MF7 A;  1TTZ A;  2P5R A;  2RII A;  3P2A A;  1V2A A;  5AIV A;  3WGD A;  3ZVJ A;  5IO2 A;  2C3N A;  4K6X A;  4EUY A;  2H1G A;  2C0D A;  2R6K A;  3NOF A;  3HKR A;  2R37 A;  3KM6 A;  4HUA A;  1X9S B;  3APS A;  2H76 A;  2A2R A;  3QFB C;  4OFN A;  2I81 A;  3QR6 A;  1XVQ A;  4KSO A;  3TJG A;  2VCX A;  1TK5 B;  5EPF A;  3WD6 A;  4IN0 A;  3VWW A;  1GTU A;  1ABA A;  3GIX A;  2HZE A;  2VM2 A;  3KD0 A;  4WR5 A;  4HU9 A;  2RM6 A;  3CTG A;  2WUL A;  2O89 A;  2I1U A;  2H70 A;  3ED3 A;  4KCE A;  2XPE A;  3FK8 A;  4BVX A;  1ZYQ B;  1CQG A;  4PUF C;  4YQV A;  3Q74 A;  4PXO A;  3ERW A;  4IQA A;  2KP1 A;  3TJK A;  3ZML A;  3GUR A;  1PL1 A;  1OC9 A;  3IR4 A;  4F9Z A;  1IYH A;  3D4M A;  2JSY A;  1SK1 A;  1PX6 A;  2H71 A;  4HI7 A;  2IJY A;  2H01 A;  1ML6 A;  3HCZ A;  1OAZ A;  3KTB A;  1X0R A;  3VWV A;  1TRU A;  1W4V A;  3HXS A;  1T7P B;  5AIS A;  4DSS B;  1SU9 A;  4MZB A;  1GUH A;  3QMX A;  4GWR A;  3F63 A;  1Q4J A;  4KDX A;  3TB2 A;  3IAS 2;  2V41 A;  4G10 A;  2OBI A;  3TKS E;  7GSS A;  4XRA A;  1K3Y A;  4L0U A;  1YEX A;  3GMF A;  3L9U A;  4CHS A;  3FRC A;  3F4R A;  1PQN A;  2X64 A;  3TJJ A;  4PUA A;  2ES7 A;  1PL2 A;  3KH7 A;  4MJB A;  2FD3 A;  3IA1 A;  2CZ3 A;  2GTU A;  2IFQ A;  5EY6 A;  3FZA A;  3IRA A;  2P31 A;  2V6O A;  2L6C A;  3BBY A;  2K18 A;  3PGT A;  4ZBA A;  1THO A;  4JE1 A;  5IIZ A;  3K8N A;  5ECN B;  2FLS A;  5HFI A;  3VI7 A;  4PGT A;  3N5O A;  2LV3 A;  1GUK A;  9GSS A;  4K7O A;  1FW1 A;  3I69 A;  4ZL7 A;  2FWG A;  3J7Y b;  2VL2 C;  2PU9 C;  4MJA A;  5DCH A;  3GL3 A;  2AJQ B;  4RQR A;  4ZB8 A;  2GS3 A;  3I6A A;  4TR0 A;  1R4W A;  3GKN A;  1TK0 B;  2ZNM A;  22GS A;  3LJR A;  2DBC A;  1EGO A;  2VLV A;  5AIX A;  4GST A;  1ZGN A;  2PER A;  3LQ7 A;  3FEU A;  2V1M A;  1GTA A;  4TKY A;  5KN3 A;  2L6D A;  1WRY A;  2L4Q A;  1S3C A;  2REM A;  4K7N A;  3DML A;  3QPM A;  4PNG A;  1Z7P A;  4K9Z A;  1TU8 A;  2LRN A;  4NHZ A;  1TRV A;  3ERG A;  3GA4 A;  2XC2 A;  4G19 A;  18GS A;  1F6M C;  17GS A;  1F3B A;  1K3L A;  3IOS A;  3M1G A;  1SL2 B;  1QQ2 A;  3H1N A;  1NSW A;  2HZE B;  3RHB A;  5D9X A;  4PQI A;  1EV9 A;  2WJU A;  2VCT A;  4POL A;  1OKT A;  1M2B A;  3CSI A;  2TRX A;  3GTU A;  5JCW A;  3SWL A;  2HXK A;  3U5R E;  4N0Z A;  5HFK A;  4IVF A;  5ECI B;  1PGT A;  2PN8 A;  1XZO A;  2I3Y A;  1BG5 A;  2IYJ A;  4F2I A;  2LNT A;  3C1R A;  1OC9 B;  1ON4 A;  2FUG 2;  1KBN A;  3KXO A;  1JLW A;  3R2Q A;  2DJ0 A;  2C0E A;  2OA7 A;  2H8L A;  1ERU A;  4GCI A;  5IM9 A;  2YNX A;  5D9W A;  2KLX A;  1QGV A;  4HJ2 A;  1CQH A;  5IMF A;  2GSQ A;  2OBK A;  4MK3 A;  5JWR B;  1FB0 A;  4O92 A;  5HFG A;  3ZZX A;  2H1D A;  5HR1 A;  2VCQ A;  2QSI A;  4MA9 A;  2WB9 A;  1SYR A;  3HDC A;  4TXO A;  1GTB A;  3W8S A;  5ECQ B;  1GSE A;  3J7Y k;  2PMT A;  3VPT A;  1JZO A;  3M8N A;  3EMP A;  2L4C A;  2BTO T;  3UBK A;  5D96 A;  4IEL A;  4N0V A;  2JZR A;  4XS6 A;  3ZIJ A;  2QC7 A;  5J5N A;  1BJX A;  3KZQ A;  1SL0 B;  2GVP A;  2PWJ A;  4YQM A;  2TRC P;  3ZMK A;  1ZL9 A;  2DC5 A;  2C80 A;  4BL7 A;  2MMA A;  3MNG A;  1ERW A;  2K6V A;  2WS2 A;  4EKZ A;  2H6Y A;  4LL1 B;  4JU5 A;  1EP8 A;  5FWG A;  5DAK A;  4BPY A;  2H75 A;  2VM1 A;  3BCK A;  4V1A g;  1DE2 A;  2K9F A;  4NV2 A;  4MF5 A;  3CTF A;  2LJA A;  5D73 A;  1T3B A;  1ZMA A;  1AC1 A;  1WOU A;  3WT2 A;  3DRN A;  1XW9 A;  4PQ1 A;  4QL9 A;  2HNL A;  3P8W A;  2QGV A;  3GFK A;  3EU4 A;  4ILF A;  2B1L A;  3GHA A;  4YAV A;  1OKD A;  3L0H A;  2KOK A;  1XPV A;  1TI1 A;  3DYR A;  2IL3 A;  5J9B A;  1Q98 A;  2CX4 A;  3CRT A;  3PIN A;  1WPI A;  1I9D A;  4BWS A;  2P5Q A;  2HYX A;  4POK A;  4WF5 A;  2ZUP A;  3N9J A;  1XFL A;  14GS A;  3H93 A;  1GNE A;  4JBB A;  6GSW A;  5CRE A;  1WJK A;  5FT3 A;  4WET A;  3VLN A;  3HHV A;  2WRT A;  3GNJ A;  2E2M A;  4ECB A;  1X5D A;  1G0T A;  1ZOF A;  4JR4 A;  4AJ6 A;  4X1U A;  4YQU A;  1YZX A;  3MSZ A;  1GLQ A;  3GTU B;  1EV4 A;  4AGS A;  1EOH A;  1U3A A;  4EC0 A;  4V2L A;  5ABR A;  4G2E A;  2NDO A;  1YDK A;  5F8B A;  2OAD A;  6GSS A;  3GST A;  3RPN A;  2MZC A;  1GNW A;  2HLS A;  4GXZ A;  4EDZ A;  2FWH A;  4GQF A;  5HQP A;  2ZCT A;  3VFI A;  4BWQ A;  5DJM A;  5CRW A;  4HZ4 A;  1THX A;  1F2E A;  5ELG A;  2AB6 A;  3F6F A;  4HOJ A;  4O5R A;  3TRQ A;  3DXB A;  1M7T A;  3DEX A;  5DVB A;  1MDI A;  4P3Y B;  3KCM A;  3WGX A;  2H0I A;  4XCS A;  1GSY A;  1V57 A;  5CRH A;  1VF1 A;  2CVB A;  1Y6E A;  1WP0 A;  4TXO B;  1OE8 A;  3TGZ A;  5JWQ B;  2CAQ A;  1OYJ A;  3F3Q A;  5AGY A;  3L9V A;  1AQX A;  2EC4 A;  1A23 A;  3CYN A;  4ZIL A;  4TN8 A;  5DQY A;  2BMX A;  4TR4 A;  2HT9 A;  1EP7 A;  1K0O A;  4HJM A;  3S9F A;  2IIY A;  16GS A;  1M9B A;  1MD4 A;  2WGR A;  1X9M B;  4V2N A;  4CDO A;  3CXG A;  2H73 A;  2CX3 A;  3I9V 2;  3Q19 A;  4KDY A;  4PUR A;  3DGQ A;  4F82 A;  1FHE A;  2B6M A;  2JZS A;  1X9W B;  5B8A A;  2YWI A;  3IC4 A;  5DAK B;  3GUS A;  1YQ1 A;  4HDE A;  2GZZ A;  3V1W A;  3A2X A;  4ZB6 A;  4NHW A;  1USB A;  5DJL A;  3ZRE A;  3NIV A;  1XXU A;  4GQC A;  4L5L A;  4OFT A;  3C1S A;  5KN0 A;  1DSB A;  5ECK B;  4KAE A;  3IK9 A;  4I8B A;  2J23 A;  4I5Q A;  3KP9 A;  2TIR A;  5F0G A;  1K0N A;  4G9H A;  5JCU A;  2FA4 A;  3F9U A;  3TRX A;  3DIE A;  2R4V A;  4PNF A;  3UL3 A;  2E2G A;  3G7Y A;  4XS4 A;  4WR4 A;  4D73 A;  4ZXG A;  4FO5 A;  2LS5 A;  1VF2 A;  3HZ4 A;  3HJO A;  4KB3 A;  2B5Y A;  3UMA A;  2WCI A;  2DJJ A;  4V2M A;  2H0G A;  2LEG A;  4F0C A;  1WE0 A;  4L8E A;  2NBS A;  4NAX A;  2YZU A;  1PA3 A;  4ZBB A;  4K1F A;  5IMA A;  4L5O A;  6GSV A;  5D9T A;  4KH7 A;  2H19 A;  1OC8 A;  1RQM A;  5ECO B;  2X8H A;  2PUK C;  1Z3E A;  1R5A A;  2MBS A;  4OFM A;  3P90 A;  2MMN A;  2VD1 A;  2H30 A;  20GS A;  1SJI A;  3GH6 A;  4ZL8 A;  2LTK A;  2H72 A;  4KSM A;  3O3T A;  1JZR A;  3LYP A;  3UVH A;  3WYW A;  3GN3 A;  4MZC A;  3FZ9 A;  2N5B A;  3BCI A;  1JZW A;  3KP8 A;  1I5G A;  5D9V A;  4MP4 A;  5ECS A;  2VAF A;  1MDK A;  5H5Q A;  2R5G A;  1XCC A;  2MMZ A;  2B5X A;  3FKF A;  1W89 A;  1GWC A;  2IME A;  2VUP A;  2N5F A;  3TOT A;  1X5C A;  4DVC A;  3EVI A;  4O7H A;  1YKA A;  2EIR A;  3CRU A;  3DWV A;  1ZYE A;  2AYT A;  2VCW A;  1QUW A;  3UEM A;  5D8I A;  4GSN A;  5LNK e;  1GSU A;  1QMV A;  3D0Z A;  2GGT A;  2A4V A;  1J9B A;  3VWU A;  3HA9 A;  2OKA A;  2EIQ A;  2CVK A;  4BVY A;  2HSY A;  5GST A;  3U6V A;  2YCD A;  1O8X A;  1PRX A;  4FH8 A;  1B48 A;  1T4Y A;  2B3S A;  3QAG A;  5IPH A;  4MAB A;  3QAV A;  3ME7 A;  4HQZ A;  5GSS A;  5ID2 A;  3Q6O A;  3GSS A;  1SEN A;  3QCP A;  4AJ7 A;  2VLT A;  1LBK A;  4ECJ A;  3G7I A;  2DJ2 A;  3JCM L;  4ZIJ A;  3AY8 A;  4K0N A;  2J9H A;  1UC7 A;  5CRD A;  2B5E A;  2HFD A;  5D93 A;  3LEF A;  1B4Q A;  3GH9 A;  1G7O A;  2B7J A;  1A2L A;  3D6I A;  2G0F A;  3F4T A;  5HR3 A;  3GRX A;  3GKK A;  1URM A;  4EF0 A;  2DML A;  2WFC A;  1AUC A;  1R26 A;  3D21 A;  4ZBD A;  1BQ7 A;  3ZLP A;  1SK0 A;  3A2V A;  2F51 A;  4IQ1 A;  3GL5 A;  2CQ9 A;  2VCV A;  4XS4 B;  2JL4 A;  3E9J B;  4D73 B;  4TW5 A;  3HZ8 A;  1O85 A;  5IMC A;  3FW2 A;  4HS1 A;  3CMI A;  1QK8 A;  2WDU A;  4MZW A;  3TKR A;  1EWX A;  1FAA A;  2V6K A;  5ECR B;  1KTE A;  3TCO A;  4IW9 A;  1SKW B;  1XWG A;  4KA0 A;  2RUE A;  3ZIV A;  1BYE A;  2VD0 A;  5A4V A;  3KMN A;  1OC3 A;  3BD2 A;  4IHU A;  4EDY A;  4QL7 A;  2O85 A;  5EL8 A;  1G6W A;  4JED A;  1XBS A;  3IDV A;  3HD5 A;  2GSS A;  4MF6 A;  5G1L A;  1YKC A;  2DJ1 A;  2YAN A;  2FWE A;  4GRF A;  1A2J A;  4IP6 A;  1UVZ A;  5G2Z A;  1JZD A;  1UN2 A;  4MPF A;  1SK2 A;  2LST A;  1JLV A;  1M0U A;  3D22 A;  3KGK A;  3WT1 A;  2GDR A;  4E8E A;  4KX4 A;  2E7P A;  2H6X A;  5J4U A;  1U3I A;  4EXJ A;  2C4J A;  2ON7 A;  4NV5 A;  3EMX A;  3D5J A;  3TJF A;  2FWF A;  3EYT A;  10GS A;  4Q5R A;  3VK9 A;  2XHF A;  5CAX A;  1AAZ A;  1DE1 A;  1R5P A;  1MTC A;  3EUR A;  2GSR A;  3E3E A;  1JHB A;  3TKP A;  1EGR A;  3A5W A;  2C1Y A;  2L59 A;  3M0F A;  2K8V A;  3NZN A;  5IMZ A;  1TXX A;  1LU4 A;  4BA7 A;  3ZL5 A;  3KJY A;  2DMM A;  3FR9 A;  1ACV A;  4PX1 A;  3C73 A;  3HVX A;  1RW1 A;  2O7K A;  1DUG A;  3FR6 A;  3HJM A;  1FG4 A;  1G6Y A;  3H8Q A;  3VWX A;  1SYX A;  4ML1 A;  3QOU A;  2GT5 A;  3HY2 A;  4KUN A;  3ZYW A;  3PH9 A;  4K0G A;  2X8G A;  3RAZ A;  4I2T A;  2AAW A;  2H1A A;  2DIY A;  4J2F A;  1EZK A;  5DQS A;  2FHE A;  3DD3 A;  2HRN A;  1H4O A;  1VF4 A;  2DSA A;  4OCF A;  4IP1 A;  2O87 A;  1YF0 A;  2OE3 A;  6GSU A;  1B8X A;  4HU7 A;  3FHK A;  4ULX A;  4XTS A;  4LA1 A;  2JAC A;  2M46 A;  2C3T A;  5CO3 A;  4JZQ A;  5ID2 B;  3C71 A;  3FR3 A;  3UOM A;  4QQ7 A;  1XIY A;  1AW9 A;  3KEB A;  4OCE A;  1XVW A;  4AF2 A;  2GST A;  2YJ7 A;  1H75 A;  1NM3 A;  4KGI A;  2YWO A;  1BX9 A;  4ML6 A;  1GLP A;  4RI7 A;  4ZB9 A;  4I6X A;  2FGX A;  3UAP A;  2MYG A;  3IHQ A;  3Q18 A;  1FVK A;  1BAY A;  3F3R A;  3IAM 2;  2CT6 A;  5H5R A;  4KE3 A;  1B9X C;  5KN2 A;  2GZY A;  3HVS A;  2MBT A;  1U88 A;  3MAK A;  2V2G A; 
#chains in the Genus database with same CATH topology
 2KF5 A;  3F40 A;  3NUV A;  2OCT A;  5AN1 A;  4YAP A;  2DKH A;  4TR3 A;  4FQU A;  2ML5 A;  3S29 A;  2H6Z A;  3TKS A;  2ZDJ A;  2XBQ A;  4MPG A;  4WF4 A;  1RRL A;  3LZA A;  6GSP A;  4POM A;  2KUC A;  1FUS A;  5ENU A;  5LC6 A;  3LML A;  2OE1 A;  1GUM A;  4LMV A;  1RGH A;  1HZ1 A;  2RFR A;  2DLX A;  5CF1 A;  4BTX A;  1XW6 A;  3FZ4 A;  1GSD A;  3MYT A;  2IY2 A;  2X99 A;  3TRP A;  1M9G A;  5E4W A;  1GMQ A;  2JQ5 A;  1JB2 A;  3DUK A;  2XBI A;  3O6T A;  1Y25 A;  2X8C A;  2YWM A;  3GV1 A;  5HR2 A;  2ON5 A;  3TOU A;  2GZP A;  1SII A;  4HM3 B;  1GH2 A;  1BRJ A;  1RSN A;  1ZZY A;  1A0F A;  1RRH A;  5IG3 A;  1K0C A;  1MWS A;  2IMK A;  1UGH I;  1GP1 A;  2I4A A;  2R2J A;  1OE7 A;  1Q86 4;  1E3R A;  2YZH A;  3FLJ A;  3KMO A;  2IN3 A;  2E2U A;  4IKH A;  2GQK A;  1EA2 A;  1OGZ A;  3UL6 A;  2KP2 A;  3M3M A;  1TRW A;  3CPO A;  1SD8 A;  3IV4 A;  1WIK A;  1Q42 A;  2L5L A;  2VIM A;  2V32 A;  3KTL A;  5INY A;  1JFU A;  3LTA A;  1K3O A;  3GYK A;  5J3R A;  1TP6 A;  1O73 A;  1KC8 4;  3O76 A;  1F3A A;  5IG4 A;  2FXT A;  1I70 A;  3BLZ A;  2LRT A;  3KIJ A;  4EVM A;  2OE0 A;  3CBU A;  1LOV A;  5B6M A;  4L8O A;  5D81 A;  2QKE A;  1W02 A;  1FYS A;  1NO3 A;  1HNC A;  3D5G A;  1SJ6 A;  1Z6M A;  1TK8 B;  2LUS A;  1VZZ A;  3H4K A;  4ISD A;  2CWU A;  4EXR A;  1A24 A;  1FUW A;  3FYG A;  5BVB A;  2YOI A;  4HVN A;  3TDG A;  1HKX A;  1HD2 A;  1WWJ A;  3CCU 3;  4E8H A;  5LCZ A;  4KT3 B;  2ZA4 A;  1MDJ A;  2P0G A;  1WMJ A;  3ZIT A;  4GF0 A;  3CME 3;  1YF1 A;  5LD0 A;  1MEK A;  1HYU A;  4IBP A;  2JZT A;  4KDU A;  4EL1 A;  5ECM B;  2L4V A;  2KXG A;  2CV4 A;  5G30 A;  4WHA A;  3VI5 A;  3G9B A;  1YJ6 A;  1S3D A;  1OVN A;  4JR6 A;  3MPH A;  2CAI A;  3FZ5 A;  2CVD A;  3LTD A;  2QA1 A;  1E3V A;  1X5E A;  1PSQ A;  4EW5 A;  2C0G A;  1O7W B;  3BOA A;  1T4Z A;  1K0D A;  3TKS C;  1G7E A;  4X43 A;  1Z5Y E;  3CCE 3;  4MCU A;  3FZW A;  1RCK A;  5IMD A;  2AAE A;  4JRR A;  3EU3 A;  5A4U A;  1YI2 3;  1N5P A;  1FA3 A;  5AIG A;  1KNG A;  2OAC A;  3ERF A;  1D6Y A;  2HZF A;  1CQS A;  3KSP A;  1QFN A;  1QXH A;  1KWI A;  4FMB A;  3CCS 3;  4GSS A;  1DVD A;  3CQF A;  3NBB A;  3M9K A;  2OOV A;  3JUQ A;  3UNL A;  2FA8 A;  3NHX A;  3VPQ A;  1BNF A;  3FY7 A;  4L7K A;  2BIR A;  4WEY A;  2L57 A;  1VRS D;  4OMV A;  1LQM B;  5G1K A;  1XWC A;  3G0K A;  2VO4 A;  5FHI A;  2JU5 A;  2N5A A;  3GKX A;  1F37 A;  1Q9E A;  2DJK A;  5COH A;  2UGI A;  1K41 A;  1LOX A;  3NM7 A;  1AQW A;  4K2D A;  4XDV A;  5CK6 A;  3LOR A;  3EHC A;  3MDK A;  1ULJ B;  2VL2 A;  5J9C A;  4X4J A;  3LSZ A;  1MNL A;  1X1W A;  3DKS A;  4FYC A;  3K9M C;  1ERV A;  1Z7R A;  1AIU A;  1XWK A;  4CW9 A;  5EVO A;  4HEA 2;  4F0B A;  2CZ2 A;  4K5S A;  5HOH A;  1B27 A;  2YX9 A;  1PD2 1;  4N3V A;  4NRE A;  2YWN A;  1B9Y C;  2P05 A;  4NPB A;  3HI7 A;  3BNC A;  2JSZ A;  2BMR B;  4IJI A;  2PVO C;  3KH9 A;  3IXR A;  1PKZ A;  1BNI A;  5IF6 A;  1M1X B;  1Z6N A;  4KFF A;  5G5F A;  1JBR A;  1B4P A;  3P7X A;  4O5U A;  1ILO A;  3WGE A;  3WA3 A;  3DVX A;  5IQY A;  3ME8 A;  1RMS A;  5B8B A;  2PZV A;  3AHW A;  2RGQ A;  3CCJ 3;  3QD9 A;  3X3Y A;  2BO9 B;  3I43 A;  3EX9 A;  4J57 E;  4XIH A;  3OWU A;  2H0H A;  5HR0 A;  4L0W A;  5CLK A;  3KE7 A;  1SIH A;  3GX0 A;  2HE3 A;  1YGW A;  4XS1 A;  2F3M A;  2AV4 A;  2WZ9 A;  2KF3 A;  3LFL A;  3LTB A;  1IVW A;  4DEJ A;  3QAW A;  4N6M A;  2GXF A;  4HZB B;  6GST A;  4OD7 A;  4GHO A;  4XBT A;  5CP1 A;  3G7J A;  4POB A;  2RNT A;  2PBJ A;  1EEJ A;  1VF3 A;  4EYC A;  1CYU A;  1SD9 A;  2LQQ A;  5ELA A;  5B6N A;  2MMO A;  2HRF A;  2XPD A;  1BAN A;  3S67 A;  5IMV A;  2HSH A;  1K0A A;  2YV7 A;  1O81 A;  2OJL A;  4OO4 A;  3W6G A;  4KW6 A;  2G2Q A;  1TW9 A;  3IBH A;  2LQO A;  3CSH A;  1PN9 A;  1DVC A;  1QVG 2;  3BNE A;  1VGL A;  3HYP A;  3DGM A;  2FNO A;  1V40 A;  1AQV A;  3PS8 A;  4O5Q A;  5F06 A;  4GLT A;  5C00 A;  1M2A A;  2JAD A;  4TRX A;  3UIW A;  13GS A;  1GSQ A;  4RUV A;  5KP1 A;  2NTO A;  1T00 A;  2CHC A;  4TVE A;  1BNJ A;  4EE0 A;  5KN1 A;  4LL4 B;  2CH9 A;  1YEP A;  4ACS A;  11GS A;  5DCG A;  2STD A;  1O7G B;  1DET A;  3OX9 A;  3W8J A;  4WYK A;  1GOU A;  1TTO A;  2BMQ B;  1EOG A;  1YY7 A;  4JF8 A;  1YJ9 3;  5J41 A;  2VCZ A;  1K28 A;  2IMI A;  1PU4 A;  3CSJ A;  1C72 A;  3GZB A;  1JNQ A;  1TDI A;  3S28 A;  3HJP A;  4FCJ A;  3QFA C;  5IO0 A;  4F03 A;  1N8J A;  4TXV A;  4HZ2 A;  4Q5Q A;  1HNA A;  1SKR B;  1J0F A;  2CG1 A;  3F9S A;  2IUK A;  3M8C A;  3X40 A;  3C8E A;  3SBC A;  2QEX 3;  1MD3 A;  2M7O A;  1GS3 A;  4HQS A;  5JWO B;  4Z2T A;  5CYY A;  3LW9 A;  1FVJ A;  5GAP D;  4Q53 A;  3GZR A;  1K0B A;  3A3T A;  3SOA A;  4RI6 A;  2E0Q A;  1J08 A;  5H5S A;  2P0M A;  3HVN A;  4XM4 A;  3F4S A;  3B8L A;  1MWT A;  2RLI A;  3CC7 3;  3BIR A;  3Q3F A;  1IDP A;  3X42 A;  2R41 A;  1T8E B;  3LG6 A;  1E2Y A;  1O8W A;  3C7M A;  1KEB A;  2YN1 A;  4N11 A;  2IMD A;  4MMY B;  1TJD A;  4Q5F A;  3DMC A;  1O6J A;  1M9A A;  2CFW A;  4H86 A;  2RBI A;  1M99 A;  5ECH B;  1GOY A;  4JRF A;  3F6D A;  4K1U A;  3HVV A;  2I9H A;  3F8X A;  2GLR A;  1I0X A;  1A8Y A;  2O3O A;  3EIN A;  1M2D A;  3IK7 A;  1EG9 B;  2D1W A;  1DBY A;  1U6T A;  2OQE A;  3UL5 A;  1M3I A;  1NHO A;  4BVX B;  5KEJ A;  3ISO A;  1LXE A;  1BRS A;  3EPT A;  3ZRD A;  1XOB A;  3D4A A;  2ZHX B;  2C0F A;  1YIJ 3;  4MMX B;  1IVU A;  5IOW A;  4TR1 A;  1OPY A;  4XBY A;  1V9W A;  4NMU A;  2PPT A;  1RKY A;  1EEM A;  4IPB A;  4KCA A;  3RDW A;  3HX8 A;  4WXT A;  4Q5N A;  3E0U A;  4MJE A;  4HYZ A;  4ECC A;  1LRA A;  2YJH A;  2FY6 A;  3EBY A;  3ZTL A;  2D2Z A;  1IK3 A;  3IMA B;  2VLU A;  2HI7 A;  4AJ8 A;  1IYI A;  3H79 A;  4PQH A;  5DAL A;  2M72 A;  4Z7X A;  3UBL A;  1W6G A;  4ORL A;  3QDN A;  5JBS A;  2LRC A;  4MJC A;  2EIO A;  1V58 A;  1AQZ A;  3G4S 3;  1TI3 A;  2H66 A;  3EE2 A;  4G0L A;  4XBX A;  3L78 A;  3KZT A;  2H1B A;  3GKM A;  1RJO A;  4Z2U A;  4N6V 0;  1A67 A;  3IPZ A;  3PR8 A;  3V92 A;  3GX8 A;  4I97 A;  5CRG A;  1ASK A;  3WOE B;  2DIZ A;  5ECP B;  1NW2 A;  3GZY B;  3B4P A;  5A5K A;  3OWS A;  2C8U A;  2CC3 A;  4V1A p;  1PYL A;  4R9L A;  1WQL B;  4DSQ A;  2OTL 3;  2J8X B;  2IFQ B;  4OO5 A;  3MIX A;  3DY5 A;  3M9J A;  1WNH A;  2NPB A;  2IMF A;  1PMT A;  5EEO A;  4A5P A;  4LLR A;  5B7C A;  3VUR A;  1CH0 A;  3OV4 A;  4N10 A;  2CFL A;  1YGE A;  1ZO2 A;  3APQ A;  2F8F A;  4ZL9 A;  1TRQ A;  4CY8 A;  1O7U A;  1RNB A;  4MH3 A;  5A4W A;  2GQM A;  7RNT A;  1FGQ A;  5AIH A;  4FYU A;  3CNX A;  2W56 A;  1FB6 A;  1ST9 A;  4YKF A;  4N6L A;  2L5O A;  5IPG A;  5AI1 A;  12GS A;  3ZVJ D;  1GSF A;  1E6B A;  1OAC A;  4FIW A;  2PGT A;  1UA5 A;  1STF I;  3F8U A;  2K0M A;  4EBG A;  2B7K A;  1B20 A;  1U87 A;  1HU9 A;  2BJX A;  4O8S A;  4LZI A;  4K2X A;  3LXZ A;  1RN4 A;  5JPP A;  1XWA A;  4IJ3 A;  5C04 A;  4PEJ A;  3RDE A;  5RNT A;  3DVW A;  3D4T A;  1A8L A;  2VL3 A;  1GRX A;  2K8S A;  3ZFB A;  4K7I A;  2Z9S A;  4O32 A;  1BIR A;  1FO5 A;  2C3Q A;  4MLY A;  3L9S A;  2Q07 A;  4K90 B;  2GEX A;  2YPM A;  2INX A;  4RQX A;  1W6Y A;  2AHE A;  2FCH A;  8RNT A;  1GY7 A;  2Z6B A;  5E59 A;  2HMN B;  4K8M A;  1GL8 A;  4KFE A;  1N2A A;  1SJZ A;  1Z9H A;  1BSC A;  4GTU A;  4YH2 A;  2WGQ A;  2ALB A;  3X3Z A;  1ERT A;  4H61 A;  3LWA A;  3APO A;  1D6Z A;  3VGN A;  3LYK A;  4I2U A;  3AHS A;  2D42 A;  3T8N A;  3GZX B;  4MEI A;  3CCQ 3;  1I3I A;  3RBT A;  1F9M A;  1SKS B;  1SL1 B;  2GSP A;  3DH2 A;  4J8T A;  5JCG A;  4FMA A;  1TRS A;  1B2X A;  3CPW 2;  3BJ5 A;  1Q40 A;  1NHY A;  1A2M A;  1PKW A;  4ID0 A;  3BNB A;  4NWY A;  3AGN A;  3PCR A;  1M3J A;  5LC7 A;  1S72 3;  1TP9 A;  1JKG A;  2F8A A;  2IPA A;  1TKD B;  2LJR A;  4DSS A;  1S3A A;  3UJM A;  2WGO A;  3TKQ A;  1TU5 A;  1BUJ A;  1XWB A;  1X1U A;  5F05 A;  4HM4 B;  1VQ5 3;  2CA8 A;  3EWL A;  2VL9 A;  2NVL A;  3EJV A;  5G31 A;  5A0O B;  3UAR A;  2HRA A;  4NXI A;  2GQL A;  2CX1 A;  3Q90 A;  5F07 A;  1V98 A;  1RK4 A;  2GT6 A;  1AXD A;  3EC9 A;  2HSM A;  4N30 A;  5DBQ A;  2O8V B;  4XHM A;  3D79 A;  1WMN A;  3FCS B;  5G5E A;  2CFK A;  4TOP A;  1OF5 A;  1UUG B;  4RBN A;  4MDC A;  8GSS A;  1BNS A;  3OR5 A;  1AR0 A;  3T0U A;  3ZG0 A;  1T1V A;  2P38 A;  4TR1 B;  4ECI A;  5DDL A;  2KHP A;  1LJR A;  2LNS A;  4N6N B;  3SOY A;  1HNB A;  3G16 A;  2GBX B;  3MWH A;  6GSX A;  4CY6 A;  2BHM A;  3TJB A;  4EO3 A;  4WBR D;  4LEH A;  2RUF A;  2CFD A;  1PX7 A;  2Z7A A;  1IVX A;  5L71 A;  4OWY A;  4FYB A;  1VQK 3;  1SQW A;  1L5G B;  2B1K A;  6GSY A;  3LXT A;  5BXQ A;  1GTI A;  3K7C A;  3WOD G;  2E2T A;  1TU7 A;  1K9M 4;  1FOV A;  19GS A;  2DJ3 A;  1YVB I;  5AII A;  4MMM A;  4DSR A;  3RHC A;  3LGC A;  3UJ1 A;  5ECL B;  1UDI I;  1QAL A;  1O7P B;  1R7H A;  1ZCP A;  5DAL B;  2A2S A;  2R3X A;  3US3 A;  3A2W A;  1K0M A;  3SX1 A;  3IE3 A;  1XW5 A;  2H74 A;  1B2Z A;  4WBJ A;  5GZZ B;  2M80 A;  3WOF B;  2VOC A;  4IS0 A;  4XRD A;  1MGR A;  2YP6 A;  2IA7 A;  3PCS A;  2LJK A;  1A0R P;  5IOX A;  3QK9 A;  3L4N A;  4IGJ A;  5AIF A;  3A76 A;  3X3X A;  4X0X A;  1W6C A;  1XOA A;  2PVQ A;  2KAA A;  1GSS A;  3ZFL A;  3TUE A;  3CNM A;  4MH2 A;  4FCZ A;  3RPP A;  1TOF A;  5CNW A;  1BED A;  3F0I A;  3EC3 A;  1RN1 A;  5KP3 A;  2AUV A;  5I97 A;  2LKU A;  4KND A;  3UVT A;  4J56 E;  4EIQ A;  1Q82 4;  1U8C B;  1GUL A;  2F9S A;  1I8V A;  1R4Y A;  1B2M A;  5GAN D;  2ML6 A;  2IWT A;  4LMW A;  2BMO B;  1HQO A;  4WKW A;  1RNT A;  1Z1S A;  2FGT A;  2YV9 A;  2RM5 A;  4MF7 A;  3SLU A;  2GU3 A;  1TTZ A;  3BB9 A;  3KSE D;  2P5R A;  4K61 A;  5M1A A;  2RII A;  3P2A A;  7GSP A;  1V2A A;  5AIV A;  3WGD A;  2W56 B;  2PNC A;  3ZVJ A;  2A2P A;  5IO2 A;  3AGO A;  2C3N A;  4K6X A;  4EUY A;  2H1G A;  2C0D A;  4BTY A;  1FW7 A;  2R6K A;  4HOH A;  3NOF A;  1GSP A;  3HKR A;  1R4C A;  2R37 A;  1RGK A;  3KM6 A;  4HUA A;  1X9S B;  1FZU A;  2F86 B;  3APS A;  2H76 A;  1LVN A;  2LYX A;  2A2R A;  3QFB C;  3OXA A;  4OFN A;  2I81 A;  3QR6 A;  1XVQ A;  4O2H A;  4G0K A;  4KSO A;  4XDW A;  3TJG A;  2VCX A;  1TK5 B;  5EPF A;  3UB1 A;  3WD6 A;  1BRG A;  5JPU A;  1JV2 B;  4IN0 A;  3VWW A;  1GTU A;  1ABA A;  3GIX A;  2HZE A;  2VM2 A;  1DMM A;  3KD0 A;  4WR5 A;  4HU9 A;  3NM2 A;  2RM6 A;  2A15 A;  2WUL A;  3LT9 A;  3CTG A;  2CKF B;  2O89 A;  2I1U A;  2H70 A;  3ED3 A;  4KCE A;  4IT7 A;  4EV2 A;  2XPE A;  1GD4 A;  3FK8 A;  4BVX A;  1ZYQ B;  1CQG A;  4PUF C;  4YQV A;  3Q74 A;  4PXO A;  2Z76 A;  5BRT A;  3ERW A;  4IQA A;  2KF4 A;  1LOW A;  4HM6 B;  2KP1 A;  4GB5 A;  3TJK A;  4LYL B;  3ZML A;  3GUR A;  1IQY A;  1PL1 A;  1SPU A;  1JBS A;  1OC9 A;  3IR4 A;  4F9Z A;  1IYH A;  3D4M A;  1FUT A;  2F98 A;  2JSY A;  1SK1 A;  1PX6 A;  3RGA A;  1UI8 A;  2H71 A;  4HI7 A;  1JBT A;  2H01 A;  2IJY A;  1ML6 A;  3HCZ A;  1Q40 B;  3R3E A;  1OAZ A;  3KTB A;  1X0R A;  3VWV A;  3D3L A;  1TRU A;  1I2F A;  1JKG B;  1W4V A;  3HXS A;  1T7P B;  5AIS A;  4DSS B;  4R9K A;  1SU9 A;  4MZB A;  1GUH A;  3QMX A;  4GWR A;  3F63 A;  1Q4J A;  4KDX A;  3TB2 A;  3IAS 2;  2B24 B;  1W4N A;  2V41 A;  5TGN A;  4G10 A;  3FF0 A;  2OBI A;  3TKS E;  1RGL A;  1I3F A;  4LSO A;  3WMD A;  5G2G A;  4L8P A;  7GSS A;  4XRA A;  1K3Y A;  4L0U A;  1YEX A;  3GMF A;  3L9U A;  4CHS A;  3FRC A;  3F4R A;  3STD A;  1PQN A;  4OVM A;  1IU7 A;  4HM0 B;  2X64 A;  3TJJ A;  4PUA A;  2ES7 A;  1PL2 A;  4H3U A;  3KH7 A;  4MJB A;  3FF2 A;  2XSH B;  1PFO A;  2FD3 A;  1OF5 B;  3IA1 A;  2CZ3 A;  1ZX2 A;  2GTU A;  2IFQ A;  5EY6 A;  1VQ9 3;  1IVV A;  3FZA A;  3IRA A;  2P31 A;  1UCI A;  2V6O A;  2L6C A;  4LGQ A;  2HMK B;  4DKI A;  3BBY A;  2K18 A;  3NBJ A;  3GAX A;  7STD A;  3CMA 3;  3PGT A;  4ZBA A;  1W00 A;  2OOV C;  3ER7 A;  1TFK A;  1THO A;  4JE1 A;  1NNV A;  3N8B A;  2HOH A;  2WOF A;  5IIZ A;  3MG1 A;  2XSO B;  4QWT A;  3K8N A;  4K5R A;  5ECN B;  2FLS A;  5HFI A;  3VI7 A;  4YKG A;  4PGT A;  2I9W A;  3N5O A;  2XF3 A;  1NJI 4;  2LV3 A;  1GUK A;  3IJE B;  9GSS A;  1I0V A;  4K7O A;  1NB5 I;  1FW1 A;  3I69 A;  4ZL7 A;  2FWG A;  3J7Y b;  1BOX A;  1KQS 2;  2VL2 C;  2CWV A;  1M90 4;  2PU9 C;  3X41 A;  4MJA A;  4BL3 A;  5DCH A;  2FNQ A;  1I2E A;  3GL3 A;  2AJQ B;  4RQR A;  2P0X A;  3FMW A;  3OWY A;  2XGN A;  4ZB8 A;  1GMP A;  1OCV A;  2GS3 A;  4MJD A;  3NQZ A;  3I6A A;  2X49 A;  4KFD A;  4TR0 A;  1R4W A;  3S5C A;  3GKN A;  1TK0 B;  1DMQ A;  2ZNM A;  22GS A;  2HMJ B;  3LJR A;  3DGY A;  2DBC A;  1EGO A;  2VLV A;  2RSX A;  2HRK A;  5AIX A;  3A5I A;  5IEO A;  1I2G A;  1ZGN A;  4GST A;  2PER A;  3LQ7 A;  1RTU A;  3FEU A;  2V1M A;  3AMO B;  1BNE A;  1GTA A;  1A90 A;  4TKY A;  4RNZ A;  5KN3 A;  2L6D A;  4IIA A;  1WRY A;  1UUW B;  3EE1 A;  2L4Q A;  1S3C A;  1XG8 A;  3I56 3;  2CG0 A;  2REM A;  4K7N A;  4X2O A;  3F7X A;  3DML A;  3QPM A;  4PNG A;  5IER A;  1Z7P A;  4K9Z A;  1CYV A;  1FGR A;  1TU8 A;  1S5A A;  2LRN A;  2W0Q A;  3PPU A;  4NHZ A;  1TRV A;  3ERG A;  1BSD A;  3Q2P A;  1EKM A;  3GA4 A;  1JN5 B;  2XC2 A;  1OHO A;  1YVS A;  4G19 A;  18GS A;  2YFL B;  4CJN A;  1RGF A;  3B4O A;  1F6M C;  1BRH A;  4FCM A;  2R0G A;  17GS A;  1F3B A;  2F56 A;  3DM8 A;  1K3L A;  3IOS A;  4HJL B;  4AEQ A;  3M1G A;  1SL2 B;  1QQ2 A;  3MG3 A;  2W6J H;  3H1N A;  1B21 A;  1NSW A;  2HZE B;  3RHB A;  5D9X A;  1K73 4;  4PQI A;  4HSC X;  1W5Z A;  1EV9 A;  2WJU A;  2VCT A;  5IEN A;  4POL A;  1OKT A;  1M2B A;  4XB5 A;  3QRD A;  1W01 A;  3CSI A;  1X1X A;  2TRX A;  3GTU A;  5JCW A;  3SWL A;  2HXK A;  3U5R E;  4N0Z A;  5HFK A;  4IVF A;  5ECI B;  3G6E 3;  5KP4 A;  1PGT A;  2PN8 A;  1XZO A;  2I3Y A;  1BG5 A;  3MHE A;  3DZL A;  1E97 A;  2IYJ A;  4F2I A;  1BUQ A;  2LNT A;  3C1R A;  1OC9 B;  1ON4 A;  4WWU C;  1JRQ A;  2FUG 2;  5FGO A;  1KBN A;  3KXO A;  3SVA A;  1JLW A;  3R2Q A;  2DJ0 A;  1DE3 A;  2C0E A;  2XGL A;  2OA7 A;  2H8L A;  3CXC 2;  1ERU A;  1RDS A;  1KD1 4;  4GCI A;  3H51 A;  2MF7 A;  5IM9 A;  2YNX A;  5D9W A;  1VQL 3;  2KLX A;  1QGV A;  4HJ2 A;  1CQH A;  5IMF A;  3FGY A;  2GSQ A;  1BNR A;  3SYU A;  2OBK A;  3SXX A;  4MK3 A;  5JWR B;  3JUP A;  1FB0 A;  4O92 A;  5HFG A;  1IV7 A;  1VQM 3;  1AVL A;  1STD A;  3ZZX A;  2H1D A;  4J5K A;  5HR1 A;  4HZ9 B;  1J2B A;  2VCQ A;  1GY5 A;  2XEP A;  3ZFZ A;  3O8Y A;  2QSI A;  1YJN 3;  2WB9 A;  1SYR A;  4MA9 A;  3HDC A;  1UI7 A;  4TXO A;  5KOW A;  4AKZ A;  3D5I A;  1GTB A;  2XR8 B;  3ROB A;  2W9Q A;  3RNT A;  3W8S A;  3HZP A;  3VSY A;  5ECQ B;  1OUN A;  1GSE A;  3J7Y k;  3PYJ A;  2PMT A;  3VPT A;  1JZO A;  3M8N A;  3EMP A;  1W7C A;  2L4C A;  2BTO T;  3UBK A;  5D96 A;  1GD3 A;  4J9A A;  4IEL A;  4N0V A;  2JZR A;  3DGO A;  4XS6 A;  4CCV A;  4G0I A;  3ZIJ A;  2F5W A;  2QC7 A;  5J5N A;  1BJX A;  3KZQ A;  1SL0 B;  2GVP A;  2PWJ A;  1LQG C;  2K54 A;  4YQM A;  2TRC P;  3ZMK A;  2OQE C;  1ZL9 A;  3I0Y A;  2DC5 A;  2C80 A;  4BL7 A;  1T2H A;  1RGG A;  5BU4 A;  2MMA A;  5FW5 A;  3MNG A;  4I4K A;  1ERW A;  4Z2R A;  2K6V A;  2WS2 A;  1IYY A;  4EKZ A;  2GU1 A;  3ECF A;  2QA2 A;  2H6Y A;  4LL1 B;  4JU5 A;  1EP8 A;  5FWG A;  5DAK A;  4BPY A;  2H75 A;  2VM1 A;  4EC6 A;  3BCK A;  3LYG A;  4V1A g;  3GSP A;  1DE2 A;  1BRI A;  2K9F A;  4NV2 A;  3EN8 A;  5BIR A;  4HKV B;  3F8H A;  4MF5 A;  1RLS A;  5AYR B;  3CTF A;  2LJA A;  2K3D A;  5STD A;  1N8R 4;  3FSD A;  1BRK A;  3NXJ A;  5D73 A;  1T3B A;  1ZMA A;  4N6U A;  3CU3 A;  1AC1 A;  3KKG A;  1BAO A;  1WOU A;  3WT2 A;  3DRN A;  2HMO B;  3MKI A;  1XW9 A;  4PQ1 A;  3MG2 A;  4QL9 A;  4USS A;  2HNL A;  2QA4 3;  3P8W A;  1ZYP A;  3IPT A;  2QGV A;  2JDI H;  3GFK A;  3EU4 A;  1LNI A;  4ILF A;  2B1L A;  3GHA A;  4YAV A;  1IT8 A;  1OKD A;  2F99 A;  3VF1 A;  4HM8 B;  1NB3 I;  3I55 3;  3L0H A;  2KOK A;  1XPV A;  1TI1 A;  1RCL A;  2XH9 A;  3DYR A;  2IL3 A;  5J9B A;  3NQY A;  1Q98 A;  2R0P A;  2CX4 A;  1OH0 A;  4BL2 A;  3CCV 3;  3CRT A;  3PIN A;  1WPI A;  1I9D A;  4BWS A;  2P5Q A;  2HYX A;  4POK A;  1LOY A;  4WF5 A;  1N5H A;  2ZUP A;  4J5G A;  2O9U X;  3N9J A;  1XFL A;  14GS A;  3H93 A;  1GNE A;  4JBB A;  1Y4K A;  5CRE A;  6GSW A;  3KN4 A;  4G1M B;  1WJK A;  5FT3 A;  4WET A;  3VLN A;  3HHV A;  2WRT A;  3GNJ A;  2A4H A;  2E2M A;  4ECB A;  4MMZ B;  1FGO A;  1VQO 3;  1X5D A;  1G0T A;  4R1K A;  1ZOF A;  1ZS7 A;  4JR4 A;  3MSO A;  1SJW A;  4AJ6 A;  4X1U A;  4YQU A;  1YZX A;  3MSZ A;  1GLQ A;  1BVI A;  3GTU B;  1EV4 A;  1OHS A;  4AGS A;  1EOH A;  4KVH A;  1U3A A;  4EC0 A;  4V2L A;  5ABR A;  4G2E A;  3G71 3;  2NDO A;  1YDK A;  5F8B A;  1BRN L;  2OAD A;  3V98 A;  6GSS A;  3GST A;  3RPN A;  1U5O A;  4GL6 A;  2MZC A;  1GNW A;  2HLS A;  4GXZ A;  4EDZ A;  1HYF A;  3G8Z A;  3JUM A;  2FWH A;  4GQF A;  2UUG C;  2GEY A;  5HQP A;  2ZCT A;  1IQX A;  1QAK A;  2BNG A;  3J7Y d;  3VFI A;  3L0R A;  2R4I A;  4BWQ A;  2AAD A;  5DJM A;  3LT8 A;  5CRW A;  2SAR A;  4HZ4 A;  2CWT A;  1THX A;  1F2E A;  5ELG A;  2AB6 A;  3F6F A;  4HOJ A;  4O5R A;  3TRQ A;  5CXO A;  3DXB A;  1M7T A;  3DEX A;  1UCK A;  3U1W A;  5DVB A;  1MDI A;  4P3Y B;  3KCM A;  1LNH A;  1T2I A;  1ROV A;  3WGX A;  1O7M B;  2H0I A;  4XCS A;  1GSY A;  2RCD A;  1V57 A;  3E99 A;  5CRH A;  2KCD A;  1VF1 A;  1DYU A;  2CVB A;  1Y6E A;  1AV4 A;  2Y74 A;  1PFP A;  1WP0 A;  1OE8 A;  4TXO B;  3TGZ A;  5ELU A;  1JB5 A;  3F14 A;  5JWQ B;  3FG3 A;  2CAQ A;  3CC4 3;  1N9E A;  1OYJ A;  3F3Q A;  3WR2 A;  3CCR 3;  1O7N B;  5AGY A;  3L9V A;  3BU4 A;  1AQX A;  2EC4 A;  1A23 A;  3CYN A;  3PXM A;  1BGS A;  3AMO A;  4ZIL A;  4TN8 A;  5DQY A;  5ELJ A;  3WHO A;  2BMX A;  4TR4 A;  2HT9 A;  1EP7 A;  2CX0 A;  1DMN A;  1K0O A;  4HJM A;  3S9F A;  1MWR A;  4N6O B;  2IIY A;  16GS A;  1IT7 A;  1M9B A;  1MD4 A;  2WGR A;  1X9M B;  4CDL A;  1FGT A;  3KCH A;  4V2N A;  4CDO A;  3CXG A;  1Q7Y 4;  2H73 A;  1QJG A;  3N54 B;  1JN5 A;  4BL7 B;  5IW9 A;  1YHQ 3;  2CX3 A;  3I9V 2;  3Q19 A;  4KDY A;  4PUR A;  3DGQ A;  4F82 A;  1FHE A;  3DGN A;  1IQ8 A;  2B6M A;  2JZS A;  3NV0 A;  1N8Q A;  1X9W B;  5B8A A;  1D6U A;  2YWI A;  3IC4 A;  5DAK B;  3GUS A;  2Y73 A;  1YQ1 A;  4HDE A;  2GZZ A;  2WOH A;  3V1W A;  3LXU X;  3A2X A;  4ZB6 A;  4NHW A;  1USB A;  5DJL A;  3ZRE A;  1BNG A;  3NIV A;  1XXU A;  4GQC A;  4L5L A;  2V1L A;  3CD6 3;  4OFT A;  3C1S A;  5KN0 A;  4O02 B;  4WFO A;  1DSB A;  2CK3 H;  5ECK B;  3IK9 A;  4I8B A;  4KAE A;  2J23 A;  4I5Q A;  2W9P A;  3EN1 B;  5AYS C;  1C54 A;  3KP9 A;  2TIR A;  5F0G A;  1K0N A;  4G9H A;  1QVF 2;  5JCU A;  1UUV B;  2FA4 A;  3F9U A;  3TRX A;  1UCL A;  4NHF A;  3DIE A;  2R4V A;  4PNF A;  3RGR A;  3UL3 A;  2E2G A;  3G7Y A;  4XS4 A;  2DKI A;  2R0C A;  1JJ2 2;  4WR4 A;  4D73 A;  3HK4 A;  4ZXG A;  4FO5 A;  2LS5 A;  1VF2 A;  3HZ4 A;  2XFT A;  1OGX A;  3HJO A;  4KB3 A;  2B5Y A;  4HM1 B;  3UMA A;  2XRX B;  4R80 A;  2WCI A;  2DJJ A;  4V2M A;  2H0G A;  2LEG A;  3U97 A;  1AY7 A;  1VQ7 3;  4F0C A;  1WE0 A;  4L8E A;  2OWP A;  2NBS A;  1MWU A;  1KSI A;  3DGL A;  1UW1 A;  4NAX A;  2YZU A;  1PA3 A;  4ZBB A;  5IEP A;  4K1F A;  3FG4 A;  3IC8 A;  5IMA A;  4HM7 B;  1OHP A;  1UGI A;  4L5O A;  6GSV A;  1IV9 A;  3KII A;  5D9T A;  4KH7 A;  2H19 A;  1OC8 A;  1RQM A;  5ECO B;  2X8H A;  2CFG A;  2PUK C;  1Z3E A;  1BSA A;  1R5A A;  1WTH A;  2MBS A;  4OFM A;  1A2P A;  1BSB A;  3P90 A;  1VQ8 3;  2MMN A;  1US1 A;  4ZM8 A;  1GY6 A;  2VD1 A;  4FMC A;  2H30 A;  20GS A;  1SJI A;  1G02 A;  4STD A;  3GH6 A;  4ZL8 A;  2LTK A;  1NWW A;  2KF6 A;  2H72 A;  3URP A;  4KSM A;  1GYB A;  5CF2 A;  3O3T A;  2LQV A;  1JZR A;  5KOX A;  3BND A;  3LYP A;  3NX0 A;  1K8A 4;  3UVH A;  3WYW A;  4HAA A;  3GN3 A;  4MZC A;  3FZ9 A;  5DRE A;  1BSE A;  2N5B A;  3BCI A;  1JZW A;  3IHG A;  5EVH A;  3KP8 A;  1I5G A;  4HM2 B;  5D9V A;  2KRT A;  4FMD A;  4MP4 A;  5ECS A;  8CHO A;  1A2K A;  1ROA A;  2VAF A;  4EIP A;  3V99 A;  3JUN A;  1MDK A;  3LH4 A;  5H5Q A;  1GOV A;  2R5G A;  1UCJ A;  1XCC A;  2MMZ A;  2B5X A;  4K1V A;  2L1S A;  3FKF A;  1MOL A;  1GWC A;  1W89 A;  3EBT A;  2IME A;  2VUP A;  2N5F A;  3TOT A;  4R4K A;  3CCL 3;  1M1K 4;  1X5C A;  1PY3 A;  4DVC A;  1A2V A;  2HML B;  3HII A;  3EVI A;  2CIU A;  4O7H A;  1YKA A;  2EIR A;  3CRU A;  3H3H A;  3DWV A;  6STD A;  1ZYE A;  1MGW A;  5HGR A;  2AYT A;  2VCW A;  1QUW A;  3UEM A;  5M19 A;  5D8I A;  4GSN A;  2W04 A;  5LNK e;  1GSU A;  1QMA A;  1QMV A;  3D0Z A;  4GSP A;  2GGT A;  2A4V A;  1J9B A;  3GWR A;  3WA2 X;  3HA9 A;  3VWU A;  2OKA A;  2EIQ A;  3K5T A;  3FH1 A;  3EF8 A;  1VQQ A;  2C4B A;  1QAF A;  2P09 A;  2CVK A;  4BVY A;  2HSY A;  5GST A;  3U6V A;  2YCD A;  1O8X A;  1PRX A;  4FH8 A;  1B48 A;  1T4Y A;  2B3S A;  3QAG A;  5IPH A;  4MAB A;  4BIK A;  2YFI B;  3QAV A;  3NV0 B;  3ME7 A;  4MNN A;  4HQZ A;  5GSS A;  1RGA A;  3Q6O A;  5ID2 A;  3GSS A;  3B7C A;  1SEN A;  2WO0 A;  4BIR A;  1TIJ A;  3QCP A;  1Q81 4;  4AJ7 A;  1RHL A;  2VLT A;  1LBK A;  3MWZ A;  4ECJ A;  3G7I A;  2DJ2 A;  3JCM L;  4ZIJ A;  3AY8 A;  4K0N A;  2E2V A;  2J9H A;  3SED A;  1UC7 A;  4OK0 A;  2B5E A;  4WP5 A;  2HFD A;  3MYD A;  4RNY A;  5CRD A;  5D93 A;  3LEF A;  1V74 A;  1B4Q A;  3GH9 A;  1G7O A;  2B7J A;  1A2L A;  3D6I A;  2G0F A;  3F4T A;  5HR3 A;  3GRX A;  3GKK A;  3OW2 2;  1URM A;  4EF0 A;  2DML A;  2WFC A;  1AUC A;  1R26 A;  3D21 A;  4ZBD A;  1BQ7 A;  3ZLP A;  3HIG A;  1SK0 A;  3A2V A;  1T5Y A;  3DXO A;  1ZYN A;  2F51 A;  5D83 A;  4IQ1 A;  3GL5 A;  1G96 A;  1VQ4 3;  2CQ9 A;  4X2H A;  1FOH A;  2VCV A;  4XS4 B;  1W2Z A;  2JL4 A;  3E9J B;  4D73 B;  4TW5 A;  4BTW A;  2F4Y A;  1NDO B;  5AEW B;  3HZ8 A;  1O85 A;  5IMC A;  3FW2 A;  4HS1 A;  1ULI B;  3JUO A;  4BU4 A;  3CMI A;  1B2S A;  1QK8 A;  3NBR A;  2YFJ B;  2WDU A;  4LMI A;  1PN0 A;  4MZW A;  3TKR A;  1EWX A;  2QGU A;  3D9R A;  1FAA A;  2C11 A;  2V6K A;  5ECR B;  1KTE A;  3TCO A;  4IW9 A;  1SKW B;  1XWG A;  4KA0 A;  2W2C A;  2RUE A;  2OTJ 3;  1NU3 A;  3ZIV A;  1TRP A;  1BYE A;  2VD0 A;  5A4V A;  3KMN A;  1OC3 A;  3BD2 A;  4IHU A;  4EDY A;  4QL7 A;  2IMJ A;  3F7S A;  1VQP 3;  1G6W A;  2O85 A;  5EL8 A;  1EUI C;  1YIT 3;  1W2B 2;  4JED A;  1VQN 3;  1XBS A;  2SBL A;  1O7H B;  1RGE A;  3IDV A;  5AEU B;  3HD5 A;  2GSS A;  4MF6 A;  5G1L A;  1YKC A;  3K0Z A;  2DJ1 A;  5BMU A;  2QIY A;  3A5E A;  2YAN A;  2FWE A;  4GRF A;  1A2J A;  4IP6 A;  1UVZ A;  5G2Z A;  1JZD A;  1B3S A;  1UN2 A;  3JVC A;  4MPF A;  1SK2 A;  2LST A;  2BT3 A;  5GSP A;  1JLV A;  1M0U A;  3D22 A;  3KGK A;  3WT1 A;  1S3R A;  2CW9 A;  2GDR A;  4O3V A;  4E8E A;  4KX4 A;  2E7P A;  2GBW B;  1RN7 A;  6RNT A;  2H6X A;  5J4U A;  1U3I A;  4EXJ A;  4EV5 A;  2C4J A;  2ON7 A;  4NV5 A;  3EMX A;  1WMO A;  1BU4 A;  3D5J A;  9RNT A;  3TJF A;  2Z77 A;  2FWF A;  1SAR A;  3EYT A;  10GS A;  4Q5R A;  5D82 A;  3VK9 A;  5DRV A;  2XHF A;  5CAX A;  1TUH A;  2UX0 A;  1AAZ A;  1DE1 A;  4AKY A;  1C7H A;  1R5P A;  1MTC A;  3EUR A;  2IUJ A;  2GSR A;  4OUQ A;  3E3E A;  4TX4 A;  3TKP A;  1JHB A;  1EGR A;  3A5W A;  3LTC A;  3FKA A;  1F8N A;  2C1Y A;  2L59 A;  3M0F A;  2K8V A;  3NZN A;  2XFS A;  1TXX A;  1LU4 A;  5IMZ A;  3ZL5 A;  4BA7 A;  3CC2 3;  3KJY A;  2DMM A;  1B2U A;  3FR9 A;  1ACV A;  1GMR A;  2ZL8 A;  4PX1 A;  3C73 A;  4FR9 A;  3HVX A;  3CCM 3;  3EB8 A;  1JB4 A;  3FG1 A;  1RW1 A;  1DUG A;  2O7K A;  3FR6 A;  3HJM A;  1FG4 A;  3GRD A;  3WDG B;  4KF9 A;  1G6Y A;  4HM5 B;  3H8Q A;  1RGC A;  4HBR A;  1ZGX A;  1ISK A;  2F5M A;  2X4A A;  1AVK A;  2B1X B;  3VWX A;  4CPK A;  2W03 A;  3EQQ B;  1SYX A;  1FGM A;  1N9J A;  4ML1 A;  4RNT A;  3QOU A;  2GT5 A;  3PGB A;  5M18 A;  3K63 A;  3HY2 A;  4KUN A;  3ZYW A;  2C10 A;  3PH9 A;  4K0G A;  2X8G A;  3RAZ A;  1WMP A;  4WYK B;  4I2T A;  2AAW A;  2H1A A;  2DIY A;  4J2F A;  1EZK A;  3S27 A;  1YJW 3;  5DQS A;  2FHE A;  1EQK A;  1CEW I;  3DD3 A;  5IG0 A;  2HRN A;  1H4O A;  1VF4 A;  4N6T A;  2DSA A;  4OCF A;  4ICY A;  4KZ1 A;  4PTS A;  4BVY B;  4IP1 A;  1Q7H A;  3ALA A;  2O87 A;  1YF0 A;  2UZ8 A;  2OE3 A;  6GSU A;  1B8X A;  4HU7 A;  3FHK A;  4ULX A;  4XTS A;  4LA1 A;  3Q1C A;  2JAC A;  2M46 A;  3T8U A;  2C3T A;  5CO3 A;  4JZQ A;  5ID2 B;  3C71 A;  2BU4 A;  3FR3 A;  1X1Y A;  3UOM A;  4QQ7 A;  1XIY A;  2MC8 A;  1AW9 A;  3KEB A;  1XVW A;  4OCE A;  4AF2 A;  2GST A;  1YNV X;  5IG5 A;  2YJ7 A;  1VQ6 3;  1H75 A;  1NM3 A;  4KGI A;  2YWO A;  1BX9 A;  4RZM A;  4ML6 A;  1GLP A;  4RI7 A;  1TFO A;  4ZB9 A;  5EQL A;  3PZW A;  4I6X A;  2FGX A;  3UAP A;  4U13 A;  2HMM B;  2MYG A;  3IHQ A;  3Q18 A;  3ZG5 A;  3HOH A;  1FVK A;  1BAY A;  3F3R A;  3IAM 2;  3KFQ C;  2CT6 A;  3N9H A;  5H5R A;  4KE3 A;  3LOY A;  1B9X C;  5KN2 A;  2GZY A;  3HVS A;  2MBT A;  1U88 A;  3MAK A;  2V2G A; 
#chains in the Genus database with same CATH homology
 5AN1 A;  4YAP A;  2DKH A;  4TR3 A;  4FQU A;  2H6Z A;  3TKS A;  2XBQ A;  4MPG A;  4WF4 A;  4POM A;  2KUC A;  5ENU A;  2OE1 A;  1GUM A;  4LMV A;  2DLX A;  1XW6 A;  3FZ4 A;  1GSD A;  2IY2 A;  2X99 A;  3TRP A;  5E4W A;  2XBI A;  3O6T A;  1Y25 A;  2X8C A;  2YWM A;  3GV1 A;  5HR2 A;  2ON5 A;  3TOU A;  2GZP A;  1GH2 A;  1ZZY A;  1A0F A;  1K0C A;  2IMK A;  1GP1 A;  2I4A A;  2R2J A;  1OE7 A;  2YZH A;  3KMO A;  2IN3 A;  4IKH A;  2GQK A;  2KP2 A;  3M3M A;  1TRW A;  1SD8 A;  3IV4 A;  1WIK A;  2L5L A;  2VIM A;  2V32 A;  3KTL A;  5INY A;  1JFU A;  1K3O A;  3GYK A;  5J3R A;  1O73 A;  3O76 A;  1F3A A;  2LRT A;  3KIJ A;  4EVM A;  2OE0 A;  3CBU A;  5B6M A;  2QKE A;  1HNC A;  1TK8 B;  1SJ6 A;  1Z6M A;  2LUS A;  3H4K A;  4ISD A;  1A24 A;  3FYG A;  2YOI A;  1HD2 A;  3TDG A;  1WWJ A;  4E8H A;  5LCZ A;  2P0G A;  1MDJ A;  1WMJ A;  3ZIT A;  4GF0 A;  1YF1 A;  5LD0 A;  1MEK A;  1HYU A;  4IBP A;  2JZT A;  4KDU A;  4EL1 A;  5ECM B;  2CV4 A;  5G30 A;  3VI5 A;  3G9B A;  1YJ6 A;  1S3D A;  1OVN A;  4JR6 A;  2CAI A;  3FZ5 A;  2CVD A;  2QA1 A;  1X5E A;  1PSQ A;  2C0G A;  3BOA A;  1T4Z A;  1K0D A;  3TKS C;  1G7E A;  4X43 A;  1Z5Y E;  4MCU A;  5IMD A;  5A4U A;  4JRR A;  3EU3 A;  1KNG A;  2OAC A;  3ERF A;  2HZF A;  1QFN A;  1QXH A;  4GSS A;  3M9K A;  2FA8 A;  3VPQ A;  3FY7 A;  4WEY A;  2L57 A;  1VRS D;  4OMV A;  5G1K A;  1XWC A;  2VO4 A;  5FHI A;  2JU5 A;  2N5A A;  3GKX A;  1F37 A;  2DJK A;  5COH A;  1AQW A;  4K2D A;  3LOR A;  3MDK A;  2VL2 A;  5J9C A;  4X4J A;  3LSZ A;  3DKS A;  4FYC A;  1ERV A;  1Z7R A;  1AIU A;  1XWK A;  4CW9 A;  5EVO A;  4HEA 2;  4F0B A;  2CZ2 A;  4K5S A;  1PD2 1;  2YWN A;  1B9Y C;  4NPB A;  2JSZ A;  4IJI A;  2PVO C;  3KH9 A;  3IXR A;  1PKZ A;  1Z6N A;  5G5F A;  1B4P A;  3P7X A;  4O5U A;  1ILO A;  3WGE A;  3DVX A;  5IQY A;  3ME8 A;  5B8B A;  3QD9 A;  3I43 A;  4J57 E;  4XIH A;  2H0H A;  5HR0 A;  4L0W A;  3GX0 A;  2HE3 A;  4XS1 A;  2F3M A;  2AV4 A;  2WZ9 A;  3LFL A;  4DEJ A;  3QAW A;  6GST A;  4OD7 A;  5CP1 A;  3G7J A;  4POB A;  2PBJ A;  1EEJ A;  1VF3 A;  1SD9 A;  2LQQ A;  5ELA A;  5B6N A;  2MMO A;  2HRF A;  2XPD A;  5IMV A;  2HSH A;  1K0A A;  2YV7 A;  1O81 A;  2OJL A;  4OO4 A;  3W6G A;  4KW6 A;  2G2Q A;  1TW9 A;  3IBH A;  2LQO A;  3CSH A;  1PN9 A;  1VGL A;  3HYP A;  2FNO A;  1V40 A;  1AQV A;  4O5Q A;  5F06 A;  5C00 A;  4GLT A;  1M2A A;  2JAD A;  4TRX A;  3UIW A;  13GS A;  1GSQ A;  4RUV A;  2NTO A;  1T00 A;  4TVE A;  4EE0 A;  5KN1 A;  4LL4 B;  1YEP A;  4ACS A;  11GS A;  5DCG A;  3W8J A;  1EOG A;  1YY7 A;  5J41 A;  2VCZ A;  2IMI A;  3CSJ A;  1C72 A;  1TDI A;  3HJP A;  3QFA C;  5IO0 A;  4F03 A;  1N8J A;  4TXV A;  4HZ2 A;  4Q5Q A;  1HNA A;  1SKR B;  1J0F A;  3SBC A;  3C8E A;  1MD3 A;  4HQS A;  5JWO B;  4Z2T A;  5CYY A;  3LW9 A;  1FVJ A;  5GAP D;  1K0B A;  3A3T A;  4RI6 A;  2E0Q A;  1J08 A;  5H5S A;  3F4S A;  2RLI A;  1T8E B;  3LG6 A;  1E2Y A;  1O8W A;  3C7M A;  1KEB A;  2YN1 A;  4N11 A;  2IMD A;  1TJD A;  4Q5F A;  1O6J A;  1M9A A;  4H86 A;  1M99 A;  5ECH B;  3F6D A;  3HVV A;  2I9H A;  2GLR A;  1A8Y A;  3EIN A;  1M2D A;  3IK7 A;  1DBY A;  1U6T A;  1NHO A;  4BVX B;  5KEJ A;  3ISO A;  3EPT A;  3ZRD A;  1XOB A;  2C0F A;  5IOW A;  4TR1 A;  1V9W A;  4NMU A;  2PPT A;  1EEM A;  4KCA A;  3RDW A;  4WXT A;  4Q5N A;  3E0U A;  4MJE A;  4ECC A;  2YJH A;  2FY6 A;  3ZTL A;  2D2Z A;  2VLU A;  2HI7 A;  4AJ8 A;  1IYI A;  3H79 A;  4PQH A;  5DAL A;  2M72 A;  4Z7X A;  3UBL A;  3QDN A;  2LRC A;  4MJC A;  2EIO A;  1V58 A;  1TI3 A;  2H66 A;  3EE2 A;  4G0L A;  3L78 A;  2H1B A;  3GKM A;  4Z2U A;  3IPZ A;  3PR8 A;  3GX8 A;  4I97 A;  5CRG A;  2DIZ A;  5ECP B;  1NW2 A;  5A5K A;  2C8U A;  4V1A p;  4DSQ A;  2IFQ B;  4OO5 A;  3MIX A;  3M9J A;  2NPB A;  2IMF A;  1PMT A;  4A5P A;  4LLR A;  5B7C A;  3VUR A;  4N10 A;  3APQ A;  2F8F A;  4ZL9 A;  4CY8 A;  1O7U A;  4MH3 A;  5A4W A;  2GQM A;  4FYU A;  1ST9 A;  1FB6 A;  4YKF A;  2L5O A;  5IPG A;  12GS A;  3ZVJ D;  1GSF A;  1E6B A;  4FIW A;  2PGT A;  1UA5 A;  3F8U A;  2B7K A;  1U87 A;  2BJX A;  4K2X A;  3LXZ A;  1XWA A;  4IJ3 A;  5C04 A;  3DVW A;  3D4T A;  1A8L A;  2VL3 A;  1GRX A;  2K8S A;  3ZFB A;  4K7I A;  2Z9S A;  4O32 A;  1FO5 A;  2C3Q A;  4MLY A;  3L9S A;  2YPM A;  4RQX A;  2AHE A;  2FCH A;  5E59 A;  4K8M A;  1GL8 A;  1N2A A;  1SJZ A;  1Z9H A;  4GTU A;  4YH2 A;  2ALB A;  1ERT A;  3LWA A;  3APO A;  3LYK A;  4I2U A;  1SKS B;  3RBT A;  1F9M A;  1SL1 B;  5JCG A;  1TRS A;  3BJ5 A;  1NHY A;  1A2M A;  1PKW A;  4ID0 A;  4NWY A;  1TKD B;  1TP9 A;  2IPA A;  2F8A A;  2LJR A;  4DSS A;  1S3A A;  3TKQ A;  1XWB A;  5F05 A;  2CA8 A;  3EWL A;  2VL9 A;  2NVL A;  5G31 A;  3UAR A;  2HRA A;  4NXI A;  2GQL A;  5F07 A;  1V98 A;  1RK4 A;  2GT6 A;  1AXD A;  2HSM A;  4N30 A;  5DBQ A;  2O8V B;  4XHM A;  5G5E A;  4TOP A;  4MDC A;  8GSS A;  3OR5 A;  1T1V A;  4TR1 B;  4ECI A;  5DDL A;  2KHP A;  1LJR A;  2LNS A;  1HNB A;  6GSX A;  3MWH A;  4CY6 A;  3TJB A;  4EO3 A;  4WBR D;  2RUF A;  1PX7 A;  5L71 A;  4OWY A;  4FYB A;  2B1K A;  6GSY A;  3LXT A;  1GTI A;  1FOV A;  1TU7 A;  19GS A;  2DJ3 A;  4MMM A;  4DSR A;  3RHC A;  3LGC A;  3UJ1 A;  5ECL B;  1R7H A;  1ZCP A;  5DAL B;  2A2S A;  2R3X A;  3US3 A;  3A2W A;  1K0M A;  3IE3 A;  1XW5 A;  2H74 A;  5GZZ B;  4WBJ A;  2M80 A;  2VOC A;  4IS0 A;  4XRD A;  2YP6 A;  2LJK A;  5IOX A;  1A0R P;  3L4N A;  4IGJ A;  4X0X A;  1XOA A;  2PVQ A;  1GSS A;  3ZFL A;  3TUE A;  4MH2 A;  3RPP A;  1TOF A;  5CNW A;  1BED A;  3F0I A;  3EC3 A;  2AUV A;  2LKU A;  4KND A;  3UVT A;  4J56 E;  4EIQ A;  1GUL A;  2F9S A;  5GAN D;  2IWT A;  4LMW A;  1HQO A;  4WKW A;  2YV9 A;  2RM5 A;  4MF7 A;  1TTZ A;  2P5R A;  2RII A;  3P2A A;  1V2A A;  5AIV A;  3WGD A;  3ZVJ A;  5IO2 A;  2A2P A;  2C3N A;  4K6X A;  4EUY A;  2H1G A;  2C0D A;  2R6K A;  3NOF A;  3HKR A;  2R37 A;  3KM6 A;  4HUA A;  1X9S B;  3APS A;  2H76 A;  2A2R A;  3QFB C;  4OFN A;  2I81 A;  3QR6 A;  1XVQ A;  4G0K A;  4KSO A;  3TJG A;  2VCX A;  1TK5 B;  5EPF A;  3WD6 A;  4IN0 A;  3VWW A;  1GTU A;  1ABA A;  3GIX A;  2HZE A;  2VM2 A;  3KD0 A;  4WR5 A;  4HU9 A;  2RM6 A;  3CTG A;  2WUL A;  2O89 A;  2I1U A;  2H70 A;  3ED3 A;  4KCE A;  2XPE A;  3FK8 A;  4BVX A;  1ZYQ B;  1CQG A;  4PUF C;  4YQV A;  3Q74 A;  4PXO A;  5BRT A;  3ERW A;  4IQA A;  2KP1 A;  3TJK A;  3ZML A;  3GUR A;  1PL1 A;  1OC9 A;  3IR4 A;  4F9Z A;  1IYH A;  3D4M A;  2JSY A;  1SK1 A;  1PX6 A;  2H71 A;  4HI7 A;  2IJY A;  2H01 A;  1ML6 A;  3HCZ A;  3R3E A;  1OAZ A;  3KTB A;  1X0R A;  3VWV A;  1TRU A;  1W4V A;  3HXS A;  1T7P B;  5AIS A;  4DSS B;  1SU9 A;  4MZB A;  1GUH A;  3QMX A;  4GWR A;  3F63 A;  1Q4J A;  4KDX A;  3TB2 A;  3IAS 2;  2V41 A;  4G10 A;  2OBI A;  3TKS E;  7GSS A;  4XRA A;  1K3Y A;  4L0U A;  1YEX A;  3GMF A;  3L9U A;  4CHS A;  3FRC A;  3F4R A;  1PQN A;  2X64 A;  3TJJ A;  4PUA A;  2ES7 A;  1PL2 A;  3KH7 A;  4MJB A;  2FD3 A;  3IA1 A;  2CZ3 A;  2GTU A;  2IFQ A;  5EY6 A;  3FZA A;  3IRA A;  2P31 A;  2V6O A;  2L6C A;  3BBY A;  2K18 A;  3PGT A;  4ZBA A;  1THO A;  4JE1 A;  5IIZ A;  3K8N A;  4K5R A;  5ECN B;  2FLS A;  5HFI A;  3VI7 A;  4YKG A;  4PGT A;  3N5O A;  2LV3 A;  1GUK A;  9GSS A;  4K7O A;  1FW1 A;  3I69 A;  4ZL7 A;  2FWG A;  3J7Y b;  2VL2 C;  2PU9 C;  4MJA A;  5DCH A;  3GL3 A;  2AJQ B;  4RQR A;  3FMW A;  4ZB8 A;  2GS3 A;  3I6A A;  2X49 A;  4TR0 A;  1R4W A;  3GKN A;  1TK0 B;  2ZNM A;  22GS A;  3LJR A;  2DBC A;  1EGO A;  2VLV A;  2HRK A;  5AIX A;  3A5I A;  4GST A;  1ZGN A;  2PER A;  3LQ7 A;  3FEU A;  2V1M A;  1GTA A;  4TKY A;  5KN3 A;  2L6D A;  1WRY A;  2L4Q A;  1S3C A;  2REM A;  4K7N A;  3DML A;  3QPM A;  4PNG A;  1Z7P A;  4K9Z A;  1TU8 A;  2LRN A;  3PPU A;  4NHZ A;  1TRV A;  3ERG A;  3GA4 A;  2XC2 A;  4G19 A;  18GS A;  1F6M C;  2R0G A;  17GS A;  1F3B A;  1K3L A;  3IOS A;  3M1G A;  1SL2 B;  1QQ2 A;  3H1N A;  1NSW A;  2HZE B;  3RHB A;  5D9X A;  4PQI A;  1EV9 A;  2WJU A;  2VCT A;  4POL A;  1OKT A;  1M2B A;  3CSI A;  2TRX A;  3GTU A;  5JCW A;  3SWL A;  2HXK A;  3U5R E;  4N0Z A;  5HFK A;  4IVF A;  5ECI B;  1PGT A;  2PN8 A;  1XZO A;  2I3Y A;  1BG5 A;  2IYJ A;  4F2I A;  2LNT A;  3C1R A;  1OC9 B;  1ON4 A;  2FUG 2;  1KBN A;  3KXO A;  1JLW A;  3R2Q A;  2DJ0 A;  2C0E A;  2OA7 A;  2H8L A;  1ERU A;  4GCI A;  5IM9 A;  2YNX A;  5D9W A;  2KLX A;  1QGV A;  4HJ2 A;  1CQH A;  5IMF A;  2GSQ A;  2OBK A;  4MK3 A;  5JWR B;  1FB0 A;  4O92 A;  5HFG A;  3ZZX A;  2H1D A;  5HR1 A;  2VCQ A;  2QSI A;  4MA9 A;  2WB9 A;  1SYR A;  3HDC A;  4TXO A;  5KOW A;  1GTB A;  3W8S A;  5ECQ B;  1GSE A;  3J7Y k;  2PMT A;  3VPT A;  1JZO A;  3M8N A;  3EMP A;  2L4C A;  2BTO T;  3UBK A;  5D96 A;  4IEL A;  4N0V A;  2JZR A;  4XS6 A;  4G0I A;  3ZIJ A;  2QC7 A;  5J5N A;  1BJX A;  3KZQ A;  1SL0 B;  2GVP A;  2PWJ A;  4YQM A;  2TRC P;  3ZMK A;  1ZL9 A;  2DC5 A;  2C80 A;  4BL7 A;  2MMA A;  3MNG A;  1ERW A;  4Z2R A;  2K6V A;  2WS2 A;  4EKZ A;  2QA2 A;  2H6Y A;  4LL1 B;  4JU5 A;  1EP8 A;  5FWG A;  5DAK A;  4BPY A;  2H75 A;  2VM1 A;  3BCK A;  4V1A g;  1DE2 A;  2K9F A;  4NV2 A;  4MF5 A;  3CTF A;  2LJA A;  5D73 A;  1T3B A;  1ZMA A;  1AC1 A;  1WOU A;  3WT2 A;  3DRN A;  1XW9 A;  4PQ1 A;  4QL9 A;  4USS A;  2HNL A;  3P8W A;  1ZYP A;  2QGV A;  3GFK A;  3EU4 A;  4ILF A;  2B1L A;  3GHA A;  4YAV A;  1OKD A;  3L0H A;  2KOK A;  1XPV A;  1TI1 A;  3DYR A;  2IL3 A;  5J9B A;  1Q98 A;  2R0P A;  2CX4 A;  3CRT A;  3PIN A;  1WPI A;  1I9D A;  4BWS A;  2P5Q A;  2HYX A;  4POK A;  4WF5 A;  2ZUP A;  3N9J A;  1XFL A;  14GS A;  3H93 A;  1GNE A;  4JBB A;  6GSW A;  5CRE A;  1WJK A;  5FT3 A;  4WET A;  3VLN A;  3HHV A;  2WRT A;  3GNJ A;  2A4H A;  2E2M A;  4ECB A;  1X5D A;  1G0T A;  1ZOF A;  4JR4 A;  4AJ6 A;  4X1U A;  4YQU A;  1YZX A;  3MSZ A;  1GLQ A;  3GTU B;  1EV4 A;  4AGS A;  1EOH A;  1U3A A;  4EC0 A;  4V2L A;  5ABR A;  4G2E A;  2NDO A;  1YDK A;  5F8B A;  2OAD A;  6GSS A;  3GST A;  3RPN A;  2MZC A;  1GNW A;  2HLS A;  4GXZ A;  4EDZ A;  2FWH A;  4GQF A;  5HQP A;  2ZCT A;  3VFI A;  4BWQ A;  5DJM A;  5CRW A;  4HZ4 A;  1THX A;  1F2E A;  5ELG A;  2AB6 A;  3F6F A;  4HOJ A;  4O5R A;  3TRQ A;  3DXB A;  1M7T A;  3DEX A;  5DVB A;  1MDI A;  4P3Y B;  3KCM A;  3WGX A;  2H0I A;  4XCS A;  1GSY A;  1V57 A;  5CRH A;  1VF1 A;  2CVB A;  1Y6E A;  1WP0 A;  4TXO B;  1OE8 A;  3TGZ A;  5JWQ B;  2CAQ A;  1OYJ A;  3F3Q A;  5AGY A;  3L9V A;  1AQX A;  2EC4 A;  1A23 A;  3CYN A;  4ZIL A;  4TN8 A;  5DQY A;  2BMX A;  4TR4 A;  2HT9 A;  1EP7 A;  1K0O A;  4HJM A;  3S9F A;  2IIY A;  16GS A;  1M9B A;  1MD4 A;  2WGR A;  1X9M B;  4V2N A;  4CDO A;  3CXG A;  2H73 A;  4BL7 B;  2CX3 A;  3I9V 2;  3Q19 A;  4KDY A;  4PUR A;  3DGQ A;  4F82 A;  1FHE A;  2B6M A;  2JZS A;  1X9W B;  5B8A A;  2YWI A;  3IC4 A;  5DAK B;  3GUS A;  1YQ1 A;  4HDE A;  2GZZ A;  3V1W A;  3A2X A;  4ZB6 A;  4NHW A;  1USB A;  5DJL A;  3ZRE A;  3NIV A;  1XXU A;  4GQC A;  4L5L A;  4OFT A;  3C1S A;  5KN0 A;  1DSB A;  5ECK B;  4KAE A;  3IK9 A;  4I8B A;  2J23 A;  4I5Q A;  3KP9 A;  2TIR A;  5F0G A;  1K0N A;  4G9H A;  5JCU A;  2FA4 A;  3F9U A;  3TRX A;  3DIE A;  2R4V A;  4PNF A;  3UL3 A;  2E2G A;  3G7Y A;  4XS4 A;  2DKI A;  2R0C A;  4WR4 A;  4D73 A;  4ZXG A;  4FO5 A;  2LS5 A;  1VF2 A;  3HZ4 A;  3HJO A;  4KB3 A;  2B5Y A;  3UMA A;  2WCI A;  2DJJ A;  4V2M A;  2H0G A;  2LEG A;  4F0C A;  1WE0 A;  4L8E A;  2NBS A;  4NAX A;  2YZU A;  1PA3 A;  4ZBB A;  4K1F A;  3IC8 A;  5IMA A;  4L5O A;  6GSV A;  5D9T A;  4KH7 A;  2H19 A;  1OC8 A;  1RQM A;  5ECO B;  2X8H A;  2PUK C;  1Z3E A;  1R5A A;  2MBS A;  4OFM A;  3P90 A;  2MMN A;  2VD1 A;  2H30 A;  20GS A;  1SJI A;  3GH6 A;  4ZL8 A;  2LTK A;  2H72 A;  4KSM A;  3O3T A;  1JZR A;  5KOX A;  3LYP A;  3UVH A;  3WYW A;  3GN3 A;  4MZC A;  3FZ9 A;  2N5B A;  3BCI A;  1JZW A;  3IHG A;  3KP8 A;  1I5G A;  5D9V A;  4MP4 A;  5ECS A;  2VAF A;  4EIP A;  1MDK A;  5H5Q A;  2R5G A;  1XCC A;  2MMZ A;  2B5X A;  3FKF A;  1W89 A;  1GWC A;  2IME A;  2VUP A;  2N5F A;  3TOT A;  1X5C A;  4DVC A;  3EVI A;  4O7H A;  1YKA A;  2EIR A;  3CRU A;  3DWV A;  1ZYE A;  2AYT A;  2VCW A;  1QUW A;  3UEM A;  5D8I A;  4GSN A;  5LNK e;  1GSU A;  1QMV A;  3D0Z A;  2GGT A;  2A4V A;  1J9B A;  3VWU A;  3HA9 A;  2OKA A;  2EIQ A;  2CVK A;  4BVY A;  2HSY A;  5GST A;  3U6V A;  2YCD A;  1O8X A;  1PRX A;  4FH8 A;  1B48 A;  1T4Y A;  2B3S A;  3QAG A;  5IPH A;  4MAB A;  3QAV A;  3ME7 A;  4MNN A;  4HQZ A;  5GSS A;  5ID2 A;  3Q6O A;  3GSS A;  1SEN A;  3QCP A;  4AJ7 A;  2VLT A;  1LBK A;  4ECJ A;  3G7I A;  2DJ2 A;  3JCM L;  4ZIJ A;  3AY8 A;  4K0N A;  2J9H A;  1UC7 A;  5CRD A;  2B5E A;  2HFD A;  3MYD A;  5D93 A;  3LEF A;  1B4Q A;  3GH9 A;  1G7O A;  2B7J A;  1A2L A;  3D6I A;  2G0F A;  3F4T A;  5HR3 A;  3GRX A;  3GKK A;  1URM A;  4EF0 A;  2DML A;  2WFC A;  1AUC A;  1R26 A;  3D21 A;  4ZBD A;  1BQ7 A;  3ZLP A;  1SK0 A;  3A2V A;  1ZYN A;  2F51 A;  4IQ1 A;  3GL5 A;  2CQ9 A;  1FOH A;  2VCV A;  4XS4 B;  2JL4 A;  3E9J B;  4D73 B;  4TW5 A;  3HZ8 A;  1O85 A;  5IMC A;  3FW2 A;  4HS1 A;  3CMI A;  1QK8 A;  2WDU A;  4MZW A;  1PN0 A;  3TKR A;  1EWX A;  1FAA A;  2V6K A;  5ECR B;  1KTE A;  3TCO A;  4IW9 A;  1SKW B;  1XWG A;  4KA0 A;  2RUE A;  3ZIV A;  1BYE A;  2VD0 A;  5A4V A;  3KMN A;  1OC3 A;  3BD2 A;  4IHU A;  4EDY A;  4QL7 A;  2O85 A;  5EL8 A;  1G6W A;  4JED A;  1XBS A;  3IDV A;  3HD5 A;  2GSS A;  4MF6 A;  5G1L A;  1YKC A;  2DJ1 A;  5BMU A;  2YAN A;  2FWE A;  4GRF A;  1A2J A;  4IP6 A;  1UVZ A;  5G2Z A;  1JZD A;  1UN2 A;  4MPF A;  1SK2 A;  2LST A;  1JLV A;  1M0U A;  3D22 A;  3KGK A;  3WT1 A;  2GDR A;  4E8E A;  4KX4 A;  2E7P A;  2H6X A;  5J4U A;  1U3I A;  4EXJ A;  2C4J A;  2ON7 A;  4NV5 A;  3EMX A;  3D5J A;  3TJF A;  2FWF A;  3EYT A;  10GS A;  4Q5R A;  3VK9 A;  2XHF A;  5CAX A;  1AAZ A;  1DE1 A;  1R5P A;  1MTC A;  3EUR A;  2GSR A;  3E3E A;  1JHB A;  3TKP A;  1EGR A;  3A5W A;  2C1Y A;  2L59 A;  3M0F A;  2K8V A;  3NZN A;  5IMZ A;  1TXX A;  1LU4 A;  4BA7 A;  3ZL5 A;  3KJY A;  2DMM A;  3FR9 A;  1ACV A;  4PX1 A;  3C73 A;  3HVX A;  1RW1 A;  2O7K A;  1DUG A;  3FR6 A;  3HJM A;  1FG4 A;  4KF9 A;  1G6Y A;  3H8Q A;  2X4A A;  3VWX A;  1SYX A;  4ML1 A;  3QOU A;  2GT5 A;  3HY2 A;  4KUN A;  3ZYW A;  3PH9 A;  4K0G A;  2X8G A;  3RAZ A;  4I2T A;  2AAW A;  2H1A A;  2DIY A;  4J2F A;  1EZK A;  5DQS A;  2FHE A;  3DD3 A;  2HRN A;  1H4O A;  1VF4 A;  2DSA A;  4OCF A;  4ICY A;  4PTS A;  4BVY B;  4IP1 A;  2O87 A;  1YF0 A;  2UZ8 A;  2OE3 A;  6GSU A;  1B8X A;  4HU7 A;  3FHK A;  4ULX A;  4XTS A;  4LA1 A;  2JAC A;  2M46 A;  2C3T A;  5CO3 A;  4JZQ A;  5ID2 B;  3C71 A;  3FR3 A;  3UOM A;  4QQ7 A;  1XIY A;  1AW9 A;  3KEB A;  4OCE A;  1XVW A;  4AF2 A;  2GST A;  2YJ7 A;  1H75 A;  1NM3 A;  4KGI A;  2YWO A;  1BX9 A;  4ML6 A;  1GLP A;  4RI7 A;  4ZB9 A;  4I6X A;  2FGX A;  3UAP A;  2MYG A;  3IHQ A;  3Q18 A;  1FVK A;  1BAY A;  3F3R A;  3IAM 2;  2CT6 A;  5H5R A;  4KE3 A;  1B9X C;  5KN2 A;  2GZY A;  3HVS A;  2MBT A;  1U88 A;  3MAK A;  2V2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...