1TJDA

The crystal structure of the reduced disulphide bond isomerase, dsbc, from escherichia coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
216
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the reduced disulfide-bond isomerase DsbC from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbC
total genus 70
structure length 216
sequence length 216
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1tjdA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tjdA02
2OACA 2C0GA 2H6XA 3ZMKA 3O3TA 1SKSB 3EU4A 3PH9A 2P5QA 3RHBA 2VUPA 2IMFA 4ZB9A 4KX4A 1K3YA 2IMDA 2REMA 6GSXA 4LL4B 2E2GA 4QL9A 5IMZA 2IMIA 1Z3EA 2YWIA 4HU7A 1X9MB 5G5EA 3UEMA 4Z7XA 3A2VA 1PN9A 3ERWA 3QD9A 1A2LA 5ECNB 1O85A 2R6KA 2C0DA 2NPBA 1G7EA 4F03A 2XPDA 3ISOA 1TRWA 2YJHA 5IMCA 5DBQA 1PGTA 3ZLPA 4GF0A 1JZRA 3E9JB 3UOMA 1EGOA 4O7HA 3TKSC 3HHVA 2XPEA 3IAM2 2X8CA 3I43A 2VCQA 1VRSD 2DIZA 2KHPA 1PL1A 3M1GA 3RPPA 2MZCA 4MDCA 2PPTA 1T7PB 1C72A 4I6XA 1TU7A 5G31A 3GTUA 3LQ7A 5G2ZA 3LJRA 1WPIA 3KM6A 5DJLA 1TRVA 3CYNA 1SKWB 1W89A 3V1WA 5ENUA 5DCGA 3IK7A 2PMTA 1GWCA 4KCAA 2VO4A 5HQPA 3OR5A 2X99A 4KH7A 2B1LA 3ZZXA 3CSJA 2X8HA 1IYIA 4HDEA 2GQKA 3QAVA 3IR4A 2P5RA 4YAPA 5GAND 3APQA 3HDCA 5B8AA 1ERTA 4P3YB 5ABRA 2OA7A 2VLVA 2R37A 3C1RA 1A8LA 8GSSA 3IDVA 1GL8A 2YJ7A 1S3DA 5LNKe 2B7KA 2LEGA 4POKA 1ILOA 2YV7A 3KIJA 3QMXA 3C8EA 4OO4A 1VF4A 2L59A 1MDKA 1WOUA 4GLTA 2HZEA 3ZTLA 2ON5A 2Z9SA 3Q74A 3F4RA 1U3IA 4XRDA 4CDOA 1S3AA 4IJ3A 1O6JA 3TJJA 1GLQA 1GULA 2EC4A 1YQ1A 17GSA 13GSA 4TOPA 2FWEA 3H79A 4BVXA 4N30A 2M46A 2PGTA 2XHFA 5F8BA 3F8UA 1SYXA 5KN2A 2B5EA 3TCOA 3GH9A 4EUYA 3GRXA 1GP1A 2E7PA 1XW9A 1YF1A 1K3OA 3APOA 3F3RA 3UIWA 5DAKB 5DALB 3DRNA 1SU9A 4OWYA 4KSMA 2GLRA 3F6DA 3DYRA 3C1SA 4L0UA 1TXXA 2H6YA 4K9ZA 3BCIA 2VCXA 5ID2B 2H71A 4ZB8A 1ERVA 4GTUA 3GHAA 1U6TA 2CZ3A 4J56E 3DGQA 5FHIA 1YKAA 4KDYA 1X9SB 4ML1A 1ZL9A 1U88A 3QR6A 5C04A 1CQHA 4IP1A 5IMFA 3IXRA 3TOTA 4KDXA 4V1Ag 3M0FA 4L8EA 1DBYA 4GSSA 4BVYA 4ZIJA 5ELGA 2FA8A 5CNWA 2YWNA 3LG6A 3ZIJA 3KZQA 1EV9A 1NW2A 4WF5A 4IN0A 1SJZA 1EOHA 3IK9A 4ID0A 2H0GA 1H4OA 2YNXA 1HNBA 3UL3A 4CHSA 2AHEA 5CRGA 4YQMA 1ZZYA 4Q5NA 1HQOA 4G10A 2ALBA 2JU5A 2R2JA 2CX3A 2PVQA 4O32A 4DEJA 4QQ7A 2B3SA 5CP1A 2V1MA 1ON4A 2JSYA 3GYKA 2H1GA 5KN1A 3FR3A 4IHUA 2JSZA 5ID2A 5KEJA 1R26A 1YDKA 1TKDB 1R5PA 1XVWA 5HFIA 2IMKA 1G6WA 3H1NA 4TR0A 1WE0A 2K8VA 2IPAA 1PRXA 3CSIA 2H73A 3UVTA 1GTUA 2B6MA 3P8WA 3KEBA 1ZGNA 1AC1A 2EIRA 2MYGA 4G19A 4K7IA 3U5RE 3UBLA 2H19A 1PA3A 3BBYA 3GFKA 2GTUA 3EURA 4F0CA 4TW5A 4ZL9A 4O92A 2XC2A 2WCIA 1OVNA 1TI3A 4G9HA 4XS6A 1RW1A 2KP1A 4HQSA 5CAXA 1AW9A 3L78A 4WEYA 3ME8A 4X43A 1Z5YE 3VURA 2P31A 4PX1A 2FY6A 2BJXA 1AQWA 3D5JA 3UAPA 1XFLA 1HD2A 3LFLA 5F05A 5ECIB 2JACA 5F06A 2FGXA 2JZTA 1JHBA 5DQYA 3GUSA 3FZ5A 1PD21 1T4ZA 2VAFA 1T4YA 3HJMA 4IQAA 2FWFA 3GSTA 1N2AA 1K0DA 4OCEA 4KDUA 2WDUA 4KB3A 2G2QA 2CZ2A 3NZNA 4MJAA 4OFTA 1XVQA 4MZWA 4CW9A 2OKAA 11GSA 3EYTA 4EKZA 2KOKA 2CVKA 4FYBA 4EO3A 2JL4A 3FEUA 4JEDA 2F9SA 2PU9C 3TRQA 4TN8A 2FNOA 2C3NA 3HVVA 1SENA 4LA1A 1F2EA 4IJIA 1B8XA 1VGLA 4KGIA 1XOAA 2IWTA 1M9BA 4JBBA 3P2AA 3QFBC 16GSA 2OBKA 1PX6A 4TR1B 4RQRA 3N9JA 4GSNA 3TGZA 1BQ7A 4YQVA 18GSA 1OKDA 1QFNA 3VI5A 1F6MC 4PURA 4ECBA 3HXSA 1SL1B 3IE3A 2H01A 2DIYA 4Q5FA 1Q4JA 4DVCA 1YEXA 3TJKA 3KH7A 2DJ2A 5HR2A 1GTBA 4HUAA 14GSA 4XS4B 2GQLA 1WJKA 5G30A 1MEKA 3LXZA 1K0NA 3L9VA 4BPYA 1IYHA 2KUCA 3HJPA 1NHOA 5IPHA 4MCUA 2PWJA 3APSA 1M7TA 1OC3A 3L9UA 3P90A 1SL0B 4KNDA 4GWRA 4ACSA 1E2YA 3WYWA 1EEJA 2OE0A 3ZVJD 1TJDA 1MDJA 5AN1A 3PGTA 2TIRA 1S3CA 1Z7RA 2C4JA 4QL7A 2H1DA 4K2DA 2LSTA 1X5EA 4ZL7A 1ERUA 2B5YA 3MWHA 22GSA 4IGJA 4H86A 3FYGA 2DJJA 4JU5A 3MDKA 3M9JA 4EE0A 2DMLA 2FLSA 5GAPD 3IC4A 1M2AA 1AAZA 1J08A 2H8LA 3CTGA 4ECCA 3WGEA 2HSHA 2VCWA 3FK8A 1T00A 2AJQB 4GXZA 3FZAA 1H75A 2DJ1A 1URMA 1DE1A 3D22A 1XXUA 3RHCA 2IMEA 5ECPB 1VF2A 3HYPA 3Q6OA 1YF0A 1SKRB 4N0ZA 2OE3A 1DE2A 3WT2A 3TUEA 4WKWA 4TR4A 1NSWA 3LORA 5ECHB 2CAQA 4AJ7A 2RUEA 5JCGA 1U3AA 2X8GA 1Z6MA 4LLRA 5A4UA 4DSQA 3H4KA 5J9BA 1ZCPA 5JWQB 5J3RA 1J9BA 3FW2A 3F4SA 1BG5A 3ZVJA 2R4VA 3P7XA 2AB6A 3H8QA 1O7UA 2OE1A 3J7Yk 3DXBA 3M3MA 5D9TA 2WULA 1MTCA 3D21A 2V41A 3M9KA 2CQ9A 3FZ9A 2LNSA 1NHYA 3GX8A 2YCDA 5CRHA 3HJOA 3FRCA 1F9MA 3TRPA 1F3AA 3VWWA 4HZ2A 2NBSA 3MAKA 1EP8A 1OE7A 5G1LA 5CO3A 1XIYA 3ZYWA 2VCZA 4DSRA 5IPGA 4MABA 5IO0A 1FB6A 3LYKA 2RUFA 3UJ1A 5IO2A 2R3XA 2GDRA 5FWGA 1K0AA 3TKQA 1UVZA 1B4PA 1FO5A 2PUKC 4YAVA 1O81A 5LCZA 1K0OA 3CBUA 1SK2A 1K0CA 2C3QA 5AIVA 3EINA 4GSTA 4POMA 2CX4A 3GURA 1PMTA 1U87A 4GQFA 4FYUA 2NDOA 1Q98A 1TOFA 2H1BA 3GKKA 2I1UA 3LEFA 4KUNA 4V2MA 1FB0A 1JLWA 3RBTA 2LRNA 5IMAA 5D93A 4HJ2A 2JZSA 3QFAC 4FO5A 1TRUA 2YP6A 4RI7A 2D2ZA 4L5OA 3L4NA 2IYJA 2LRTA 5DCHA 20GSA 2F51A 4OD7A 5IQYA 3BJ5A 4WR4A 2HFDA 5IIZA 1YY7A 2KLXA 1A24A 5B8BA 2TRCP 2K8SA 2XBQA 1TTZA 5HFGA 1V98A 1HYUA 2V6OA 3NOFA 5G5FA 4PNGA 1ZYEA 5ELAA 3IRAA 2ON7A 4KCEA 1SK1A 2PVOC 2N5AA 2DJKA 4KW6A 5ECQB 3ZRDA 2WJUA 3ZFBA 3IV4A 3GL5A 3LWAA 2GSRA 2H6ZA 1N8JA 1A2MA 1R4WA 4MMMA 5EVOA 3TJFA 4AJ6A 5D8IA 4O5RA 4MF7A 4MJCA 2IIYA 4I2TA 3D6IA 4L0WA 5KN3A 3KP9A 3DMLA 3LSZA 1K0BA 1YZXA 3Q19A 5HR0A 5F0GA 2FD3A 2VM2A 3TKPA 2RM5A 1PSQA 3C73A 1JLVA 4HJMA 5ECLB 2CVBA 4WBRD 3IHQA 1PQNA 2L4CA 3EC3A 4WXTA 4MZCA 3GTUB 1A8YA 2L6DA 4KA0A 4DSSA 1J0FA 4XS4A 3QAGA 2HRNA 5IMDA 2PBJA 5GZZB 5CYYA 4PXOA 3HA9A 1DSBA 3A3TA 4F0BA 5ECMB 2C80A 3EE2A 2A2RA 3VWUA 3KXOA 3EU3A 4FH8A 4XCSA 4IELA 2C1YA 4JR4A 4MP4A 1CQGA 4K0GA 2G0FA 4K8MA 4POBA 1GSSA 5F07A 4OFNA 7GSSA 2LNTA 1WWJA 4WF4A 2LTKA 1V58A 3IOSA 4I97A 1ST9A 3GL3A 4N0VA 2VL2C 4FIWA 1EWXA 4NMUA 1MD3A 4ZBAA 3HCZA 4MPGA 2MMAA 1SJIA 4AGSA 2V6KA 2AUVA 3HY2A 12GSA 3RPNA 1T1VA 3WGXA 5FT3A 3NIVA 1GUHA 4E8HA 3SBCA 4EDYA 3CXGA 1KTEA 4IKHA 3KCMA 4V1Ap 2LJAA 2YWOA 1YJ6A 2QC7A 6GSUA 1R7HA 3D0ZA 2DLXA 5LD0A 3ED3A 3DKSA 3H93A 3HKRA 1GRXA 3IBHA 3BCKA 1ZYQB 1GTIA 5D9VA 3ZITA 1TI1A 5INYA 1EV4A 1BX9A 4K1FA 4MJEA 4MPFA 3I9V2 3GSSA 4IW9A 2HXKA 3L0HA 1V40A 2FHEA 1WMJA 4EVMA 3G7JA 2YV9A 5A4VA 1ZOFA 2H0HA 5CRWA 3ZREA 1UN2A 1G0TA 1XCCA 2V2GA 5DALA 1Y25A 3G9BA 2QKEA 1F37A 4V2NA 1KBNA 1G6YA 1BAYA 2O87A 1BEDA 1ML6A 1QXHA 4K0NA 2EIQA 2ES7A 2F8FA 1A23A 1EOGA 2K18A 3DIEA 4RI6A 1MD4A 1X0RA 4RUVA 4ZBBA 3VK9A 1GTAA 1HNAA 3CTFA 4N11A 5GSSA 3F4TA 3F0IA 2VD0A 5JWRB 3SWLA 1QQ2A 3GKMA 2X64A 5ECOB 2FUG2 2IL3A 2V32A 1XW6A 2IY2A 2L5OA 1LBKA 5JCWA 1RQMA 3KD0A 2M72A 3DD3A 2FWGA 1FAAA 5E4WA 3LXTA 3FR6A 1SJ6A 1FOVA 5DVBA 3DVWA 1GNWA 2TRXA 2JADA 3QDNA 5EY6A 5DQSA 2VLUA 3CSHA 1M2DA 5HFKA 1ACVA 3US3A 3LGCA 2RLIA 4MF6A 2C8UA 1ABAA 2GSTA 4HS1A 4BWQA 9GSSA 3A2WA 2O89A 1ZMAA 2H30A 1THXA 2WFCA 1PKZA 4AJ8A 1XZOA 3A2XA 4WETA 4OCFA 5J41A 1VF1A 3ZL5A 1WIKA 3EVIA 3W6GA 2YWMA 3VLNA 3I69A 2VLTA 2HZEB 2EIOA 3FKFA 2FCHA 2MBSA 5HR1A 1TDIA 1ERWA 4Q5RA 3TDGA 4ILFA 4HZ4A 4NWYA 2YN1A 2DJ3A 2H72A 4MH2A 1XWAA 2LUSA 5JWOB 1T3BA 3WGDA 1M99A 1K0MA 1XWKA 4KE3A 4D73A 3BOAA 2YZHA 4OO5A 1GSQA 1X5DA 1M0UA 2C3TA 1EP7A 2O7KA 4TKYA 2GSSA 1PL2A 4BL7A 1TP9A 2DJ0A 3GA4A 2WB9A 5H5QA 2IFQB 4PGTA 2LJKA 1AQVA 3CRTA 5HR3A 2LJRA 2GS3A 2J9HA 1TU8A 2YOIA 1FHEA 4F82A 1K3LA 3FR9A 4J2FA 3HZ8A 2H0IA 2ZCTA 4ZBDA 4FYCA 2LRCA 1M2BA 3QAWA 5AIXA 4KAEA 1THOA 2YPMA 3W8SA 2VOCA 4XHMA 2HRFA 2RIIA 4NAXA 4V2LA 3KH9A 2HE3A 3IPZA 3KJYA 2GT6A 1V2AA 3HVXA 2CAIA 2BTOT 2HZFA 5G1KA 3HVSA 3ZMLA 1AUCA 3RDWA 2GT5A 2B5XA 4JR6A 3F6FA 4D73B 3F3QA 2MMZA 2I4AA 1TRSA 1B4QA 1QMVA 3QOUA 1DUGA 2B1KA 1WP0A 4JRRA 3RAZA 3G7IA 4OMVA 1XW5A 2DMMA 3BD2A 2ZNMA 2K9FA 3MNGA 4PQIA 2QGVA 1A2JA 3K8NA 3KMOA 4NPBA 1OE8A 4ZXGA 5IMVA 1X9WB 4OFMA 3E0UA 3TKSA 1I9DA 5JCUA 3GH6A 4K7OA 3GKNA 1V9WA 1B9XC 2JZRA 1OYJA 2OJLA 3AY8A 2HSYA 5J4UA 1WRYA 5E59A 4K6XA 3N5OA 1QK8A 4NXIA 2XBIA 5DJMA 2J23A 3ZFLA 5DDLA 5EPFA 4XTSA 2L57A 4E8EA 2O85A 1GLPA 4HI7A 4MK3A 5AGYA 3A5WA 2WS2A 1E6BA 2H74A 2RM6A 1XBSA 5D9XA 3WD6A 4X0XA 5EL8A 3QCPA 5A5KA 3TJGA 1PX7A 2H70A 3FHKA 1USBA 2I3YA 4N10A 1XPVA 2GZYA 3MSZA 3G7YA 3ERFA 2MBTA 4EC0A 2AYTA 3TB2A 3VWXA 4EXJA 4EF0A 3UBKA 5B6NA 2HNLA 3KMNA 3UMAA 4ZILA 2NTOA 6GSTA 2GVPA 2IFQA 2YZUA 2IJYA 3EWLA 1QUWA 2ZUPA 3U6VA 2VL9A 4NHZA 2GZPA 3J7Yb 1GSUA 1PKWA 4ULXA 1GNEA 1R5AA 4I2UA 2VCTA 2DC5A 1NM3A 3GIXA 4X1UA 3ZIVA 4ECJA 3PR8A 4IVFA 5H5RA 1UC7A 2E2MA 4MZBA 2PERA 2N5BA 5D9WA 4MH3A 3TJBA 3CMIA 3F63A 3DVXA 1AXDA 4PNFA 4ZL8A 3JCML 3TKSE 2K6VA 3D4TA 3HD5A 4JZQA 2DBCA 3GKXA 2LS5A 2L4QA 2WGRA 1OKTA 4BA7A 2OBIA 2MMNA 1OC9A 2H75A 4POLA 2I9HA 4I8BA 3S9FA 5ECRB 3TOUA 3R2QA 4XIHA 2GSQA 6GSVA 4NHWA 5KN0A 3CRUA 4GQCA 2HLSA 1LU4A 4BWSA 5A4WA 3FZ4A 4ML6A 2LQOA 1B9YC 5IM9A 2BMXA 3Q18A 1GSFA 3C71A 4NV2A 3LYPA 3KGKA 5J5NA 4TR1A 1SD8A 1GUKA 3IA1A 1AIUA 2LV3A 4AF2A 3GX0A 1A0FA 3VPTA 2OADA 3UVHA 1GSYA 1YKCA 10GSA 4LL1B 3W8JA 5IOWA 1EGRA 2VL2A 2LQQA 2GQMA 1VF3A 1EEMA 2H66A 3O6TA 5CREA 2F3MA 1I5GA 3IAS2 4DSSB 4TXVA 3QPMA 1BYEA 2KP2A 2F8AA 2QSIA 2IN3A 4YQUA 1FG4A 6GSWA 1KNGA 1XOBA 4MA9A 2DSAA 3E3EA 1GSEA 3TRXA 1EZKA 5DAKA 1B48A 2CT6A 2FA4A 4GCIA 1XWGA 4F9ZA 2GZZA 2AAWA 1UA5A 2P0GA 3F9UA 1HNCA 3GV1A 3VPQA 3WT1A 1XWCA 1QGVA 4IBPA 4GRFA 1SD9A 2VL3A 2VM1A 1AQXA 6GSYA 4J57E 5COHA 2FWHA 3GNJA 4TXOA 3VFIA 3L9SA 1RK4A 1G7OA 3ME7A 1M9AA 5GSTA 1XWBA 5B6MA 2H1AA 1MDIA 3M8NA 1OC8A 3PINA 5ECKB 5J9CA 1T8EB 4HQZA 3GN3A 3VWVA 4F2IA 1GH2A 1KEBA 2N5FA 4NV5A 3KP8A 3EMPA 4PQHA 4K7NA 4ISDA 3TKRA 4KSOA 2B7JA 3I6AA 1JZOA 1TW9A 4IQ1A 4RQXA 5H5SA 2M80A 4LMWA 1V57A 3HZ4A 1GSDA 3ERGA 3O76A 3VI7A 4LMVA 2CVDA 4EDZA 2PN8A 2R5GA 4ECIA 2E0QA 4HOJA 1SL2B 4MF5A 3DEXA 1F3BA 3KTBA 5AISA 4WR5A 2HT9A 5D73A 4Q5QA 1A0RP 1O8XA 1JFUA 1SYRA 2HYXA 1YEPA 1O8WA 4TXOB 2GGTA 4IS0A 4TR3A 4TRXA 1BJXA 5C00A 2HI7A 2VD1A 1GUMA 3C7MA 4XS1A 4XRAA 2C0EA 4I5QA 2L6CA 1JZDA 3D4MA 6GSSA 2I81A 2NVLA 4MLYA 1Z9HA 1JZWA 4PQ1A 1LJRA 4TVEA 1Y6EA 2WZ9A 1TK8B 1OC9B 1FVKA 4IP6A 1FW1A 4HU9A 1TK5B 4PUFC 5ECSA 5L71A 4JE1A 2WRTA 4WBJA 19GSA 1W4VA 5CRDA 4HEA2 1X5CA 2CA8A 5IOXA 2H76A 4G2EA 2YANA 3KTLA 1SK0A 4PUAA 2CV4A 1FVJA 3DWVA 4ZB6A 3GMFA 3UARA 5B7CA 2VCVA 5D96A 4EL1A 2L5LA 3EMXA 2MMOA 1Z7PA 1O73A 2O8VB 1Z6NA 2A2SA 4MJBA 4L5LA 2AV4A 2LKUA 2A4VA 1OAZA 4YH2A 2VIMA 1TK0B 2C0FA 3FY7A
chains in the Genus database with same CATH superfamily
2OACA 2C0GA 2H6XA 3ZMKA 3AHWA 1BANA 3DXOA 3O3TA 1DMQA 1SKSB 3EU4A 1DVCA 5LC6A 3PH9A 2P5QA 3RHBA 1E3RA 1EQKA 3X40A 4JF8A 1YIT3 2VUPA 3NM2A 2IMFA 4ZB9A 4KX4A 3EN8A 1K3YA 2IMDA 2REMA 6GSXA 4LL4B 1IT8A 2E2GA 3F7XA 4QL9A 5IMZA 2HRAA 1KQS2 3NM7A 2IMIA 3PYJA 1Z3EA 2YWIA 4HU7A 1DE3A 5G5EA 1X9MB 3UEMA 1MWSA 3FG4A 5FGOA 4CCVA 3GRDA 3HIIA 3LTBA 4Z7XA 6GSPA 3A2VA 1PN9A 3ERWA 2OQEC 2YFIB 3X3ZA 3QD9A 1A2LA 1BIRA 2E2TA 5ECNB 1O85A 4N6OB 2R6KA 2C0DA 2NPBA 3HIGA 1G7EA 2D1WA 4F03A 1BVIA 2XPDA 3ISOA 1TRWA 1LRAA 2YJHA 1A90A 5IMCA 1AVLA 5DBQA 4LMIA 1K9M4 1PGTA 3EX9A 3ZLPA 4GF0A 1JZRA 1BNFA 3E9JB 3UOMA 3E99A 1EGOA 4O7HA 3TKSC 3HHVA 2XPEA 3IAM2 2X8CA 3I43A 6RNTA 2VCQA 3BU4A 4H61A 1CEWI 1VRSD 2DIZA 2W0QA 2KHPA 1M9GA 1PL1A 3M1GA 3RPPA 2MZCA 4MDCA 2PPTA 1T7PB 1C72A 4I6XA 1TU7A 5G31A 2C11A 1RLSA 3GTUA 3LQ7A 5G2ZA 3LJRA 1WPIA 3KM6A 1STDA 5DJLA 1CYVA 1TRVA 4LEHA 3CYNA 1SKWB 1W89A 2CFWA 3V1WA 5ENUA 1JB4A 5DCGA 1K8A4 3IK7A 2PMTA 1GWCA 4BL2A 4KCAA 1ZO2A 2VO4A 3FF2A 1JBTA 3BLZA 4HM5B 5HQPA 2BMOB 3OR5A 2X99A 4KH7A 2B1LA 3ZZXA 3PPUA 3CSJA 2X8HA 1IYIA 4HDEA 4H3UA 2GQKA 3QAVA 3MKIA 3B7CA 4MMZB 1M1K4 1NO3A 4EV2A 1I2GA 3IR4A 5M19A 2P5RA 4YAPA 2YX9A 9RNTA 2Y74A 3KZTA 5GAND 1Q7HA 3N54B 1W7CA 3APQA 3HDCA 2QA1A 4PTSA 1W4NA 5B8AA 1PN0A 1W6CA 1ERTA 4P3YB 5ABRA 2CG1A 2OA7A 2VLVA 2R37A 2OQEA 3C1RA 1WMNA 1A8LA 8GSSA 3IDVA 1GL8A 1FGMA 4WHAA 1K28A 2MF7A 4KFFA 2YJ7A 1S3DA 3LT9A 5LNKe 3T0UA 2B7KA 2LEGA 4POKA 1ILOA 2YV7A 3KIJA 3QMXA 4FQUA 3C8EA 4OO4A 1RJOA 1VF4A 2L59A 1MDKA 3WDGB 1U5OA 4BL3A 1WOUA 4LGQA 2HZEA 4GLTA 3ZTLA 1Q42A 3SLUA 1RSNA 2ON5A 2Z9SA 2XSOB 2CW9A 3JUNA 3OWSA 3Q74A 3F4RA 1U3IA 4XRDA 4Z2UA 4CDOA 1S3AA 3AGNA 3KN4A 4CY8A 4IJ3A 3L0RA 1O6JA 5D82A 3TJJA 1GLQA 3LTDA 1GULA 1KC84 2EC4A 1W6GA 1YQ1A 17GSA 1GY7A 2F5MA 13GSA 4TOPA 2FWEA 3H79A 4BVXA 4N30A 2M46A 2PGTA 2XHFA 4HBRA 5F8BA 1RRLA 3F8UA 1SYXA 5KN2A 2B5EA 2ML5A 3SOAA 3ZG0A 5RNTA 3TCOA 3GH9A 4EUYA 2R41A 3NQZA 1B27A 3GRXA 1GOYA 1GP1A 2E7PA 1XW9A 1YF1A 1K3OA 2OOVA 1MWUA 3APOA 3F3RA 3UIWA 5DAKB 4G0IA 5AEWB 2OTJ3 5DALB 3DRNA 1SU9A 5AIIA 4KSMA 4OWYA 2GLRA 3F6DA 3DYRA 3C1SA 4L0UA 1TXXA 2H6YA 1W00A 1DYUA 4K9ZA 1BRJA 2GBXB 5AI1A 1OACA 3BCIA 2VCXA 3EN1B 5ID2B 2H71A 1I0VA 3UL6A 2ZL8A 4ZB8A 1ERVA 1W02A 1N5HA 4GTUA 3GHAA 1U6TA 2CZ3A 3LOYA 4J8TA 3MIXA 4J56E 1RGCA 3DGQA 5FHIA 2QIYA 1YKAA 4KDYA 1X9SB 4ML1A 4GHOA 1ZL9A 1U88A 1FYSA 3QR6A 2J8XB 2C0FA 3B4OA 1CQHA 5C04A 2KXGA 5IG0A 4IP1A 2WOFA 3IXRA 5IMFA 1SJWA 1B2MA 1CH0A 4KDXA 3TOTA 4V1Ag 3M0FA 4L8EA 1FGQA 1DMNA 1DBYA 1BSDA 4HM2B 4GSSA 4BVYA 4ZIJA 5ELGA 3UL5A 2FA8A 3G713 5CNWA 1RNTA 2YWNA 3LG6A 3LW9A 1D6UA 1IU7A 5M1AA 3ZIJA 3KZQA 4G1MB 1EV9A 1NW2A 4WF5A 4IN0A 1SJZA 1YGWA 1EOHA 3IK9A 4ID0A 2FXTA 3DY5A 3JUPA 2H0GA 1H4OA 2YNXA 1HNBA 1D6ZA 4OUQA 3UL3A 4EBGA 4CHSA 2AHEA 5CRGA 4YQMA 1ZZYA 4Q5NA 1HQOA 4G10A 3CC23 4LSOA 2ALBA 2JU5A 2R2JA 2CX3A 2PVQA 4R9LA 4O32A 4DEJA 4QQ7A 3DH2A 2B3SA 5CP1A 3WMDA 2V1MA 1ON4A 2JSYA 3GYKA 7STDA 2H1GA 5KN1A 3FR3A 4IHUA 4HAAA 4WYKB 2JSZA 5ID2A 5KEJA 3RNTA 2GEXA 1R26A 1YDKA 1AR0A 1TKDB 3AMOA 3DUKA 1R5PA 1XVWA 2IMKA 5HFIA 2P38A 1G6WA 3H1NA 4HZ9B 3ECFA 4TR0A 4MEIA 1WE0A 2K8VA 1L5GB 2IPAA 3MG2A 1PRXA 3CSIA 2P09A 2H73A 1RGGA 1GTUA 3UVTA 2B6MA 3P8WA 4R4KA 3KEBA 1ZGNA 1AC1A 3OWUA 2EIRA 2MYGA 1TP6A 4G19A 3T8NA 1OGXA 2QEX3 4K7IA 3U5RE 3UBLA 2H19A 3FG1A 2CFLA 1PA3A 3BBYA 3GFKA 2GTUA 3FGYA 3EURA 1JKGB 4JRFA 5BXQA 4F0CA 3LTCA 4TW5A 4KT3B 1UI8A 2W2CA 1O7PB 3PGBA 4ZL9A 1Q7Y4 4O92A 3UB1A 2XC2A 2WCIA 1OVNA 1BNIA 1TI3A 4G9HA 4XS6A 1RW1A 2KP1A 4HQSA 5CAXA 1AW9A 3L78A 4WEYA 5ELUA 2V1LA 3ME8A 2YFLB 4X43A 2IMJA 1Z5YE 2QA43 3N9HA 1BNGA 3VURA 2P31A 2FY6A 4PX1A 2BJXA 1AQWA 3MYDA 3D5JA 3UAPA 1QJGA 4N6MA 4IIAA 1LNIA 1XFLA 1IV9A 1HD2A 3LFLA 5F05A 2BO9B 5AYRB 5ECIB 3JUMA 4L7KA 3BNEA 2JACA 1TU5A 1VQM3 5KOWA 5F06A 4IPBA 2FGXA 1BOXA 2JZTA 1JHBA 5DQYA 3CCR3 3O8YA 3GUSA 1RGEA 1YJ93 3ALAA 1DMMA 3FZ5A 1PD21 1T4ZA 2VAFA 3RDEA 3VF1A 1T4YA 2UZ8A 3NBBA 3HJMA 4IQAA 1N9EA 2R0CA 3CCE3 2FWFA 3GSTA 1IK3A 3S29A 3LMLA 1N2AA 1RDSA 3LXUX 1K0DA 4OCEA 4AKZA 3K0ZA 4KDUA 1FGOA 3FMWA 2CWVA 2WDUA 3LT8A 4KB3A 2G2QA 2CZ2A 3NZNA 4EIQA 2B24B 2BIRA 4MJAA 1OF5B 1M3IA 3OX9A 4HM1B 4OFTA 1LNHA 3EHCA 3URPA 1XVQA 1E97A 4MZWA 1LOWA 4CW9A 2OKAA 2CKFB 11GSA 3EYTA 1UW1A 1ZYNA 1C7HA 4EKZA 2KOKA 2CVKA 4FYBA 4EO3A 2JL4A 3FEUA 4JEDA 2F9SA 2HMJB 2PU9C 3TRQA 4CDLA 1RHLA 1IVVA 4TN8A 4XBTA 2BMQB 2FNOA 2W9PA 2F5WA 2C3NA 1MNLA 3SEDA 3HVVA 1SENA 4LA1A 2C10A 1F2EA 4IJIA 1BGSA 1O7HB 1B8XA 4O3VA 2F99A 2Z76A 4XDVA 1GY6A 1VGLA 2OCTA 4KGIA 2XR8B 1XOAA 2IWTA 1M9BA 4JBBA 1PY3A 3P2AA 1JN5B 3QFBC 1BRIA 16GSA 2OBKA 1W6YA 1PX6A 4TR1B 3CCM3 3FZWA 4RQRA 2HMNB 3GAXA 3N9JA 4GSNA 3TGZA 1BQ7A 2XRXB 1TTOA 4NREA 4YQVA 4FCMA 18GSA 1OKDA 3S27A 1QFNA 3VI5A 5DRVA 1F6MC 5M18A 4PURA 4ECBA 3DGMA 4O5UA 2P0XA 2UX0A 3MSOA 3HXSA 1SL1B 4YKGA 3WOEB 3IE3A 2K3DA 2H01A 2DIYA 2CHCA 5IW9A 3F8HA 4Q5FA 1Q4JA 4DVCA 1YEXA 3V98A 3OV4A 3TJKA 3KH7A 4OK0A 2DJ2A 4J5GA 5HR2A 1GTBA 4HUAA 14GSA 4XS4B 2DKHA 1FOHA 2GQLA 1WJKA 5G30A 1MEKA 3LXZA 1K0NA 3L9VA 1FZUA 4BPYA 1IYHA 2KUCA 3WA3A 3BNBA 2KF3A 2GBWB 3HJPA 1NHOA 5IPHA 2F98A 4MCUA 2PWJA 3APSA 1M7TA 1OC3A 3L9UA 3QRDA 3WA2X 4KVHA 4USSA 1T2IA 3P90A 1EUIC 1SL0B 4KNDA 2CX0A 4GWRA 4ACSA 5KOXA 2A2PA 3NV0A 1E2YA 3WYWA 2Z6BA 1BRNL 1IVXA 2SBLA 3V92A 3SOYA 1EEJA 1S5AA 2OE0A 3ZVJD 1TJDA 1RMSA 1MDJA 5AN1A 3PGTA 2TIRA 1S3CA 1Z7RA 1GMRA 2C4JA 3DM8A 3CME3 2H1DA 3F40A 4K2DA 2LSTA 3CC43 1X5EA 4QL7A 2BMRB 4ZL7A 1FGTA 1ERUA 2B5YA 3MWHA 22GSA 4EXRA 4IGJA 1UCJA 4K61A 1O7NB 4H86A 3EJVA 3FYGA 2DJJA 4JU5A 3MDKA 1YIJ3 3K9MC 3M9JA 4EE0A 3A5EA 2DMLA 2FLSA 5GAPD 4MMYB 1I3FA 4LZIA 1M2AA 3IC4A 2QGUA 1AAZA 1UDII 1J08A 2H8LA 3CTGA 4ECCA 3WGEA 3D5GA 2HSHA 2VCWA 3FK8A 1T00A 2AJQB 4KZ1A 3FF0A 1X1XA 4GXZA 1QVF2 3FZAA 1H75A 2DJ1A 1URMA 2WO0A 1FGRA 2XGLA 3R3EA 1STFI 1DE1A 3JUQA 1W2B2 1JV2B 3D22A 1XXUA 4IT7A 3RHCA 1SIIA 2IMEA 3HX8A 5ECPB 2UUGC 1VF2A 1WNHA 3HYPA 1DVDA 3Q6OA 1YF0A 1SKRB 1UGIA 4N0ZA 1A2VA 4EC6A 2OE3A 1DE2A 3WT2A 3IMAB 3TUEA 1VQ43 5FW5A 4WKWA 2HRKA 4TR4A 3DGOA 1NSWA 1FA3A 3LORA 5ECHB 1V74A 2CAQA 4AJ7A 3FY7A 1MGWA 2RUEA 5JCGA 1U3AA 1VQL3 2X8GA 1Z6MA 4LLRA 5A4UA 4DSQA 2ZDJA 3H4KA 5J9BA 1ZCPA 5JWQB 5J3RA 1J9BA 3FW2A 3F4SA 1VQ93 1BG5A 3ZVJA 2R4VA 3P7XA 2R4IA 2AB6A 4Z2RA 2CWTA 3H8QA 1O7UA 2OE1A 3J7Yk 3DXBA 3D5IA 2WGQA 3M3MA 4XBYA 4K90B 5D9TA 1UCIA 2WULA 1MTCA 3D21A 2V41A 3M9KA 2CQ9A 1I70A 3FZ9A 2LNSA 1EG9B 1NHYA 3GX8A 4QWTA 5BU4A 1BU4A 2YCDA 5CRHA 3HJOA 3FRCA 1F9MA 3TRPA 1F3AA 1US1A 3VWWA 4HZ2A 1ULIB 2NBSA 3MAKA 1EP8A 1OE7A 5G1LA 4YKFA 5CO3A 1XIYA 3ZYWA 2VCZA 1RGAA 4DSRA 5IPGA 4MABA 1I2FA 3PZWA 5IO0A 1FB6A 1Q824 3LYKA 2KF5A 2RUFA 3UJ1A 1BRKA 5IO2A 2R3XA 2GDRA 5FWGA 1QALA 1K0AA 3NHXA 4MMXB 3TKQA 1UVZA 1B4PA 1FO5A 2PUKC 4YAVA 1O81A 5LCZA 1K0OA 3CBUA 1SK2A 4X2OA 1K0CA 2C3QA 4KF9A 1X1UA 5AIVA 3EINA 4GSTA 4POMA 1G02A 3EB8A 1E3VA 3X3XA 2GSPA 1IDPA 5IG4A 2BU4A 1Q864 2CX4A 1A2KA 1K734 4I4KA 3GURA 1PMTA 1U87A 4GQFA 3G0KA 5CK6A 4FYUA 2CC3A 2NDOA 2CIUA 1Q98A 3QK9A 1TOFA 1LOYA 1Q9EA 2H1BA 3GKKA 3NBJA 2I1UA 3LEFA 2E2VA 4KUNA 4V2MA 1FB0A 1IYYA 4MNNA 1JLWA 3RBTA 2LRNA 1GYBA 5IMAA 5D93A 4HJ2A 2JZSA 3QFAC 2C4BA 4FO5A 1TRUA 2YP6A 5STDA 1MWRA 4RI7A 2D2ZA 4L5OA 5D81A 3L4NA 2IYJA 1OHOA 3MG1A 2LRTA 5DCHA 4K5SA 20GSA 2F51A 3STDA 4OD7A 2CG0A 3FH1A 5IG3A 5IQYA 1Q40B 3BJ5A 4WR4A 2HFDA 5IIZA 4ICYA 1YY7A 1VQK3 4K1UA 2KLXA 1A24A 2M7OA 3NXJA 5B8BA 2TRCP 3I563 3BIRA 5CXOA 1M1XB 5KP1A 1SIHA 2K8SA 2XBQA 3EE1A 3N8BA 2KRTA 3G4S3 1TTZA 5HFGA 1V98A 1HYUA 2XEPA 3A76A 1N9JA 2V6OA 4U13A 8CHOA 1EKMA 3NOFA 4GL6A 3X42A 1JB5A 5G5FA 1GSPA 4PNGA 1ZYEA 5ELAA 3CPW2 3IRAA 1YJN3 2ON7A 4FMBA 4KCEA 3EBTA 1SK1A 2RBIA 2PVOC 3EBYA 5AYSC 2N5AA 2F4YA 3IC8A 2DJKA 4KW6A 5ECQB 3ZRDA 1RGLA 2WJUA 3ZFBA 5D83A 2JQ5A 3IV4A 3GL5A 1S3RA 3LWAA 2GSRA 2H6ZA 1N8JA 1A2MA 1R4WA 1YGEA 4MMMA 5EVOA 3TJFA 4AJ6A 5D8IA 4O5RA 3NV0B 4MF7A 4MJCA 2IIYA 4I2TA 3D6IA 2W6JH 4L0WA 5KN3A 2FNQA 3KP9A 2OWPA 3DMLA 3A5IA 1NU3A 3LSZA 1K0BA 1O7WB 1YZXA 3KSPA 3Q19A 3D3LA 5HR0A 3IPTA 5F0GA 2FD3A 5GSPA 2VM2A 3TKPA 2RM5A 1PSQA 3C73A 1JLVA 4HKVB 4HJMA 5ECLB 2CVBA 4WBRD 3IHQA 2L4VA 1PQNA 1B2UA 2L4CA 3EC3A 4WXTA 4MZCA 3GTUB 2AADA 1A8YA 3HI7A 3U1WA 6STDA 2L6DA 4KA0A 4DSSA 1LQMB 1J0FA 4XS4A 3QAGA 1BSAA 2HRNA 5HOHA 3KSED 5IMDA 1TFKA 1RGHA 1FW7A 2PBJA 5GZZB 5CYYA 4HJLB 4PXOA 1WMOA 3HA9A 1DSBA 2INXA 3A3TA 4F0BA 1YHQ3 5ECMB 2C80A 3EE2A 4BIRA 2A2RA 3VWUA 1O7GB 1HYFA 3PXMA 3KXOA 3EU3A 4FCZA 4FH8A 4XCSA 4IELA 2C1YA 4JR4A 3OW22 4MP4A 1CQGA 4K0GA 1N8R4 3SXXA 2G0FA 4K8MA 4Q53A 4POBA 3LH4A 3CC73 1B20A 1IV7A 1GSSA 4X2HA 5F07A 3SVAA 4OFNA 3NX0A 7GSSA 3DZLA 2LNTA 1WWJA 2IUJA 4WF4A 2LTKA 1V58A 1B2XA 3IOSA 4I97A 1ST9A 3GL3A 4N0VA 3Q90A 2VL2C 4FR9A 4BTYA 1EWXA 4FIWA 4NMUA 1MD3A 4ZBAA 3HCZA 4MPGA 1TRPA 2MMAA 1SJIA 3SYUA 3MYTA 2V6KA 1Y4KA 2AUVA 2GU1A 4AGSA 3HY2A 3U97A 12GSA 4G0KA 3RPNA 1T1VA 3H51A 3WGXA 2A15A 2B1XB 1VZZA 2A4HA 5FT3A 4BTWA 1UUGB 5BMUA 3WR2A 3NIVA 2HMKB 1GUHA 5IEPA 4HM8B 4E8HA 3SBCA 4EDYA 3BB9A 3CXGA 1KTEA 4IKHA 3KCMA 4V1Ap 3HK4A 5CF1A 1M904 2LJAA 4RNZA 4XBXA 2YWOA 1YJ6A 2QC7A 6GSUA 1R7HA 1QMAA 3D0ZA 2DLXA 1B2ZA 5LD0A 3ED3A 1HKXA 2HMOB 5EEOA 3DKSA 3H93A 3HKRA 3CMA3 1GRXA 3KKGA 3IBHA 3PCRA 3BCKA 3GSPA 4O02B 1ZYQB 1GTIA 1BUJA 5D9VA 3ZITA 1TI1A 5INYA 4K2XA 3FSDA 1EV4A 5BVBA 1BX9A 4K1FA 4MJEA 5JPPA 4MPFA 3I9V2 4HM0B 3GSSA 4IW9A 2CFGA 2HXKA 3B8LA 3L0HA 5JBSA 1V40A 2FHEA 7RNTA 1WMJA 4EVMA 3AHSA 3G7JA 2YV9A 4N6V0 5A4VA 1ZOFA 2H0HA 4FCJA 5CRWA 4FMDA 1UN2A 3ZREA 1G0TA 1XCCA 2V2GA 4WWUC 1KD14 5DALA 2JDIH 3WHOA 1Y25A 3CCU3 3G9BA 3CCS3 2QKEA 1F37A 4V2NA 1KBNA 1G6YA 2X4AA 1BAYA 2W9QA 3RGAA 2O87A 1I2EA 1ZX2A 1BEDA 2RGQA 1ML6A 1ZGXA 1VQO3 1QXHA 4K0NA 2EIQA 2ES7A 2F8FA 4BVYB 1A23A 1EOGA 2K18A 3DIEA 4RI6A 3EF8A 1MD4A 1X0RA 4RUVA 4ZBBA 1GTAA 3VK9A 1HNAA 2OTL3 1T2HA 5IEOA 3CTFA 4N11A 5GSSA 3F4TA 5KP3A 3F0IA 1A67A 3Q2PA 2VD0A 5JWRB 1WTHA 3SWLA 2Q07A 1QQ2A 3GKMA 1ZYPA 1SPUA 1J2BA 1BSEA 2F86B 2X64A 5ECOB 2F56A 2FUG2 2IL3A 2V32A 1XW6A 2IY2A 3K5TA 2L5OA 1LBKA 5JCWA 1RQMA 3KD0A 1AQZA 2DKIA 4HZBB 2M72A 3DD3A 1UCKA 2FWGA 2HSMA 1FAAA 5E4WA 3LXTA 5I97A 3FR6A 3ZG5A 1SJ6A 1GMPA 3GZBA 1T5YA 4WYKA 1FOVA 5DVBA 3DVWA 1GNWA 2TRXA 1EA2A 1WQLB 1WMPA 2KF4A 2JADA 3QDNA 2KAAA 5EY6A 5DQSA 5CLKA 2VLUA 3CSHA 1MWTA 1M2DA 2K54A 5HFKA 2AAEA 1ACVA 3VGNA 3US3A 3LGCA 2RLIA 4MF6A 2C8UA 1ABAA 2GSTA 3D9RA 4HS1A 4BWQA 9GSSA 1C54A 3A2WA 1GS3A 1BSCA 1ZMAA 2O89A 2H30A 1THXA 2WFCA 1ROVA 4EYCA 1PKZA 4AJ8A 4KFEA 3EPTA 1XZOA 2O9UX 2XH9A 3A2XA 4WETA 3CU3A 4OCFA 1QAKA 5J41A 2O3OA 3AGOA 1VF1A 2PZVA 3ZL5A 2LYXA 2W56B 3F9SA 3JVCA 1CQSA 2K0MA 1WIKA 3CCV3 4CY6A 3EVIA 3W6GA 1BSBA 3I553 2YWMA 4HM6B 3VLNA 2RFRA 1GD4A 3I69A 2ZA4A 1GD3A 1CYUA 2VLTA 2HZEB 5EQLA 3S5CA 2EIOA 5AIFA 3FKFA 4K5RA 1RN4A 2FCHA 2MBSA 5HR1A 1TDIA 1ERWA 3TDGA 4Q5RA 4ILFA 5CF2A 4HZ4A 4NWYA 2YN1A 3GZRA 2DJ3A 2H72A 4MH2A 1XWAA 2LUSA 5JWOB 1T3BA 2GXFA 3NUVA 3WGDA 1M99A 1K0MA 1XWKA 4KE3A 3KIIA 4D73A 3BOAA 2HOHA 2YZHA 4OO5A 1VQ53 2XSHB 1GSQA 4L8PA 1X5DA 1M0UA 4X4JA 2C3TA 1EP7A 3PS8A 2O7KA 4TKYA 2GSSA 1PL2A 4BL7A 1TP9A 2DJ0A 1LXEA 3GA4A 2WB9A 5H5QA 1FUWA 1MGRA 4G0LA 1ISKA 1YNVX 3Q1CA 4AKYA 2IFQB 4PGTA 3SX1A 2LJKA 1AQVA 3CRTA 5HR3A 2LJRA 2GS3A 1BNRA 3JUOA 4L8OA 2J9HA 1OHSA 1TU8A 2YOIA 1FHEA 4F82A 1K3LA 3FR9A 4J2FA 3HZ8A 3DGNA 1IVUA 2H0IA 2ZCTA 4ZBDA 4FYCA 2LRCA 1M2BA 3QAWA 5AIXA 4KAEA 4BVXB 1HZ1A 1THOA 2YPMA 3BNDA 1NWWA 2PNCA 2GEYA 4O5QA 3W8SA 5BIRA 2VOCA 4XHMA 1PU4A 2HRFA 2RIIA 4NAXA 2XFTA 4V2LA 4FMCA 1A2PA 3KH9A 1RN7A 2HE3A 1R4CA 3IPZA 2I9WA 4GSPA 3KJYA 3BNCA 2GT6A 1V2AA 3HVXA 2WGOA 3F14A 3MPHA 1K41A 2CAIA 2BTOT 4NHFA 5A0OB 2HZFA 1OHPA 3KFQC 5G1KA 3HVSA 3ZMLA 1SQWA 1AUCA 3RDWA 2GT5A 1OCVA 3FLJA 2BNGA 1JKGA 2B5XA 4OVMA 4JR6A 3F6FA 4D73B 3F3QA 2MMZA 2I4AA 4O8SA 1TRSA 2ZHXB 1B4QA 1YI23 1QMVA 3QOUA 1DUGA 3K7CA 2B1KA 1WP0A 4JRRA 3RAZA 3G7IA 4J9AA 4OMVA 1ULJB 1XW5A 2DMMA 2YFJB 3BD2A 2ZNMA 2GU3A 2K9FA 3WOFB 3H3HA 1NNVA 3Q3FA 4HSCX 3MNGA 5IF6A 4LYLB 4PQIA 2KF6A 2QGVA 4MJDA 3ROBA 1RCLA 1B21A 1A2JA 3K8NA 3KMOA 4NPBA 1OE8A 3RGRA 4ZXGA 5IMVA 1X9WB 4OFMA 3E0UA 3NQYA 2CWUA 3TKSA 1BRHA 2XFSA 1I9DA 5JCUA 3GH6A 2CK3H 4K7OA 3GKNA 1V9WA 1B9XC 2JZRA 1IT7A 1OYJA 2OJLA 3AY8A 2HSYA 5J4UA 1WRYA 1AY7A 5KP4A 3CCJ3 5E59A 4K6XA 3N5OA 1QK8A 4NXIA 2XBIA 5DJMA 1S723 3M8CA 3CNXA 3G16A 2J23A 3ZFLA 1GY5A 5DDLA 5EPFA 4XTSA 2L1SA 1VQP3 2L57A 4E8EA 1IQYA 2O85A 1GLPA 4HI7A 4PEJA 3DGLA 2P05A 4MK3A 5AGYA 1IVWA 3A5WA 3D4AA 4BU4A 2WS2A 4RNTA 1E6BA 2H74A 2RM6A 1XBSA 5D9XA 3WD6A 4X0XA 3HVNA 1BAOA 3QCPA 5EL8A 5A5KA 3TJGA 1DETA 1PX7A 3EQQB 2H70A 3FHKA 1PFOA 1USBA 2I3YA 1GOUA 2P0MA 4N10A 1BRGA 1XPVA 1KSIA 2GZYA 3MSZA 1B2SA 3MHEA 3CQFA 3G7YA 3ERFA 1IQXA 3LZAA 2MBTA 4EC0A 2AYTA 3TB2A 3VWXA 3OWYA 4EXJA 1JN5A 4EF0A 4O2HA 4HM7B 3UBKA 5B6NA 2HNLA 1RN1A 3KMNA 3UMAA 1ZS7A 1I3IA 2NTOA 2RSXA 4ZILA 6GSTA 2GVPA 2IFQA 2YZUA 3DMCA 1LOXA 2IJYA 3EWLA 1QUWA 2ZUPA 3GZYB 1F8NA 3U6VA 2VL9A 3NBRA 4NHZA 2GZPA 1N5PA 1W01A 1RGKA 1NDOB 3J7Yb 1GSUA 1PKWA 3X3YA 4ULXA 1GNEA 3K63A 1R5AA 1RTUA 4I2UA 5EVHA 2VCTA 2DC5A 1NM3A 3GIXA 4DKIA 4X1UA 1RKYA 1JB2A 3ZIVA 2STDA 4ECJA 3D79A 3T8UA 3PR8A 4IVFA 5H5RA 1Q814 1UC7A 4R9KA 2E2MA 1IQ8A 4MZBA 2PERA 2N5BA 5D9WA 4MH3A 2CX1A 1VQ83 3TJBA 2BHMA 1U8CB 3CMIA 3F63A 3DVXA 1AXDA 4PNFA 4ZL8A 3JCML 3TKSE 2K6VA 3D4TA 5HGRA 2CFKA 3HD5A 1TFOA 4JZQA 2DBCA 2X49A 3GKXA 3IHGA 4K1VA 2LS5A 3DGYA 4N3VA 2L4QA 1I0XA 2R0GA 2WGRA 1OKTA 4BA7A 2OBIA 4BTXA 2MMNA 3G8ZA 1OC9A 2H75A 4POLA 2I9HA 4I8BA 1AV4A 3S9FA 2QA2A 3IJEB 5ECRB 1BUQA 3TOUA 3GWRA 2FGTA 3R2QA 4XIHA 2GSQA 6GSVA 4CJNA 4NHWA 1RGFA 5KN0A 3CRUA 4KFDA 4GQCA 3HOHA 2HLSA 1LU4A 4BWSA 5A4WA 3FZ4A 4ML6A 3S67A 2LQOA 1B9YC 1FUTA 5IM9A 4GB5A 2BMXA 3Q18A 1OH0A 2BT3A 5TGNA 1GSFA 3C71A 4NV2A 3S28A 3LYPA 3KGKA 5J5NA 4EIPA 4TR1A 1SD8A 1LVNA 1GUKA 3IA1A 1AIUA 4HYZA 2LV3A 3CXC2 3GX0A 4AF2A 4R80A 1A0FA 3VPTA 1JNQA 1LOVA 2OADA 3UVHA 1GSYA 2MC8A 4TX4A 3WODG 1BRSA 2UGIA 1LQGC 3CNMA 3GZXB 1YKCA 10GSA 4LL1B 4STDA 1UGHI 3W8JA 5IOWA 1EGRA 1YVSA 2VL2A 3CCL3 1X1WA 2LQQA 1BNJA 2XGNA 1UCLA 2IUKA 1VQQA 2Z7AA 2GQMA 1VF3A 1EEMA 2H66A 3O6TA 2LQVA 5IERA 5CREA 2F3MA 2OOVC 5BRTA 3HZPA 1I5GA 3IAS2 1W5ZA 4DSSB 4TXVA 1SARA 3QPMA 4AEQA 1VQN3 5DREA 1BYEA 2KP2A 2F8AA 2QSIA 2IN3A 4YQUA 1FG4A 6GSWA 1KNGA 2KCDA 4XDWA 1XOBA 4MA9A 3KE7A 3FKAA 2DSAA 3E3EA 1GSEA 2SARA 1YVBI 3TRXA 4XM4A 1EZKA 5DAKA 1QAFA 1B48A 2CT6A 2FA4A 4GCIA 1VQ73 3F8XA 1XWGA 4F9ZA 1BNSA 5AIHA 2GZZA 2AAWA 4EV5A 1JRQA 1UA5A 2P0GA 3F9UA 4N6TA 7GSPA 3J7Yd 4HOHA 1HNCA 1NB3I 1NB5I 3GV1A 1ASKA 4ORLA 3MWZA 3I0YA 2HMLB 3VPQA 1X1YA 3WT1A 2WOHA 1XWCA 1QGVA 4IBPA 1YJW3 4GRFA 1MOLA 1SD9A 5ELJA 2VL3A 2VM1A 1AQXA 6GSYA 4J57E 2ML6A 2FWHA 5COHA 3GNJA 3CPOA 4TXOA 3VFIA 3L9SA 1B3SA 1Q40A 3LYGA 1RK4A 1G7OA 4WP5A 1M3JA 3ME7A 1M9AA 5GSTA 5JPUA 1XWBA 1RNBA 5B6MA 2H1AA 1MDIA 1UUWB 3M8NA 2Y73A 1OC8A 3PINA 1W2ZA 5ECKB 5J9CA 4ZM8A 4J5KA 3X41A 3VSYA 1T8EB 4HQZA 3CD63 3GN3A 3VWVA 4F2IA 1OGZA 1GH2A 1KEBA 2N5FA 4NV5A 5AIGA 3MG3A 3KP8A 3EMPA 3B4PA 4PQHA 4K7NA 4ISDA 3TKRA 4A5PA 1D6YA 4RZMA 3V99A 4KSOA 1TIJA 1Z1SA 2B7JA 3I6AA 1JZOA 1TW9A 4IQ1A 1R4YA 8RNTA 4RQXA 3G6E3 5H5SA 2M80A 4LMWA 1V57A 3HZ4A 1GSDA 3ERGA 3O76A 5G2GA 3VI7A 1AVKA 4HVNA 4LMVA 2W03A 2CVDA 1UUVB 4EDZA 2PN8A 2R5GA 4ECIA 1PYLA 4R1KA 1JBRA 2E0QA 4HOJA 1SL2B 5IENA 4MF5A 3DEXA 1KWIA 1F3BA 1TRQA 3KTBA 3KCHA 5AISA 1GMQA 1BNEA 4WR5A 2HT9A 5D73A 1ROAA 4Q5QA 1A0RP 1O8XA 1JFUA 3F7SA 1JBSA 4Z2TA 1O7MB 1RRHA 1SYRA 3FCSB 4BL7B 2HYXA 1YEPA 1O8WA 1JJ22 4TXOB 2GGTA 4IS0A 1N8QA 4TR3A 4TRXA 1BJXA 4N6NB 3UNLA 5C00A 2HI7A 2VD1A 1GUMA 3C7MA 4HM3B 4EW5A 4XS1A 4XRAA 2C0EA 1NJI4 4I5QA 4FMAA 2L6CA 2E2UA 1JZDA 2XF3A 1I8VA 1VQ63 3D4MA 6GSSA 1OUNA 4N6UA 5LC7A 2I81A 2NVLA 3EC9A 4MLYA 1Z9HA 1JZWA 4PQ1A 1LJRA 4TVEA 1Y6EA 2WZ9A 5IG5A 1TK8B 1OC9B 1FVKA 1OF5A 3UJMA 4IP6A 3CCQ3 2RNTA 2W56A 1UI7A 1FW1A 2RCDA 4HU9A 1TK5B 4PUFC 5ECSA 5L71A 4RNYA 4JE1A 4HM4B 2WRTA 2W04A 1QVG2 4WBJA 19GSA 1W4VA 5CRDA 3LTAA 3OXAA 3ER7A 4HEA2 1X5CA 2CA8A 5IOXA 1GOVA 2H76A 4G2EA 1XG8A 2YANA 3KTLA 1SK0A 1OPYA 4PUAA 2CV4A 1FVJA 3DWVA 3FG3A 4BIKA 4ZB6A 3GMFA 4WFOA 2HMMB 3UARA 5B7CA 2VCVA 2IA7A 2CFDA 5D96A 4EL1A 2L5LA 4RBNA 3EMXA 2D42A 4N6LA 2MMOA 1TUHA 1Z7PA 1FUSA 1O73A 2O8VB 1Z6NA 2A2SA 3PCSA 3AMOB 2Z77A 2R0PA 4XB5A 5AEUB 1PFPA 4MJBA 4L5LA 2AV4A 1RCKA 2LKUA 4CPKA 2A4VA 2CH9A 1OAZA 4YH2A 1HU9A 2VIMA 1TK0B 1G96A 3ZFZA
chains in the Genus database with same CATH topology
2OACA 2C0GA 2H6XA 3ZMKA 3O3TA 1SKSB 3EU4A 3PH9A 2P5QA 3RHBA 2VUPA 2IMFA 4ZB9A 4KX4A 1K3YA 2IMDA 2REMA 6GSXA 4LL4B 2E2GA 4QL9A 5IMZA 2HRAA 2IMIA 1Z3EA 2YWIA 4HU7A 1X9MB 5G5EA 3UEMA 4Z7XA 3A2VA 1PN9A 3ERWA 3QD9A 1A2LA 5ECNB 1O85A 2R6KA 2C0DA 2NPBA 1G7EA 4F03A 2XPDA 3ISOA 1TRWA 2YJHA 5IMCA 5DBQA 1PGTA 3ZLPA 4GF0A 1JZRA 3E9JB 3UOMA 1EGOA 4O7HA 3TKSC 3HHVA 2XPEA 3IAM2 2X8CA 3I43A 2VCQA 1VRSD 2DIZA 2KHPA 1PL1A 3M1GA 3RPPA 2MZCA 4MDCA 2PPTA 1T7PB 1C72A 4I6XA 1TU7A 5G31A 3GTUA 3LQ7A 5G2ZA 3LJRA 1WPIA 3KM6A 5DJLA 1TRVA 3CYNA 1SKWB 1W89A 3V1WA 5ENUA 5DCGA 3IK7A 2PMTA 1GWCA 4KCAA 2VO4A 5HQPA 3OR5A 2X99A 4KH7A 2B1LA 3ZZXA 3PPUA 3CSJA 2X8HA 1IYIA 4HDEA 2GQKA 3QAVA 3IR4A 2P5RA 4YAPA 5GAND 3APQA 3HDCA 2QA1A 4PTSA 5B8AA 1PN0A 1ERTA 4P3YB 5ABRA 2OA7A 2VLVA 2R37A 3C1RA 1A8LA 8GSSA 3IDVA 1GL8A 2YJ7A 1S3DA 5LNKe 2B7KA 2LEGA 4POKA 1ILOA 2YV7A 3KIJA 3QMXA 4FQUA 3C8EA 4OO4A 1VF4A 2L59A 1MDKA 1WOUA 4GLTA 2HZEA 3ZTLA 2ON5A 2Z9SA 3Q74A 3F4RA 1U3IA 4XRDA 4Z2UA 4CDOA 1S3AA 4CY8A 4IJ3A 1O6JA 3TJJA 1GLQA 1GULA 2EC4A 1YQ1A 17GSA 13GSA 4TOPA 2FWEA 3H79A 4BVXA 4N30A 2M46A 2PGTA 2XHFA 5F8BA 3F8UA 1SYXA 5KN2A 2B5EA 3TCOA 3GH9A 4EUYA 3GRXA 1GP1A 2E7PA 1XW9A 1YF1A 1K3OA 3APOA 3F3RA 3UIWA 5DAKB 4G0IA 5DALB 3DRNA 1SU9A 4OWYA 4KSMA 2GLRA 3F6DA 3DYRA 3C1SA 4L0UA 1TXXA 2H6YA 4K9ZA 3BCIA 2VCXA 5ID2B 2H71A 4ZB8A 1ERVA 4GTUA 3GHAA 1U6TA 2CZ3A 3MIXA 4J56E 3DGQA 5FHIA 1YKAA 4KDYA 1X9SB 4ML1A 1ZL9A 1U88A 3QR6A 5C04A 1CQHA 4IP1A 5IMFA 3IXRA 3TOTA 4KDXA 4V1Ag 3M0FA 4L8EA 1DBYA 4GSSA 4BVYA 4ZIJA 5ELGA 2FA8A 5CNWA 2YWNA 3LG6A 3LW9A 3ZIJA 3KZQA 1EV9A 1NW2A 4WF5A 4IN0A 1SJZA 1EOHA 3IK9A 4ID0A 2H0GA 1H4OA 2YNXA 1HNBA 3UL3A 4CHSA 2AHEA 5CRGA 4YQMA 1ZZYA 4Q5NA 1HQOA 4G10A 2ALBA 2JU5A 2R2JA 2CX3A 2PVQA 4O32A 4DEJA 4QQ7A 2B3SA 5CP1A 2V1MA 1ON4A 2JSYA 3GYKA 2H1GA 5KN1A 3FR3A 4IHUA 2JSZA 5ID2A 5KEJA 1R26A 1YDKA 1TKDB 1R5PA 1XVWA 5HFIA 2IMKA 1G6WA 3H1NA 4TR0A 1WE0A 2K8VA 2IPAA 1PRXA 3CSIA 2H73A 3UVTA 1GTUA 2B6MA 3P8WA 3KEBA 1ZGNA 1AC1A 2EIRA 2MYGA 4G19A 4K7IA 3U5RE 3UBLA 2H19A 1PA3A 3BBYA 3GFKA 2GTUA 3EURA 4F0CA 4TW5A 4ZL9A 4O92A 2XC2A 2WCIA 1OVNA 1TI3A 4G9HA 4XS6A 1RW1A 2KP1A 4HQSA 5CAXA 1AW9A 3L78A 4WEYA 3ME8A 4X43A 1Z5YE 3VURA 2P31A 4PX1A 2FY6A 2BJXA 1AQWA 3MYDA 3D5JA 3UAPA 1XFLA 1HD2A 3LFLA 5F05A 5ECIB 2JACA 5KOWA 5F06A 2FGXA 2JZTA 1JHBA 5DQYA 3GUSA 3FZ5A 1PD21 1T4ZA 2VAFA 1T4YA 2UZ8A 3HJMA 4IQAA 2R0CA 2FWFA 3GSTA 1N2AA 1K0DA 4OCEA 4KDUA 3FMWA 2WDUA 4KB3A 2G2QA 2CZ2A 3NZNA 4EIQA 4MJAA 4OFTA 1XVQA 4MZWA 4CW9A 2OKAA 11GSA 3EYTA 1ZYNA 4EKZA 2KOKA 2CVKA 4FYBA 4EO3A 2JL4A 3FEUA 4JEDA 2F9SA 2PU9C 3TRQA 4TN8A 2FNOA 2C3NA 3HVVA 1SENA 4LA1A 1F2EA 4IJIA 1B8XA 1VGLA 4KGIA 1XOAA 2IWTA 1M9BA 4JBBA 3P2AA 3QFBC 16GSA 2OBKA 1PX6A 4TR1B 4RQRA 3N9JA 4GSNA 3TGZA 1BQ7A 4YQVA 18GSA 1OKDA 1QFNA 3VI5A 1F6MC 4PURA 4ECBA 4O5UA 3HXSA 1SL1B 4YKGA 3IE3A 2H01A 2DIYA 4Q5FA 1Q4JA 4DVCA 1YEXA 3TJKA 3KH7A 2DJ2A 5HR2A 1GTBA 4HUAA 14GSA 4XS4B 2DKHA 1FOHA 2GQLA 1WJKA 5G30A 1MEKA 3LXZA 1K0NA 3L9VA 4BPYA 1IYHA 2KUCA 3HJPA 1NHOA 5IPHA 4MCUA 2PWJA 3APSA 1M7TA 1OC3A 3L9UA 4USSA 3P90A 1SL0B 4KNDA 4GWRA 4ACSA 5KOXA 2A2PA 1E2YA 3WYWA 1EEJA 2OE0A 3ZVJD 1TJDA 1MDJA 5AN1A 3PGTA 2TIRA 1S3CA 1Z7RA 2C4JA 4QL7A 2H1DA 4K2DA 2LSTA 1X5EA 4ZL7A 1ERUA 2B5YA 3MWHA 22GSA 4IGJA 4H86A 3FYGA 2DJJA 4JU5A 3MDKA 3M9JA 4EE0A 2DMLA 2FLSA 5GAPD 3IC4A 1M2AA 1AAZA 1J08A 2H8LA 3CTGA 4ECCA 3WGEA 2HSHA 2VCWA 3FK8A 1T00A 2AJQB 4GXZA 3FZAA 1H75A 2DJ1A 1URMA 3R3EA 1DE1A 3D22A 1XXUA 3RHCA 2IMEA 5ECPB 1VF2A 3HYPA 3Q6OA 1YF0A 1SKRB 4N0ZA 2OE3A 1DE2A 3WT2A 3TUEA 4WKWA 2HRKA 4TR4A 1NSWA 3LORA 5ECHB 2CAQA 4AJ7A 2RUEA 5JCGA 1U3AA 2X8GA 1Z6MA 4LLRA 5A4UA 4DSQA 3H4KA 5J9BA 1ZCPA 5JWQB 5J3RA 1J9BA 3FW2A 3F4SA 1BG5A 3ZVJA 2R4VA 3P7XA 2AB6A 4Z2RA 3H8QA 1O7UA 2OE1A 3J7Yk 3DXBA 3M3MA 5D9TA 2WULA 1MTCA 3D21A 2V41A 3M9KA 2CQ9A 3FZ9A 2LNSA 1NHYA 3GX8A 2YCDA 5CRHA 3HJOA 3FRCA 1F9MA 3TRPA 1F3AA 3VWWA 4HZ2A 2NBSA 3MAKA 1EP8A 1OE7A 5G1LA 4YKFA 5CO3A 1XIYA 3ZYWA 2VCZA 4DSRA 5IPGA 4MABA 5IO0A 1FB6A 3LYKA 2RUFA 3UJ1A 5IO2A 2R3XA 2GDRA 5FWGA 1K0AA 3TKQA 1UVZA 1B4PA 1FO5A 2PUKC 4YAVA 1O81A 5LCZA 1K0OA 3CBUA 4KF9A 1SK2A 1K0CA 2C3QA 5AIVA 3EINA 4GSTA 4POMA 2CX4A 3GURA 1PMTA 1U87A 4GQFA 4FYUA 2NDOA 1Q98A 1TOFA 2H1BA 3GKKA 2I1UA 3LEFA 4KUNA 4V2MA 1FB0A 4MNNA 1JLWA 3RBTA 2LRNA 5IMAA 5D93A 4HJ2A 2JZSA 3QFAC 4FO5A 1TRUA 2YP6A 4RI7A 2D2ZA 4L5OA 3L4NA 2IYJA 2LRTA 5DCHA 4K5SA 20GSA 2F51A 4OD7A 5IQYA 3BJ5A 4WR4A 2HFDA 5IIZA 4ICYA 1YY7A 2KLXA 1A24A 5B8BA 2TRCP 2K8SA 2XBQA 1TTZA 5HFGA 1V98A 1HYUA 2V6OA 3NOFA 5G5FA 4PNGA 1ZYEA 5ELAA 3IRAA 2ON7A 4KCEA 1SK1A 2PVOC 2N5AA 3IC8A 2DJKA 4KW6A 5ECQB 3ZRDA 2WJUA 3ZFBA 3IV4A 3GL5A 3LWAA 2GSRA 2H6ZA 1N8JA 1A2MA 1R4WA 4MMMA 5EVOA 3TJFA 4AJ6A 5D8IA 4O5RA 4MF7A 4MJCA 2IIYA 4I2TA 3D6IA 4L0WA 5KN3A 3KP9A 3DMLA 3A5IA 3LSZA 1K0BA 1YZXA 3Q19A 5HR0A 5F0GA 2FD3A 2VM2A 3TKPA 2RM5A 1PSQA 3C73A 1JLVA 4HJMA 5ECLB 2CVBA 4WBRD 3IHQA 1PQNA 2L4CA 3EC3A 4WXTA 4MZCA 3GTUB 1A8YA 2L6DA 4KA0A 4DSSA 1J0FA 4XS4A 3QAGA 2HRNA 5IMDA 2PBJA 5GZZB 5CYYA 4PXOA 3HA9A 1DSBA 3A3TA 4F0BA 5ECMB 2C80A 3EE2A 2A2RA 3VWUA 3KXOA 3EU3A 4FH8A 4XCSA 4IELA 2C1YA 4JR4A 4MP4A 1CQGA 4K0GA 2G0FA 4K8MA 4POBA 1GSSA 5F07A 4OFNA 7GSSA 2LNTA 1WWJA 4WF4A 2LTKA 1V58A 3IOSA 4I97A 1ST9A 3GL3A 4N0VA 2VL2C 4FIWA 1EWXA 4NMUA 1MD3A 4ZBAA 3HCZA 4MPGA 2MMAA 1SJIA 4AGSA 2V6KA 2AUVA 3HY2A 12GSA 4G0KA 3RPNA 1T1VA 3WGXA 2A4HA 5FT3A 5BMUA 3NIVA 1GUHA 4E8HA 3SBCA 4EDYA 3CXGA 1KTEA 4IKHA 3KCMA 4V1Ap 2LJAA 2YWOA 1YJ6A 2QC7A 6GSUA 1R7HA 3D0ZA 2DLXA 5LD0A 3ED3A 3DKSA 3H93A 3HKRA 1GRXA 3IBHA 3BCKA 1ZYQB 1GTIA 5D9VA 3ZITA 1TI1A 5INYA 4K2XA 1EV4A 1BX9A 4K1FA 4MJEA 4MPFA 3I9V2 3GSSA 4IW9A 2HXKA 3L0HA 1V40A 2FHEA 1WMJA 4EVMA 3G7JA 2YV9A 5A4VA 1ZOFA 2H0HA 5CRWA 3ZREA 1UN2A 1G0TA 1XCCA 2V2GA 5DALA 1Y25A 3G9BA 2QKEA 1F37A 4V2NA 1KBNA 1G6YA 2X4AA 1BAYA 2O87A 1BEDA 1ML6A 1QXHA 4K0NA 2EIQA 2ES7A 2F8FA 4BVYB 1A23A 1EOGA 2K18A 3DIEA 4RI6A 1MD4A 1X0RA 4RUVA 4ZBBA 3VK9A 1GTAA 1HNAA 3CTFA 4N11A 5GSSA 3F4TA 3F0IA 2VD0A 5JWRB 3SWLA 1QQ2A 3GKMA 1ZYPA 2X64A 5ECOB 2FUG2 2IL3A 2V32A 1XW6A 2IY2A 2L5OA 1LBKA 5JCWA 1RQMA 3KD0A 2DKIA 2M72A 3DD3A 2FWGA 2HSMA 1FAAA 5E4WA 3LXTA 3FR6A 1SJ6A 1FOVA 5DVBA 3DVWA 1GNWA 2TRXA 2JADA 3QDNA 5EY6A 5DQSA 2VLUA 3CSHA 1M2DA 5HFKA 1ACVA 3US3A 3LGCA 2RLIA 4MF6A 2C8UA 1ABAA 2GSTA 4HS1A 4BWQA 9GSSA 3A2WA 2O89A 1ZMAA 2H30A 1THXA 2WFCA 1PKZA 4AJ8A 3EPTA 1XZOA 3A2XA 4WETA 4OCFA 5J41A 1VF1A 3ZL5A 1WIKA 4CY6A 3EVIA 3W6GA 2YWMA 3VLNA 3I69A 2VLTA 2HZEB 2EIOA 3FKFA 4K5RA 2FCHA 2MBSA 5HR1A 1TDIA 1ERWA 4Q5RA 3TDGA 4ILFA 4HZ4A 4NWYA 2YN1A 2DJ3A 2H72A 4MH2A 1XWAA 2LUSA 5JWOB 1T3BA 3WGDA 1M99A 1K0MA 1XWKA 4KE3A 4D73A 3BOAA 2YZHA 4OO5A 1GSQA 1X5DA 1M0UA 4X4JA 2C3TA 1EP7A 2O7KA 4TKYA 2GSSA 1PL2A 4BL7A 1TP9A 2DJ0A 3GA4A 2WB9A 5H5QA 4G0LA 2IFQB 4PGTA 2LJKA 1AQVA 3CRTA 5HR3A 2LJRA 2GS3A 2J9HA 1TU8A 2YOIA 1FHEA 4F82A 1K3LA 3FR9A 4J2FA 3HZ8A 2H0IA 2ZCTA 4ZBDA 4FYCA 2LRCA 1M2BA 3QAWA 5AIXA 4KAEA 4BVXB 1THOA 2YPMA 4O5QA 3W8SA 2VOCA 4XHMA 2HRFA 2RIIA 4NAXA 4V2LA 3KH9A 2HE3A 3IPZA 3KJYA 2GT6A 1V2AA 3HVXA 2CAIA 2BTOT 2HZFA 5G1KA 3HVSA 3ZMLA 1AUCA 3RDWA 2GT5A 2B5XA 4JR6A 3F6FA 4D73B 3F3QA 2MMZA 2I4AA 1TRSA 1B4QA 1QMVA 3QOUA 1DUGA 2B1KA 1WP0A 4JRRA 3RAZA 3G7IA 4OMVA 1XW5A 2DMMA 3BD2A 2ZNMA 2K9FA 3MNGA 4PQIA 2QGVA 1A2JA 3K8NA 3KMOA 4NPBA 1OE8A 4ZXGA 5IMVA 1X9WB 4OFMA 3E0UA 3TKSA 1I9DA 5JCUA 3GH6A 4K7OA 3GKNA 1V9WA 1B9XC 2JZRA 1OYJA 2OJLA 3AY8A 2HSYA 5J4UA 1WRYA 5E59A 4K6XA 3N5OA 1QK8A 4NXIA 2XBIA 5DJMA 2J23A 3ZFLA 5DDLA 5EPFA 4XTSA 2L57A 4E8EA 2O85A 1GLPA 4HI7A 4MK3A 5AGYA 3A5WA 2WS2A 1E6BA 2H74A 2RM6A 1XBSA 5D9XA 3WD6A 4X0XA 5EL8A 3QCPA 5A5KA 3TJGA 1PX7A 2H70A 3FHKA 1USBA 2I3YA 4N10A 1XPVA 2GZYA 3MSZA 3G7YA 3ERFA 2MBTA 4EC0A 2AYTA 3TB2A 3VWXA 4EXJA 4EF0A 3UBKA 5B6NA 2HNLA 3KMNA 3UMAA 4ZILA 2NTOA 6GSTA 2GVPA 2IFQA 2YZUA 2IJYA 3EWLA 1QUWA 2ZUPA 3U6VA 2VL9A 4NHZA 2GZPA 3J7Yb 1GSUA 1PKWA 4ULXA 1GNEA 1R5AA 4I2UA 2VCTA 2DC5A 1NM3A 3GIXA 4X1UA 3ZIVA 4ECJA 3PR8A 4IVFA 5H5RA 1UC7A 2E2MA 4MZBA 2PERA 2N5BA 5D9WA 4MH3A 3TJBA 3CMIA 3F63A 3DVXA 1AXDA 4PNFA 4ZL8A 3JCML 3TKSE 2K6VA 3D4TA 3HD5A 4JZQA 2DBCA 2X49A 3GKXA 3IHGA 2LS5A 2R0GA 2L4QA 2WGRA 1OKTA 4BA7A 2OBIA 2MMNA 1OC9A 2H75A 4POLA 2I9HA 4I8BA 3S9FA 2QA2A 5ECRB 3TOUA 3R2QA 4XIHA 2GSQA 6GSVA 4NHWA 5KN0A 3CRUA 4GQCA 2HLSA 1LU4A 4BWSA 5A4WA 3FZ4A 4ML6A 2LQOA 1B9YC 5IM9A 2BMXA 3Q18A 1GSFA 3C71A 4NV2A 3LYPA 3KGKA 5J5NA 4EIPA 4TR1A 1SD8A 1GUKA 3IA1A 1AIUA 2LV3A 4AF2A 3GX0A 1A0FA 3VPTA 2OADA 3UVHA 1GSYA 1YKCA 10GSA 4LL1B 3W8JA 5IOWA 1EGRA 2VL2A 2LQQA 2GQMA 1VF3A 1EEMA 2H66A 3O6TA 5CREA 2F3MA 5BRTA 1I5GA 3IAS2 4DSSB 4TXVA 3QPMA 1BYEA 2KP2A 2F8AA 2QSIA 2IN3A 4YQUA 1FG4A 6GSWA 1KNGA 1XOBA 4MA9A 2DSAA 3E3EA 1GSEA 3TRXA 1EZKA 5DAKA 1B48A 2CT6A 2FA4A 4GCIA 1XWGA 4F9ZA 2GZZA 2AAWA 1UA5A 2P0GA 3F9UA 1HNCA 3GV1A 3VPQA 3WT1A 1XWCA 1QGVA 4IBPA 4GRFA 1SD9A 2VL3A 2VM1A 1AQXA 6GSYA 4J57E 5COHA 2FWHA 3GNJA 4TXOA 3VFIA 3L9SA 1RK4A 1G7OA 3ME7A 1M9AA 5GSTA 1XWBA 5B6MA 2H1AA 1MDIA 3M8NA 1OC8A 3PINA 5ECKB 5J9CA 1T8EB 4HQZA 3GN3A 3VWVA 4F2IA 1GH2A 1KEBA 2N5FA 4NV5A 3KP8A 3EMPA 4PQHA 4K7NA 4ISDA 3TKRA 4A5PA 4KSOA 2B7JA 3I6AA 1JZOA 1TW9A 4IQ1A 4RQXA 5H5SA 2M80A 4LMWA 1V57A 3HZ4A 1GSDA 3ERGA 3O76A 3VI7A 4LMVA 2CVDA 4EDZA 2PN8A 2R5GA 4ECIA 2E0QA 4HOJA 1SL2B 4MF5A 3DEXA 1F3BA 3KTBA 5AISA 4WR5A 2HT9A 5D73A 4Q5QA 1A0RP 1O8XA 1JFUA 4Z2TA 1SYRA 4BL7B 2HYXA 1YEPA 1O8WA 4TXOB 2GGTA 4IS0A 4TR3A 4TRXA 1BJXA 5C00A 2HI7A 2VD1A 1GUMA 3C7MA 4XS1A 4XRAA 2C0EA 4I5QA 2L6CA 1JZDA 3D4MA 6GSSA 2I81A 2NVLA 4MLYA 1Z9HA 1JZWA 4PQ1A 1LJRA 4TVEA 1Y6EA 2WZ9A 1TK8B 1OC9B 1FVKA 4IP6A 1FW1A 4HU9A 1TK5B 4PUFC 5ECSA 5L71A 4JE1A 2WRTA 4WBJA 19GSA 1W4VA 5CRDA 4HEA2 1X5CA 2CA8A 5IOXA 2H76A 4G2EA 2YANA 3KTLA 1SK0A 4PUAA 2CV4A 1FVJA 3DWVA 4ZB6A 3GMFA 3UARA 5B7CA 2VCVA 5D96A 4EL1A 2L5LA 3EMXA 2MMOA 1Z7PA 1O73A 2O8VB 1Z6NA 2A2SA 2R0PA 4MJBA 4L5LA 2AV4A 2LKUA 2A4VA 1OAZA 4YH2A 2VIMA 1TK0B 2C0FA 3FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAC A;  2C0G A;  2H6X A;  3ZMK A;  3O3T A;  1SKS B;  3EU4 A;  3PH9 A;  2P5Q A;  3RHB A;  2VUP A;  2IMF A;  4ZB9 A;  4KX4 A;  1K3Y A;  2IMD A;  2REM A;  6GSX A;  4LL4 B;  2E2G A;  4QL9 A;  5IMZ A;  2IMI A;  1Z3E A;  2YWI A;  4HU7 A;  1X9M B;  5G5E A;  3UEM A;  4Z7X A;  3A2V A;  1PN9 A;  3ERW A;  3QD9 A;  1A2L A;  5ECN B;  1O85 A;  2R6K A;  2C0D A;  2NPB A;  1G7E A;  4F03 A;  2XPD A;  3ISO A;  1TRW A;  2YJH A;  5IMC A;  5DBQ A;  1PGT A;  3ZLP A;  4GF0 A;  1JZR A;  3E9J B;  3UOM A;  1EGO A;  4O7H A;  3TKS C;  3HHV A;  2XPE A;  3IAM 2;  2X8C A;  3I43 A;  2VCQ A;  1VRS D;  2DIZ A;  2KHP A;  1PL1 A;  3M1G A;  3RPP A;  2MZC A;  4MDC A;  2PPT A;  1T7P B;  1C72 A;  4I6X A;  1TU7 A;  5G31 A;  3GTU A;  3LQ7 A;  5G2Z A;  3LJR A;  1WPI A;  3KM6 A;  5DJL A;  1TRV A;  3CYN A;  1SKW B;  1W89 A;  3V1W A;  5ENU A;  5DCG A;  3IK7 A;  2PMT A;  1GWC A;  4KCA A;  2VO4 A;  5HQP A;  3OR5 A;  2X99 A;  4KH7 A;  2B1L A;  3ZZX A;  3CSJ A;  2X8H A;  1IYI A;  4HDE A;  2GQK A;  3QAV A;  3IR4 A;  2P5R A;  4YAP A;  5GAN D;  3APQ A;  3HDC A;  5B8A A;  1ERT A;  4P3Y B;  5ABR A;  2OA7 A;  2VLV A;  2R37 A;  3C1R A;  1A8L A;  8GSS A;  3IDV A;  1GL8 A;  2YJ7 A;  1S3D A;  5LNK e;  2B7K A;  2LEG A;  4POK A;  1ILO A;  2YV7 A;  3KIJ A;  3QMX A;  3C8E A;  4OO4 A;  1VF4 A;  2L59 A;  1MDK A;  1WOU A;  4GLT A;  2HZE A;  3ZTL A;  2ON5 A;  2Z9S A;  3Q74 A;  3F4R A;  1U3I A;  4XRD A;  4CDO A;  1S3A A;  4IJ3 A;  1O6J A;  3TJJ A;  1GLQ A;  1GUL A;  2EC4 A;  1YQ1 A;  17GS A;  13GS A;  4TOP A;  2FWE A;  3H79 A;  4BVX A;  4N30 A;  2M46 A;  2PGT A;  2XHF A;  5F8B A;  3F8U A;  1SYX A;  5KN2 A;  2B5E A;  3TCO A;  3GH9 A;  4EUY A;  3GRX A;  1GP1 A;  2E7P A;  1XW9 A;  1YF1 A;  1K3O A;  3APO A;  3F3R A;  3UIW A;  5DAK B;  5DAL B;  3DRN A;  1SU9 A;  4OWY A;  4KSM A;  2GLR A;  3F6D A;  3DYR A;  3C1S A;  4L0U A;  1TXX A;  2H6Y A;  4K9Z A;  3BCI A;  2VCX A;  5ID2 B;  2H71 A;  4ZB8 A;  1ERV A;  4GTU A;  3GHA A;  1U6T A;  2CZ3 A;  4J56 E;  3DGQ A;  5FHI A;  1YKA A;  4KDY A;  1X9S B;  4ML1 A;  1ZL9 A;  1U88 A;  3QR6 A;  5C04 A;  1CQH A;  4IP1 A;  5IMF A;  3IXR A;  3TOT A;  4KDX A;  4V1A g;  3M0F A;  4L8E A;  1DBY A;  4GSS A;  4BVY A;  4ZIJ A;  5ELG A;  2FA8 A;  5CNW A;  2YWN A;  3LG6 A;  3ZIJ A;  3KZQ A;  1EV9 A;  1NW2 A;  4WF5 A;  4IN0 A;  1SJZ A;  1EOH A;  3IK9 A;  4ID0 A;  2H0G A;  1H4O A;  2YNX A;  1HNB A;  3UL3 A;  4CHS A;  2AHE A;  5CRG A;  4YQM A;  1ZZY A;  4Q5N A;  1HQO A;  4G10 A;  2ALB A;  2JU5 A;  2R2J A;  2CX3 A;  2PVQ A;  4O32 A;  4DEJ A;  4QQ7 A;  2B3S A;  5CP1 A;  2V1M A;  1ON4 A;  2JSY A;  3GYK A;  2H1G A;  5KN1 A;  3FR3 A;  4IHU A;  2JSZ A;  5ID2 A;  5KEJ A;  1R26 A;  1YDK A;  1TKD B;  1R5P A;  1XVW A;  5HFI A;  2IMK A;  1G6W A;  3H1N A;  4TR0 A;  1WE0 A;  2K8V A;  2IPA A;  1PRX A;  3CSI A;  2H73 A;  3UVT A;  1GTU A;  2B6M A;  3P8W A;  3KEB A;  1ZGN A;  1AC1 A;  2EIR A;  2MYG A;  4G19 A;  4K7I A;  3U5R E;  3UBL A;  2H19 A;  1PA3 A;  3BBY A;  3GFK A;  2GTU A;  3EUR A;  4F0C A;  4TW5 A;  4ZL9 A;  4O92 A;  2XC2 A;  2WCI A;  1OVN A;  1TI3 A;  4G9H A;  4XS6 A;  1RW1 A;  2KP1 A;  4HQS A;  5CAX A;  1AW9 A;  3L78 A;  4WEY A;  3ME8 A;  4X43 A;  1Z5Y E;  3VUR A;  2P31 A;  4PX1 A;  2FY6 A;  2BJX A;  1AQW A;  3D5J A;  3UAP A;  1XFL A;  1HD2 A;  3LFL A;  5F05 A;  5ECI B;  2JAC A;  5F06 A;  2FGX A;  2JZT A;  1JHB A;  5DQY A;  3GUS A;  3FZ5 A;  1PD2 1;  1T4Z A;  2VAF A;  1T4Y A;  3HJM A;  4IQA A;  2FWF A;  3GST A;  1N2A A;  1K0D A;  4OCE A;  4KDU A;  2WDU A;  4KB3 A;  2G2Q A;  2CZ2 A;  3NZN A;  4MJA A;  4OFT A;  1XVQ A;  4MZW A;  4CW9 A;  2OKA A;  11GS A;  3EYT A;  4EKZ A;  2KOK A;  2CVK A;  4FYB A;  4EO3 A;  2JL4 A;  3FEU A;  4JED A;  2F9S A;  2PU9 C;  3TRQ A;  4TN8 A;  2FNO A;  2C3N A;  3HVV A;  1SEN A;  4LA1 A;  1F2E A;  4IJI A;  1B8X A;  1VGL A;  4KGI A;  1XOA A;  2IWT A;  1M9B A;  4JBB A;  3P2A A;  3QFB C;  16GS A;  2OBK A;  1PX6 A;  4TR1 B;  4RQR A;  3N9J A;  4GSN A;  3TGZ A;  1BQ7 A;  4YQV A;  18GS A;  1OKD A;  1QFN A;  3VI5 A;  1F6M C;  4PUR A;  4ECB A;  3HXS A;  1SL1 B;  3IE3 A;  2H01 A;  2DIY A;  4Q5F A;  1Q4J A;  4DVC A;  1YEX A;  3TJK A;  3KH7 A;  2DJ2 A;  5HR2 A;  1GTB A;  4HUA A;  14GS A;  4XS4 B;  2GQL A;  1WJK A;  5G30 A;  1MEK A;  3LXZ A;  1K0N A;  3L9V A;  4BPY A;  1IYH A;  2KUC A;  3HJP A;  1NHO A;  5IPH A;  4MCU A;  2PWJ A;  3APS A;  1M7T A;  1OC3 A;  3L9U A;  3P90 A;  1SL0 B;  4KND A;  4GWR A;  4ACS A;  1E2Y A;  3WYW A;  1EEJ A;  2OE0 A;  3ZVJ D;  1TJD A;  1MDJ A;  5AN1 A;  3PGT A;  2TIR A;  1S3C A;  1Z7R A;  2C4J A;  4QL7 A;  2H1D A;  4K2D A;  2LST A;  1X5E A;  4ZL7 A;  1ERU A;  2B5Y A;  3MWH A;  22GS A;  4IGJ A;  4H86 A;  3FYG A;  2DJJ A;  4JU5 A;  3MDK A;  3M9J A;  4EE0 A;  2DML A;  2FLS A;  5GAP D;  3IC4 A;  1M2A A;  1AAZ A;  1J08 A;  2H8L A;  3CTG A;  4ECC A;  3WGE A;  2HSH A;  2VCW A;  3FK8 A;  1T00 A;  2AJQ B;  4GXZ A;  3FZA A;  1H75 A;  2DJ1 A;  1URM A;  1DE1 A;  3D22 A;  1XXU A;  3RHC A;  2IME A;  5ECP B;  1VF2 A;  3HYP A;  3Q6O A;  1YF0 A;  1SKR B;  4N0Z A;  2OE3 A;  1DE2 A;  3WT2 A;  3TUE A;  4WKW A;  4TR4 A;  1NSW A;  3LOR A;  5ECH B;  2CAQ A;  4AJ7 A;  2RUE A;  5JCG A;  1U3A A;  2X8G A;  1Z6M A;  4LLR A;  5A4U A;  4DSQ A;  3H4K A;  5J9B A;  1ZCP A;  5JWQ B;  5J3R A;  1J9B A;  3FW2 A;  3F4S A;  1BG5 A;  3ZVJ A;  2R4V A;  3P7X A;  2AB6 A;  3H8Q A;  1O7U A;  2OE1 A;  3J7Y k;  3DXB A;  3M3M A;  5D9T A;  2WUL A;  1MTC A;  3D21 A;  2V41 A;  3M9K A;  2CQ9 A;  3FZ9 A;  2LNS A;  1NHY A;  3GX8 A;  2YCD A;  5CRH A;  3HJO A;  3FRC A;  1F9M A;  3TRP A;  1F3A A;  3VWW A;  4HZ2 A;  2NBS A;  3MAK A;  1EP8 A;  1OE7 A;  5G1L A;  5CO3 A;  1XIY A;  3ZYW A;  2VCZ A;  4DSR A;  5IPG A;  4MAB A;  5IO0 A;  1FB6 A;  3LYK A;  2RUF A;  3UJ1 A;  5IO2 A;  2R3X A;  2GDR A;  5FWG A;  1K0A A;  3TKQ A;  1UVZ A;  1B4P A;  1FO5 A;  2PUK C;  4YAV A;  1O81 A;  5LCZ A;  1K0O A;  3CBU A;  1SK2 A;  1K0C A;  2C3Q A;  5AIV A;  3EIN A;  4GST A;  4POM A;  2CX4 A;  3GUR A;  1PMT A;  1U87 A;  4GQF A;  4FYU A;  2NDO A;  1Q98 A;  1TOF A;  2H1B A;  3GKK A;  2I1U A;  3LEF A;  4KUN A;  4V2M A;  1FB0 A;  1JLW A;  3RBT A;  2LRN A;  5IMA A;  5D93 A;  4HJ2 A;  2JZS A;  3QFA C;  4FO5 A;  1TRU A;  2YP6 A;  4RI7 A;  2D2Z A;  4L5O A;  3L4N A;  2IYJ A;  2LRT A;  5DCH A;  20GS A;  2F51 A;  4OD7 A;  5IQY A;  3BJ5 A;  4WR4 A;  2HFD A;  5IIZ A;  1YY7 A;  2KLX A;  1A24 A;  5B8B A;  2TRC P;  2K8S A;  2XBQ A;  1TTZ A;  5HFG A;  1V98 A;  1HYU A;  2V6O A;  3NOF A;  5G5F A;  4PNG A;  1ZYE A;  5ELA A;  3IRA A;  2ON7 A;  4KCE A;  1SK1 A;  2PVO C;  2N5A A;  2DJK A;  4KW6 A;  5ECQ B;  3ZRD A;  2WJU A;  3ZFB A;  3IV4 A;  3GL5 A;  3LWA A;  2GSR A;  2H6Z A;  1N8J A;  1A2M A;  1R4W A;  4MMM A;  5EVO A;  3TJF A;  4AJ6 A;  5D8I A;  4O5R A;  4MF7 A;  4MJC A;  2IIY A;  4I2T A;  3D6I A;  4L0W A;  5KN3 A;  3KP9 A;  3DML A;  3LSZ A;  1K0B A;  1YZX A;  3Q19 A;  5HR0 A;  5F0G A;  2FD3 A;  2VM2 A;  3TKP A;  2RM5 A;  1PSQ A;  3C73 A;  1JLV A;  4HJM A;  5ECL B;  2CVB A;  4WBR D;  3IHQ A;  1PQN A;  2L4C A;  3EC3 A;  4WXT A;  4MZC A;  3GTU B;  1A8Y A;  2L6D A;  4KA0 A;  4DSS A;  1J0F A;  4XS4 A;  3QAG A;  2HRN A;  5IMD A;  2PBJ A;  5GZZ B;  5CYY A;  4PXO A;  3HA9 A;  1DSB A;  3A3T A;  4F0B A;  5ECM B;  2C80 A;  3EE2 A;  2A2R A;  3VWU A;  3KXO A;  3EU3 A;  4FH8 A;  4XCS A;  4IEL A;  2C1Y A;  4JR4 A;  4MP4 A;  1CQG A;  4K0G A;  2G0F A;  4K8M A;  4POB A;  1GSS A;  5F07 A;  4OFN A;  7GSS A;  2LNT A;  1WWJ A;  4WF4 A;  2LTK A;  1V58 A;  3IOS A;  4I97 A;  1ST9 A;  3GL3 A;  4N0V A;  2VL2 C;  4FIW A;  1EWX A;  4NMU A;  1MD3 A;  4ZBA A;  3HCZ A;  4MPG A;  2MMA A;  1SJI A;  4AGS A;  2V6K A;  2AUV A;  3HY2 A;  12GS A;  3RPN A;  1T1V A;  3WGX A;  5FT3 A;  3NIV A;  1GUH A;  4E8H A;  3SBC A;  4EDY A;  3CXG A;  1KTE A;  4IKH A;  3KCM A;  4V1A p;  2LJA A;  2YWO A;  1YJ6 A;  2QC7 A;  6GSU A;  1R7H A;  3D0Z A;  2DLX A;  5LD0 A;  3ED3 A;  3DKS A;  3H93 A;  3HKR A;  1GRX A;  3IBH A;  3BCK A;  1ZYQ B;  1GTI A;  5D9V A;  3ZIT A;  1TI1 A;  5INY A;  1EV4 A;  1BX9 A;  4K1F A;  4MJE A;  4MPF A;  3I9V 2;  3GSS A;  4IW9 A;  2HXK A;  3L0H A;  1V40 A;  2FHE A;  1WMJ A;  4EVM A;  3G7J A;  2YV9 A;  5A4V A;  1ZOF A;  2H0H A;  5CRW A;  3ZRE A;  1UN2 A;  1G0T A;  1XCC A;  2V2G A;  5DAL A;  1Y25 A;  3G9B A;  2QKE A;  1F37 A;  4V2N A;  1KBN A;  1G6Y A;  1BAY A;  2O87 A;  1BED A;  1ML6 A;  1QXH A;  4K0N A;  2EIQ A;  2ES7 A;  2F8F A;  1A23 A;  1EOG A;  2K18 A;  3DIE A;  4RI6 A;  1MD4 A;  1X0R A;  4RUV A;  4ZBB A;  3VK9 A;  1GTA A;  1HNA A;  3CTF A;  4N11 A;  5GSS A;  3F4T A;  3F0I A;  2VD0 A;  5JWR B;  3SWL A;  1QQ2 A;  3GKM A;  2X64 A;  5ECO B;  2FUG 2;  2IL3 A;  2V32 A;  1XW6 A;  2IY2 A;  2L5O A;  1LBK A;  5JCW A;  1RQM A;  3KD0 A;  2M72 A;  3DD3 A;  2FWG A;  1FAA A;  5E4W A;  3LXT A;  3FR6 A;  1SJ6 A;  1FOV A;  5DVB A;  3DVW A;  1GNW A;  2TRX A;  2JAD A;  3QDN A;  5EY6 A;  5DQS A;  2VLU A;  3CSH A;  1M2D A;  5HFK A;  1ACV A;  3US3 A;  3LGC A;  2RLI A;  4MF6 A;  2C8U A;  1ABA A;  2GST A;  4HS1 A;  4BWQ A;  9GSS A;  3A2W A;  2O89 A;  1ZMA A;  2H30 A;  1THX A;  2WFC A;  1PKZ A;  4AJ8 A;  1XZO A;  3A2X A;  4WET A;  4OCF A;  5J41 A;  1VF1 A;  3ZL5 A;  1WIK A;  3EVI A;  3W6G A;  2YWM A;  3VLN A;  3I69 A;  2VLT A;  2HZE B;  2EIO A;  3FKF A;  2FCH A;  2MBS A;  5HR1 A;  1TDI A;  1ERW A;  4Q5R A;  3TDG A;  4ILF A;  4HZ4 A;  4NWY A;  2YN1 A;  2DJ3 A;  2H72 A;  4MH2 A;  1XWA A;  2LUS A;  5JWO B;  1T3B A;  3WGD A;  1M99 A;  1K0M A;  1XWK A;  4KE3 A;  4D73 A;  3BOA A;  2YZH A;  4OO5 A;  1GSQ A;  1X5D A;  1M0U A;  2C3T A;  1EP7 A;  2O7K A;  4TKY A;  2GSS A;  1PL2 A;  4BL7 A;  1TP9 A;  2DJ0 A;  3GA4 A;  2WB9 A;  5H5Q A;  2IFQ B;  4PGT A;  2LJK A;  1AQV A;  3CRT A;  5HR3 A;  2LJR A;  2GS3 A;  2J9H A;  1TU8 A;  2YOI A;  1FHE A;  4F82 A;  1K3L A;  3FR9 A;  4J2F A;  3HZ8 A;  2H0I A;  2ZCT A;  4ZBD A;  4FYC A;  2LRC A;  1M2B A;  3QAW A;  5AIX A;  4KAE A;  1THO A;  2YPM A;  3W8S A;  2VOC A;  4XHM A;  2HRF A;  2RII A;  4NAX A;  4V2L A;  3KH9 A;  2HE3 A;  3IPZ A;  3KJY A;  2GT6 A;  1V2A A;  3HVX A;  2CAI A;  2BTO T;  2HZF A;  5G1K A;  3HVS A;  3ZML A;  1AUC A;  3RDW A;  2GT5 A;  2B5X A;  4JR6 A;  3F6F A;  4D73 B;  3F3Q A;  2MMZ A;  2I4A A;  1TRS A;  1B4Q A;  1QMV A;  3QOU A;  1DUG A;  2B1K A;  1WP0 A;  4JRR A;  3RAZ A;  3G7I A;  4OMV A;  1XW5 A;  2DMM A;  3BD2 A;  2ZNM A;  2K9F A;  3MNG A;  4PQI A;  2QGV A;  1A2J A;  3K8N A;  3KMO A;  4NPB A;  1OE8 A;  4ZXG A;  5IMV A;  1X9W B;  4OFM A;  3E0U A;  3TKS A;  1I9D A;  5JCU A;  3GH6 A;  4K7O A;  3GKN A;  1V9W A;  1B9X C;  2JZR A;  1OYJ A;  2OJL A;  3AY8 A;  2HSY A;  5J4U A;  1WRY A;  5E59 A;  4K6X A;  3N5O A;  1QK8 A;  4NXI A;  2XBI A;  5DJM A;  2J23 A;  3ZFL A;  5DDL A;  5EPF A;  4XTS A;  2L57 A;  4E8E A;  2O85 A;  1GLP A;  4HI7 A;  4MK3 A;  5AGY A;  3A5W A;  2WS2 A;  1E6B A;  2H74 A;  2RM6 A;  1XBS A;  5D9X A;  3WD6 A;  4X0X A;  5EL8 A;  3QCP A;  5A5K A;  3TJG A;  1PX7 A;  2H70 A;  3FHK A;  1USB A;  2I3Y A;  4N10 A;  1XPV A;  2GZY A;  3MSZ A;  3G7Y A;  3ERF A;  2MBT A;  4EC0 A;  2AYT A;  3TB2 A;  3VWX A;  4EXJ A;  4EF0 A;  3UBK A;  5B6N A;  2HNL A;  3KMN A;  3UMA A;  4ZIL A;  2NTO A;  6GST A;  2GVP A;  2IFQ A;  2YZU A;  2IJY A;  3EWL A;  1QUW A;  2ZUP A;  3U6V A;  2VL9 A;  4NHZ A;  2GZP A;  3J7Y b;  1GSU A;  1PKW A;  4ULX A;  1GNE A;  1R5A A;  4I2U A;  2VCT A;  2DC5 A;  1NM3 A;  3GIX A;  4X1U A;  3ZIV A;  4ECJ A;  3PR8 A;  4IVF A;  5H5R A;  1UC7 A;  2E2M A;  4MZB A;  2PER A;  2N5B A;  5D9W A;  4MH3 A;  3TJB A;  3CMI A;  3F63 A;  3DVX A;  1AXD A;  4PNF A;  4ZL8 A;  3JCM L;  3TKS E;  2K6V A;  3D4T A;  3HD5 A;  4JZQ A;  2DBC A;  3GKX A;  2LS5 A;  2L4Q A;  2WGR A;  1OKT A;  4BA7 A;  2OBI A;  2MMN A;  1OC9 A;  2H75 A;  4POL A;  2I9H A;  4I8B A;  3S9F A;  5ECR B;  3TOU A;  3R2Q A;  4XIH A;  2GSQ A;  6GSV A;  4NHW A;  5KN0 A;  3CRU A;  4GQC A;  2HLS A;  1LU4 A;  4BWS A;  5A4W A;  3FZ4 A;  4ML6 A;  2LQO A;  1B9Y C;  5IM9 A;  2BMX A;  3Q18 A;  1GSF A;  3C71 A;  4NV2 A;  3LYP A;  3KGK A;  5J5N A;  4TR1 A;  1SD8 A;  1GUK A;  3IA1 A;  1AIU A;  2LV3 A;  4AF2 A;  3GX0 A;  1A0F A;  3VPT A;  2OAD A;  3UVH A;  1GSY A;  1YKC A;  10GS A;  4LL1 B;  3W8J A;  5IOW A;  1EGR A;  2VL2 A;  2LQQ A;  2GQM A;  1VF3 A;  1EEM A;  2H66 A;  3O6T A;  5CRE A;  2F3M A;  1I5G A;  3IAS 2;  4DSS B;  4TXV A;  3QPM A;  1BYE A;  2KP2 A;  2F8A A;  2QSI A;  2IN3 A;  4YQU A;  1FG4 A;  6GSW A;  1KNG A;  1XOB A;  4MA9 A;  2DSA A;  3E3E A;  1GSE A;  3TRX A;  1EZK A;  5DAK A;  1B48 A;  2CT6 A;  2FA4 A;  4GCI A;  1XWG A;  4F9Z A;  2GZZ A;  2AAW A;  1UA5 A;  2P0G A;  3F9U A;  1HNC A;  3GV1 A;  3VPQ A;  3WT1 A;  1XWC A;  1QGV A;  4IBP A;  4GRF A;  1SD9 A;  2VL3 A;  2VM1 A;  1AQX A;  6GSY A;  4J57 E;  5COH A;  2FWH A;  3GNJ A;  4TXO A;  3VFI A;  3L9S A;  1RK4 A;  1G7O A;  3ME7 A;  1M9A A;  5GST A;  1XWB A;  5B6M A;  2H1A A;  1MDI A;  3M8N A;  1OC8 A;  3PIN A;  5ECK B;  5J9C A;  1T8E B;  4HQZ A;  3GN3 A;  3VWV A;  4F2I A;  1GH2 A;  1KEB A;  2N5F A;  4NV5 A;  3KP8 A;  3EMP A;  4PQH A;  4K7N A;  4ISD A;  3TKR A;  4KSO A;  2B7J A;  3I6A A;  1JZO A;  1TW9 A;  4IQ1 A;  4RQX A;  5H5S A;  2M80 A;  4LMW A;  1V57 A;  3HZ4 A;  1GSD A;  3ERG A;  3O76 A;  3VI7 A;  4LMV A;  2CVD A;  4EDZ A;  2PN8 A;  2R5G A;  4ECI A;  2E0Q A;  4HOJ A;  1SL2 B;  4MF5 A;  3DEX A;  1F3B A;  3KTB A;  5AIS A;  4WR5 A;  2HT9 A;  5D73 A;  4Q5Q A;  1A0R P;  1O8X A;  1JFU A;  1SYR A;  2HYX A;  1YEP A;  1O8W A;  4TXO B;  2GGT A;  4IS0 A;  4TR3 A;  4TRX A;  1BJX A;  5C00 A;  2HI7 A;  2VD1 A;  1GUM A;  3C7M A;  4XS1 A;  4XRA A;  2C0E A;  4I5Q A;  2L6C A;  1JZD A;  3D4M A;  6GSS A;  2I81 A;  2NVL A;  4MLY A;  1Z9H A;  1JZW A;  4PQ1 A;  1LJR A;  4TVE A;  1Y6E A;  2WZ9 A;  1TK8 B;  1OC9 B;  1FVK A;  4IP6 A;  1FW1 A;  4HU9 A;  1TK5 B;  4PUF C;  5ECS A;  5L71 A;  4JE1 A;  2WRT A;  4WBJ A;  19GS A;  1W4V A;  5CRD A;  4HEA 2;  1X5C A;  2CA8 A;  5IOX A;  2H76 A;  4G2E A;  2YAN A;  3KTL A;  1SK0 A;  4PUA A;  2CV4 A;  1FVJ A;  3DWV A;  4ZB6 A;  3GMF A;  3UAR A;  5B7C A;  2VCV A;  5D96 A;  4EL1 A;  2L5L A;  3EMX A;  2MMO A;  1Z7P A;  1O73 A;  2O8V B;  1Z6N A;  2A2S A;  4MJB A;  4L5L A;  2AV4 A;  2LKU A;  2A4V A;  1OAZ A;  4YH2 A;  2VIM A;  1TK0 B;  2C0F A;  3FY7 A; 
#chains in the Genus database with same CATH topology
 2OAC A;  2C0G A;  2H6X A;  3ZMK A;  3AHW A;  1BAN A;  3DXO A;  3O3T A;  1DMQ A;  1SKS B;  3EU4 A;  1DVC A;  5LC6 A;  3PH9 A;  2P5Q A;  3RHB A;  1E3R A;  1EQK A;  3X40 A;  4JF8 A;  1YIT 3;  2VUP A;  3NM2 A;  2IMF A;  4ZB9 A;  4KX4 A;  3EN8 A;  1K3Y A;  2IMD A;  2REM A;  6GSX A;  4LL4 B;  1IT8 A;  2E2G A;  3F7X A;  4QL9 A;  5IMZ A;  2HRA A;  1KQS 2;  3NM7 A;  2IMI A;  3PYJ A;  1Z3E A;  2YWI A;  4HU7 A;  1DE3 A;  5G5E A;  1X9M B;  3UEM A;  1MWS A;  3FG4 A;  5FGO A;  4CCV A;  3GRD A;  3HII A;  3LTB A;  4Z7X A;  6GSP A;  3A2V A;  1PN9 A;  3ERW A;  2OQE C;  2YFI B;  3X3Z A;  3QD9 A;  1A2L A;  1BIR A;  2E2T A;  5ECN B;  1O85 A;  4N6O B;  2R6K A;  2C0D A;  2NPB A;  3HIG A;  1G7E A;  2D1W A;  4F03 A;  1BVI A;  2XPD A;  3ISO A;  1TRW A;  1LRA A;  2YJH A;  1A90 A;  5IMC A;  1AVL A;  5DBQ A;  4LMI A;  1K9M 4;  1PGT A;  3EX9 A;  3ZLP A;  4GF0 A;  1JZR A;  1BNF A;  3E9J B;  3UOM A;  3E99 A;  1EGO A;  4O7H A;  3TKS C;  3HHV A;  2XPE A;  3IAM 2;  2X8C A;  3I43 A;  6RNT A;  2VCQ A;  3BU4 A;  4H61 A;  1CEW I;  1VRS D;  2DIZ A;  2W0Q A;  2KHP A;  1M9G A;  1PL1 A;  3M1G A;  3RPP A;  2MZC A;  4MDC A;  2PPT A;  1T7P B;  1C72 A;  4I6X A;  1TU7 A;  5G31 A;  2C11 A;  1RLS A;  3GTU A;  3LQ7 A;  5G2Z A;  3LJR A;  1WPI A;  3KM6 A;  1STD A;  5DJL A;  1CYV A;  1TRV A;  4LEH A;  3CYN A;  1SKW B;  1W89 A;  2CFW A;  3V1W A;  5ENU A;  1JB4 A;  5DCG A;  1K8A 4;  3IK7 A;  2PMT A;  1GWC A;  4BL2 A;  4KCA A;  1ZO2 A;  2VO4 A;  3FF2 A;  1JBT A;  3BLZ A;  4HM5 B;  5HQP A;  2BMO B;  3OR5 A;  2X99 A;  4KH7 A;  2B1L A;  3ZZX A;  3PPU A;  3CSJ A;  2X8H A;  1IYI A;  4HDE A;  4H3U A;  2GQK A;  3QAV A;  3MKI A;  3B7C A;  4MMZ B;  1M1K 4;  1NO3 A;  4EV2 A;  1I2G A;  3IR4 A;  5M19 A;  2P5R A;  4YAP A;  2YX9 A;  9RNT A;  2Y74 A;  3KZT A;  5GAN D;  1Q7H A;  3N54 B;  1W7C A;  3APQ A;  3HDC A;  2QA1 A;  4PTS A;  1W4N A;  5B8A A;  1PN0 A;  1W6C A;  1ERT A;  4P3Y B;  5ABR A;  2CG1 A;  2OA7 A;  2VLV A;  2R37 A;  2OQE A;  3C1R A;  1WMN A;  1A8L A;  8GSS A;  3IDV A;  1GL8 A;  1FGM A;  4WHA A;  1K28 A;  2MF7 A;  4KFF A;  2YJ7 A;  1S3D A;  3LT9 A;  5LNK e;  3T0U A;  2B7K A;  2LEG A;  4POK A;  1ILO A;  2YV7 A;  3KIJ A;  3QMX A;  4FQU A;  3C8E A;  4OO4 A;  1RJO A;  1VF4 A;  2L59 A;  1MDK A;  3WDG B;  1U5O A;  4BL3 A;  1WOU A;  4LGQ A;  2HZE A;  4GLT A;  3ZTL A;  1Q42 A;  3SLU A;  1RSN A;  2ON5 A;  2Z9S A;  2XSO B;  2CW9 A;  3JUN A;  3OWS A;  3Q74 A;  3F4R A;  1U3I A;  4XRD A;  4Z2U A;  4CDO A;  1S3A A;  3AGN A;  3KN4 A;  4CY8 A;  4IJ3 A;  3L0R A;  1O6J A;  5D82 A;  3TJJ A;  1GLQ A;  3LTD A;  1GUL A;  1KC8 4;  2EC4 A;  1W6G A;  1YQ1 A;  17GS A;  1GY7 A;  2F5M A;  13GS A;  4TOP A;  2FWE A;  3H79 A;  4BVX A;  4N30 A;  2M46 A;  2PGT A;  2XHF A;  4HBR A;  5F8B A;  1RRL A;  3F8U A;  1SYX A;  5KN2 A;  2B5E A;  2ML5 A;  3SOA A;  3ZG0 A;  5RNT A;  3TCO A;  3GH9 A;  4EUY A;  2R41 A;  3NQZ A;  1B27 A;  3GRX A;  1GOY A;  1GP1 A;  2E7P A;  1XW9 A;  1YF1 A;  1K3O A;  2OOV A;  1MWU A;  3APO A;  3F3R A;  3UIW A;  5DAK B;  4G0I A;  5AEW B;  2OTJ 3;  5DAL B;  3DRN A;  1SU9 A;  5AII A;  4KSM A;  4OWY A;  2GLR A;  3F6D A;  3DYR A;  3C1S A;  4L0U A;  1TXX A;  2H6Y A;  1W00 A;  1DYU A;  4K9Z A;  1BRJ A;  2GBX B;  5AI1 A;  1OAC A;  3BCI A;  2VCX A;  3EN1 B;  5ID2 B;  2H71 A;  1I0V A;  3UL6 A;  2ZL8 A;  4ZB8 A;  1ERV A;  1W02 A;  1N5H A;  4GTU A;  3GHA A;  1U6T A;  2CZ3 A;  3LOY A;  4J8T A;  3MIX A;  4J56 E;  1RGC A;  3DGQ A;  5FHI A;  2QIY A;  1YKA A;  4KDY A;  1X9S B;  4ML1 A;  4GHO A;  1ZL9 A;  1U88 A;  1FYS A;  3QR6 A;  2J8X B;  2C0F A;  3B4O A;  1CQH A;  5C04 A;  2KXG A;  5IG0 A;  4IP1 A;  2WOF A;  3IXR A;  5IMF A;  1SJW A;  1B2M A;  1CH0 A;  4KDX A;  3TOT A;  4V1A g;  3M0F A;  4L8E A;  1FGQ A;  1DMN A;  1DBY A;  1BSD A;  4HM2 B;  4GSS A;  4BVY A;  4ZIJ A;  5ELG A;  3UL5 A;  2FA8 A;  3G71 3;  5CNW A;  1RNT A;  2YWN A;  3LG6 A;  3LW9 A;  1D6U A;  1IU7 A;  5M1A A;  3ZIJ A;  3KZQ A;  4G1M B;  1EV9 A;  1NW2 A;  4WF5 A;  4IN0 A;  1SJZ A;  1YGW A;  1EOH A;  3IK9 A;  4ID0 A;  2FXT A;  3DY5 A;  3JUP A;  2H0G A;  1H4O A;  2YNX A;  1HNB A;  1D6Z A;  4OUQ A;  3UL3 A;  4EBG A;  4CHS A;  2AHE A;  5CRG A;  4YQM A;  1ZZY A;  4Q5N A;  1HQO A;  4G10 A;  3CC2 3;  4LSO A;  2ALB A;  2JU5 A;  2R2J A;  2CX3 A;  2PVQ A;  4R9L A;  4O32 A;  4DEJ A;  4QQ7 A;  3DH2 A;  2B3S A;  5CP1 A;  3WMD A;  2V1M A;  1ON4 A;  2JSY A;  3GYK A;  7STD A;  2H1G A;  5KN1 A;  3FR3 A;  4IHU A;  4HAA A;  4WYK B;  2JSZ A;  5ID2 A;  5KEJ A;  3RNT A;  2GEX A;  1R26 A;  1YDK A;  1AR0 A;  1TKD B;  3AMO A;  3DUK A;  1R5P A;  1XVW A;  2IMK A;  5HFI A;  2P38 A;  1G6W A;  3H1N A;  4HZ9 B;  3ECF A;  4TR0 A;  4MEI A;  1WE0 A;  2K8V A;  1L5G B;  2IPA A;  3MG2 A;  1PRX A;  3CSI A;  2P09 A;  2H73 A;  1RGG A;  1GTU A;  3UVT A;  2B6M A;  3P8W A;  4R4K A;  3KEB A;  1ZGN A;  1AC1 A;  3OWU A;  2EIR A;  2MYG A;  1TP6 A;  4G19 A;  3T8N A;  1OGX A;  2QEX 3;  4K7I A;  3U5R E;  3UBL A;  2H19 A;  3FG1 A;  2CFL A;  1PA3 A;  3BBY A;  3GFK A;  2GTU A;  3FGY A;  3EUR A;  1JKG B;  4JRF A;  5BXQ A;  4F0C A;  3LTC A;  4TW5 A;  4KT3 B;  1UI8 A;  2W2C A;  1O7P B;  3PGB A;  4ZL9 A;  1Q7Y 4;  4O92 A;  3UB1 A;  2XC2 A;  2WCI A;  1OVN A;  1BNI A;  1TI3 A;  4G9H A;  4XS6 A;  1RW1 A;  2KP1 A;  4HQS A;  5CAX A;  1AW9 A;  3L78 A;  4WEY A;  5ELU A;  2V1L A;  3ME8 A;  2YFL B;  4X43 A;  2IMJ A;  1Z5Y E;  2QA4 3;  3N9H A;  1BNG A;  3VUR A;  2P31 A;  2FY6 A;  4PX1 A;  2BJX A;  1AQW A;  3MYD A;  3D5J A;  3UAP A;  1QJG A;  4N6M A;  4IIA A;  1LNI A;  1XFL A;  1IV9 A;  1HD2 A;  3LFL A;  5F05 A;  2BO9 B;  5AYR B;  5ECI B;  3JUM A;  4L7K A;  3BNE A;  2JAC A;  1TU5 A;  1VQM 3;  5KOW A;  5F06 A;  4IPB A;  2FGX A;  1BOX A;  2JZT A;  1JHB A;  5DQY A;  3CCR 3;  3O8Y A;  3GUS A;  1RGE A;  1YJ9 3;  3ALA A;  1DMM A;  3FZ5 A;  1PD2 1;  1T4Z A;  2VAF A;  3RDE A;  3VF1 A;  1T4Y A;  2UZ8 A;  3NBB A;  3HJM A;  4IQA A;  1N9E A;  2R0C A;  3CCE 3;  2FWF A;  3GST A;  1IK3 A;  3S29 A;  3LML A;  1N2A A;  1RDS A;  3LXU X;  1K0D A;  4OCE A;  4AKZ A;  3K0Z A;  4KDU A;  1FGO A;  3FMW A;  2CWV A;  2WDU A;  3LT8 A;  4KB3 A;  2G2Q A;  2CZ2 A;  3NZN A;  4EIQ A;  2B24 B;  2BIR A;  4MJA A;  1OF5 B;  1M3I A;  3OX9 A;  4HM1 B;  4OFT A;  1LNH A;  3EHC A;  3URP A;  1XVQ A;  1E97 A;  4MZW A;  1LOW A;  4CW9 A;  2OKA A;  2CKF B;  11GS A;  3EYT A;  1UW1 A;  1ZYN A;  1C7H A;  4EKZ A;  2KOK A;  2CVK A;  4FYB A;  4EO3 A;  2JL4 A;  3FEU A;  4JED A;  2F9S A;  2HMJ B;  2PU9 C;  3TRQ A;  4CDL A;  1RHL A;  1IVV A;  4TN8 A;  4XBT A;  2BMQ B;  2FNO A;  2W9P A;  2F5W A;  2C3N A;  1MNL A;  3SED A;  3HVV A;  1SEN A;  4LA1 A;  2C10 A;  1F2E A;  4IJI A;  1BGS A;  1O7H B;  1B8X A;  4O3V A;  2F99 A;  2Z76 A;  4XDV A;  1GY6 A;  1VGL A;  2OCT A;  4KGI A;  2XR8 B;  1XOA A;  2IWT A;  1M9B A;  4JBB A;  1PY3 A;  3P2A A;  1JN5 B;  3QFB C;  1BRI A;  16GS A;  2OBK A;  1W6Y A;  1PX6 A;  4TR1 B;  3CCM 3;  3FZW A;  4RQR A;  2HMN B;  3GAX A;  3N9J A;  4GSN A;  3TGZ A;  1BQ7 A;  2XRX B;  1TTO A;  4NRE A;  4YQV A;  4FCM A;  18GS A;  1OKD A;  3S27 A;  1QFN A;  3VI5 A;  5DRV A;  1F6M C;  5M18 A;  4PUR A;  4ECB A;  3DGM A;  4O5U A;  2P0X A;  2UX0 A;  3MSO A;  3HXS A;  1SL1 B;  4YKG A;  3WOE B;  3IE3 A;  2K3D A;  2H01 A;  2DIY A;  2CHC A;  5IW9 A;  3F8H A;  4Q5F A;  1Q4J A;  4DVC A;  1YEX A;  3V98 A;  3OV4 A;  3TJK A;  3KH7 A;  4OK0 A;  2DJ2 A;  4J5G A;  5HR2 A;  1GTB A;  4HUA A;  14GS A;  4XS4 B;  2DKH A;  1FOH A;  2GQL A;  1WJK A;  5G30 A;  1MEK A;  3LXZ A;  1K0N A;  3L9V A;  1FZU A;  4BPY A;  1IYH A;  2KUC A;  3WA3 A;  3BNB A;  2KF3 A;  2GBW B;  3HJP A;  1NHO A;  5IPH A;  2F98 A;  4MCU A;  2PWJ A;  3APS A;  1M7T A;  1OC3 A;  3L9U A;  3QRD A;  3WA2 X;  4KVH A;  4USS A;  1T2I A;  3P90 A;  1EUI C;  1SL0 B;  4KND A;  2CX0 A;  4GWR A;  4ACS A;  5KOX A;  2A2P A;  3NV0 A;  1E2Y A;  3WYW A;  2Z6B A;  1BRN L;  1IVX A;  2SBL A;  3V92 A;  3SOY A;  1EEJ A;  1S5A A;  2OE0 A;  3ZVJ D;  1TJD A;  1RMS A;  1MDJ A;  5AN1 A;  3PGT A;  2TIR A;  1S3C A;  1Z7R A;  1GMR A;  2C4J A;  3DM8 A;  3CME 3;  2H1D A;  3F40 A;  4K2D A;  2LST A;  3CC4 3;  1X5E A;  4QL7 A;  2BMR B;  4ZL7 A;  1FGT A;  1ERU A;  2B5Y A;  3MWH A;  22GS A;  4EXR A;  4IGJ A;  1UCJ A;  4K61 A;  1O7N B;  4H86 A;  3EJV A;  3FYG A;  2DJJ A;  4JU5 A;  3MDK A;  1YIJ 3;  3K9M C;  3M9J A;  4EE0 A;  3A5E A;  2DML A;  2FLS A;  5GAP D;  4MMY B;  1I3F A;  4LZI A;  1M2A A;  3IC4 A;  2QGU A;  1AAZ A;  1UDI I;  1J08 A;  2H8L A;  3CTG A;  4ECC A;  3WGE A;  3D5G A;  2HSH A;  2VCW A;  3FK8 A;  1T00 A;  2AJQ B;  4KZ1 A;  3FF0 A;  1X1X A;  4GXZ A;  1QVF 2;  3FZA A;  1H75 A;  2DJ1 A;  1URM A;  2WO0 A;  1FGR A;  2XGL A;  3R3E A;  1STF I;  1DE1 A;  3JUQ A;  1W2B 2;  1JV2 B;  3D22 A;  1XXU A;  4IT7 A;  3RHC A;  1SII A;  2IME A;  3HX8 A;  5ECP B;  2UUG C;  1VF2 A;  1WNH A;  3HYP A;  1DVD A;  3Q6O A;  1YF0 A;  1SKR B;  1UGI A;  4N0Z A;  1A2V A;  4EC6 A;  2OE3 A;  1DE2 A;  3WT2 A;  3IMA B;  3TUE A;  1VQ4 3;  5FW5 A;  4WKW A;  2HRK A;  4TR4 A;  3DGO A;  1NSW A;  1FA3 A;  3LOR A;  5ECH B;  1V74 A;  2CAQ A;  4AJ7 A;  3FY7 A;  1MGW A;  2RUE A;  5JCG A;  1U3A A;  1VQL 3;  2X8G A;  1Z6M A;  4LLR A;  5A4U A;  4DSQ A;  2ZDJ A;  3H4K A;  5J9B A;  1ZCP A;  5JWQ B;  5J3R A;  1J9B A;  3FW2 A;  3F4S A;  1VQ9 3;  1BG5 A;  3ZVJ A;  2R4V A;  3P7X A;  2R4I A;  2AB6 A;  4Z2R A;  2CWT A;  3H8Q A;  1O7U A;  2OE1 A;  3J7Y k;  3DXB A;  3D5I A;  2WGQ A;  3M3M A;  4XBY A;  4K90 B;  5D9T A;  1UCI A;  2WUL A;  1MTC A;  3D21 A;  2V41 A;  3M9K A;  2CQ9 A;  1I70 A;  3FZ9 A;  2LNS A;  1EG9 B;  1NHY A;  3GX8 A;  4QWT A;  5BU4 A;  1BU4 A;  2YCD A;  5CRH A;  3HJO A;  3FRC A;  1F9M A;  3TRP A;  1F3A A;  1US1 A;  3VWW A;  4HZ2 A;  1ULI B;  2NBS A;  3MAK A;  1EP8 A;  1OE7 A;  5G1L A;  4YKF A;  5CO3 A;  1XIY A;  3ZYW A;  2VCZ A;  1RGA A;  4DSR A;  5IPG A;  4MAB A;  1I2F A;  3PZW A;  5IO0 A;  1FB6 A;  1Q82 4;  3LYK A;  2KF5 A;  2RUF A;  3UJ1 A;  1BRK A;  5IO2 A;  2R3X A;  2GDR A;  5FWG A;  1QAL A;  1K0A A;  3NHX A;  4MMX B;  3TKQ A;  1UVZ A;  1B4P A;  1FO5 A;  2PUK C;  4YAV A;  1O81 A;  5LCZ A;  1K0O A;  3CBU A;  1SK2 A;  4X2O A;  1K0C A;  2C3Q A;  4KF9 A;  1X1U A;  5AIV A;  3EIN A;  4GST A;  4POM A;  1G02 A;  3EB8 A;  1E3V A;  3X3X A;  2GSP A;  1IDP A;  5IG4 A;  2BU4 A;  1Q86 4;  2CX4 A;  1A2K A;  1K73 4;  4I4K A;  3GUR A;  1PMT A;  1U87 A;  4GQF A;  3G0K A;  5CK6 A;  4FYU A;  2CC3 A;  2NDO A;  2CIU A;  1Q98 A;  3QK9 A;  1TOF A;  1LOY A;  1Q9E A;  2H1B A;  3GKK A;  3NBJ A;  2I1U A;  3LEF A;  2E2V A;  4KUN A;  4V2M A;  1FB0 A;  1IYY A;  4MNN A;  1JLW A;  3RBT A;  2LRN A;  1GYB A;  5IMA A;  5D93 A;  4HJ2 A;  2JZS A;  3QFA C;  2C4B A;  4FO5 A;  1TRU A;  2YP6 A;  5STD A;  1MWR A;  4RI7 A;  2D2Z A;  4L5O A;  5D81 A;  3L4N A;  2IYJ A;  1OHO A;  3MG1 A;  2LRT A;  5DCH A;  4K5S A;  20GS A;  2F51 A;  3STD A;  4OD7 A;  2CG0 A;  3FH1 A;  5IG3 A;  5IQY A;  1Q40 B;  3BJ5 A;  4WR4 A;  2HFD A;  5IIZ A;  4ICY A;  1YY7 A;  1VQK 3;  4K1U A;  2KLX A;  1A24 A;  2M7O A;  3NXJ A;  5B8B A;  2TRC P;  3I56 3;  3BIR A;  5CXO A;  1M1X B;  5KP1 A;  1SIH A;  2K8S A;  2XBQ A;  3EE1 A;  3N8B A;  2KRT A;  3G4S 3;  1TTZ A;  5HFG A;  1V98 A;  1HYU A;  2XEP A;  3A76 A;  1N9J A;  2V6O A;  4U13 A;  8CHO A;  1EKM A;  3NOF A;  4GL6 A;  3X42 A;  1JB5 A;  5G5F A;  1GSP A;  4PNG A;  1ZYE A;  5ELA A;  3CPW 2;  3IRA A;  1YJN 3;  2ON7 A;  4FMB A;  4KCE A;  3EBT A;  1SK1 A;  2RBI A;  2PVO C;  3EBY A;  5AYS C;  2N5A A;  2F4Y A;  3IC8 A;  2DJK A;  4KW6 A;  5ECQ B;  3ZRD A;  1RGL A;  2WJU A;  3ZFB A;  5D83 A;  2JQ5 A;  3IV4 A;  3GL5 A;  1S3R A;  3LWA A;  2GSR A;  2H6Z A;  1N8J A;  1A2M A;  1R4W A;  1YGE A;  4MMM A;  5EVO A;  3TJF A;  4AJ6 A;  5D8I A;  4O5R A;  3NV0 B;  4MF7 A;  4MJC A;  2IIY A;  4I2T A;  3D6I A;  2W6J H;  4L0W A;  5KN3 A;  2FNQ A;  3KP9 A;  2OWP A;  3DML A;  3A5I A;  1NU3 A;  3LSZ A;  1K0B A;  1O7W B;  1YZX A;  3KSP A;  3Q19 A;  3D3L A;  5HR0 A;  3IPT A;  5F0G A;  2FD3 A;  5GSP A;  2VM2 A;  3TKP A;  2RM5 A;  1PSQ A;  3C73 A;  1JLV A;  4HKV B;  4HJM A;  5ECL B;  2CVB A;  4WBR D;  3IHQ A;  2L4V A;  1PQN A;  1B2U A;  2L4C A;  3EC3 A;  4WXT A;  4MZC A;  3GTU B;  2AAD A;  1A8Y A;  3HI7 A;  3U1W A;  6STD A;  2L6D A;  4KA0 A;  4DSS A;  1LQM B;  1J0F A;  4XS4 A;  3QAG A;  1BSA A;  2HRN A;  5HOH A;  3KSE D;  5IMD A;  1TFK A;  1RGH A;  1FW7 A;  2PBJ A;  5GZZ B;  5CYY A;  4HJL B;  4PXO A;  1WMO A;  3HA9 A;  1DSB A;  2INX A;  3A3T A;  4F0B A;  1YHQ 3;  5ECM B;  2C80 A;  3EE2 A;  4BIR A;  2A2R A;  3VWU A;  1O7G B;  1HYF A;  3PXM A;  3KXO A;  3EU3 A;  4FCZ A;  4FH8 A;  4XCS A;  4IEL A;  2C1Y A;  4JR4 A;  3OW2 2;  4MP4 A;  1CQG A;  4K0G A;  1N8R 4;  3SXX A;  2G0F A;  4K8M A;  4Q53 A;  4POB A;  3LH4 A;  3CC7 3;  1B20 A;  1IV7 A;  1GSS A;  4X2H A;  5F07 A;  3SVA A;  4OFN A;  3NX0 A;  7GSS A;  3DZL A;  2LNT A;  1WWJ A;  2IUJ A;  4WF4 A;  2LTK A;  1V58 A;  1B2X A;  3IOS A;  4I97 A;  1ST9 A;  3GL3 A;  4N0V A;  3Q90 A;  2VL2 C;  4FR9 A;  4BTY A;  1EWX A;  4FIW A;  4NMU A;  1MD3 A;  4ZBA A;  3HCZ A;  4MPG A;  1TRP A;  2MMA A;  1SJI A;  3SYU A;  3MYT A;  2V6K A;  1Y4K A;  2AUV A;  2GU1 A;  4AGS A;  3HY2 A;  3U97 A;  12GS A;  4G0K A;  3RPN A;  1T1V A;  3H51 A;  3WGX A;  2A15 A;  2B1X B;  1VZZ A;  2A4H A;  5FT3 A;  4BTW A;  1UUG B;  5BMU A;  3WR2 A;  3NIV A;  2HMK B;  1GUH A;  5IEP A;  4HM8 B;  4E8H A;  3SBC A;  4EDY A;  3BB9 A;  3CXG A;  1KTE A;  4IKH A;  3KCM A;  4V1A p;  3HK4 A;  5CF1 A;  1M90 4;  2LJA A;  4RNZ A;  4XBX A;  2YWO A;  1YJ6 A;  2QC7 A;  6GSU A;  1R7H A;  1QMA A;  3D0Z A;  2DLX A;  1B2Z A;  5LD0 A;  3ED3 A;  1HKX A;  2HMO B;  5EEO A;  3DKS A;  3H93 A;  3HKR A;  3CMA 3;  1GRX A;  3KKG A;  3IBH A;  3PCR A;  3BCK A;  3GSP A;  4O02 B;  1ZYQ B;  1GTI A;  1BUJ A;  5D9V A;  3ZIT A;  1TI1 A;  5INY A;  4K2X A;  3FSD A;  1EV4 A;  5BVB A;  1BX9 A;  4K1F A;  4MJE A;  5JPP A;  4MPF A;  3I9V 2;  4HM0 B;  3GSS A;  4IW9 A;  2CFG A;  2HXK A;  3B8L A;  3L0H A;  5JBS A;  1V40 A;  2FHE A;  7RNT A;  1WMJ A;  4EVM A;  3AHS A;  3G7J A;  2YV9 A;  4N6V 0;  5A4V A;  1ZOF A;  2H0H A;  4FCJ A;  5CRW A;  4FMD A;  1UN2 A;  3ZRE A;  1G0T A;  1XCC A;  2V2G A;  4WWU C;  1KD1 4;  5DAL A;  2JDI H;  3WHO A;  1Y25 A;  3CCU 3;  3G9B A;  3CCS 3;  2QKE A;  1F37 A;  4V2N A;  1KBN A;  1G6Y A;  2X4A A;  1BAY A;  2W9Q A;  3RGA A;  2O87 A;  1I2E A;  1ZX2 A;  1BED A;  2RGQ A;  1ML6 A;  1ZGX A;  1VQO 3;  1QXH A;  4K0N A;  2EIQ A;  2ES7 A;  2F8F A;  4BVY B;  1A23 A;  1EOG A;  2K18 A;  3DIE A;  4RI6 A;  3EF8 A;  1MD4 A;  1X0R A;  4RUV A;  4ZBB A;  1GTA A;  3VK9 A;  1HNA A;  2OTL 3;  1T2H A;  5IEO A;  3CTF A;  4N11 A;  5GSS A;  3F4T A;  5KP3 A;  3F0I A;  1A67 A;  3Q2P A;  2VD0 A;  5JWR B;  1WTH A;  3SWL A;  2Q07 A;  1QQ2 A;  3GKM A;  1ZYP A;  1SPU A;  1J2B A;  1BSE A;  2F86 B;  2X64 A;  5ECO B;  2F56 A;  2FUG 2;  2IL3 A;  2V32 A;  1XW6 A;  2IY2 A;  3K5T A;  2L5O A;  1LBK A;  5JCW A;  1RQM A;  3KD0 A;  1AQZ A;  2DKI A;  4HZB B;  2M72 A;  3DD3 A;  1UCK A;  2FWG A;  2HSM A;  1FAA A;  5E4W A;  3LXT A;  5I97 A;  3FR6 A;  3ZG5 A;  1SJ6 A;  1GMP A;  3GZB A;  1T5Y A;  4WYK A;  1FOV A;  5DVB A;  3DVW A;  1GNW A;  2TRX A;  1EA2 A;  1WQL B;  1WMP A;  2KF4 A;  2JAD A;  3QDN A;  2KAA A;  5EY6 A;  5DQS A;  5CLK A;  2VLU A;  3CSH A;  1MWT A;  1M2D A;  2K54 A;  5HFK A;  2AAE A;  1ACV A;  3VGN A;  3US3 A;  3LGC A;  2RLI A;  4MF6 A;  2C8U A;  1ABA A;  2GST A;  3D9R A;  4HS1 A;  4BWQ A;  9GSS A;  1C54 A;  3A2W A;  1GS3 A;  1BSC A;  1ZMA A;  2O89 A;  2H30 A;  1THX A;  2WFC A;  1ROV A;  4EYC A;  1PKZ A;  4AJ8 A;  4KFE A;  3EPT A;  1XZO A;  2O9U X;  2XH9 A;  3A2X A;  4WET A;  3CU3 A;  4OCF A;  1QAK A;  5J41 A;  2O3O A;  3AGO A;  1VF1 A;  2PZV A;  3ZL5 A;  2LYX A;  2W56 B;  3F9S A;  3JVC A;  1CQS A;  2K0M A;  1WIK A;  3CCV 3;  4CY6 A;  3EVI A;  3W6G A;  1BSB A;  3I55 3;  2YWM A;  4HM6 B;  3VLN A;  2RFR A;  1GD4 A;  3I69 A;  2ZA4 A;  1GD3 A;  1CYU A;  2VLT A;  2HZE B;  5EQL A;  3S5C A;  2EIO A;  5AIF A;  3FKF A;  4K5R A;  1RN4 A;  2FCH A;  2MBS A;  5HR1 A;  1TDI A;  1ERW A;  3TDG A;  4Q5R A;  4ILF A;  5CF2 A;  4HZ4 A;  4NWY A;  2YN1 A;  3GZR A;  2DJ3 A;  2H72 A;  4MH2 A;  1XWA A;  2LUS A;  5JWO B;  1T3B A;  2GXF A;  3NUV A;  3WGD A;  1M99 A;  1K0M A;  1XWK A;  4KE3 A;  3KII A;  4D73 A;  3BOA A;  2HOH A;  2YZH A;  4OO5 A;  1VQ5 3;  2XSH B;  1GSQ A;  4L8P A;  1X5D A;  1M0U A;  4X4J A;  2C3T A;  1EP7 A;  3PS8 A;  2O7K A;  4TKY A;  2GSS A;  1PL2 A;  4BL7 A;  1TP9 A;  2DJ0 A;  1LXE A;  3GA4 A;  2WB9 A;  5H5Q A;  1FUW A;  1MGR A;  4G0L A;  1ISK A;  1YNV X;  3Q1C A;  4AKY A;  2IFQ B;  4PGT A;  3SX1 A;  2LJK A;  1AQV A;  3CRT A;  5HR3 A;  2LJR A;  2GS3 A;  1BNR A;  3JUO A;  4L8O A;  2J9H A;  1OHS A;  1TU8 A;  2YOI A;  1FHE A;  4F82 A;  1K3L A;  3FR9 A;  4J2F A;  3HZ8 A;  3DGN A;  1IVU A;  2H0I A;  2ZCT A;  4ZBD A;  4FYC A;  2LRC A;  1M2B A;  3QAW A;  5AIX A;  4KAE A;  4BVX B;  1HZ1 A;  1THO A;  2YPM A;  3BND A;  1NWW A;  2PNC A;  2GEY A;  4O5Q A;  3W8S A;  5BIR A;  2VOC A;  4XHM A;  1PU4 A;  2HRF A;  2RII A;  4NAX A;  2XFT A;  4V2L A;  4FMC A;  1A2P A;  3KH9 A;  1RN7 A;  2HE3 A;  1R4C A;  3IPZ A;  2I9W A;  4GSP A;  3KJY A;  3BNC A;  2GT6 A;  1V2A A;  3HVX A;  2WGO A;  3F14 A;  3MPH A;  1K41 A;  2CAI A;  2BTO T;  4NHF A;  5A0O B;  2HZF A;  1OHP A;  3KFQ C;  5G1K A;  3HVS A;  3ZML A;  1SQW A;  1AUC A;  3RDW A;  2GT5 A;  1OCV A;  3FLJ A;  2BNG A;  1JKG A;  2B5X A;  4OVM A;  4JR6 A;  3F6F A;  4D73 B;  3F3Q A;  2MMZ A;  2I4A A;  4O8S A;  1TRS A;  2ZHX B;  1B4Q A;  1YI2 3;  1QMV A;  3QOU A;  1DUG A;  3K7C A;  2B1K A;  1WP0 A;  4JRR A;  3RAZ A;  3G7I A;  4J9A A;  4OMV A;  1ULJ B;  1XW5 A;  2DMM A;  2YFJ B;  3BD2 A;  2ZNM A;  2GU3 A;  2K9F A;  3WOF B;  3H3H A;  1NNV A;  3Q3F A;  4HSC X;  3MNG A;  5IF6 A;  4LYL B;  4PQI A;  2KF6 A;  2QGV A;  4MJD A;  3ROB A;  1RCL A;  1B21 A;  1A2J A;  3K8N A;  3KMO A;  4NPB A;  1OE8 A;  3RGR A;  4ZXG A;  5IMV A;  1X9W B;  4OFM A;  3E0U A;  3NQY A;  2CWU A;  3TKS A;  1BRH A;  2XFS A;  1I9D A;  5JCU A;  3GH6 A;  2CK3 H;  4K7O A;  3GKN A;  1V9W A;  1B9X C;  2JZR A;  1IT7 A;  1OYJ A;  2OJL A;  3AY8 A;  2HSY A;  5J4U A;  1WRY A;  1AY7 A;  5KP4 A;  3CCJ 3;  5E59 A;  4K6X A;  3N5O A;  1QK8 A;  4NXI A;  2XBI A;  5DJM A;  1S72 3;  3M8C A;  3CNX A;  3G16 A;  2J23 A;  3ZFL A;  1GY5 A;  5DDL A;  5EPF A;  4XTS A;  2L1S A;  1VQP 3;  2L57 A;  4E8E A;  1IQY A;  2O85 A;  1GLP A;  4HI7 A;  4PEJ A;  3DGL A;  2P05 A;  4MK3 A;  5AGY A;  1IVW A;  3A5W A;  3D4A A;  4BU4 A;  2WS2 A;  4RNT A;  1E6B A;  2H74 A;  2RM6 A;  1XBS A;  5D9X A;  3WD6 A;  4X0X A;  3HVN A;  1BAO A;  3QCP A;  5EL8 A;  5A5K A;  3TJG A;  1DET A;  1PX7 A;  3EQQ B;  2H70 A;  3FHK A;  1PFO A;  1USB A;  2I3Y A;  1GOU A;  2P0M A;  4N10 A;  1BRG A;  1XPV A;  1KSI A;  2GZY A;  3MSZ A;  1B2S A;  3MHE A;  3CQF A;  3G7Y A;  3ERF A;  1IQX A;  3LZA A;  2MBT A;  4EC0 A;  2AYT A;  3TB2 A;  3VWX A;  3OWY A;  4EXJ A;  1JN5 A;  4EF0 A;  4O2H A;  4HM7 B;  3UBK A;  5B6N A;  2HNL A;  1RN1 A;  3KMN A;  3UMA A;  1ZS7 A;  1I3I A;  2NTO A;  2RSX A;  4ZIL A;  6GST A;  2GVP A;  2IFQ A;  2YZU A;  3DMC A;  1LOX A;  2IJY A;  3EWL A;  1QUW A;  2ZUP A;  3GZY B;  1F8N A;  3U6V A;  2VL9 A;  3NBR A;  4NHZ A;  2GZP A;  1N5P A;  1W01 A;  1RGK A;  1NDO B;  3J7Y b;  1GSU A;  1PKW A;  3X3Y A;  4ULX A;  1GNE A;  3K63 A;  1R5A A;  1RTU A;  4I2U A;  5EVH A;  2VCT A;  2DC5 A;  1NM3 A;  3GIX A;  4DKI A;  4X1U A;  1RKY A;  1JB2 A;  3ZIV A;  2STD A;  4ECJ A;  3D79 A;  3T8U A;  3PR8 A;  4IVF A;  5H5R A;  1Q81 4;  1UC7 A;  4R9K A;  2E2M A;  1IQ8 A;  4MZB A;  2PER A;  2N5B A;  5D9W A;  4MH3 A;  2CX1 A;  1VQ8 3;  3TJB A;  2BHM A;  1U8C B;  3CMI A;  3F63 A;  3DVX A;  1AXD A;  4PNF A;  4ZL8 A;  3JCM L;  3TKS E;  2K6V A;  3D4T A;  5HGR A;  2CFK A;  3HD5 A;  1TFO A;  4JZQ A;  2DBC A;  2X49 A;  3GKX A;  3IHG A;  4K1V A;  2LS5 A;  3DGY A;  4N3V A;  2L4Q A;  1I0X A;  2R0G A;  2WGR A;  1OKT A;  4BA7 A;  2OBI A;  4BTX A;  2MMN A;  3G8Z A;  1OC9 A;  2H75 A;  4POL A;  2I9H A;  4I8B A;  1AV4 A;  3S9F A;  2QA2 A;  3IJE B;  5ECR B;  1BUQ A;  3TOU A;  3GWR A;  2FGT A;  3R2Q A;  4XIH A;  2GSQ A;  6GSV A;  4CJN A;  4NHW A;  1RGF A;  5KN0 A;  3CRU A;  4KFD A;  4GQC A;  3HOH A;  2HLS A;  1LU4 A;  4BWS A;  5A4W A;  3FZ4 A;  4ML6 A;  3S67 A;  2LQO A;  1B9Y C;  1FUT A;  5IM9 A;  4GB5 A;  2BMX A;  3Q18 A;  1OH0 A;  2BT3 A;  5TGN A;  1GSF A;  3C71 A;  4NV2 A;  3S28 A;  3LYP A;  3KGK A;  5J5N A;  4EIP A;  4TR1 A;  1SD8 A;  1LVN A;  1GUK A;  3IA1 A;  1AIU A;  4HYZ A;  2LV3 A;  3CXC 2;  3GX0 A;  4AF2 A;  4R80 A;  1A0F A;  3VPT A;  1JNQ A;  1LOV A;  2OAD A;  3UVH A;  1GSY A;  2MC8 A;  4TX4 A;  3WOD G;  1BRS A;  2UGI A;  1LQG C;  3CNM A;  3GZX B;  1YKC A;  10GS A;  4LL1 B;  4STD A;  1UGH I;  3W8J A;  5IOW A;  1EGR A;  1YVS A;  2VL2 A;  3CCL 3;  1X1W A;  2LQQ A;  1BNJ A;  2XGN A;  1UCL A;  2IUK A;  1VQQ A;  2Z7A A;  2GQM A;  1VF3 A;  1EEM A;  2H66 A;  3O6T A;  2LQV A;  5IER A;  5CRE A;  2F3M A;  2OOV C;  5BRT A;  3HZP A;  1I5G A;  3IAS 2;  1W5Z A;  4DSS B;  4TXV A;  1SAR A;  3QPM A;  4AEQ A;  1VQN 3;  5DRE A;  1BYE A;  2KP2 A;  2F8A A;  2QSI A;  2IN3 A;  4YQU A;  1FG4 A;  6GSW A;  1KNG A;  2KCD A;  4XDW A;  1XOB A;  4MA9 A;  3KE7 A;  3FKA A;  2DSA A;  3E3E A;  1GSE A;  2SAR A;  1YVB I;  3TRX A;  4XM4 A;  1EZK A;  5DAK A;  1QAF A;  1B48 A;  2CT6 A;  2FA4 A;  4GCI A;  1VQ7 3;  3F8X A;  1XWG A;  4F9Z A;  1BNS A;  5AIH A;  2GZZ A;  2AAW A;  4EV5 A;  1JRQ A;  1UA5 A;  2P0G A;  3F9U A;  4N6T A;  7GSP A;  3J7Y d;  4HOH A;  1HNC A;  1NB3 I;  1NB5 I;  3GV1 A;  1ASK A;  4ORL A;  3MWZ A;  3I0Y A;  2HML B;  3VPQ A;  1X1Y A;  3WT1 A;  2WOH A;  1XWC A;  1QGV A;  4IBP A;  1YJW 3;  4GRF A;  1MOL A;  1SD9 A;  5ELJ A;  2VL3 A;  2VM1 A;  1AQX A;  6GSY A;  4J57 E;  2ML6 A;  2FWH A;  5COH A;  3GNJ A;  3CPO A;  4TXO A;  3VFI A;  3L9S A;  1B3S A;  1Q40 A;  3LYG A;  1RK4 A;  1G7O A;  4WP5 A;  1M3J A;  3ME7 A;  1M9A A;  5GST A;  5JPU A;  1XWB A;  1RNB A;  5B6M A;  2H1A A;  1MDI A;  1UUW B;  3M8N A;  2Y73 A;  1OC8 A;  3PIN A;  1W2Z A;  5ECK B;  5J9C A;  4ZM8 A;  4J5K A;  3X41 A;  3VSY A;  1T8E B;  4HQZ A;  3CD6 3;  3GN3 A;  3VWV A;  4F2I A;  1OGZ A;  1GH2 A;  1KEB A;  2N5F A;  4NV5 A;  5AIG A;  3MG3 A;  3KP8 A;  3EMP A;  3B4P A;  4PQH A;  4K7N A;  4ISD A;  3TKR A;  4A5P A;  1D6Y A;  4RZM A;  3V99 A;  4KSO A;  1TIJ A;  1Z1S A;  2B7J A;  3I6A A;  1JZO A;  1TW9 A;  4IQ1 A;  1R4Y A;  8RNT A;  4RQX A;  3G6E 3;  5H5S A;  2M80 A;  4LMW A;  1V57 A;  3HZ4 A;  1GSD A;  3ERG A;  3O76 A;  5G2G A;  3VI7 A;  1AVK A;  4HVN A;  4LMV A;  2W03 A;  2CVD A;  1UUV B;  4EDZ A;  2PN8 A;  2R5G A;  4ECI A;  1PYL A;  4R1K A;  1JBR A;  2E0Q A;  4HOJ A;  1SL2 B;  5IEN A;  4MF5 A;  3DEX A;  1KWI A;  1F3B A;  1TRQ A;  3KTB A;  3KCH A;  5AIS A;  1GMQ A;  1BNE A;  4WR5 A;  2HT9 A;  5D73 A;  1ROA A;  4Q5Q A;  1A0R P;  1O8X A;  1JFU A;  3F7S A;  1JBS A;  4Z2T A;  1O7M B;  1RRH A;  1SYR A;  3FCS B;  4BL7 B;  2HYX A;  1YEP A;  1O8W A;  1JJ2 2;  4TXO B;  2GGT A;  4IS0 A;  1N8Q A;  4TR3 A;  4TRX A;  1BJX A;  4N6N B;  3UNL A;  5C00 A;  2HI7 A;  2VD1 A;  1GUM A;  3C7M A;  4HM3 B;  4EW5 A;  4XS1 A;  4XRA A;  2C0E A;  1NJI 4;  4I5Q A;  4FMA A;  2L6C A;  2E2U A;  1JZD A;  2XF3 A;  1I8V A;  1VQ6 3;  3D4M A;  6GSS A;  1OUN A;  4N6U A;  5LC7 A;  2I81 A;  2NVL A;  3EC9 A;  4MLY A;  1Z9H A;  1JZW A;  4PQ1 A;  1LJR A;  4TVE A;  1Y6E A;  2WZ9 A;  5IG5 A;  1TK8 B;  1OC9 B;  1FVK A;  1OF5 A;  3UJM A;  4IP6 A;  3CCQ 3;  2RNT A;  2W56 A;  1UI7 A;  1FW1 A;  2RCD A;  4HU9 A;  1TK5 B;  4PUF C;  5ECS A;  5L71 A;  4RNY A;  4JE1 A;  4HM4 B;  2WRT A;  2W04 A;  1QVG 2;  4WBJ A;  19GS A;  1W4V A;  5CRD A;  3LTA A;  3OXA A;  3ER7 A;  4HEA 2;  1X5C A;  2CA8 A;  5IOX A;  1GOV A;  2H76 A;  4G2E A;  1XG8 A;  2YAN A;  3KTL A;  1SK0 A;  1OPY A;  4PUA A;  2CV4 A;  1FVJ A;  3DWV A;  3FG3 A;  4BIK A;  4ZB6 A;  3GMF A;  4WFO A;  2HMM B;  3UAR A;  5B7C A;  2VCV A;  2IA7 A;  2CFD A;  5D96 A;  4EL1 A;  2L5L A;  4RBN A;  3EMX A;  2D42 A;  4N6L A;  2MMO A;  1TUH A;  1Z7P A;  1FUS A;  1O73 A;  2O8V B;  1Z6N A;  2A2S A;  3PCS A;  3AMO B;  2Z77 A;  2R0P A;  4XB5 A;  5AEU B;  1PFP A;  4MJB A;  4L5L A;  2AV4 A;  1RCK A;  2LKU A;  4CPK A;  2A4V A;  2CH9 A;  1OAZ A;  4YH2 A;  1HU9 A;  2VIM A;  1TK0 B;  1G96 A;  3ZFZ A; 
#chains in the Genus database with same CATH homology
 2OAC A;  2C0G A;  2H6X A;  3ZMK A;  3O3T A;  1SKS B;  3EU4 A;  3PH9 A;  2P5Q A;  3RHB A;  2VUP A;  2IMF A;  4ZB9 A;  4KX4 A;  1K3Y A;  2IMD A;  2REM A;  6GSX A;  4LL4 B;  2E2G A;  4QL9 A;  5IMZ A;  2HRA A;  2IMI A;  1Z3E A;  2YWI A;  4HU7 A;  1X9M B;  5G5E A;  3UEM A;  4Z7X A;  3A2V A;  1PN9 A;  3ERW A;  3QD9 A;  1A2L A;  5ECN B;  1O85 A;  2R6K A;  2C0D A;  2NPB A;  1G7E A;  4F03 A;  2XPD A;  3ISO A;  1TRW A;  2YJH A;  5IMC A;  5DBQ A;  1PGT A;  3ZLP A;  4GF0 A;  1JZR A;  3E9J B;  3UOM A;  1EGO A;  4O7H A;  3TKS C;  3HHV A;  2XPE A;  3IAM 2;  2X8C A;  3I43 A;  2VCQ A;  1VRS D;  2DIZ A;  2KHP A;  1PL1 A;  3M1G A;  3RPP A;  2MZC A;  4MDC A;  2PPT A;  1T7P B;  1C72 A;  4I6X A;  1TU7 A;  5G31 A;  3GTU A;  3LQ7 A;  5G2Z A;  3LJR A;  1WPI A;  3KM6 A;  5DJL A;  1TRV A;  3CYN A;  1SKW B;  1W89 A;  3V1W A;  5ENU A;  5DCG A;  3IK7 A;  2PMT A;  1GWC A;  4KCA A;  2VO4 A;  5HQP A;  3OR5 A;  2X99 A;  4KH7 A;  2B1L A;  3ZZX A;  3PPU A;  3CSJ A;  2X8H A;  1IYI A;  4HDE A;  2GQK A;  3QAV A;  3IR4 A;  2P5R A;  4YAP A;  5GAN D;  3APQ A;  3HDC A;  2QA1 A;  4PTS A;  5B8A A;  1PN0 A;  1ERT A;  4P3Y B;  5ABR A;  2OA7 A;  2VLV A;  2R37 A;  3C1R A;  1A8L A;  8GSS A;  3IDV A;  1GL8 A;  2YJ7 A;  1S3D A;  5LNK e;  2B7K A;  2LEG A;  4POK A;  1ILO A;  2YV7 A;  3KIJ A;  3QMX A;  4FQU A;  3C8E A;  4OO4 A;  1VF4 A;  2L59 A;  1MDK A;  1WOU A;  4GLT A;  2HZE A;  3ZTL A;  2ON5 A;  2Z9S A;  3Q74 A;  3F4R A;  1U3I A;  4XRD A;  4Z2U A;  4CDO A;  1S3A A;  4CY8 A;  4IJ3 A;  1O6J A;  3TJJ A;  1GLQ A;  1GUL A;  2EC4 A;  1YQ1 A;  17GS A;  13GS A;  4TOP A;  2FWE A;  3H79 A;  4BVX A;  4N30 A;  2M46 A;  2PGT A;  2XHF A;  5F8B A;  3F8U A;  1SYX A;  5KN2 A;  2B5E A;  3TCO A;  3GH9 A;  4EUY A;  3GRX A;  1GP1 A;  2E7P A;  1XW9 A;  1YF1 A;  1K3O A;  3APO A;  3F3R A;  3UIW A;  5DAK B;  4G0I A;  5DAL B;  3DRN A;  1SU9 A;  4OWY A;  4KSM A;  2GLR A;  3F6D A;  3DYR A;  3C1S A;  4L0U A;  1TXX A;  2H6Y A;  4K9Z A;  3BCI A;  2VCX A;  5ID2 B;  2H71 A;  4ZB8 A;  1ERV A;  4GTU A;  3GHA A;  1U6T A;  2CZ3 A;  3MIX A;  4J56 E;  3DGQ A;  5FHI A;  1YKA A;  4KDY A;  1X9S B;  4ML1 A;  1ZL9 A;  1U88 A;  3QR6 A;  5C04 A;  1CQH A;  4IP1 A;  5IMF A;  3IXR A;  3TOT A;  4KDX A;  4V1A g;  3M0F A;  4L8E A;  1DBY A;  4GSS A;  4BVY A;  4ZIJ A;  5ELG A;  2FA8 A;  5CNW A;  2YWN A;  3LG6 A;  3LW9 A;  3ZIJ A;  3KZQ A;  1EV9 A;  1NW2 A;  4WF5 A;  4IN0 A;  1SJZ A;  1EOH A;  3IK9 A;  4ID0 A;  2H0G A;  1H4O A;  2YNX A;  1HNB A;  3UL3 A;  4CHS A;  2AHE A;  5CRG A;  4YQM A;  1ZZY A;  4Q5N A;  1HQO A;  4G10 A;  2ALB A;  2JU5 A;  2R2J A;  2CX3 A;  2PVQ A;  4O32 A;  4DEJ A;  4QQ7 A;  2B3S A;  5CP1 A;  2V1M A;  1ON4 A;  2JSY A;  3GYK A;  2H1G A;  5KN1 A;  3FR3 A;  4IHU A;  2JSZ A;  5ID2 A;  5KEJ A;  1R26 A;  1YDK A;  1TKD B;  1R5P A;  1XVW A;  5HFI A;  2IMK A;  1G6W A;  3H1N A;  4TR0 A;  1WE0 A;  2K8V A;  2IPA A;  1PRX A;  3CSI A;  2H73 A;  3UVT A;  1GTU A;  2B6M A;  3P8W A;  3KEB A;  1ZGN A;  1AC1 A;  2EIR A;  2MYG A;  4G19 A;  4K7I A;  3U5R E;  3UBL A;  2H19 A;  1PA3 A;  3BBY A;  3GFK A;  2GTU A;  3EUR A;  4F0C A;  4TW5 A;  4ZL9 A;  4O92 A;  2XC2 A;  2WCI A;  1OVN A;  1TI3 A;  4G9H A;  4XS6 A;  1RW1 A;  2KP1 A;  4HQS A;  5CAX A;  1AW9 A;  3L78 A;  4WEY A;  3ME8 A;  4X43 A;  1Z5Y E;  3VUR A;  2P31 A;  4PX1 A;  2FY6 A;  2BJX A;  1AQW A;  3MYD A;  3D5J A;  3UAP A;  1XFL A;  1HD2 A;  3LFL A;  5F05 A;  5ECI B;  2JAC A;  5KOW A;  5F06 A;  2FGX A;  2JZT A;  1JHB A;  5DQY A;  3GUS A;  3FZ5 A;  1PD2 1;  1T4Z A;  2VAF A;  1T4Y A;  2UZ8 A;  3HJM A;  4IQA A;  2R0C A;  2FWF A;  3GST A;  1N2A A;  1K0D A;  4OCE A;  4KDU A;  3FMW A;  2WDU A;  4KB3 A;  2G2Q A;  2CZ2 A;  3NZN A;  4EIQ A;  4MJA A;  4OFT A;  1XVQ A;  4MZW A;  4CW9 A;  2OKA A;  11GS A;  3EYT A;  1ZYN A;  4EKZ A;  2KOK A;  2CVK A;  4FYB A;  4EO3 A;  2JL4 A;  3FEU A;  4JED A;  2F9S A;  2PU9 C;  3TRQ A;  4TN8 A;  2FNO A;  2C3N A;  3HVV A;  1SEN A;  4LA1 A;  1F2E A;  4IJI A;  1B8X A;  1VGL A;  4KGI A;  1XOA A;  2IWT A;  1M9B A;  4JBB A;  3P2A A;  3QFB C;  16GS A;  2OBK A;  1PX6 A;  4TR1 B;  4RQR A;  3N9J A;  4GSN A;  3TGZ A;  1BQ7 A;  4YQV A;  18GS A;  1OKD A;  1QFN A;  3VI5 A;  1F6M C;  4PUR A;  4ECB A;  4O5U A;  3HXS A;  1SL1 B;  4YKG A;  3IE3 A;  2H01 A;  2DIY A;  4Q5F A;  1Q4J A;  4DVC A;  1YEX A;  3TJK A;  3KH7 A;  2DJ2 A;  5HR2 A;  1GTB A;  4HUA A;  14GS A;  4XS4 B;  2DKH A;  1FOH A;  2GQL A;  1WJK A;  5G30 A;  1MEK A;  3LXZ A;  1K0N A;  3L9V A;  4BPY A;  1IYH A;  2KUC A;  3HJP A;  1NHO A;  5IPH A;  4MCU A;  2PWJ A;  3APS A;  1M7T A;  1OC3 A;  3L9U A;  4USS A;  3P90 A;  1SL0 B;  4KND A;  4GWR A;  4ACS A;  5KOX A;  2A2P A;  1E2Y A;  3WYW A;  1EEJ A;  2OE0 A;  3ZVJ D;  1TJD A;  1MDJ A;  5AN1 A;  3PGT A;  2TIR A;  1S3C A;  1Z7R A;  2C4J A;  4QL7 A;  2H1D A;  4K2D A;  2LST A;  1X5E A;  4ZL7 A;  1ERU A;  2B5Y A;  3MWH A;  22GS A;  4IGJ A;  4H86 A;  3FYG A;  2DJJ A;  4JU5 A;  3MDK A;  3M9J A;  4EE0 A;  2DML A;  2FLS A;  5GAP D;  3IC4 A;  1M2A A;  1AAZ A;  1J08 A;  2H8L A;  3CTG A;  4ECC A;  3WGE A;  2HSH A;  2VCW A;  3FK8 A;  1T00 A;  2AJQ B;  4GXZ A;  3FZA A;  1H75 A;  2DJ1 A;  1URM A;  3R3E A;  1DE1 A;  3D22 A;  1XXU A;  3RHC A;  2IME A;  5ECP B;  1VF2 A;  3HYP A;  3Q6O A;  1YF0 A;  1SKR B;  4N0Z A;  2OE3 A;  1DE2 A;  3WT2 A;  3TUE A;  4WKW A;  2HRK A;  4TR4 A;  1NSW A;  3LOR A;  5ECH B;  2CAQ A;  4AJ7 A;  2RUE A;  5JCG A;  1U3A A;  2X8G A;  1Z6M A;  4LLR A;  5A4U A;  4DSQ A;  3H4K A;  5J9B A;  1ZCP A;  5JWQ B;  5J3R A;  1J9B A;  3FW2 A;  3F4S A;  1BG5 A;  3ZVJ A;  2R4V A;  3P7X A;  2AB6 A;  4Z2R A;  3H8Q A;  1O7U A;  2OE1 A;  3J7Y k;  3DXB A;  3M3M A;  5D9T A;  2WUL A;  1MTC A;  3D21 A;  2V41 A;  3M9K A;  2CQ9 A;  3FZ9 A;  2LNS A;  1NHY A;  3GX8 A;  2YCD A;  5CRH A;  3HJO A;  3FRC A;  1F9M A;  3TRP A;  1F3A A;  3VWW A;  4HZ2 A;  2NBS A;  3MAK A;  1EP8 A;  1OE7 A;  5G1L A;  4YKF A;  5CO3 A;  1XIY A;  3ZYW A;  2VCZ A;  4DSR A;  5IPG A;  4MAB A;  5IO0 A;  1FB6 A;  3LYK A;  2RUF A;  3UJ1 A;  5IO2 A;  2R3X A;  2GDR A;  5FWG A;  1K0A A;  3TKQ A;  1UVZ A;  1B4P A;  1FO5 A;  2PUK C;  4YAV A;  1O81 A;  5LCZ A;  1K0O A;  3CBU A;  4KF9 A;  1SK2 A;  1K0C A;  2C3Q A;  5AIV A;  3EIN A;  4GST A;  4POM A;  2CX4 A;  3GUR A;  1PMT A;  1U87 A;  4GQF A;  4FYU A;  2NDO A;  1Q98 A;  1TOF A;  2H1B A;  3GKK A;  2I1U A;  3LEF A;  4KUN A;  4V2M A;  1FB0 A;  4MNN A;  1JLW A;  3RBT A;  2LRN A;  5IMA A;  5D93 A;  4HJ2 A;  2JZS A;  3QFA C;  4FO5 A;  1TRU A;  2YP6 A;  4RI7 A;  2D2Z A;  4L5O A;  3L4N A;  2IYJ A;  2LRT A;  5DCH A;  4K5S A;  20GS A;  2F51 A;  4OD7 A;  5IQY A;  3BJ5 A;  4WR4 A;  2HFD A;  5IIZ A;  4ICY A;  1YY7 A;  2KLX A;  1A24 A;  5B8B A;  2TRC P;  2K8S A;  2XBQ A;  1TTZ A;  5HFG A;  1V98 A;  1HYU A;  2V6O A;  3NOF A;  5G5F A;  4PNG A;  1ZYE A;  5ELA A;  3IRA A;  2ON7 A;  4KCE A;  1SK1 A;  2PVO C;  2N5A A;  3IC8 A;  2DJK A;  4KW6 A;  5ECQ B;  3ZRD A;  2WJU A;  3ZFB A;  3IV4 A;  3GL5 A;  3LWA A;  2GSR A;  2H6Z A;  1N8J A;  1A2M A;  1R4W A;  4MMM A;  5EVO A;  3TJF A;  4AJ6 A;  5D8I A;  4O5R A;  4MF7 A;  4MJC A;  2IIY A;  4I2T A;  3D6I A;  4L0W A;  5KN3 A;  3KP9 A;  3DML A;  3A5I A;  3LSZ A;  1K0B A;  1YZX A;  3Q19 A;  5HR0 A;  5F0G A;  2FD3 A;  2VM2 A;  3TKP A;  2RM5 A;  1PSQ A;  3C73 A;  1JLV A;  4HJM A;  5ECL B;  2CVB A;  4WBR D;  3IHQ A;  1PQN A;  2L4C A;  3EC3 A;  4WXT A;  4MZC A;  3GTU B;  1A8Y A;  2L6D A;  4KA0 A;  4DSS A;  1J0F A;  4XS4 A;  3QAG A;  2HRN A;  5IMD A;  2PBJ A;  5GZZ B;  5CYY A;  4PXO A;  3HA9 A;  1DSB A;  3A3T A;  4F0B A;  5ECM B;  2C80 A;  3EE2 A;  2A2R A;  3VWU A;  3KXO A;  3EU3 A;  4FH8 A;  4XCS A;  4IEL A;  2C1Y A;  4JR4 A;  4MP4 A;  1CQG A;  4K0G A;  2G0F A;  4K8M A;  4POB A;  1GSS A;  5F07 A;  4OFN A;  7GSS A;  2LNT A;  1WWJ A;  4WF4 A;  2LTK A;  1V58 A;  3IOS A;  4I97 A;  1ST9 A;  3GL3 A;  4N0V A;  2VL2 C;  4FIW A;  1EWX A;  4NMU A;  1MD3 A;  4ZBA A;  3HCZ A;  4MPG A;  2MMA A;  1SJI A;  4AGS A;  2V6K A;  2AUV A;  3HY2 A;  12GS A;  4G0K A;  3RPN A;  1T1V A;  3WGX A;  2A4H A;  5FT3 A;  5BMU A;  3NIV A;  1GUH A;  4E8H A;  3SBC A;  4EDY A;  3CXG A;  1KTE A;  4IKH A;  3KCM A;  4V1A p;  2LJA A;  2YWO A;  1YJ6 A;  2QC7 A;  6GSU A;  1R7H A;  3D0Z A;  2DLX A;  5LD0 A;  3ED3 A;  3DKS A;  3H93 A;  3HKR A;  1GRX A;  3IBH A;  3BCK A;  1ZYQ B;  1GTI A;  5D9V A;  3ZIT A;  1TI1 A;  5INY A;  4K2X A;  1EV4 A;  1BX9 A;  4K1F A;  4MJE A;  4MPF A;  3I9V 2;  3GSS A;  4IW9 A;  2HXK A;  3L0H A;  1V40 A;  2FHE A;  1WMJ A;  4EVM A;  3G7J A;  2YV9 A;  5A4V A;  1ZOF A;  2H0H A;  5CRW A;  3ZRE A;  1UN2 A;  1G0T A;  1XCC A;  2V2G A;  5DAL A;  1Y25 A;  3G9B A;  2QKE A;  1F37 A;  4V2N A;  1KBN A;  1G6Y A;  2X4A A;  1BAY A;  2O87 A;  1BED A;  1ML6 A;  1QXH A;  4K0N A;  2EIQ A;  2ES7 A;  2F8F A;  4BVY B;  1A23 A;  1EOG A;  2K18 A;  3DIE A;  4RI6 A;  1MD4 A;  1X0R A;  4RUV A;  4ZBB A;  3VK9 A;  1GTA A;  1HNA A;  3CTF A;  4N11 A;  5GSS A;  3F4T A;  3F0I A;  2VD0 A;  5JWR B;  3SWL A;  1QQ2 A;  3GKM A;  1ZYP A;  2X64 A;  5ECO B;  2FUG 2;  2IL3 A;  2V32 A;  1XW6 A;  2IY2 A;  2L5O A;  1LBK A;  5JCW A;  1RQM A;  3KD0 A;  2DKI A;  2M72 A;  3DD3 A;  2FWG A;  2HSM A;  1FAA A;  5E4W A;  3LXT A;  3FR6 A;  1SJ6 A;  1FOV A;  5DVB A;  3DVW A;  1GNW A;  2TRX A;  2JAD A;  3QDN A;  5EY6 A;  5DQS A;  2VLU A;  3CSH A;  1M2D A;  5HFK A;  1ACV A;  3US3 A;  3LGC A;  2RLI A;  4MF6 A;  2C8U A;  1ABA A;  2GST A;  4HS1 A;  4BWQ A;  9GSS A;  3A2W A;  2O89 A;  1ZMA A;  2H30 A;  1THX A;  2WFC A;  1PKZ A;  4AJ8 A;  3EPT A;  1XZO A;  3A2X A;  4WET A;  4OCF A;  5J41 A;  1VF1 A;  3ZL5 A;  1WIK A;  4CY6 A;  3EVI A;  3W6G A;  2YWM A;  3VLN A;  3I69 A;  2VLT A;  2HZE B;  2EIO A;  3FKF A;  4K5R A;  2FCH A;  2MBS A;  5HR1 A;  1TDI A;  1ERW A;  4Q5R A;  3TDG A;  4ILF A;  4HZ4 A;  4NWY A;  2YN1 A;  2DJ3 A;  2H72 A;  4MH2 A;  1XWA A;  2LUS A;  5JWO B;  1T3B A;  3WGD A;  1M99 A;  1K0M A;  1XWK A;  4KE3 A;  4D73 A;  3BOA A;  2YZH A;  4OO5 A;  1GSQ A;  1X5D A;  1M0U A;  4X4J A;  2C3T A;  1EP7 A;  2O7K A;  4TKY A;  2GSS A;  1PL2 A;  4BL7 A;  1TP9 A;  2DJ0 A;  3GA4 A;  2WB9 A;  5H5Q A;  4G0L A;  2IFQ B;  4PGT A;  2LJK A;  1AQV A;  3CRT A;  5HR3 A;  2LJR A;  2GS3 A;  2J9H A;  1TU8 A;  2YOI A;  1FHE A;  4F82 A;  1K3L A;  3FR9 A;  4J2F A;  3HZ8 A;  2H0I A;  2ZCT A;  4ZBD A;  4FYC A;  2LRC A;  1M2B A;  3QAW A;  5AIX A;  4KAE A;  4BVX B;  1THO A;  2YPM A;  4O5Q A;  3W8S A;  2VOC A;  4XHM A;  2HRF A;  2RII A;  4NAX A;  4V2L A;  3KH9 A;  2HE3 A;  3IPZ A;  3KJY A;  2GT6 A;  1V2A A;  3HVX A;  2CAI A;  2BTO T;  2HZF A;  5G1K A;  3HVS A;  3ZML A;  1AUC A;  3RDW A;  2GT5 A;  2B5X A;  4JR6 A;  3F6F A;  4D73 B;  3F3Q A;  2MMZ A;  2I4A A;  1TRS A;  1B4Q A;  1QMV A;  3QOU A;  1DUG A;  2B1K A;  1WP0 A;  4JRR A;  3RAZ A;  3G7I A;  4OMV A;  1XW5 A;  2DMM A;  3BD2 A;  2ZNM A;  2K9F A;  3MNG A;  4PQI A;  2QGV A;  1A2J A;  3K8N A;  3KMO A;  4NPB A;  1OE8 A;  4ZXG A;  5IMV A;  1X9W B;  4OFM A;  3E0U A;  3TKS A;  1I9D A;  5JCU A;  3GH6 A;  4K7O A;  3GKN A;  1V9W A;  1B9X C;  2JZR A;  1OYJ A;  2OJL A;  3AY8 A;  2HSY A;  5J4U A;  1WRY A;  5E59 A;  4K6X A;  3N5O A;  1QK8 A;  4NXI A;  2XBI A;  5DJM A;  2J23 A;  3ZFL A;  5DDL A;  5EPF A;  4XTS A;  2L57 A;  4E8E A;  2O85 A;  1GLP A;  4HI7 A;  4MK3 A;  5AGY A;  3A5W A;  2WS2 A;  1E6B A;  2H74 A;  2RM6 A;  1XBS A;  5D9X A;  3WD6 A;  4X0X A;  5EL8 A;  3QCP A;  5A5K A;  3TJG A;  1PX7 A;  2H70 A;  3FHK A;  1USB A;  2I3Y A;  4N10 A;  1XPV A;  2GZY A;  3MSZ A;  3G7Y A;  3ERF A;  2MBT A;  4EC0 A;  2AYT A;  3TB2 A;  3VWX A;  4EXJ A;  4EF0 A;  3UBK A;  5B6N A;  2HNL A;  3KMN A;  3UMA A;  4ZIL A;  2NTO A;  6GST A;  2GVP A;  2IFQ A;  2YZU A;  2IJY A;  3EWL A;  1QUW A;  2ZUP A;  3U6V A;  2VL9 A;  4NHZ A;  2GZP A;  3J7Y b;  1GSU A;  1PKW A;  4ULX A;  1GNE A;  1R5A A;  4I2U A;  2VCT A;  2DC5 A;  1NM3 A;  3GIX A;  4X1U A;  3ZIV A;  4ECJ A;  3PR8 A;  4IVF A;  5H5R A;  1UC7 A;  2E2M A;  4MZB A;  2PER A;  2N5B A;  5D9W A;  4MH3 A;  3TJB A;  3CMI A;  3F63 A;  3DVX A;  1AXD A;  4PNF A;  4ZL8 A;  3JCM L;  3TKS E;  2K6V A;  3D4T A;  3HD5 A;  4JZQ A;  2DBC A;  2X49 A;  3GKX A;  3IHG A;  2LS5 A;  2R0G A;  2L4Q A;  2WGR A;  1OKT A;  4BA7 A;  2OBI A;  2MMN A;  1OC9 A;  2H75 A;  4POL A;  2I9H A;  4I8B A;  3S9F A;  2QA2 A;  5ECR B;  3TOU A;  3R2Q A;  4XIH A;  2GSQ A;  6GSV A;  4NHW A;  5KN0 A;  3CRU A;  4GQC A;  2HLS A;  1LU4 A;  4BWS A;  5A4W A;  3FZ4 A;  4ML6 A;  2LQO A;  1B9Y C;  5IM9 A;  2BMX A;  3Q18 A;  1GSF A;  3C71 A;  4NV2 A;  3LYP A;  3KGK A;  5J5N A;  4EIP A;  4TR1 A;  1SD8 A;  1GUK A;  3IA1 A;  1AIU A;  2LV3 A;  4AF2 A;  3GX0 A;  1A0F A;  3VPT A;  2OAD A;  3UVH A;  1GSY A;  1YKC A;  10GS A;  4LL1 B;  3W8J A;  5IOW A;  1EGR A;  2VL2 A;  2LQQ A;  2GQM A;  1VF3 A;  1EEM A;  2H66 A;  3O6T A;  5CRE A;  2F3M A;  5BRT A;  1I5G A;  3IAS 2;  4DSS B;  4TXV A;  3QPM A;  1BYE A;  2KP2 A;  2F8A A;  2QSI A;  2IN3 A;  4YQU A;  1FG4 A;  6GSW A;  1KNG A;  1XOB A;  4MA9 A;  2DSA A;  3E3E A;  1GSE A;  3TRX A;  1EZK A;  5DAK A;  1B48 A;  2CT6 A;  2FA4 A;  4GCI A;  1XWG A;  4F9Z A;  2GZZ A;  2AAW A;  1UA5 A;  2P0G A;  3F9U A;  1HNC A;  3GV1 A;  3VPQ A;  3WT1 A;  1XWC A;  1QGV A;  4IBP A;  4GRF A;  1SD9 A;  2VL3 A;  2VM1 A;  1AQX A;  6GSY A;  4J57 E;  5COH A;  2FWH A;  3GNJ A;  4TXO A;  3VFI A;  3L9S A;  1RK4 A;  1G7O A;  3ME7 A;  1M9A A;  5GST A;  1XWB A;  5B6M A;  2H1A A;  1MDI A;  3M8N A;  1OC8 A;  3PIN A;  5ECK B;  5J9C A;  1T8E B;  4HQZ A;  3GN3 A;  3VWV A;  4F2I A;  1GH2 A;  1KEB A;  2N5F A;  4NV5 A;  3KP8 A;  3EMP A;  4PQH A;  4K7N A;  4ISD A;  3TKR A;  4A5P A;  4KSO A;  2B7J A;  3I6A A;  1JZO A;  1TW9 A;  4IQ1 A;  4RQX A;  5H5S A;  2M80 A;  4LMW A;  1V57 A;  3HZ4 A;  1GSD A;  3ERG A;  3O76 A;  3VI7 A;  4LMV A;  2CVD A;  4EDZ A;  2PN8 A;  2R5G A;  4ECI A;  2E0Q A;  4HOJ A;  1SL2 B;  4MF5 A;  3DEX A;  1F3B A;  3KTB A;  5AIS A;  4WR5 A;  2HT9 A;  5D73 A;  4Q5Q A;  1A0R P;  1O8X A;  1JFU A;  4Z2T A;  1SYR A;  4BL7 B;  2HYX A;  1YEP A;  1O8W A;  4TXO B;  2GGT A;  4IS0 A;  4TR3 A;  4TRX A;  1BJX A;  5C00 A;  2HI7 A;  2VD1 A;  1GUM A;  3C7M A;  4XS1 A;  4XRA A;  2C0E A;  4I5Q A;  2L6C A;  1JZD A;  3D4M A;  6GSS A;  2I81 A;  2NVL A;  4MLY A;  1Z9H A;  1JZW A;  4PQ1 A;  1LJR A;  4TVE A;  1Y6E A;  2WZ9 A;  1TK8 B;  1OC9 B;  1FVK A;  4IP6 A;  1FW1 A;  4HU9 A;  1TK5 B;  4PUF C;  5ECS A;  5L71 A;  4JE1 A;  2WRT A;  4WBJ A;  19GS A;  1W4V A;  5CRD A;  4HEA 2;  1X5C A;  2CA8 A;  5IOX A;  2H76 A;  4G2E A;  2YAN A;  3KTL A;  1SK0 A;  4PUA A;  2CV4 A;  1FVJ A;  3DWV A;  4ZB6 A;  3GMF A;  3UAR A;  5B7C A;  2VCV A;  5D96 A;  4EL1 A;  2L5L A;  3EMX A;  2MMO A;  1Z7P A;  1O73 A;  2O8V B;  1Z6N A;  2A2S A;  2R0P A;  4MJB A;  4L5L A;  2AV4 A;  2LKU A;  2A4V A;  1OAZ A;  4YH2 A;  2VIM A;  1TK0 B;  2C0F A;  3FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...