1TJDA

The crystal structure of the reduced disulphide bond isomerase, dsbc, from escherichia coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
216
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the reduced disulfide-bond isomerase DsbC from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbC
total genus 70
structure length 216
sequence length 216
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1tjdA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tjdA02
4LMVA 4MJEA 4ZILA 10GSA 1XPVA 1F9MA 3EC3A 5ID2A 2C3TA 2CZ2A 4KGIA 5DALB 1O8XA 2CT6A 4ECJA 3HCZA 3VI5A 1S3DA 3HZ8A 4LL1B 1BJXA 5DDLA 2VO4A 3LGCA 5IO2A 4JRRA 3RAZA 1OVNA 1ERUA 5DJLA 5FWGA 1S3AA 4OD7A 5D93A 3US3A 2FWHA 2B5YA 5COHA 4TW5A 4ULXA 1B9YC 1B8XA 3HVXA 3GRXA 4KDYA 4NV5A 3KMNA 3DEXA 3IE3A 1T4ZA 2OBIA 3H8QA 4JE1A 1MEKA 2YP6A 1U6TA 1W4VA 2ZNMA 3GKMA 4DSSB 4HI7A 5ECNB 3GTUB 1T7PB 2VD1A 1BEDA 2PVOC 2ES7A 3P7XA 1ZYQB 1Z6NA 4WR5A 3RHCA 2HZEB 4N10A 4EKZA 1OYJA 1JZRA 3GSTA 4K2DA 5D9TA 3H1NA 4YAVA 2RM6A 1YEPA 2PU9C 1SYXA 4BWQA 3LYPA 2FCHA 1IYHA 1GUMA 5G1LA 4PQIA 1W89A 1OAZA 4MJBA 1ERWA 2C4JA 4GQCA 4MZBA 3GKNA 3HVSA 2I3YA 3KCMA 2E2GA 2OBKA 4KH7A 2VCQA 2C3QA 4PUAA 3I6AA 1H4OA 3HY2A 3EMXA 2FWEA 3I69A 2I9HA 3UARA 5DBQA 3A2WA 1GSSA 3LORA 1Z5YE 5ECMB 2IPAA 2GZZA 3DWVA 4ZL8A 3NZNA 2PPTA 4AJ7A 16GSA 3K8NA 3P8WA 1GSDA 2QGVA 2IY2A 3GH9A 1LU4A 3VI7A 1SK2A 2FGXA 3GX8A 2ON5A 2YCDA 3D4TA 5IMZA 2R2JA 3ZREA 3DD3A 4GQFA 1FVKA 2MBTA 4ZBAA 5ECKB 3FZ5A 3CSIA 3TKQA 1PGTA 1XFLA 1Y6EA 3F3RA 1AQVA 1VF1A 2FA8A 1JHBA 3F6DA 2VCVA 4YAPA 1USBA 2FUG2 1TDIA 1JLWA 5GSTA 3H79A 6GSUA 1A2JA 2CAIA 3D22A 3VURA 4YQVA 4IP1A 1PD21 1TW9A 5JWOB 2WRTA 4NAXA 3TKSE 3PH9A 5H5RA 4RI6A 3QFAC 4JZQA 4RQXA 1SD8A 1VF4A 4POMA 2H0IA 1MD3A 1K3YA 2N5BA 5DCHA 3F6FA 2VIMA 4XS6A 5CNWA 2CA8A 4ZB9A 4KDUA 2PBJA 2F3MA 4EO3A 1PMTA 4DVCA 3ZITA 4MJCA 1E6BA 2GSTA 4KX4A 6GSTA 4PNGA 1EV4A 3CSHA 4L0UA 1G7OA 2AV4A 2LNSA 4MF7A 1GSQA 2EIRA 4HQSA 3J7Yk 3WGEA 2RM5A 4K7IA 2X99A 3FYGA 3TKSA 4KCAA 4GSSA 2JZRA 3HKRA 4WXTA 4OWYA 1A0RP 1DUGA 1FAAA 5AIXA 1F2EA 3GIXA 1M99A 4IBPA 4KSMA 2JSZA 4PQHA 5J5NA 2GTUA 4KE3A 2L57A 2V41A 2AHEA 3QOUA 2AYTA 3ERFA 3UMAA 3APSA 1M2BA 4DSRA 1O85A 5ECQB 3IV4A 5KN2A 3G7IA 2X64A 3LXTA 2DIZA 4N0VA 4N11A 4IP6A 3W8JA 4XRAA 1OKTA 12GSA 1G6YA 2ALBA 4OFMA 4MF6A 2REMA 2P5RA 3FY7A 2GS3A 3TOUA 2H76A 2LUSA 3HJOA 2GGTA 1GP1A 3D4MA 1A24A 3DVWA 3APQA 4LA1A 3TRPA 1PL2A 3ZLPA 1FB0A 2JZTA 1K3OA 2ON7A 2HNLA 3C1RA 4PXOA 1Q4JA 1SK1A 5KN0A 3GUSA 2JSYA 4XS4A 5ENUA 2FHEA 4MCUA 2I4AA 3EURA 1XCCA 2B5XA 1ABAA 5AISA 1XOAA 1FOVA 3QFBC 1FHEA 5ECRB 1TTZA 2DC5A 3HJPA 3G7YA 2HSYA 3IAM2 1AQXA 4NHWA 3LG6A 4KDXA 4NMUA 5GAND 4IHUA 4POBA 4ZBDA 4XCSA 1GWCA 1GUHA 3TJBA 1DE2A 2CX3A 3G7JA 1N8JA 3EINA 4ECCA 1Q98A 2JACA 1UC7A 2HRFA 4EUYA 3TOTA 3I43A 1GH2A 5KN3A 5EL8A 4IQ1A 4I8BA 1RW1A 4MLYA 3FK8A 3ZTLA 2LRCA 3VPTA 2R5GA 5EPFA 4L8EA 3D0ZA 3PINA 3KXOA 3RHBA 2H74A 1RQMA 2AAWA 3IXRA 3CTFA 3BCKA 4QL7A 2EIOA 3TJFA 3A2VA 3C73A 4X0XA 4IGJA 5CREA 4PQ1A 1MTCA 1YEXA 2TRCP 5KEJA 2I1UA 1WPIA 2ZCTA 4FH8A 3IA1A 2YZHA 5B6MA 4F2IA 1TKDB 4GXZA 5D9WA 3HYPA 3ZMKA 2AJQB 5ID2B 2M80A 1VF3A 3WGDA 5IOXA 1OC9B 4N0ZA 1SYRA 1O8WA 3E9JB 2BTOT 3BD2A 3UJ1A 4AJ8A 5H5SA 1J0FA 4TR1B 3TKPA 5F06A 5DAKB 1H75A 2CZ3A 3TRQA 4G19A 2OADA 3KD0A 4I5QA 4WBJA 3UAPA 1WE0A 4YQUA 1GSEA 2CAQA 2OE0A 1TXXA 1WJKA 20GSA 1SD9A 1HQOA 4MZCA 2YZUA 2JU5A 3TGZA 5F8BA 2X8CA 4O7HA 4ZXGA 3TJGA 2YN1A 1PKZA 2IL3A 4GCIA 5J3RA 3LWAA 2IYJA 5FT3A 4IELA 2H1DA 2FWFA 3ZFBA 4JR6A 2GQKA 2OE3A 3GHAA 1AXDA 4G10A 3M9KA 2IFQB 5IO0A 1EP8A 2B3SA 5B8BA 1GNEA 5FHIA 1GRXA 4K0GA 1K0CA 4Q5NA 4K6XA 3GKXA 4KB3A 2WB9A 4XTSA 4IS0A 2RUEA 5CP1A 1SENA 4ECIA 1PQNA 2K9FA 4BVXA 5IMAA 4CHSA 1OKDA 4BL7A 5G30A 1EGOA 2FA4A 3TRXA 2HSHA 2X8HA 1ILOA 2VLVA 1K0BA 5DCGA 2YJ7A 2XPDA 1LJRA 4POKA 3N5OA 4GWRA 3DIEA 2WFCA 4KSOA 1F3AA 2OA7A 1SKRB 5E4WA 2HZEA 1GULA 1EWXA 4GF0A 5F05A 4KW6A 1G6WA 3I9V2 4TXOA 2VCTA 4CDOA 4I2TA 4NV2A 3UBLA 2DJKA 3L9VA 2KUCA 1OC3A 4P3YB 2C0FA 2YNXA 3UEMA 3TJKA 4V2MA 3DMLA 2K6VA 2PN8A 1RK4A 3VK9A 4O32A 4F9ZA 4FYBA 4HOJA 3L78A 4XRDA 4BVYA 3UVTA 5ECIB 2DSAA 5D73A 2F8FA 3FR6A 1V9WA 2WGRA 3FZ4A 4HS1A 1OE7A 2MMOA 3LQ7A 3FRCA 1MD4A 5JWRB 3HVVA 4AF2A 2RIIA 4WKWA 1T1VA 1I9DA 3KP9A 4HZ2A 3VFIA 1QFNA 3ED3A 1K0OA 1UN2A 19GSA 1GUKA 3V1WA 1A8YA 1XWBA 1ZMAA 5IMCA 3Q18A 4KCEA 3BJ5A 1KBNA 2KOKA 3FHKA 5A4WA 4O5RA 4KUNA 5H5QA 4Q5FA 4JEDA 4HZ4A 2XHFA 3A3TA 1XWCA 1B4PA 4MK3A 2VM1A 2O7KA 3SWLA 1F6MC 2LSTA 4DSSA 2PUKC 3IC4A 4LLRA 4TR3A 1B48A 1JZDA 2H6YA 3EU3A 5E59A 1J08A 2LNTA 3WT2A 2MMAA 3H4KA 3GL3A 5IIZA 2F9SA 3AY8A 3GNJA 3F0IA 5CRDA 4XS1A 2K18A 4DEJA 2LQQA 1AAZA 4J2FA 5D8IA 1ON4A 1BYEA 1E2YA 5IM9A 2DJJA 1SU9A 2WJUA 3CRTA 3QMXA 3TKRA 4F03A 3DGQA 3P90A 3TDGA 1F3BA 1YDKA 2B1LA 2LTKA 4IW9A 4K0NA 5DQYA 1KTEA 5D96A 2HZFA 3Q6OA 1FB6A 1HYUA 2R4VA 1XWGA 4V2NA 2VCXA 2BJXA 2XPEA 3WT1A 2OE1A 4I6XA 5IOWA 2YWOA 1KNGA 1GLPA 3QR6A 1JFUA 2R3XA 5GZZB 4TXVA 2H1AA 3KIJA 2HLSA 3VPQA 3GX0A 5C00A 1O81A 3FZ9A 2C1YA 2H66A 4O92A 4Q5QA 1AC1A 2FY6A 3GURA 1VGLA 5F0GA 3IK7A 1FVJA 1TRUA 3UOMA 3EYTA 3JCML 1SL0B 3KM6A 1R26A 4HJ2A 1Z7RA 1X5EA 1WRYA 1K0MA 1LBKA 2H1GA 1GTAA 3A5WA 2E0QA 3EWLA 7GSSA 3ME8A 5GSSA 2HXKA 3MWHA 3C8EA 2H6XA 2DMLA 3HD5A 4MPGA 2XBIA 5J4UA 3QAVA 3DVXA 3MDKA 5CO3A 3R2QA 5L71A 2L59A 4MABA 2H72A 3CYNA 3ZYWA 2YWMA 2HI7A 4V1Ap 1XIYA 2HFDA 4ZB6A 2VLUA 2IMKA 1S3CA 4TR0A 3KTLA 1X9MB 1QGVA 2HE3A 1QK8A 5HR3A 4PX1A 2D2ZA 1VRSD 1UVZA 3M0FA 2PWJA 2H6ZA 1YF0A 1V2AA 1ZCPA 2L6CA 4EDYA 2B1KA 1XWKA 5HR1A 4TOPA 1PN9A 4ZBBA 5HR2A 1PKWA 4IKHA 2GLRA 5HFKA 4K9ZA 1X5CA 1I5GA 2CV4A 4ZL7A 3O6TA 2J9HA 4GLTA 3KP8A 4HU9A 1KEBA 3L0HA 3GMFA 3L9UA 1ST9A 2XBQA 2DLXA 2OACA 4IJ3A 1XWAA 4EXJA 2MMZA 5HQPA 2XC2A 3IBHA 3F4RA 4IVFA 2GSSA 4RQRA 5HFGA 3ZVJA 1TU8A 3GA4A 1YKAA 2H75A 2V1MA 2L5LA 2CVDA 2YPMA 4DSQA 4XIHA 3QDNA 2CQ9A 4GRFA 5KN1A 4X43A 2IMEA 1AQWA 1WIKA 2QC7A 3ZVJD 3GKKA 1M7TA 2L5OA 1X9SB 2H0HA 3D21A 1QXHA 3HXSA 3J7Yb 1A23A 2OJLA 1Z7PA 1HNBA 1C72A 2IIYA 4MA9A 3WD6A 1VF2A 4OFNA 2H70A 1A2LA 2YANA 1R7HA 3UVHA 3RBTA 5D9VA 2QKEA 4WR4A 1U87A 3IPZA 3KH7A 2OKAA 3H93A 1CQGA 1HNAA 4YH2A 1BAYA 4GSNA 1Z9HA 4ILFA 3FKFA 2TIRA 5A4UA 2C3NA 1GTUA 3VLNA 5AIVA 2K8VA 3EMPA 1NHYA 2AB6A 5F07A 5LNKe 4TXOB 2IWTA 2RLIA 3TJJA 3GV1A 1PSQA 3U6VA 4Z7XA 3E3EA 3KTBA 4EDZA 2L6DA 2A2SA 3UL3A 1QMVA 5IMVA 5ABRA 2MZCA 3KZQA 4J57E 1EEJA 3VWUA 3ZFLA 2FNOA 5J9BA 4FYUA 1K3LA 3GTUA 4MP4A 4E8HA 3S9FA 3D6IA 2GZYA 1AW9A 2MYGA 2V6OA 1TRWA 3TUEA 3LYKA 9GSSA 2LEGA 4JU5A 3ZMLA 3F3QA 3VWXA 1ZL9A 3OR5A 5IMFA 1XZOA 1SKWB 2J23A 1V57A 4K8MA 2GQLA 5ELGA 3ZRDA 1YZXA 4CW9A 1GSFA 2JADA 3QCPA 4LL4B 4AJ6A 1PRXA 4L5LA 4ML6A 4OMVA 1ML6A 1THOA 1WWJA 1WOUA 1UA5A 4OFTA 1SL1B 1XVWA 1THXA 3F8UA 4FYCA 4TRXA 2PVQA 4HU7A 2WS2A 2DJ3A 2H73A 1B4QA 4WEYA 11GSA 3QD9A 5ECHB 1MDJA 2CX4A 2GSRA 3F63A 4QL9A 2O85A 4HDEA 4K7OA 3GSSA 4KAEA 4FO5A 3F4SA 2A4VA 2DJ1A 3NOFA 4MZWA 1K0NA 3F9UA 4OCEA 1YJ6A 3GFKA 4BA7A 3W6GA 1NHOA 3L4NA 3WYWA 3ZIJA 4EF0A 1ZGNA 2WULA 2ZUPA 2VLTA 5ECOB 3TB2A 2B6MA 5CYYA 3MAKA 2PGTA 1GLQA 2IN3A 3F4TA 3U5RE 1JZOA 2B5EA 5ECLB 3D5JA 3QPMA 1TOFA 4G2EA 2HYXA 4RUVA 3RPNA 4TR1A 2H01A 5IPGA 2NBSA 4MF5A 2GVPA 4IQAA 1TK8B 1TI1A 2MBSA 3ISOA 1YF1A 14GSA 4E8EA 1QQ2A 4Q5RA 4BWSA 5GAPD 3P2AA 3ZL5A 2PMTA 3Q74A 2K8SA 5EY6A 1O7UA 2YV9A 4NWYA 1M0UA 2LRNA 4F0BA 2P31A 5EVOA 5AGYA 2VCWA 5CRHA 4LMWA 3NIVA 3EVIA 1XOBA 1NSWA 2H19A 1SJIA 3GH6A 1V40A 3RDWA 2R6KA 3CBUA 5DAKA 2EIQA 3HJMA 3WGXA 1M2DA 3O76A 5IQYA 1ACVA 3M9JA 1WMJA 1QUWA 3BCIA 2G2QA 4MH2A 1A2MA 1SL2B 1PL1A 2GSQA 5G2ZA 6GSWA 3ZIVA 3MSZA 1BX9A 1EP7A 3VWWA 1R5AA 1X9WB 2EC4A 2IMDA 4MH3A 3CTGA 1F37A 1M9AA 3UIWA 3EE2A 3O3TA 5JCUA 3HDCA 5A5KA 1TRSA 1OE8A 1GSYA 1K0DA 2DJ2A 3CXGA 2IMFA 5LCZA 2GZPA 4FIWA 3IR4A 2WDUA 3IRAA 2QSIA 5DVBA 4F82A 1GTIA 2YV7A 1GTBA 4HEA2 2LJKA 3KGKA 1TRVA 2VL2C 1U3IA 5DQSA 3DRNA 2NPBA 3A2XA 1PX6A 2R37A 4PUFC 1A8LA 3PGTA 4WF4A 3TCOA 1URMA 2H71A 2O89A 2V32A 4WBRD 2Z9SA 4I97A 1T3BA 4HQZA 1EOGA 4XS4B 2RUFA 2LS5A 4MMMA 4ISDA 2NVLA 1MDIA 1PX7A 4QQ7A 3LEFA 4NPBA 1BG5A 4ZIJA 1R4WA 2LRTA 3C71A 4GTUA 1X0RA 1A0FA 4V1Ag 1T00A 3DYRA 2NDOA 5C04A 2VL2A 5DALA 1GNWA 2KP2A 2C8UA 2MMNA 5AN1A 3DKSA 4L5OA 3BBYA 6GSSA 2LJRA 3DXBA 2L4CA 2F8AA 3LJRA 4POLA 3HHVA 2P5QA 3VWVA 5JWQB 4PNFA 2CVBA 5HFIA 1JZWA 2VM2A 2H0GA 2M46A 4JR4A 4L0WA 1EV9A 2IMIA 1CQHA 2N5FA 2WCIA 2N5AA 4YQMA 4GSTA 4X1UA 1M9BA 5IMDA 2DMMA 1XVQA 3HZ4A 4OCFA 1ERTA 2YOIA 5CAXA 1XXUA 1TK5B 1SKSB 1G7EA 2GQMA 1YKCA 1SJZA 1XW6A 17GSA 4NHZA 1TJDA 1R5PA 5INYA 2X8GA 3Q19A 3CRUA 3C1SA 4ML1A 5ECSA 1EOHA 3ERGA 2VCZA 5D9XA 3KJYA 3M8NA 4F0CA 2P0GA 3FW2A 4BPYA 1JLVA 1O6JA 4HUAA 2V2GA 1XW9A 2VD0A 5LD0A 4PURA 4TN8A 4EL1A 4JBBA 1K0AA 2C0DA 2WZ9A 5B8AA 6GSVA 1Y25A 2H8LA 4D73A 1V58A 3L9SA 18GSA 2YWNA 4AGSA 3G9BA 5B6NA 3APOA 4KA0A 5ECPB 2H1BA 6GSYA 4EE0A 4OO4A 5ELAA 1DSBA 2IFQA 2C0EA 2GT6A 2GT5A 5JCGA 4N30A 2I81A 3ME7A 2A2RA 2FLSA 1XW5A 1U88A 1XBSA 3UBKA 1OC8A 1T8EB 1GL8A 3LFLA 4K7NA 1AUCA 2CVKA 5CRGA 2DJ0A 4IN0A 1EZKA 4TKYA 3FEUA 1T4YA 4NXIA 2NTOA 4TVEA 4MDCA 4KNDA 3C7MA 2C0GA 3IOSA 22GSA 3MNGA 4ACSA 1O73A 2DBCA 2E2MA 1EGRA 1U3AA 4WETA 1EEMA 1SJ6A 3ERWA 5G5FA 1FO5A 1FG4A 5J9CA 2YWIA 2PERA 3TKSC 1SK0A 2HRNA 2TRXA 5JCWA 4ECBA 2LKUA 3FR9A 4G9HA 8GSSA 1DE1A 2VOCA 2JZSA 3KH9A 2KHPA 2KP1A 4TR4A 5IPHA 4MJAA 2VL3A 3KMOA 3CMIA 2HT9A 3QAGA 1WP0A 1N2AA 1M2AA 6GSXA 3IDVA 1ZOFA 4K1FA 1OC9A 1NW2A 3IAS2 1V98A 1ERVA 5B7CA 4IJIA 3FR3A 1HD2A 3EU4A 4I2UA 2L4QA 1FW1A 4RI7A 1TP9A 5J41A 4ZL9A 2KLXA 2F51A 2FD3A 3BOAA 4D73B 3E0UA 4PGTA 1ZYEA 1AIUA 3CSJA 2JL4A 1NM3A 1J9BA 2C80A 4J56E 2LV3A 1TU7A 1YQ1A 3M1GA 2VAFA 3GL5A 1B9XC 5CRWA 4V2LA 5DJMA 4EC0A 1HNCA 1GSUA 3IK9A 5HR0A 4HJMA 1X5DA 2H30A 4MPFA 5G5EA 3W8SA 1TI3A 2LJAA 1Z3EA 4ZB8A 2M72A 1YY7A 3KEBA 3PR8A 2DIYA 1DBYA 3ZZXA 1G0TA 1TK0B 1Z6MA 3GYKA 4ID0A 2E7PA 1PA3A 3RPPA 3QAWA 1BQ7A 2G0FA 1IYIA 3LXZA 4XHMA 13GSA 1MDKA 2V6KA 4EVMA 1ZZYA 2O8VB 5G31A 3IHQA 2IJYA 2AUVA 4H86A 4WF5A 3LSZA 3HA9A 2VL9A 2O87A 2VUPA 2YJHA 5A4VA 2BMXA 2FWGA 3FZAA 5G1KA 2LQOA 3GN3A 4OO5A 2B7JA 2B7KA 2GDRA 3SBCA 3M3MA 3N9JA
chains in the Genus database with same CATH superfamily
5KP4A 4LMVA 4MJEA 4ZILA 4MMXB 10GSA 3KE7A 1XPVA 3QRDA 1F9MA 1TIJA 3EC3A 5ID2A 2C3TA 2CZ2A 4KGIA 5DALB 1O8XA 2CT6A 4ECJA 1FOHA 3G6E3 1IYYA 2OOVA 3HCZA 1G96A 3VI5A 1S3DA 2GBWB 3HZ8A 2Y73A 2ZDJA 4LL1B 4EIQA 3M8CA 1BJXA 5DDLA 2VO4A 2QA43 3LGCA 1Q42A 5IO2A 4JRRA 3RAZA 1OVNA 4MMZB 1ERUA 1EKMA 5DJLA 5FWGA 1S3AA 4XDVA 4OD7A 5D93A 3US3A 2FWHA 2B5YA 2GU1A 4TW5A 3PGBA 5FW5A 5COHA 4ULXA 1RKYA 3N9JA 4MEIA 1B9YC 1B8XA 3HVXA 3GRXA 4KDYA 4O5QA 4KT3B 4NV5A 1BNFA 3KMNA 3OW22 4DKIA 3DEXA 3IE3A 3IPTA 1T4ZA 2OBIA 3H8QA 1SIHA 2DKIA 4JE1A 1MEKA 2YP6A 1U6TA 4PEJA 1Q824 4Z2TA 1W4VA 2ZNMA 3GKMA 4DSSB 1X1XA 2QEX3 4HI7A 5ECNB 5BMUA 3GTUB 1T7PB 2VD1A 1IV7A 1BEDA 2PVOC 1FGRA 2ES7A 3P7XA 1GOUA 1ZYQB 3EX9A 1Z6NA 4WR5A 3RHCA 2OQEC 1W7CA 1OHPA 3EHCA 4RNYA 1Q40A 4L8OA 2HZEB 4N10A 4EKZA 1OYJA 2ZL8A 1UW1A 3GWRA 1MOLA 1JZRA 3GZRA 3GSTA 4K2DA 1WMPA 4HM2B 5D9TA 2GEYA 3H1NA 4IT7A 4YAVA 3LT9A 1AQZA 1O7GB 4R1KA 3D4AA 4HSCX 2RM6A 1YEPA 3G8ZA 2PU9C 1SYXA 1GMPA 4CDLA 2CFDA 4BWQA 1VQM3 2XH9A 2RBIA 3LYPA 3SOYA 2FCHA 1IYHA 2XSOB 2RSXA 2XFTA 1S5AA 3K5TA 2F99A 4FR9A 1GUMA 1UCKA 3EJVA 2B24B 5G1LA 4PQIA 1E97A 1W89A 1I70A 5HGRA 1OAZA 4MJBA 5ELUA 5CXOA 5D81A 1ERWA 2C4JA 3GZBA 4GQCA 4RBNA 4MZBA 3URPA 2AADA 3GKNA 5IW9A 3HVSA 2I3YA 3KCMA 1BRIA 2E2GA 2OBKA 4KH7A 2VCQA 2KF5A 2CFWA 1VQ83 2CWUA 5BRTA 2C3QA 4PUAA 3I6AA 1ROVA 1H4OA 3HY2A 3EMXA 2BU4A 1SJWA 2FWEA 3I69A 2I9HA 3UARA 5DBQA 4HZBB 1LOYA 3A2WA 1GSSA 2D1WA 3LORA 1Z5YE 5ECMB 2IPAA 2GZZA 5CF1A 3DWVA 4ZL8A 3NZNA 3CMA3 2PPTA 8RNTA 4AJ7A 16GSA 1RCLA 3K8NA 3P8WA 1GSDA 1M9GA 2QGVA 2IY2A 3MIXA 3GH9A 3X42A 5RNTA 1LU4A 3VI7A 2P09A 1SK2A 3EQQB 2FGXA 3GX8A 1OGZA 2ON5A 1ZGXA 4BIRA 2YCDA 3D4TA 1CH0A 4FCMA 5IMZA 2R2JA 3ZREA 3PPUA 1KWIA 1FGMA 2C11A 3LTBA 3DD3A 3NV0B 3K9MC 4GQFA 1FVKA 1GMQA 5IEPA 2W9QA 2MBTA 1D6ZA 1VQK3 4FCJA 4ZBAA 3BIRA 4EV2A 5AIIA 5ECKB 3FZ5A 1UCLA 3CSIA 3TKQA 1PGTA 1XFLA 1Y6EA 3F3RA 1AQVA 2XSHB 3UJMA 2K0MA 1VF1A 5JPPA 3EBYA 2FA8A 3KSED 1JHBA 3F6DA 2VCVA 2W04A 5AIFA 1DMMA 2J8XB 3CCS3 4YAPA 3LH4A 1USBA 3WA2X 2FUG2 3NQYA 2PNCA 4OK0A 1AVKA 1TDIA 1JLWA 3U1WA 5KP1A 3J7Yd 5GSTA 3H79A 6GSUA 1A2JA 2CAIA 3RGAA 3D22A 3S28A 1W6GA 3VURA 4IP1A 1PD21 4YQVA 1TW9A 5JWOB 2WRTA 1C7HA 5IEOA 4NAXA 4HM0B 3TKSE 3PH9A 5H5RA 4HM5B 2GSPA 4RI6A 3QFAC 1RGFA 2F4YA 4JZQA 3T8NA 1B3SA 4RQXA 1SD8A 1VF4A 4POMA 2H0IA 4X2HA 3A76A 1ULJB 1G02A 1YJ93 1MD3A 3DZLA 1K3YA 2N5BA 1UDII 5DCHA 4O5UA 3F6FA 2VIMA 2IMJA 4XS6A 5CNWA 2CX0A 3FSDA 1PY3A 2CA8A 4ZB9A 4KDUA 2PBJA 4WYKA 2F3MA 5STDA 4LYLB 1GOYA 3K63A 4EO3A 3MPHA 4RNZA 1GY5A 1PMTA 4DVCA 3ZITA 4MJCA 1STFI 3FG4A 1E6BA 2GSTA 4KX4A 6GSTA 4PNGA 1YVBI 1DMNA 1EV4A 3CSHA 4R9KA 1ASKA 4L0UA 1G7OA 3V92A 2AV4A 1PU4A 2LNSA 4MF7A 1GD4A 3UB1A 1GSQA 2EIRA 4HQSA 3J7Yk 3WGEA 2RM5A 4K7IA 2X99A 1TFKA 3FYGA 3CU3A 3TKSA 4KCAA 1BAOA 1A67A 4GSSA 1LOXA 2JZRA 3HKRA 4WXTA 4OWYA 1A0RP 1DUGA 2OTL3 1FAAA 5AIXA 2RFRA 1F2EA 3GIXA 1N8R4 1M99A 4IBPA 2OCTA 4KSMA 2JSZA 1RNBA 3EB8A 4PQHA 1O7MB 5J5NA 2GTUA 3HVNA 4KE3A 2L57A 4USSA 4BTWA 2V41A 2AHEA 5AIGA 3F7SA 3QOUA 2AYTA 3ERFA 5IG5A 3CD63 3UMAA 3APSA 1M2BA 4DSRA 3PXMA 1O85A 5ECQB 1Q9EA 3IV4A 4MJDA 5KN2A 4EIPA 3AHSA 1VQL3 3G7IA 7RNTA 2X64A 3LXTA 2DIZA 4N0VA 4N11A 2UX0A 2F86B 4IP6A 3W8JA 4RNTA 4XRAA 1OKTA 3NUVA 2BMOB 12GSA 1G6YA 4K5SA 2HSMA 2ALBA 4OFMA 1RGGA 2OTJ3 5HOHA 4MF6A 2REMA 2P5RA 3FY7A 3KIIA 1VQO3 2GS3A 3TOUA 1D6YA 2H76A 2LUSA 3HJOA 1O7WB 2GGTA 3JVCA 1GP1A 3D4MA 1A24A 3DM8A 1VQN3 3KSPA 5CF2A 2F5WA 1WNHA 3DVWA 1JNQA 1N9JA 3APQA 4LA1A 1FGQA 3TRPA 1PL2A 1LXEA 3ZLPA 1CQSA 1FB0A 4EC6A 2JZTA 1K3OA 1GMRA 4HYZA 5AEUB 2ON7A 1TP6A 2HNLA 3C1RA 4PXOA 1NB3I 1Q4JA 1SK1A 1K41A 1JBTA 5KN0A 1IT7A 3GUSA 2BO9B 1J2BA 2JSYA 4XS4A 5ENUA 3NQZA 2FHEA 4L7KA 3QK9A 4MCUA 2I4AA 3EURA 1XCCA 3LTDA 2B5XA 1ABAA 5AISA 1XOAA 1FOVA 2UZ8A 3QFBC 3CCM3 5D83A 1FHEA 1W01A 5ECRB 1TTZA 4LEHA 4AKZA 2DC5A 2BMQB 4HM6B 3G7YA 3HJPA 2HSYA 1LQMB 2KF4A 2P05A 1BRGA 3IAM2 1AQXA 3FF2A 3LG6A 1QMAA 2W0QA 4KDXA 4NHWA 4NMUA 3CQFA 4IHUA 2OQEA 5GAND 1IVXA 4POBA 4ZBDA 4XCSA 1SIIA 1GWCA 1GUHA 1X1WA 3TJBA 1DE2A 2CX3A 3G7JA 1N8JA 3EINA 4ECCA 1AR0A 5ELJA 1Q98A 2JACA 3L0RA 4EYCA 1UC7A 2HRFA 3PCSA 4EUYA 3TOTA 3I43A 1Q40B 3D5GA 1K9M4 1GH2A 1YVSA 3MKIA 5KN3A 1PFOA 5EL8A 4IQ1A 4I8BA 4AEQA 2JQ5A 1RW1A 4MLYA 3FK8A 2E2TA 5TGNA 1STDA 3ZTLA 2JDIH 2LRCA 3VPTA 2R5GA 5EPFA 4G0LA 2RNTA 4J5KA 4L8EA 3D0ZA 1A2VA 2X4AA 1RRLA 3PINA 3KXOA 4L8PA 3RHBA 4KVHA 2H74A 3SVAA 1NB5I 4LGQA 4BU4A 3GSPA 1RQMA 2AAWA 3IXRA 3CTFA 1Q814 3BCKA 1NWWA 1C54A 4QL7A 2EIOA 2IUKA 3TJFA 1ROAA 3DGLA 3A2VA 3C73A 1XG8A 4G1MB 4X0XA 4IGJA 5CREA 4PQ1A 1BIRA 3OWSA 1MTCA 1YEXA 1PFPA 2TRCP 4CY6A 5KEJA 3ER7A 2BT3A 2I1UA 1WPIA 2ZCTA 4FH8A 3IA1A 4GHOA 2YZHA 5B6MA 4F2IA 3JUMA 1TKDB 4GXZA 5D9WA 3EPTA 3HYPA 3ZMKA 2AJQB 2O3OA 5ID2B 2M80A 1GSPA 1VF3A 3WGDA 5IOXA 1OC9B 4N0ZA 1W2B2 1LVNA 1VQ63 1SYRA 2HRKA 1WQLB 1O8WA 4MMYB 1MWTA 2BTOT 3BD2A 3E9JB 4KFEA 3UJ1A 4AJ8A 5H5SA 1J0FA 4TR1B 3TKPA 3Q90A 5F06A 5DAKB 1H75A 8CHOA 4XB5A 2CZ3A 3TRQA 4G19A 1SPUA 2OADA 2O9UX 3KD0A 1V74A 2W6JH 4I5QA 5CK6A 4BL7B 4WBJA 3UAPA 1WE0A 4YQUA 4NHFA 1BRNL 1GSEA 2L4VA 3DGNA 2CAQA 4K1VA 2OE0A 1TXXA 1CEWI 1WJKA 2K54A 20GSA 1SD9A 1UCIA 1HQOA 4MZCA 3RGRA 2YZUA 2CFLA 3G4S3 2JU5A 4YKFA 5F8BA 2X8CA 4O7HA 3TGZA 4GSPA 2INXA 1YNVX 4ZXGA 1K8A4 1OACA 2QIYA 3TJGA 1UUVB 2YN1A 1YIT3 1PKZA 1VQP3 2IL3A 3CME3 4GCIA 1RNTA 5J3RA 3LWAA 2IYJA 2CIUA 3CNXA 5AYRB 2IA7A 5FT3A 1JV2B 1IDPA 3HOHA 1U8CB 4IELA 2H1DA 2FWFA 1E3RA 3ZFBA 4JR6A 2GQKA 2OE3A 3GHAA 1AXDA 3GZXB 4G10A 3BB9A 3M9KA 2IFQB 2KCDA 5IO0A 1EP8A 4N6LA 2B3SA 3H3HA 3FCSB 5B8BA 1GNEA 5FHIA 1GRXA 4K0GA 5KOXA 1MWSA 1K0CA 1UCJA 1FYSA 1YGEA 1WMOA 2OWPA 5EEOA 4K6XA 4Q5NA 3GKXA 1BANA 4KB3A 2WB9A 4XTSA 4IS0A 3RDEA 2RUEA 5CP1A 4FQUA 1SENA 4ECIA 1PQNA 4O2HA 1WMNA 1JB5A 1Q864 2K9FA 4BVXA 5IMAA 4U13A 4CHSA 1OKDA 4BL7A 2OOVC 5G30A 1W00A 1EGOA 1TFOA 2KXGA 2FA4A 3TRXA 2HSHA 1LOVA 3BNCA 1Q7HA 2P0MA 2X8HA 1ILOA 2VLVA 1K0BA 3N8BA 5DCGA 3F9SA 2YJ7A 2RGQA 2LYXA 2XPDA 3B4PA 1LJRA 4POKA 3N5OA 4GWRA 3F8XA 3DIEA 2WFCA 2MF7A 4KSOA 1FW7A 3FGYA 3HZPA 1F3AA 2OA7A 3B4OA 1SKRB 1BVIA 5E4WA 2HZEA 1GULA 4OUQA 2CW9A 3NV0A 1EWXA 4GF0A 1RLSA 2UGIA 2WOHA 5F05A 4KW6A 1G6WA 3IC8A 3I9V2 2ML6A 1AY7A 1GY7A 3DY5A 3LMLA 4XBXA 1BRJA 1VQ93 4TXOA 2VCTA 2R41A 4CDOA 4I2TA 4NV2A 3UBLA 2DJKA 2X49A 3L9VA 2KUCA 5M1AA 1OC3A 4BL2A 4P3YB 2C0FA 4BVYB 2GEXA 2YNXA 3BU4A 4Z2RA 3IJEB 3UEMA 3TJKA 4V2MA 1OF5B 3DMLA 2K6VA 2PN8A 1RK4A 1FUTA 3VK9A 4O32A 4F9ZA 1KD14 3CPOA 4FYBA 3BLZA 1MGWA 4HOJA 3L78A 4XRDA 3NBRA 3NXJA 4GB5A 4BVYA 3UVTA 3HIGA 2P0XA 5IERA 5ECIB 2DSAA 2R0PA 5D73A 2F8FA 3FR6A 1V9WA 1OPYA 2WGRA 4WP5A 3FZ4A 4HS1A 1QVG2 4EV5A 1OE7A 3VF1A 1W5ZA 4LMIA 2MMOA 1YI23 3LQ7A 3FRCA 2Z76A 1MD4A 4WFOA 3HVVA 1JRQA 5JWRB 4AF2A 1BRSA 2RIIA 4WKWA 1BSAA 5AI1A 1T1VA 1I9DA 3KP9A 3WOFB 4HZ2A 1DVCA 1QFNA 3VFIA 3KCHA 3ED3A 1K0OA 1DVDA 3IHGA 4KFDA 1UN2A 1MWUA 19GSA 1GUKA 3NHXA 3V1WA 1TU5A 1A8YA 2CHCA 3WMDA 1XWBA 1ZMAA 5IMCA 3Q18A 4HVNA 4KCEA 1M1XB 3BJ5A 1KBNA 2KOKA 3FHKA 1AVLA 5A4WA 2WGOA 3A5EA 4O5RA 2QA2A 3NX0A 4KUNA 5H5QA 5EVHA 4JEDA 4Q5FA 1RN7A 4N6OB 4HZ4A 1QAKA 2XHFA 3A3TA 3AGOA 1XWCA 1FGTA 1B4PA 4MK3A 1MWRA 2VM1A 2O7KA 3SWLA 1F6MC 1T2IA 2W9PA 1HKXA 2LSTA 5AIHA 4DSSA 2PUKC 3SOAA 1YJW3 3IC4A 2BHMA 1RHLA 2W2CA 4LLRA 4TR3A 3I0YA 4OVMA 2D42A 1B48A 1ZX2A 1JZDA 1B2UA 3V99A 2R0GA 1TUHA 2H6YA 3EU3A 1IU7A 5E59A 1J08A 2LNTA 2HMKB 3WT2A 2MMAA 3H4KA 3GL3A 5IIZA 1OF5A 2CC3A 4HM7B 2F9SA 1IQYA 3AY8A 3GNJA 3F0IA 5CRDA 4XS1A 1NO3A 2K18A 3DGYA 4DEJA 3JUQA 2ZHXB 2M7OA 2L1SA 2LQQA 3HIIA 1AAZA 1LNIA 1X1UA 1X1YA 3JUNA 4J2FA 5D8IA 2FGTA 1ON4A 3ZG0A 1BYEA 1JN5B 3DUKA 1E2YA 1IVUA 1RGCA 5IM9A 2DJJA 1SU9A 1UGHI 2WJUA 3CRTA 3QMXA 1N5PA 3Q1CA 3DXOA 3TKRA 4F03A 3FH1A 3DGQA 3P90A 3TDGA 1OGXA 1F3BA 1YDKA 2B1LA 2LTKA 4IW9A 1W2ZA 4K0NA 5DQYA 1KTEA 4JRFA 2BMRB 5D96A 2HZFA 3Q6OA 3MHEA 1BNSA 1FB6A 1OHOA 1BRKA 1HYUA 2R4VA 3D79A 1XWGA 4V2NA 3SYUA 3N54B 2VCXA 3CC73 2BJXA 2XPEA 3WT1A 2OE1A 4I6XA 5IOWA 2YWOA 1KNGA 2C4BA 4BVXB 1GLPA 3QR6A 3KKGA 2ML5A 1JFUA 2R3XA 1LQGC 2KF6A 5GZZB 4TXVA 2H1AA 3KIJA 1JKGA 5FGOA 3T8UA 2CWTA 2HLSA 1WTHA 3VPQA 3GX0A 5C00A 1O81A 5KP3A 3FZ9A 1O7PB 2C1YA 2H66A 4O92A 4Q5QA 1I0XA 1AC1A 2FY6A 3GURA 4BTXA 1VGLA 5F0GA 3IK7A 5M18A 1FVJA 1TRUA 4LSOA 3UOMA 1RGKA 3G0KA 1BGSA 1QAFA 3EYTA 3JCML 1SL0B 3KM6A 1R26A 4HJ2A 1Z7RA 1X5EA 1WRYA 1YGWA 3SXXA 1K0MA 1LBKA 4EBGA 2H1GA 4K61A 1GTAA 2YFIB 4K1UA 3A5WA 5G2GA 2E0QA 2CFGA 3GZYB 1DE3A 1JKGB 5GSPA 3EWLA 7GSSA 3FLJA 3X3ZA 3ME8A 5GSSA 3OWUA 2HXKA 3MWHA 3C8EA 1BSEA 1R4YA 2H6XA 2DMLA 3HD5A 5I97A 1GY6A 2KRTA 3FZWA 4N6MA 4MPGA 2XBIA 5J4UA 3QAVA 1PN0A 3DVXA 3MDKA 1TTOA 3WOEB 5CO3A 3D9RA 3OWYA 3R2QA 5L71A 2L59A 1RTUA 5LC6A 1ULIB 4MABA 6STDA 2H72A 2E2VA 3CYNA 1BSBA 3ZYWA 2YWMA 1M3JA 2HI7A 3CCL3 4V1Ap 3H51A 1XIYA 2HFDA 4ZB6A 2VLUA 3F14A 1RGAA 2IMKA 1S3CA 4TR0A 3KTLA 1IT8A 1X9MB 1QGVA 2GBXB 2HE3A 3CC43 1QK8A 5HR3A 4PX1A 2D2ZA 1VRSD 1B20A 3AHWA 1UVZA 3M0FA 1BU4A 2H6ZA 1YF0A 2PWJA 1V2AA 1ZCPA 3CCU3 2L6CA 2WGQA 3N9HA 2PZVA 4EDYA 2B1KA 1ISKA 5DRVA 3D3LA 4N6TA 1XWKA 5HR1A 4TOPA 1US1A 3S67A 1PN9A 4ZBBA 5HR2A 1PKWA 4IKHA 2GLRA 2GU3A 1LOWA 5HFKA 1RGEA 2XR8B 4K9ZA 3UNLA 1X5CA 1I5GA 2XFSA 2CV4A 4ZL7A 3O6TA 2J9HA 4GLTA 3KP8A 4HU9A 1KEBA 3L0HA 3GMFA 1VQ43 1S3RA 3L9UA 1ST9A 4BTYA 1Y4KA 2XBQA 2DLXA 2OACA 4IJ3A 1XWAA 4EXJA 2MMZA 5HQPA 2XC2A 4IPBA 3IBHA 3F4RA 1N5HA 4IVFA 4HKVB 3AGNA 5D82A 2GSSA 4RQRA 4N6NB 2W03A 5HFGA 4ICYA 3ZVJA 1TU8A 4J9AA 3FMWA 3GA4A 1YKAA 2H75A 3FG3A 1BOXA 2CVDA 2L5LA 2V1MA 4STDA 2YPMA 3GRDA 4DSQA 4XIHA 1JB4A 2AAEA 3QDNA 2CQ9A 4GRFA 1BUQA 2C10A 5KN1A 4X43A 5M19A 2IMEA 3MWZA 1AQWA 1WIKA 2QC7A 3ZVJD 3GKKA 1M7TA 4K5RA 1RSNA 2L5OA 2YX9A 1X9SB 2H0HA 1DYUA 4X4JA 3D21A 2F56A 2Z77A 1QXHA 2FXTA 3HXSA 3J7Yb 1A23A 2OJLA 1Z7PA 1HNBA 1ZO2A 1C72A 3I563 2IIYA 3BNEA 4MA9A 3WD6A 1VF2A 4OFNA 2H70A 4TX4A 1A2LA 2YANA 1R7HA 3F8HA 3UVHA 1RMSA 3RBTA 5D9VA 3LYGA 5CLKA 2QKEA 5IF6A 3NM7A 3WA3A 1W6YA 1U87A 4WR4A 4H3UA 3IPZA 3KH7A 2OKAA 3H93A 1CQGA 1HNAA 4YH2A 1BAYA 3NM2A 4GSNA 2KAAA 1Z9HA 4ILFA 3FKFA 2TIRA 5A4UA 2C3NA 3D5IA 3K0ZA 3WR2A 1GTUA 1B2ZA 3VLNA 5AIVA 2K8VA 1TRPA 3EMPA 1NHYA 2AB6A 5F07A 2CFKA 5LNKe 3KFQC 4TXOB 2IWTA 2RLIA 3TJJA 3MYTA 3GV1A 1PSQA 3U6VA 2Q07A 1UGIA 4Z7XA 3E3EA 2CWVA 9RNTA 3KTBA 4EDZA 4K90B 4RZMA 2L6DA 2A2SA 3UL3A 1QMVA 3CNMA 5IMVA 3ZG5A 5ABRA 2MZCA 3KZQA 4J57E 1EEJA 1GS3A 3VWUA 5KOWA 3ZFLA 2P38A 2FNOA 3AMOA 5J9BA 4FYUA 1K3LA 3GTUA 4MP4A 4PTSA 1IK3A 1CYVA 4E8HA 3S9FA 3FKAA 3D6IA 2GZYA 1AW9A 2MYGA 2V6OA 1TRWA 1BNGA 4WWUC 3TUEA 3LYKA 9GSSA 2LEGA 3IMAB 2MC8A 4JU5A 1B2SA 3ZMLA 2A2PA 3F3QA 3VWXA 1FUSA 1ZL9A 1HZ1A 3OR5A 1XZOA 5IMFA 1BRHA 1SKWB 2J23A 2HOHA 3B7CA 1V57A 4K8MA 2GQLA 5ELGA 3ZRDA 1YZXA 4CY8A 3LT8A 4CW9A 1GSFA 2JADA 1E3VA 3QCPA 4LL4B 4AJ6A 1PRXA 3Q2PA 1OCVA 4L5LA 4ML6A 4OMVA 1ML6A 1DETA 1THOA 1WWJA 1WOUA 1UA5A 5IG3A 4OFTA 4J5GA 1SL1B 3A5IA 1XVWA 3I553 1THXA 1N8QA 5BXQA 2STDA 3F8UA 4FYCA 4TRXA 2PVQA 4HU7A 2WS2A 2DJ3A 3PS8A 2XGLA 2H73A 1B4QA 1IV9A 4WEYA 3FF0A 1Z1SA 11GSA 3QD9A 5ECHB 1MDJA 2CX4A 2GSRA 3F63A 1GYBA 4QL9A 2O85A 4HDEA 4K7OA 1FGOA 1EUIC 3GSSA 4KAEA 1IQ8A 3LTAA 3F4SA 2A4VA 4FO5A 4K2XA 2DJ1A 3NOFA 4MZWA 1K0NA 3F9UA 4OCEA 1YJ6A 3GFKA 4BA7A 1NHOA 3L4NA 3W6GA 4FMDA 3GAXA 3X3XA 3WYWA 3ZIJA 4EF0A 1A2KA 1ZGNA 2I9WA 2WULA 3SLUA 1M3IA 5BVBA 3RNTA 1ZYPA 2ZUPA 2IUJA 2VLTA 5ECOB 3TB2A 3LZAA 1B2MA 2B6MA 1FUWA 5CYYA 3MAKA 2PGTA 1RJOA 2HMJB 1GLQA 2IN3A 3X3YA 3F4TA 1RDSA 3U5RE 1JZOA 1RGHA 1KQS2 2B5EA 5ECLB 3D5JA 1D6UA 3X40A 3QPMA 1TOFA 4G2EA 4BIKA 6RNTA 4EXRA 2HYXA 4RUVA 2V1LA 4WYKB 3RPNA 4TR1A 2HMOB 2H01A 5IPGA 2NBSA 3V98A 4MF5A 3ROBA 2GVPA 4IQAA 3CCJ3 1TK8B 5BU4A 1TI1A 2MBSA 2R0CA 1SARA 2W56B 3ISOA 3WHOA 1YF1A 14GSA 4E8EA 1QQ2A 2Z6BA 1QJGA 4O3VA 4Q5RA 4BWSA 1OHSA 5GAPD 1OUNA 3P2AA 3ZL5A 2PMTA 2RCDA 1QVF2 2R4IA 2ZA4A 1BUJA 3Q74A 2CK3H 2K8SA 5EY6A 1O7UA 1R4CA 4GL6A 2YV9A 4HM3B 3SX1A 4NWYA 1M0UA 2LRNA 4F0BA 2P31A 5EVOA 5AGYA 3O8YA 4FMAA 2VCWA 5CRHA 1YHQ3 2CH9A 4G0IA 2B1XB 2WOFA 4LMWA 3NIVA 3EVIA 1XOBA 1DMQA 3MG1A 3EN8A 3MG3A 4HZ9B 1NSWA 2H19A 1UUWB 3DGMA 1SJIA 3GH6A 1V40A 4Z2UA 3RDWA 2R6KA 1W6CA 3CCV3 3CBUA 5DAKA 2EIQA 3HJMA 3WGXA 1M2DA 4LZIA 3O76A 1ACVA 1K734 5IQYA 3M9JA 1WMJA 1MNLA 1QUWA 3BCIA 2G2QA 4MH2A 2Z7AA 4HM4B 1A2MA 4IIAA 1SL2B 1PL1A 2GSQA 5G2ZA 6GSWA 3ZIVA 3MSZA 1BX9A 5IG0A 1EP7A 3VWWA 1PYLA 1R5AA 1X9WB 2EC4A 1VZZA 1UI8A 2IMDA 2A4HA 4MH3A 3CTGA 1F37A 1M9AA 3UIWA 3EE2A 3O3TA 5JCUA 3HDCA 5A5KA 1TRSA 1A90A 1OE8A 4HJLB 4XBYA 1GSYA 1JN5A 1K0DA 2DJ2A 3CXGA 2CX1A 2IMFA 5LCZA 2GZPA 4I4KA 4FIWA 3PYJA 3CXC2 3IR4A 1BNJA 2WDUA 1EQKA 3OX9A 3IRAA 5BIRA 2QSIA 5DVBA 1K28A 5LC7A 4F82A 4JF8A 4HAAA 1I8VA 3ECFA 1GTIA 2YV7A 1GTBA 1UUGB 4HEA2 2LJKA 3KGKA 1TRVA 2VL2C 4AKYA 3DH2A 1U3IA 5DQSA 3DRNA 1I2EA 2NPBA 3A2XA 1PX6A 2R37A 4PUFC 4HM1B 2UUGC 1A8LA 1RN1A 3PGTA 4WF4A 4XDWA 4ZM8A 3TCOA 3LTCA 1URMA 2CG0A 4KF9A 2H71A 2O89A 2V32A 4WBRD 2Z9SA 2BNGA 2YFLB 4I97A 1T3BA 4HQZA 1EOGA 4XS4B 2RUFA 2LS5A 4MMMA 4ISDA 2XGNA 1BNEA 3HK4A 3MSOA 2NVLA 1MDIA 1PX7A 4QQ7A 3LEFA 3CPW2 4NPBA 1BG5A 4ZIJA 1R4WA 2LRTA 3C71A 3MG2A 4GTUA 1X0RA 3UL6A 1A0FA 4V1Ag 1T00A 3DYRA 2NDOA 4HBRA 5C04A 2VL2A 1B27A 5DALA 1GNWA 3LW9A 2KP2A 3STDA 1HU9A 2C8UA 3S27A 2MMNA 5AN1A 3DKSA 4L5OA 4MNNA 1LRAA 3BBYA 6GSSA 2F98A 2LJRA 4R4KA 1O7HB 1T2HA 3DXBA 2L4CA 2F8AA 3LJRA 4POLA 3HHVA 2P5QA 1Q7Y4 3VWVA 1RN4A 2BIRA 3EF8A 5JWQB 4PNFA 4H61A 2KF3A 4BL3A 3WODG 2CVBA 2K3DA 5HFIA 1JZWA 3F7XA 2VM2A 2HMLB 2H0GA 4J8TA 2M46A 3AMOB 1EV9A 2N5FA 2IMIA 1CQHA 4JR4A 2WCIA 2N5AA 4L0WA 1RGLA 4GSTA 4YQMA 4X1UA 1I2GA 1M9BA 5IMDA 4YKGA 2QGUA 1I2FA 1U5OA 4FCZA 2DMMA 1XVQA 3HZ4A 4OCFA 2SBLA 1ERTA 3VGNA 2YOIA 2A15A 5CAXA 3KZTA 3FG1A 1XXUA 1TK5B 1SKSB 1G7EA 2XF3A 3CCQ3 4CPKA 1BSCA 5IG4A 2GQMA 5JBSA 2F5MA 1YKCA 2HMMB 1SJZA 1XW6A 17GSA 4NHZA 1EA2A 1TJDA 1R5PA 1A2PA 5INYA 1I0VA 1KC84 2X8GA 3Q19A 3CRUA 3DGOA 3C1SA 4ML1A 1GD3A 1VQ73 5A0OB 5ECSA 4CCVA 1EOHA 1YJN3 3ERGA 2VCZA 5D9XA 4QWTA 3KJYA 3OV4A 3M8NA 4F0CA 3DMCA 2P0GA 2DKHA 1BNIA 1F8NA 1MGRA 3X41A 1B2XA 3E99A 3FW2A 1W02A 4BPYA 1JLVA 1O6JA 4HUAA 2V2GA 1XW9A 1IVVA 3K7CA 2VD0A 5LD0A 3SEDA 4PURA 4R80A 4TN8A 3LOYA 1JBSA 4EL1A 3S5CA 4Q53A 4JBBA 1K0AA 2C0DA 2WZ9A 5DREA 4EW5A 6GSPA 5B8AA 2E2UA 6GSVA 1EG9B 1NDOB 1Y25A 2H8LA 4D73A 1V58A 3L9SA 3LXUX 18GSA 2YWNA 3CCR3 2CKFB 4AGSA 3G9BA 2QA1A 5B6NA 3APOA 1IQXA 4KA0A 1L5GB 5ECPB 1T5YA 2W56A 2Y74A 2H1BA 6GSYA 1N9EA 4EE0A 4OO4A 4XBTA 5ELAA 1DSBA 2IFQA 2CG1A 2C0EA 2GT6A 1BNRA 2GT5A 3HX8A 5JCGA 4N30A 2I81A 3ME7A 5AEWB 7GSPA 1O7NB 2A2RA 3KN4A 1XW5A 2FLSA 1NNVA 4KFFA 1U88A 1XBSA 3UBKA 2XRXB 1KSIA 3Q3FA 1OC8A 1T8EB 1GL8A 4HM8B 1JBRA 3LFLA 3G713 4KZ1A 1SQWA 4K7NA 1AUCA 4N3VA 2CVKA 1VQ53 5CRGA 2DJ0A 4IN0A 1S723 1EZKA 3CC23 3FEUA 4TKYA 2GXFA 1M1K4 1T4YA 1ZYNA 2NTOA 4NXIA 3BNBA 4TVEA 4MDCA 4KNDA 3C7MA 7STDA 2C0GA 3IOSA 22GSA 3PCRA 3MNGA 4ACSA 1O73A 1W4NA 2DBCA 2E2MA 2FNQA 1EGRA 1U3AA 4WETA 1EEMA 1SJ6A 1QALA 3ERWA 5G5FA 1FO5A 3EN1B 1FG4A 5J9CA 1YIJ3 1NU3A 2YWIA 2PERA 3TKSC 1SK0A 4HOHA 1CYUA 2HRNA 2TRXA 5JCWA 4ECBA 2LKUA 3FR9A 4G9HA 8GSSA 1DE1A 5IENA 2VOCA 2JZSA 3KH9A 2KHPA 2KP1A 4TR4A 5IPHA 4MJAA 2VL3A 1M904 3KMOA 3CMIA 4A5PA 4XM4A 2HT9A 3QAGA 3NBBA 2WO0A 3ALAA 1WP0A 1N2AA 1M2AA 6GSXA 3IDVA 1ZOFA 4K1FA 1OC9A 1NW2A 3IAS2 1V98A 1ERVA 5JPUA 1FZUA 3R3EA 5B7CA 3JUOA 4IJIA 4NREA 4O02B 3FR3A 4FMBA 1HD2A 3EU4A 4I2UA 2L4QA 1FW1A 3NBJA 3PZWA 4RI7A 1OH0A 2LQVA 1TP9A 5J41A 4ZL9A 1BSDA 2KLXA 1UI7A 3EE1A 2F51A 2FD3A 3BOAA 4D73B 3E0UA 4PGTA 3B8LA 1AIUA 1ZYEA 3ZFZA 3F40A 4N6UA 1TRQA 1ZS7A 3CSJA 2JL4A 1NM3A 1J9BA 5AYSC 1AV4A 2C80A 4WHAA 4J56E 2LV3A 1TU7A 1YQ1A 3M1GA 2VAFA 3GL5A 3JUPA 3EBTA 1FA3A 1B9XC 5CRWA 1NJI4 2YFJB 4V2LA 5DJMA 4EC0A 1HNCA 1GSUA 3IK9A 5HR0A 4HJMA 3BNDA 1X5DA 2H30A 4MPFA 5G5EA 3G16A 2SARA 3WDGB 1TI3A 2LJAA 1Z3EA 3W8SA 4ZB8A 4O8SA 3U97A 2M72A 1YY7A 3KEBA 3PR8A 2DIYA 3CCE3 1DBYA 4R9LA 3ZZXA 3OXAA 3T0UA 1G0TA 1RCKA 1GOVA 1TK0B 1Z6MA 2HMNB 4N6V0 3GYKA 4ID0A 1IVWA 2E7PA 1PA3A 3UL5A 1B21A 3RPPA 1HYFA 3QAWA 1BQ7A 2G0FA 1JJ22 1IYIA 3LXZA 4XHMA 4ORLA 3EC9A 5EQLA 1I3IA 13GSA 1MDKA 2V6KA 4EVMA 4G0KA 1ZZYA 3VSYA 2O8VB 5G31A 3IHQA 2IJYA 2AUVA 1JB2A 4H86A 3LSZA 4WF5A 4CJNA 2XEPA 3HA9A 2VL9A 2O87A 2VUPA 2YJHA 2HRAA 5A4VA 2BMXA 2FWGA 1I3FA 3FZAA 5G1KA 2LQOA 1LNHA 3S29A 3HI7A 3GN3A 1RRHA 2B7JA 4OO5A 2B7KA 4FMCA 2GDRA 3MYDA 3SBCA 4X2OA 3M3MA 1VQQA
chains in the Genus database with same CATH topology
4LMVA 4MJEA 4ZILA 10GSA 1XPVA 1F9MA 3EC3A 5ID2A 2C3TA 2CZ2A 4KGIA 5DALB 1O8XA 2CT6A 4ECJA 1FOHA 3HCZA 3VI5A 1S3DA 3HZ8A 4LL1B 4EIQA 1BJXA 5DDLA 2VO4A 3LGCA 5IO2A 4JRRA 3RAZA 1OVNA 1ERUA 5DJLA 5FWGA 1S3AA 4OD7A 5D93A 3US3A 2FWHA 2B5YA 5COHA 4TW5A 4ULXA 1B9YC 1B8XA 3HVXA 3GRXA 4KDYA 4O5QA 4NV5A 3KMNA 3DEXA 3IE3A 1T4ZA 2OBIA 3H8QA 2DKIA 4JE1A 1MEKA 2YP6A 1U6TA 4Z2TA 1W4VA 2ZNMA 3GKMA 4DSSB 4HI7A 5ECNB 5BMUA 3GTUB 1T7PB 2VD1A 1BEDA 2PVOC 2ES7A 3P7XA 1ZYQB 1Z6NA 4WR5A 3RHCA 2HZEB 4N10A 4EKZA 1OYJA 1JZRA 3GSTA 4K2DA 5D9TA 3H1NA 4YAVA 2RM6A 1YEPA 2PU9C 1SYXA 4BWQA 3LYPA 2FCHA 1IYHA 1GUMA 5G1LA 4PQIA 1W89A 1OAZA 4MJBA 1ERWA 2C4JA 4GQCA 4MZBA 3GKNA 3HVSA 2I3YA 3KCMA 2E2GA 2OBKA 4KH7A 2VCQA 5BRTA 2C3QA 4PUAA 3I6AA 1H4OA 3HY2A 3EMXA 2FWEA 3I69A 2I9HA 3UARA 5DBQA 3A2WA 1GSSA 3LORA 1Z5YE 5ECMB 2IPAA 2GZZA 3DWVA 4ZL8A 3NZNA 2PPTA 4AJ7A 16GSA 3K8NA 3P8WA 1GSDA 2QGVA 2IY2A 3MIXA 3GH9A 1LU4A 3VI7A 1SK2A 2FGXA 3GX8A 2ON5A 2YCDA 3D4TA 5IMZA 2R2JA 3ZREA 3PPUA 3DD3A 4GQFA 1FVKA 2MBTA 4ZBAA 5ECKB 3FZ5A 3CSIA 3TKQA 1PGTA 1XFLA 1Y6EA 3F3RA 1AQVA 1VF1A 2FA8A 1JHBA 3F6DA 2VCVA 4YAPA 1USBA 2FUG2 1TDIA 1JLWA 5GSTA 3H79A 6GSUA 1A2JA 2CAIA 3D22A 3VURA 4YQVA 4IP1A 1PD21 1TW9A 5JWOB 2WRTA 4NAXA 3TKSE 3PH9A 5H5RA 4RI6A 3QFAC 4JZQA 4RQXA 1SD8A 1VF4A 4POMA 2H0IA 1MD3A 1K3YA 2N5BA 5DCHA 4O5UA 3F6FA 2VIMA 4XS6A 5CNWA 2CA8A 4ZB9A 4KDUA 2PBJA 2F3MA 4EO3A 1PMTA 4DVCA 3ZITA 4MJCA 1E6BA 2GSTA 4KX4A 6GSTA 4PNGA 1EV4A 3CSHA 4L0UA 1G7OA 2AV4A 2LNSA 4MF7A 1GSQA 2EIRA 4HQSA 3J7Yk 3WGEA 2RM5A 4K7IA 2X99A 3FYGA 3TKSA 4KCAA 4GSSA 2JZRA 3HKRA 4WXTA 4OWYA 1A0RP 1DUGA 1FAAA 5AIXA 1F2EA 3GIXA 1M99A 4IBPA 4KSMA 2JSZA 4PQHA 5J5NA 2GTUA 4KE3A 2L57A 4USSA 2V41A 2AHEA 3QOUA 2AYTA 3ERFA 3UMAA 3APSA 1M2BA 4DSRA 1O85A 5ECQB 3IV4A 5KN2A 4EIPA 3G7IA 2X64A 3LXTA 2DIZA 4N0VA 4N11A 4IP6A 3W8JA 4XRAA 1OKTA 12GSA 1G6YA 4K5SA 2HSMA 2ALBA 4OFMA 4MF6A 2REMA 2P5RA 3FY7A 2GS3A 3TOUA 2H76A 2LUSA 3HJOA 2GGTA 1GP1A 3D4MA 1A24A 3DVWA 3APQA 4LA1A 3TRPA 1PL2A 3ZLPA 1FB0A 2JZTA 1K3OA 2ON7A 2HNLA 3C1RA 4PXOA 1Q4JA 1SK1A 5KN0A 3GUSA 2JSYA 4XS4A 5ENUA 2FHEA 4MCUA 2I4AA 3EURA 1XCCA 2B5XA 1ABAA 5AISA 1XOAA 1FOVA 2UZ8A 3QFBC 1FHEA 5ECRB 1TTZA 2DC5A 3HJPA 3G7YA 2HSYA 3IAM2 1AQXA 4NHWA 3LG6A 4KDXA 4NMUA 5GAND 4IHUA 4POBA 4ZBDA 4XCSA 1GWCA 1GUHA 3TJBA 1DE2A 2CX3A 3G7JA 1N8JA 3EINA 4ECCA 1Q98A 2JACA 1UC7A 2HRFA 4EUYA 3TOTA 3I43A 1GH2A 5KN3A 5EL8A 4IQ1A 4I8BA 1RW1A 4MLYA 3FK8A 3ZTLA 2LRCA 3VPTA 2R5GA 5EPFA 4G0LA 4L8EA 3D0ZA 2X4AA 3PINA 3KXOA 3RHBA 2H74A 1RQMA 2AAWA 3IXRA 3CTFA 3BCKA 4QL7A 2EIOA 3TJFA 3A2VA 3C73A 4X0XA 4IGJA 5CREA 4PQ1A 1MTCA 1YEXA 2TRCP 4CY6A 5KEJA 2I1UA 1WPIA 2ZCTA 4FH8A 3IA1A 2YZHA 5B6MA 4F2IA 1TKDB 4GXZA 5D9WA 3EPTA 3HYPA 3ZMKA 2AJQB 5ID2B 2M80A 1VF3A 3WGDA 5IOXA 1OC9B 4N0ZA 1SYRA 2HRKA 1O8WA 3E9JB 2BTOT 3BD2A 3UJ1A 4AJ8A 5H5SA 1J0FA 4TR1B 3TKPA 5F06A 5DAKB 1H75A 2CZ3A 3TRQA 4G19A 2OADA 3KD0A 4I5QA 4BL7B 4WBJA 3UAPA 1WE0A 4YQUA 1GSEA 2CAQA 2OE0A 1TXXA 1WJKA 20GSA 1SD9A 1HQOA 4MZCA 2YZUA 2JU5A 3TGZA 4YKFA 5F8BA 2X8CA 4O7HA 4ZXGA 3TJGA 2YN1A 1PKZA 2IL3A 4GCIA 5J3RA 3LWAA 2IYJA 5FT3A 4IELA 2H1DA 2FWFA 3ZFBA 4JR6A 2GQKA 2OE3A 3GHAA 1AXDA 4G10A 3M9KA 2IFQB 5IO0A 1EP8A 2B3SA 5B8BA 1GNEA 5FHIA 1GRXA 4K0GA 5KOXA 1K0CA 4Q5NA 4K6XA 3GKXA 4KB3A 2WB9A 4XTSA 4IS0A 2RUEA 5CP1A 4FQUA 1SENA 4ECIA 1PQNA 2K9FA 4BVXA 5IMAA 4CHSA 1OKDA 4BL7A 5G30A 1EGOA 2FA4A 3TRXA 2HSHA 2X8HA 1ILOA 2VLVA 1K0BA 5DCGA 2YJ7A 2XPDA 1LJRA 4POKA 3N5OA 4GWRA 3DIEA 2WFCA 4KSOA 1F3AA 2OA7A 1SKRB 5E4WA 2HZEA 1GULA 1EWXA 4GF0A 5F05A 4KW6A 1G6WA 3IC8A 3I9V2 4TXOA 2VCTA 4CDOA 4I2TA 4NV2A 3UBLA 2DJKA 2X49A 3L9VA 2KUCA 1OC3A 4P3YB 2C0FA 4BVYB 2YNXA 4Z2RA 3UEMA 3TJKA 4V2MA 3DMLA 2K6VA 2PN8A 1RK4A 3VK9A 4O32A 4F9ZA 4FYBA 4HOJA 3L78A 4XRDA 4BVYA 3UVTA 5ECIB 2DSAA 2R0PA 5D73A 2F8FA 3FR6A 1V9WA 2WGRA 3FZ4A 4HS1A 1OE7A 2MMOA 3LQ7A 3FRCA 1MD4A 5JWRB 3HVVA 4AF2A 2RIIA 4WKWA 1T1VA 1I9DA 3KP9A 4HZ2A 3VFIA 1QFNA 3ED3A 1K0OA 3IHGA 1UN2A 19GSA 1GUKA 3V1WA 1A8YA 1XWBA 1ZMAA 5IMCA 3Q18A 4KCEA 3BJ5A 1KBNA 2KOKA 3FHKA 5A4WA 4O5RA 2QA2A 4KUNA 5H5QA 4Q5FA 4JEDA 4HZ4A 2XHFA 3A3TA 1XWCA 1B4PA 4MK3A 2VM1A 2O7KA 3SWLA 1F6MC 2LSTA 4DSSA 2PUKC 3IC4A 4LLRA 4TR3A 1B48A 1JZDA 2R0GA 2H6YA 3EU3A 5E59A 1J08A 2LNTA 3WT2A 2MMAA 3H4KA 3GL3A 5IIZA 2F9SA 3AY8A 3GNJA 3F0IA 5CRDA 4XS1A 2K18A 4DEJA 2LQQA 1AAZA 4J2FA 5D8IA 1ON4A 1BYEA 1E2YA 5IM9A 2DJJA 1SU9A 2WJUA 3CRTA 3QMXA 3TKRA 4F03A 3DGQA 3P90A 3TDGA 1F3BA 1YDKA 2B1LA 2LTKA 4IW9A 4K0NA 5DQYA 1KTEA 5D96A 2HZFA 3Q6OA 1FB6A 1HYUA 2R4VA 1XWGA 4V2NA 2VCXA 2BJXA 2XPEA 3WT1A 2OE1A 4I6XA 5IOWA 2YWOA 1KNGA 4BVXB 1GLPA 3QR6A 1JFUA 2R3XA 5GZZB 4TXVA 2H1AA 3KIJA 2HLSA 3VPQA 3GX0A 5C00A 1O81A 3FZ9A 2C1YA 2H66A 4O92A 4Q5QA 1AC1A 2FY6A 3GURA 1VGLA 5F0GA 3IK7A 1FVJA 1TRUA 3UOMA 3EYTA 3JCML 1SL0B 3KM6A 1R26A 4HJ2A 1Z7RA 1X5EA 1WRYA 1K0MA 1LBKA 2H1GA 1GTAA 3A5WA 2E0QA 3EWLA 7GSSA 3ME8A 5GSSA 2HXKA 3MWHA 3C8EA 2H6XA 2DMLA 3HD5A 4MPGA 2XBIA 5J4UA 3QAVA 1PN0A 3DVXA 3MDKA 5CO3A 3R2QA 5L71A 2L59A 4MABA 2H72A 3CYNA 3ZYWA 2YWMA 2HI7A 4V1Ap 1XIYA 2HFDA 4ZB6A 2VLUA 2IMKA 1S3CA 4TR0A 3KTLA 1X9MB 1QGVA 2HE3A 1QK8A 5HR3A 4PX1A 2D2ZA 1VRSD 1UVZA 3M0FA 2PWJA 2H6ZA 1YF0A 1V2AA 1ZCPA 2L6CA 4EDYA 2B1KA 1XWKA 5HR1A 4TOPA 1PN9A 4ZBBA 5HR2A 1PKWA 4IKHA 2GLRA 5HFKA 4K9ZA 1X5CA 1I5GA 2CV4A 4ZL7A 3O6TA 2J9HA 4GLTA 3KP8A 4HU9A 1KEBA 3L0HA 3GMFA 3L9UA 1ST9A 2XBQA 2DLXA 2OACA 4IJ3A 1XWAA 4EXJA 2MMZA 5HQPA 2XC2A 3IBHA 3F4RA 4IVFA 2GSSA 4RQRA 5HFGA 4ICYA 3ZVJA 1TU8A 3FMWA 3GA4A 1YKAA 2H75A 2V1MA 2L5LA 2CVDA 2YPMA 4DSQA 4XIHA 3QDNA 2CQ9A 4GRFA 5KN1A 4X43A 2IMEA 1AQWA 1WIKA 2QC7A 3ZVJD 3GKKA 1M7TA 4K5RA 2L5OA 1X9SB 2H0HA 4X4JA 3D21A 1QXHA 3HXSA 3J7Yb 1A23A 2OJLA 1Z7PA 1HNBA 1C72A 2IIYA 4MA9A 3WD6A 1VF2A 4OFNA 2H70A 1A2LA 2YANA 1R7HA 3UVHA 3RBTA 5D9VA 2QKEA 4WR4A 1U87A 3IPZA 3KH7A 2OKAA 3H93A 1CQGA 1HNAA 4YH2A 1BAYA 4GSNA 1Z9HA 4ILFA 3FKFA 2TIRA 5A4UA 2C3NA 1GTUA 3VLNA 5AIVA 2K8VA 3EMPA 1NHYA 2AB6A 5F07A 5LNKe 4TXOB 2IWTA 2RLIA 3TJJA 3GV1A 1PSQA 3U6VA 4Z7XA 3E3EA 3KTBA 4EDZA 2L6DA 2A2SA 3UL3A 1QMVA 5IMVA 5ABRA 2MZCA 3KZQA 4J57E 1EEJA 3VWUA 5KOWA 3ZFLA 2FNOA 5J9BA 4FYUA 1K3LA 3GTUA 4MP4A 4PTSA 4E8HA 3S9FA 3D6IA 2GZYA 1AW9A 2MYGA 2V6OA 1TRWA 3TUEA 3LYKA 9GSSA 2LEGA 4JU5A 3ZMLA 2A2PA 3F3QA 3VWXA 1ZL9A 3OR5A 5IMFA 1XZOA 1SKWB 2J23A 1V57A 4K8MA 2GQLA 5ELGA 3ZRDA 1YZXA 4CY8A 4CW9A 1GSFA 2JADA 3QCPA 4LL4B 4AJ6A 1PRXA 4L5LA 4ML6A 4OMVA 1ML6A 1THOA 1WWJA 1WOUA 1UA5A 4OFTA 1SL1B 3A5IA 1XVWA 1THXA 3F8UA 4FYCA 4TRXA 2PVQA 4HU7A 2WS2A 2DJ3A 2H73A 1B4QA 4WEYA 11GSA 3QD9A 5ECHB 1MDJA 2CX4A 2GSRA 3F63A 4QL9A 2O85A 4HDEA 4K7OA 3GSSA 4KAEA 4FO5A 3F4SA 2A4VA 4K2XA 2DJ1A 3NOFA 4MZWA 1K0NA 3F9UA 4OCEA 1YJ6A 3GFKA 4BA7A 1NHOA 3L4NA 3W6GA 3WYWA 3ZIJA 4EF0A 1ZGNA 2WULA 1ZYPA 2ZUPA 2VLTA 5ECOB 3TB2A 2B6MA 5CYYA 3MAKA 2PGTA 1GLQA 2IN3A 3F4TA 3U5RE 1JZOA 2B5EA 5ECLB 3D5JA 3QPMA 1TOFA 4G2EA 2HYXA 4RUVA 3RPNA 4TR1A 2H01A 5IPGA 2NBSA 4MF5A 2GVPA 4IQAA 1TK8B 1TI1A 2MBSA 2R0CA 3ISOA 1YF1A 14GSA 4E8EA 1QQ2A 4Q5RA 4BWSA 5GAPD 3P2AA 3ZL5A 2PMTA 3Q74A 2K8SA 5EY6A 1O7UA 2YV9A 4NWYA 1M0UA 2LRNA 4F0BA 2P31A 5EVOA 5AGYA 2VCWA 5CRHA 4G0IA 4LMWA 3NIVA 3EVIA 1XOBA 1NSWA 2H19A 1SJIA 3GH6A 1V40A 4Z2UA 3RDWA 2R6KA 3CBUA 5DAKA 2EIQA 3HJMA 3WGXA 1M2DA 3O76A 5IQYA 1ACVA 3M9JA 1WMJA 1QUWA 3BCIA 2G2QA 4MH2A 1A2MA 1SL2B 1PL1A 2GSQA 5G2ZA 6GSWA 3ZIVA 3MSZA 1BX9A 1EP7A 3VWWA 1R5AA 1X9WB 2EC4A 2IMDA 2A4HA 4MH3A 3CTGA 1F37A 1M9AA 3UIWA 3EE2A 3O3TA 5JCUA 3HDCA 5A5KA 1TRSA 1OE8A 1GSYA 1K0DA 2DJ2A 3CXGA 2IMFA 5LCZA 2GZPA 4FIWA 3IR4A 2WDUA 3IRAA 2QSIA 5DVBA 4F82A 1GTIA 2YV7A 1GTBA 4HEA2 2LJKA 3KGKA 1TRVA 2VL2C 1U3IA 5DQSA 3DRNA 2NPBA 3A2XA 1PX6A 2R37A 4PUFC 1A8LA 3PGTA 4WF4A 3TCOA 1URMA 4KF9A 2H71A 2O89A 2V32A 4WBRD 2Z9SA 4I97A 1T3BA 4HQZA 1EOGA 4XS4B 2RUFA 2LS5A 4MMMA 4ISDA 2NVLA 1MDIA 1PX7A 4QQ7A 3LEFA 4NPBA 1BG5A 4ZIJA 1R4WA 2LRTA 3C71A 4GTUA 1X0RA 1A0FA 4V1Ag 1T00A 3DYRA 2NDOA 5C04A 2VL2A 5DALA 1GNWA 3LW9A 2KP2A 2C8UA 2MMNA 5AN1A 3DKSA 4L5OA 4MNNA 3BBYA 6GSSA 2LJRA 3DXBA 2L4CA 2F8AA 3LJRA 4POLA 3HHVA 2P5QA 3VWVA 5JWQB 4PNFA 2CVBA 5HFIA 1JZWA 2VM2A 2H0GA 2M46A 4JR4A 4L0WA 1EV9A 2IMIA 1CQHA 2N5FA 2WCIA 2N5AA 4YQMA 4GSTA 4X1UA 1M9BA 5IMDA 4YKGA 2DMMA 1XVQA 3HZ4A 4OCFA 1ERTA 2YOIA 5CAXA 1XXUA 1TK5B 1SKSB 1G7EA 2GQMA 1YKCA 1SJZA 1XW6A 17GSA 4NHZA 1TJDA 1R5PA 5INYA 2X8GA 3Q19A 3CRUA 3C1SA 4ML1A 5ECSA 1EOHA 3ERGA 2VCZA 5D9XA 3KJYA 3M8NA 4F0CA 2P0GA 2DKHA 3FW2A 4BPYA 1JLVA 1O6JA 4HUAA 2V2GA 1XW9A 2VD0A 5LD0A 4PURA 4TN8A 4EL1A 4JBBA 1K0AA 2C0DA 2WZ9A 5B8AA 6GSVA 1Y25A 2H8LA 4D73A 1V58A 3L9SA 18GSA 2YWNA 4AGSA 3G9BA 2QA1A 5B6NA 3APOA 4KA0A 5ECPB 2H1BA 6GSYA 4EE0A 4OO4A 5ELAA 1DSBA 2IFQA 2C0EA 2GT6A 2GT5A 5JCGA 4N30A 2I81A 3ME7A 2A2RA 2FLSA 1XW5A 1U88A 1XBSA 3UBKA 1OC8A 1T8EB 1GL8A 3LFLA 4K7NA 1AUCA 2CVKA 5CRGA 2DJ0A 4IN0A 1EZKA 4TKYA 3FEUA 1ZYNA 1T4YA 4NXIA 2NTOA 4TVEA 4MDCA 4KNDA 3C7MA 2C0GA 3IOSA 22GSA 3MNGA 4ACSA 1O73A 2DBCA 2E2MA 1EGRA 1U3AA 4WETA 1EEMA 1SJ6A 3ERWA 5G5FA 1FO5A 1FG4A 5J9CA 2YWIA 2PERA 3TKSC 1SK0A 2HRNA 2TRXA 5JCWA 4ECBA 2LKUA 3FR9A 4G9HA 8GSSA 1DE1A 2VOCA 2JZSA 3KH9A 2KHPA 2KP1A 4TR4A 5IPHA 4MJAA 2VL3A 3KMOA 3CMIA 4A5PA 2HT9A 3QAGA 1WP0A 1N2AA 1M2AA 6GSXA 3IDVA 1ZOFA 4K1FA 1OC9A 1NW2A 3IAS2 1V98A 1ERVA 3R3EA 5B7CA 4IJIA 3FR3A 1HD2A 3EU4A 4I2UA 2L4QA 1FW1A 4RI7A 1TP9A 5J41A 4ZL9A 2KLXA 2F51A 2FD3A 3BOAA 4D73B 3E0UA 4PGTA 1ZYEA 1AIUA 3CSJA 2JL4A 1NM3A 1J9BA 2C80A 4J56E 2LV3A 1TU7A 1YQ1A 3M1GA 2VAFA 3GL5A 1B9XC 5CRWA 4V2LA 5DJMA 4EC0A 1HNCA 1GSUA 3IK9A 5HR0A 4HJMA 1X5DA 2H30A 4MPFA 5G5EA 3W8SA 1TI3A 2LJAA 1Z3EA 4ZB8A 2M72A 1YY7A 3KEBA 3PR8A 2DIYA 1DBYA 3ZZXA 1G0TA 1TK0B 1Z6MA 3GYKA 4ID0A 2E7PA 1PA3A 3RPPA 3QAWA 1BQ7A 2G0FA 1IYIA 3LXZA 4XHMA 13GSA 1MDKA 2V6KA 4EVMA 4G0KA 1ZZYA 2O8VB 5G31A 3IHQA 2IJYA 2AUVA 4H86A 4WF5A 3LSZA 3HA9A 2VL9A 2O87A 2VUPA 2YJHA 2HRAA 5A4VA 2BMXA 2FWGA 3FZAA 5G1KA 2LQOA 3GN3A 4OO5A 2B7JA 2B7KA 2GDRA 3MYDA 3SBCA 3M3MA 3N9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMV A;  4MJE A;  4ZIL A;  10GS A;  1XPV A;  1F9M A;  3EC3 A;  5ID2 A;  2C3T A;  2CZ2 A;  4KGI A;  5DAL B;  1O8X A;  2CT6 A;  4ECJ A;  3HCZ A;  3VI5 A;  1S3D A;  3HZ8 A;  4LL1 B;  1BJX A;  5DDL A;  2VO4 A;  3LGC A;  5IO2 A;  4JRR A;  3RAZ A;  1OVN A;  1ERU A;  5DJL A;  5FWG A;  1S3A A;  4OD7 A;  5D93 A;  3US3 A;  2FWH A;  2B5Y A;  5COH A;  4TW5 A;  4ULX A;  1B9Y C;  1B8X A;  3HVX A;  3GRX A;  4KDY A;  4NV5 A;  3KMN A;  3DEX A;  3IE3 A;  1T4Z A;  2OBI A;  3H8Q A;  4JE1 A;  1MEK A;  2YP6 A;  1U6T A;  1W4V A;  2ZNM A;  3GKM A;  4DSS B;  4HI7 A;  5ECN B;  3GTU B;  1T7P B;  2VD1 A;  1BED A;  2PVO C;  2ES7 A;  3P7X A;  1ZYQ B;  1Z6N A;  4WR5 A;  3RHC A;  2HZE B;  4N10 A;  4EKZ A;  1OYJ A;  1JZR A;  3GST A;  4K2D A;  5D9T A;  3H1N A;  4YAV A;  2RM6 A;  1YEP A;  2PU9 C;  1SYX A;  4BWQ A;  3LYP A;  2FCH A;  1IYH A;  1GUM A;  5G1L A;  4PQI A;  1W89 A;  1OAZ A;  4MJB A;  1ERW A;  2C4J A;  4GQC A;  4MZB A;  3GKN A;  3HVS A;  2I3Y A;  3KCM A;  2E2G A;  2OBK A;  4KH7 A;  2VCQ A;  2C3Q A;  4PUA A;  3I6A A;  1H4O A;  3HY2 A;  3EMX A;  2FWE A;  3I69 A;  2I9H A;  3UAR A;  5DBQ A;  3A2W A;  1GSS A;  3LOR A;  1Z5Y E;  5ECM B;  2IPA A;  2GZZ A;  3DWV A;  4ZL8 A;  3NZN A;  2PPT A;  4AJ7 A;  16GS A;  3K8N A;  3P8W A;  1GSD A;  2QGV A;  2IY2 A;  3GH9 A;  1LU4 A;  3VI7 A;  1SK2 A;  2FGX A;  3GX8 A;  2ON5 A;  2YCD A;  3D4T A;  5IMZ A;  2R2J A;  3ZRE A;  3DD3 A;  4GQF A;  1FVK A;  2MBT A;  4ZBA A;  5ECK B;  3FZ5 A;  3CSI A;  3TKQ A;  1PGT A;  1XFL A;  1Y6E A;  3F3R A;  1AQV A;  1VF1 A;  2FA8 A;  1JHB A;  3F6D A;  2VCV A;  4YAP A;  1USB A;  2FUG 2;  1TDI A;  1JLW A;  5GST A;  3H79 A;  6GSU A;  1A2J A;  2CAI A;  3D22 A;  3VUR A;  4YQV A;  4IP1 A;  1PD2 1;  1TW9 A;  5JWO B;  2WRT A;  4NAX A;  3TKS E;  3PH9 A;  5H5R A;  4RI6 A;  3QFA C;  4JZQ A;  4RQX A;  1SD8 A;  1VF4 A;  4POM A;  2H0I A;  1MD3 A;  1K3Y A;  2N5B A;  5DCH A;  3F6F A;  2VIM A;  4XS6 A;  5CNW A;  2CA8 A;  4ZB9 A;  4KDU A;  2PBJ A;  2F3M A;  4EO3 A;  1PMT A;  4DVC A;  3ZIT A;  4MJC A;  1E6B A;  2GST A;  4KX4 A;  6GST A;  4PNG A;  1EV4 A;  3CSH A;  4L0U A;  1G7O A;  2AV4 A;  2LNS A;  4MF7 A;  1GSQ A;  2EIR A;  4HQS A;  3J7Y k;  3WGE A;  2RM5 A;  4K7I A;  2X99 A;  3FYG A;  3TKS A;  4KCA A;  4GSS A;  2JZR A;  3HKR A;  4WXT A;  4OWY A;  1A0R P;  1DUG A;  1FAA A;  5AIX A;  1F2E A;  3GIX A;  1M99 A;  4IBP A;  4KSM A;  2JSZ A;  4PQH A;  5J5N A;  2GTU A;  4KE3 A;  2L57 A;  2V41 A;  2AHE A;  3QOU A;  2AYT A;  3ERF A;  3UMA A;  3APS A;  1M2B A;  4DSR A;  1O85 A;  5ECQ B;  3IV4 A;  5KN2 A;  3G7I A;  2X64 A;  3LXT A;  2DIZ A;  4N0V A;  4N11 A;  4IP6 A;  3W8J A;  4XRA A;  1OKT A;  12GS A;  1G6Y A;  2ALB A;  4OFM A;  4MF6 A;  2REM A;  2P5R A;  3FY7 A;  2GS3 A;  3TOU A;  2H76 A;  2LUS A;  3HJO A;  2GGT A;  1GP1 A;  3D4M A;  1A24 A;  3DVW A;  3APQ A;  4LA1 A;  3TRP A;  1PL2 A;  3ZLP A;  1FB0 A;  2JZT A;  1K3O A;  2ON7 A;  2HNL A;  3C1R A;  4PXO A;  1Q4J A;  1SK1 A;  5KN0 A;  3GUS A;  2JSY A;  4XS4 A;  5ENU A;  2FHE A;  4MCU A;  2I4A A;  3EUR A;  1XCC A;  2B5X A;  1ABA A;  5AIS A;  1XOA A;  1FOV A;  3QFB C;  1FHE A;  5ECR B;  1TTZ A;  2DC5 A;  3HJP A;  3G7Y A;  2HSY A;  3IAM 2;  1AQX A;  4NHW A;  3LG6 A;  4KDX A;  4NMU A;  5GAN D;  4IHU A;  4POB A;  4ZBD A;  4XCS A;  1GWC A;  1GUH A;  3TJB A;  1DE2 A;  2CX3 A;  3G7J A;  1N8J A;  3EIN A;  4ECC A;  1Q98 A;  2JAC A;  1UC7 A;  2HRF A;  4EUY A;  3TOT A;  3I43 A;  1GH2 A;  5KN3 A;  5EL8 A;  4IQ1 A;  4I8B A;  1RW1 A;  4MLY A;  3FK8 A;  3ZTL A;  2LRC A;  3VPT A;  2R5G A;  5EPF A;  4L8E A;  3D0Z A;  3PIN A;  3KXO A;  3RHB A;  2H74 A;  1RQM A;  2AAW A;  3IXR A;  3CTF A;  3BCK A;  4QL7 A;  2EIO A;  3TJF A;  3A2V A;  3C73 A;  4X0X A;  4IGJ A;  5CRE A;  4PQ1 A;  1MTC A;  1YEX A;  2TRC P;  5KEJ A;  2I1U A;  1WPI A;  2ZCT A;  4FH8 A;  3IA1 A;  2YZH A;  5B6M A;  4F2I A;  1TKD B;  4GXZ A;  5D9W A;  3HYP A;  3ZMK A;  2AJQ B;  5ID2 B;  2M80 A;  1VF3 A;  3WGD A;  5IOX A;  1OC9 B;  4N0Z A;  1SYR A;  1O8W A;  3E9J B;  2BTO T;  3BD2 A;  3UJ1 A;  4AJ8 A;  5H5S A;  1J0F A;  4TR1 B;  3TKP A;  5F06 A;  5DAK B;  1H75 A;  2CZ3 A;  3TRQ A;  4G19 A;  2OAD A;  3KD0 A;  4I5Q A;  4WBJ A;  3UAP A;  1WE0 A;  4YQU A;  1GSE A;  2CAQ A;  2OE0 A;  1TXX A;  1WJK A;  20GS A;  1SD9 A;  1HQO A;  4MZC A;  2YZU A;  2JU5 A;  3TGZ A;  5F8B A;  2X8C A;  4O7H A;  4ZXG A;  3TJG A;  2YN1 A;  1PKZ A;  2IL3 A;  4GCI A;  5J3R A;  3LWA A;  2IYJ A;  5FT3 A;  4IEL A;  2H1D A;  2FWF A;  3ZFB A;  4JR6 A;  2GQK A;  2OE3 A;  3GHA A;  1AXD A;  4G10 A;  3M9K A;  2IFQ B;  5IO0 A;  1EP8 A;  2B3S A;  5B8B A;  1GNE A;  5FHI A;  1GRX A;  4K0G A;  1K0C A;  4Q5N A;  4K6X A;  3GKX A;  4KB3 A;  2WB9 A;  4XTS A;  4IS0 A;  2RUE A;  5CP1 A;  1SEN A;  4ECI A;  1PQN A;  2K9F A;  4BVX A;  5IMA A;  4CHS A;  1OKD A;  4BL7 A;  5G30 A;  1EGO A;  2FA4 A;  3TRX A;  2HSH A;  2X8H A;  1ILO A;  2VLV A;  1K0B A;  5DCG A;  2YJ7 A;  2XPD A;  1LJR A;  4POK A;  3N5O A;  4GWR A;  3DIE A;  2WFC A;  4KSO A;  1F3A A;  2OA7 A;  1SKR B;  5E4W A;  2HZE A;  1GUL A;  1EWX A;  4GF0 A;  5F05 A;  4KW6 A;  1G6W A;  3I9V 2;  4TXO A;  2VCT A;  4CDO A;  4I2T A;  4NV2 A;  3UBL A;  2DJK A;  3L9V A;  2KUC A;  1OC3 A;  4P3Y B;  2C0F A;  2YNX A;  3UEM A;  3TJK A;  4V2M A;  3DML A;  2K6V A;  2PN8 A;  1RK4 A;  3VK9 A;  4O32 A;  4F9Z A;  4FYB A;  4HOJ A;  3L78 A;  4XRD A;  4BVY A;  3UVT A;  5ECI B;  2DSA A;  5D73 A;  2F8F A;  3FR6 A;  1V9W A;  2WGR A;  3FZ4 A;  4HS1 A;  1OE7 A;  2MMO A;  3LQ7 A;  3FRC A;  1MD4 A;  5JWR B;  3HVV A;  4AF2 A;  2RII A;  4WKW A;  1T1V A;  1I9D A;  3KP9 A;  4HZ2 A;  3VFI A;  1QFN A;  3ED3 A;  1K0O A;  1UN2 A;  19GS A;  1GUK A;  3V1W A;  1A8Y A;  1XWB A;  1ZMA A;  5IMC A;  3Q18 A;  4KCE A;  3BJ5 A;  1KBN A;  2KOK A;  3FHK A;  5A4W A;  4O5R A;  4KUN A;  5H5Q A;  4Q5F A;  4JED A;  4HZ4 A;  2XHF A;  3A3T A;  1XWC A;  1B4P A;  4MK3 A;  2VM1 A;  2O7K A;  3SWL A;  1F6M C;  2LST A;  4DSS A;  2PUK C;  3IC4 A;  4LLR A;  4TR3 A;  1B48 A;  1JZD A;  2H6Y A;  3EU3 A;  5E59 A;  1J08 A;  2LNT A;  3WT2 A;  2MMA A;  3H4K A;  3GL3 A;  5IIZ A;  2F9S A;  3AY8 A;  3GNJ A;  3F0I A;  5CRD A;  4XS1 A;  2K18 A;  4DEJ A;  2LQQ A;  1AAZ A;  4J2F A;  5D8I A;  1ON4 A;  1BYE A;  1E2Y A;  5IM9 A;  2DJJ A;  1SU9 A;  2WJU A;  3CRT A;  3QMX A;  3TKR A;  4F03 A;  3DGQ A;  3P90 A;  3TDG A;  1F3B A;  1YDK A;  2B1L A;  2LTK A;  4IW9 A;  4K0N A;  5DQY A;  1KTE A;  5D96 A;  2HZF A;  3Q6O A;  1FB6 A;  1HYU A;  2R4V A;  1XWG A;  4V2N A;  2VCX A;  2BJX A;  2XPE A;  3WT1 A;  2OE1 A;  4I6X A;  5IOW A;  2YWO A;  1KNG A;  1GLP A;  3QR6 A;  1JFU A;  2R3X A;  5GZZ B;  4TXV A;  2H1A A;  3KIJ A;  2HLS A;  3VPQ A;  3GX0 A;  5C00 A;  1O81 A;  3FZ9 A;  2C1Y A;  2H66 A;  4O92 A;  4Q5Q A;  1AC1 A;  2FY6 A;  3GUR A;  1VGL A;  5F0G A;  3IK7 A;  1FVJ A;  1TRU A;  3UOM A;  3EYT A;  3JCM L;  1SL0 B;  3KM6 A;  1R26 A;  4HJ2 A;  1Z7R A;  1X5E A;  1WRY A;  1K0M A;  1LBK A;  2H1G A;  1GTA A;  3A5W A;  2E0Q A;  3EWL A;  7GSS A;  3ME8 A;  5GSS A;  2HXK A;  3MWH A;  3C8E A;  2H6X A;  2DML A;  3HD5 A;  4MPG A;  2XBI A;  5J4U A;  3QAV A;  3DVX A;  3MDK A;  5CO3 A;  3R2Q A;  5L71 A;  2L59 A;  4MAB A;  2H72 A;  3CYN A;  3ZYW A;  2YWM A;  2HI7 A;  4V1A p;  1XIY A;  2HFD A;  4ZB6 A;  2VLU A;  2IMK A;  1S3C A;  4TR0 A;  3KTL A;  1X9M B;  1QGV A;  2HE3 A;  1QK8 A;  5HR3 A;  4PX1 A;  2D2Z A;  1VRS D;  1UVZ A;  3M0F A;  2PWJ A;  2H6Z A;  1YF0 A;  1V2A A;  1ZCP A;  2L6C A;  4EDY A;  2B1K A;  1XWK A;  5HR1 A;  4TOP A;  1PN9 A;  4ZBB A;  5HR2 A;  1PKW A;  4IKH A;  2GLR A;  5HFK A;  4K9Z A;  1X5C A;  1I5G A;  2CV4 A;  4ZL7 A;  3O6T A;  2J9H A;  4GLT A;  3KP8 A;  4HU9 A;  1KEB A;  3L0H A;  3GMF A;  3L9U A;  1ST9 A;  2XBQ A;  2DLX A;  2OAC A;  4IJ3 A;  1XWA A;  4EXJ A;  2MMZ A;  5HQP A;  2XC2 A;  3IBH A;  3F4R A;  4IVF A;  2GSS A;  4RQR A;  5HFG A;  3ZVJ A;  1TU8 A;  3GA4 A;  1YKA A;  2H75 A;  2V1M A;  2L5L A;  2CVD A;  2YPM A;  4DSQ A;  4XIH A;  3QDN A;  2CQ9 A;  4GRF A;  5KN1 A;  4X43 A;  2IME A;  1AQW A;  1WIK A;  2QC7 A;  3ZVJ D;  3GKK A;  1M7T A;  2L5O A;  1X9S B;  2H0H A;  3D21 A;  1QXH A;  3HXS A;  3J7Y b;  1A23 A;  2OJL A;  1Z7P A;  1HNB A;  1C72 A;  2IIY A;  4MA9 A;  3WD6 A;  1VF2 A;  4OFN A;  2H70 A;  1A2L A;  2YAN A;  1R7H A;  3UVH A;  3RBT A;  5D9V A;  2QKE A;  4WR4 A;  1U87 A;  3IPZ A;  3KH7 A;  2OKA A;  3H93 A;  1CQG A;  1HNA A;  4YH2 A;  1BAY A;  4GSN A;  1Z9H A;  4ILF A;  3FKF A;  2TIR A;  5A4U A;  2C3N A;  1GTU A;  3VLN A;  5AIV A;  2K8V A;  3EMP A;  1NHY A;  2AB6 A;  5F07 A;  5LNK e;  4TXO B;  2IWT A;  2RLI A;  3TJJ A;  3GV1 A;  1PSQ A;  3U6V A;  4Z7X A;  3E3E A;  3KTB A;  4EDZ A;  2L6D A;  2A2S A;  3UL3 A;  1QMV A;  5IMV A;  5ABR A;  2MZC A;  3KZQ A;  4J57 E;  1EEJ A;  3VWU A;  3ZFL A;  2FNO A;  5J9B A;  4FYU A;  1K3L A;  3GTU A;  4MP4 A;  4E8H A;  3S9F A;  3D6I A;  2GZY A;  1AW9 A;  2MYG A;  2V6O A;  1TRW A;  3TUE A;  3LYK A;  9GSS A;  2LEG A;  4JU5 A;  3ZML A;  3F3Q A;  3VWX A;  1ZL9 A;  3OR5 A;  5IMF A;  1XZO A;  1SKW B;  2J23 A;  1V57 A;  4K8M A;  2GQL A;  5ELG A;  3ZRD A;  1YZX A;  4CW9 A;  1GSF A;  2JAD A;  3QCP A;  4LL4 B;  4AJ6 A;  1PRX A;  4L5L A;  4ML6 A;  4OMV A;  1ML6 A;  1THO A;  1WWJ A;  1WOU A;  1UA5 A;  4OFT A;  1SL1 B;  1XVW A;  1THX A;  3F8U A;  4FYC A;  4TRX A;  2PVQ A;  4HU7 A;  2WS2 A;  2DJ3 A;  2H73 A;  1B4Q A;  4WEY A;  11GS A;  3QD9 A;  5ECH B;  1MDJ A;  2CX4 A;  2GSR A;  3F63 A;  4QL9 A;  2O85 A;  4HDE A;  4K7O A;  3GSS A;  4KAE A;  4FO5 A;  3F4S A;  2A4V A;  2DJ1 A;  3NOF A;  4MZW A;  1K0N A;  3F9U A;  4OCE A;  1YJ6 A;  3GFK A;  4BA7 A;  3W6G A;  1NHO A;  3L4N A;  3WYW A;  3ZIJ A;  4EF0 A;  1ZGN A;  2WUL A;  2ZUP A;  2VLT A;  5ECO B;  3TB2 A;  2B6M A;  5CYY A;  3MAK A;  2PGT A;  1GLQ A;  2IN3 A;  3F4T A;  3U5R E;  1JZO A;  2B5E A;  5ECL B;  3D5J A;  3QPM A;  1TOF A;  4G2E A;  2HYX A;  4RUV A;  3RPN A;  4TR1 A;  2H01 A;  5IPG A;  2NBS A;  4MF5 A;  2GVP A;  4IQA A;  1TK8 B;  1TI1 A;  2MBS A;  3ISO A;  1YF1 A;  14GS A;  4E8E A;  1QQ2 A;  4Q5R A;  4BWS A;  5GAP D;  3P2A A;  3ZL5 A;  2PMT A;  3Q74 A;  2K8S A;  5EY6 A;  1O7U A;  2YV9 A;  4NWY A;  1M0U A;  2LRN A;  4F0B A;  2P31 A;  5EVO A;  5AGY A;  2VCW A;  5CRH A;  4LMW A;  3NIV A;  3EVI A;  1XOB A;  1NSW A;  2H19 A;  1SJI A;  3GH6 A;  1V40 A;  3RDW A;  2R6K A;  3CBU A;  5DAK A;  2EIQ A;  3HJM A;  3WGX A;  1M2D A;  3O76 A;  5IQY A;  1ACV A;  3M9J A;  1WMJ A;  1QUW A;  3BCI A;  2G2Q A;  4MH2 A;  1A2M A;  1SL2 B;  1PL1 A;  2GSQ A;  5G2Z A;  6GSW A;  3ZIV A;  3MSZ A;  1BX9 A;  1EP7 A;  3VWW A;  1R5A A;  1X9W B;  2EC4 A;  2IMD A;  4MH3 A;  3CTG A;  1F37 A;  1M9A A;  3UIW A;  3EE2 A;  3O3T A;  5JCU A;  3HDC A;  5A5K A;  1TRS A;  1OE8 A;  1GSY A;  1K0D A;  2DJ2 A;  3CXG A;  2IMF A;  5LCZ A;  2GZP A;  4FIW A;  3IR4 A;  2WDU A;  3IRA A;  2QSI A;  5DVB A;  4F82 A;  1GTI A;  2YV7 A;  1GTB A;  4HEA 2;  2LJK A;  3KGK A;  1TRV A;  2VL2 C;  1U3I A;  5DQS A;  3DRN A;  2NPB A;  3A2X A;  1PX6 A;  2R37 A;  4PUF C;  1A8L A;  3PGT A;  4WF4 A;  3TCO A;  1URM A;  2H71 A;  2O89 A;  2V32 A;  4WBR D;  2Z9S A;  4I97 A;  1T3B A;  4HQZ A;  1EOG A;  4XS4 B;  2RUF A;  2LS5 A;  4MMM A;  4ISD A;  2NVL A;  1MDI A;  1PX7 A;  4QQ7 A;  3LEF A;  4NPB A;  1BG5 A;  4ZIJ A;  1R4W A;  2LRT A;  3C71 A;  4GTU A;  1X0R A;  1A0F A;  4V1A g;  1T00 A;  3DYR A;  2NDO A;  5C04 A;  2VL2 A;  5DAL A;  1GNW A;  2KP2 A;  2C8U A;  2MMN A;  5AN1 A;  3DKS A;  4L5O A;  3BBY A;  6GSS A;  2LJR A;  3DXB A;  2L4C A;  2F8A A;  3LJR A;  4POL A;  3HHV A;  2P5Q A;  3VWV A;  5JWQ B;  4PNF A;  2CVB A;  5HFI A;  1JZW A;  2VM2 A;  2H0G A;  2M46 A;  4JR4 A;  4L0W A;  1EV9 A;  2IMI A;  1CQH A;  2N5F A;  2WCI A;  2N5A A;  4YQM A;  4GST A;  4X1U A;  1M9B A;  5IMD A;  2DMM A;  1XVQ A;  3HZ4 A;  4OCF A;  1ERT A;  2YOI A;  5CAX A;  1XXU A;  1TK5 B;  1SKS B;  1G7E A;  2GQM A;  1YKC A;  1SJZ A;  1XW6 A;  17GS A;  4NHZ A;  1TJD A;  1R5P A;  5INY A;  2X8G A;  3Q19 A;  3CRU A;  3C1S A;  4ML1 A;  5ECS A;  1EOH A;  3ERG A;  2VCZ A;  5D9X A;  3KJY A;  3M8N A;  4F0C A;  2P0G A;  3FW2 A;  4BPY A;  1JLV A;  1O6J A;  4HUA A;  2V2G A;  1XW9 A;  2VD0 A;  5LD0 A;  4PUR A;  4TN8 A;  4EL1 A;  4JBB A;  1K0A A;  2C0D A;  2WZ9 A;  5B8A A;  6GSV A;  1Y25 A;  2H8L A;  4D73 A;  1V58 A;  3L9S A;  18GS A;  2YWN A;  4AGS A;  3G9B A;  5B6N A;  3APO A;  4KA0 A;  5ECP B;  2H1B A;  6GSY A;  4EE0 A;  4OO4 A;  5ELA A;  1DSB A;  2IFQ A;  2C0E A;  2GT6 A;  2GT5 A;  5JCG A;  4N30 A;  2I81 A;  3ME7 A;  2A2R A;  2FLS A;  1XW5 A;  1U88 A;  1XBS A;  3UBK A;  1OC8 A;  1T8E B;  1GL8 A;  3LFL A;  4K7N A;  1AUC A;  2CVK A;  5CRG A;  2DJ0 A;  4IN0 A;  1EZK A;  4TKY A;  3FEU A;  1T4Y A;  4NXI A;  2NTO A;  4TVE A;  4MDC A;  4KND A;  3C7M A;  2C0G A;  3IOS A;  22GS A;  3MNG A;  4ACS A;  1O73 A;  2DBC A;  2E2M A;  1EGR A;  1U3A A;  4WET A;  1EEM A;  1SJ6 A;  3ERW A;  5G5F A;  1FO5 A;  1FG4 A;  5J9C A;  2YWI A;  2PER A;  3TKS C;  1SK0 A;  2HRN A;  2TRX A;  5JCW A;  4ECB A;  2LKU A;  3FR9 A;  4G9H A;  8GSS A;  1DE1 A;  2VOC A;  2JZS A;  3KH9 A;  2KHP A;  2KP1 A;  4TR4 A;  5IPH A;  4MJA A;  2VL3 A;  3KMO A;  3CMI A;  2HT9 A;  3QAG A;  1WP0 A;  1N2A A;  1M2A A;  6GSX A;  3IDV A;  1ZOF A;  4K1F A;  1OC9 A;  1NW2 A;  3IAS 2;  1V98 A;  1ERV A;  5B7C A;  4IJI A;  3FR3 A;  1HD2 A;  3EU4 A;  4I2U A;  2L4Q A;  1FW1 A;  4RI7 A;  1TP9 A;  5J41 A;  4ZL9 A;  2KLX A;  2F51 A;  2FD3 A;  3BOA A;  4D73 B;  3E0U A;  4PGT A;  1ZYE A;  1AIU A;  3CSJ A;  2JL4 A;  1NM3 A;  1J9B A;  2C80 A;  4J56 E;  2LV3 A;  1TU7 A;  1YQ1 A;  3M1G A;  2VAF A;  3GL5 A;  1B9X C;  5CRW A;  4V2L A;  5DJM A;  4EC0 A;  1HNC A;  1GSU A;  3IK9 A;  5HR0 A;  4HJM A;  1X5D A;  2H30 A;  4MPF A;  5G5E A;  3W8S A;  1TI3 A;  2LJA A;  1Z3E A;  4ZB8 A;  2M72 A;  1YY7 A;  3KEB A;  3PR8 A;  2DIY A;  1DBY A;  3ZZX A;  1G0T A;  1TK0 B;  1Z6M A;  3GYK A;  4ID0 A;  2E7P A;  1PA3 A;  3RPP A;  3QAW A;  1BQ7 A;  2G0F A;  1IYI A;  3LXZ A;  4XHM A;  13GS A;  1MDK A;  2V6K A;  4EVM A;  1ZZY A;  2O8V B;  5G31 A;  3IHQ A;  2IJY A;  2AUV A;  4H86 A;  4WF5 A;  3LSZ A;  3HA9 A;  2VL9 A;  2O87 A;  2VUP A;  2YJH A;  5A4V A;  2BMX A;  2FWG A;  3FZA A;  5G1K A;  2LQO A;  3GN3 A;  4OO5 A;  2B7J A;  2B7K A;  2GDR A;  3SBC A;  3M3M A;  3N9J A; 
#chains in the Genus database with same CATH topology
 5KP4 A;  4LMV A;  4MJE A;  4ZIL A;  4MMX B;  10GS A;  3KE7 A;  1XPV A;  3QRD A;  1F9M A;  1TIJ A;  3EC3 A;  5ID2 A;  2C3T A;  2CZ2 A;  4KGI A;  5DAL B;  1O8X A;  2CT6 A;  4ECJ A;  1FOH A;  3G6E 3;  1IYY A;  2OOV A;  3HCZ A;  1G96 A;  3VI5 A;  1S3D A;  2GBW B;  3HZ8 A;  2Y73 A;  2ZDJ A;  4LL1 B;  4EIQ A;  3M8C A;  1BJX A;  5DDL A;  2VO4 A;  2QA4 3;  3LGC A;  1Q42 A;  5IO2 A;  4JRR A;  3RAZ A;  1OVN A;  4MMZ B;  1ERU A;  1EKM A;  5DJL A;  5FWG A;  1S3A A;  4XDV A;  4OD7 A;  5D93 A;  3US3 A;  2FWH A;  2B5Y A;  2GU1 A;  4TW5 A;  3PGB A;  5FW5 A;  5COH A;  4ULX A;  1RKY A;  3N9J A;  4MEI A;  1B9Y C;  1B8X A;  3HVX A;  3GRX A;  4KDY A;  4O5Q A;  4KT3 B;  4NV5 A;  1BNF A;  3KMN A;  3OW2 2;  4DKI A;  3DEX A;  3IE3 A;  3IPT A;  1T4Z A;  2OBI A;  3H8Q A;  1SIH A;  2DKI A;  4JE1 A;  1MEK A;  2YP6 A;  1U6T A;  4PEJ A;  1Q82 4;  4Z2T A;  1W4V A;  2ZNM A;  3GKM A;  4DSS B;  1X1X A;  2QEX 3;  4HI7 A;  5ECN B;  5BMU A;  3GTU B;  1T7P B;  2VD1 A;  1IV7 A;  1BED A;  2PVO C;  1FGR A;  2ES7 A;  3P7X A;  1GOU A;  1ZYQ B;  3EX9 A;  1Z6N A;  4WR5 A;  3RHC A;  2OQE C;  1W7C A;  1OHP A;  3EHC A;  4RNY A;  1Q40 A;  4L8O A;  2HZE B;  4N10 A;  4EKZ A;  1OYJ A;  2ZL8 A;  1UW1 A;  3GWR A;  1MOL A;  1JZR A;  3GZR A;  3GST A;  4K2D A;  1WMP A;  4HM2 B;  5D9T A;  2GEY A;  3H1N A;  4IT7 A;  4YAV A;  3LT9 A;  1AQZ A;  1O7G B;  4R1K A;  3D4A A;  4HSC X;  2RM6 A;  1YEP A;  3G8Z A;  2PU9 C;  1SYX A;  1GMP A;  4CDL A;  2CFD A;  4BWQ A;  1VQM 3;  2XH9 A;  2RBI A;  3LYP A;  3SOY A;  2FCH A;  1IYH A;  2XSO B;  2RSX A;  2XFT A;  1S5A A;  3K5T A;  2F99 A;  4FR9 A;  1GUM A;  1UCK A;  3EJV A;  2B24 B;  5G1L A;  4PQI A;  1E97 A;  1W89 A;  1I70 A;  5HGR A;  1OAZ A;  4MJB A;  5ELU A;  5CXO A;  5D81 A;  1ERW A;  2C4J A;  3GZB A;  4GQC A;  4RBN A;  4MZB A;  3URP A;  2AAD A;  3GKN A;  5IW9 A;  3HVS A;  2I3Y A;  3KCM A;  1BRI A;  2E2G A;  2OBK A;  4KH7 A;  2VCQ A;  2KF5 A;  2CFW A;  1VQ8 3;  2CWU A;  5BRT A;  2C3Q A;  4PUA A;  3I6A A;  1ROV A;  1H4O A;  3HY2 A;  3EMX A;  2BU4 A;  1SJW A;  2FWE A;  3I69 A;  2I9H A;  3UAR A;  5DBQ A;  4HZB B;  1LOY A;  3A2W A;  1GSS A;  2D1W A;  3LOR A;  1Z5Y E;  5ECM B;  2IPA A;  2GZZ A;  5CF1 A;  3DWV A;  4ZL8 A;  3NZN A;  3CMA 3;  2PPT A;  8RNT A;  4AJ7 A;  16GS A;  1RCL A;  3K8N A;  3P8W A;  1GSD A;  1M9G A;  2QGV A;  2IY2 A;  3MIX A;  3GH9 A;  3X42 A;  5RNT A;  1LU4 A;  3VI7 A;  2P09 A;  1SK2 A;  3EQQ B;  2FGX A;  3GX8 A;  1OGZ A;  2ON5 A;  1ZGX A;  4BIR A;  2YCD A;  3D4T A;  1CH0 A;  4FCM A;  5IMZ A;  2R2J A;  3ZRE A;  3PPU A;  1KWI A;  1FGM A;  2C11 A;  3LTB A;  3DD3 A;  3NV0 B;  3K9M C;  4GQF A;  1FVK A;  1GMQ A;  5IEP A;  2W9Q A;  2MBT A;  1D6Z A;  1VQK 3;  4FCJ A;  4ZBA A;  3BIR A;  4EV2 A;  5AII A;  5ECK B;  3FZ5 A;  1UCL A;  3CSI A;  3TKQ A;  1PGT A;  1XFL A;  1Y6E A;  3F3R A;  1AQV A;  2XSH B;  3UJM A;  2K0M A;  1VF1 A;  5JPP A;  3EBY A;  2FA8 A;  3KSE D;  1JHB A;  3F6D A;  2VCV A;  2W04 A;  5AIF A;  1DMM A;  2J8X B;  3CCS 3;  4YAP A;  3LH4 A;  1USB A;  3WA2 X;  2FUG 2;  3NQY A;  2PNC A;  4OK0 A;  1AVK A;  1TDI A;  1JLW A;  3U1W A;  5KP1 A;  3J7Y d;  5GST A;  3H79 A;  6GSU A;  1A2J A;  2CAI A;  3RGA A;  3D22 A;  3S28 A;  1W6G A;  3VUR A;  4IP1 A;  1PD2 1;  4YQV A;  1TW9 A;  5JWO B;  2WRT A;  1C7H A;  5IEO A;  4NAX A;  4HM0 B;  3TKS E;  3PH9 A;  5H5R A;  4HM5 B;  2GSP A;  4RI6 A;  3QFA C;  1RGF A;  2F4Y A;  4JZQ A;  3T8N A;  1B3S A;  4RQX A;  1SD8 A;  1VF4 A;  4POM A;  2H0I A;  4X2H A;  3A76 A;  1ULJ B;  1G02 A;  1YJ9 3;  1MD3 A;  3DZL A;  1K3Y A;  2N5B A;  1UDI I;  5DCH A;  4O5U A;  3F6F A;  2VIM A;  2IMJ A;  4XS6 A;  5CNW A;  2CX0 A;  3FSD A;  1PY3 A;  2CA8 A;  4ZB9 A;  4KDU A;  2PBJ A;  4WYK A;  2F3M A;  5STD A;  4LYL B;  1GOY A;  3K63 A;  4EO3 A;  3MPH A;  4RNZ A;  1GY5 A;  1PMT A;  4DVC A;  3ZIT A;  4MJC A;  1STF I;  3FG4 A;  1E6B A;  2GST A;  4KX4 A;  6GST A;  4PNG A;  1YVB I;  1DMN A;  1EV4 A;  3CSH A;  4R9K A;  1ASK A;  4L0U A;  1G7O A;  3V92 A;  2AV4 A;  1PU4 A;  2LNS A;  4MF7 A;  1GD4 A;  3UB1 A;  1GSQ A;  2EIR A;  4HQS A;  3J7Y k;  3WGE A;  2RM5 A;  4K7I A;  2X99 A;  1TFK A;  3FYG A;  3CU3 A;  3TKS A;  4KCA A;  1BAO A;  1A67 A;  4GSS A;  1LOX A;  2JZR A;  3HKR A;  4WXT A;  4OWY A;  1A0R P;  1DUG A;  2OTL 3;  1FAA A;  5AIX A;  2RFR A;  1F2E A;  3GIX A;  1N8R 4;  1M99 A;  4IBP A;  2OCT A;  4KSM A;  2JSZ A;  1RNB A;  3EB8 A;  4PQH A;  1O7M B;  5J5N A;  2GTU A;  3HVN A;  4KE3 A;  2L57 A;  4USS A;  4BTW A;  2V41 A;  2AHE A;  5AIG A;  3F7S A;  3QOU A;  2AYT A;  3ERF A;  5IG5 A;  3CD6 3;  3UMA A;  3APS A;  1M2B A;  4DSR A;  3PXM A;  1O85 A;  5ECQ B;  1Q9E A;  3IV4 A;  4MJD A;  5KN2 A;  4EIP A;  3AHS A;  1VQL 3;  3G7I A;  7RNT A;  2X64 A;  3LXT A;  2DIZ A;  4N0V A;  4N11 A;  2UX0 A;  2F86 B;  4IP6 A;  3W8J A;  4RNT A;  4XRA A;  1OKT A;  3NUV A;  2BMO B;  12GS A;  1G6Y A;  4K5S A;  2HSM A;  2ALB A;  4OFM A;  1RGG A;  2OTJ 3;  5HOH A;  4MF6 A;  2REM A;  2P5R A;  3FY7 A;  3KII A;  1VQO 3;  2GS3 A;  3TOU A;  1D6Y A;  2H76 A;  2LUS A;  3HJO A;  1O7W B;  2GGT A;  3JVC A;  1GP1 A;  3D4M A;  1A24 A;  3DM8 A;  1VQN 3;  3KSP A;  5CF2 A;  2F5W A;  1WNH A;  3DVW A;  1JNQ A;  1N9J A;  3APQ A;  4LA1 A;  1FGQ A;  3TRP A;  1PL2 A;  1LXE A;  3ZLP A;  1CQS A;  1FB0 A;  4EC6 A;  2JZT A;  1K3O A;  1GMR A;  4HYZ A;  5AEU B;  2ON7 A;  1TP6 A;  2HNL A;  3C1R A;  4PXO A;  1NB3 I;  1Q4J A;  1SK1 A;  1K41 A;  1JBT A;  5KN0 A;  1IT7 A;  3GUS A;  2BO9 B;  1J2B A;  2JSY A;  4XS4 A;  5ENU A;  3NQZ A;  2FHE A;  4L7K A;  3QK9 A;  4MCU A;  2I4A A;  3EUR A;  1XCC A;  3LTD A;  2B5X A;  1ABA A;  5AIS A;  1XOA A;  1FOV A;  2UZ8 A;  3QFB C;  3CCM 3;  5D83 A;  1FHE A;  1W01 A;  5ECR B;  1TTZ A;  4LEH A;  4AKZ A;  2DC5 A;  2BMQ B;  4HM6 B;  3G7Y A;  3HJP A;  2HSY A;  1LQM B;  2KF4 A;  2P05 A;  1BRG A;  3IAM 2;  1AQX A;  3FF2 A;  3LG6 A;  1QMA A;  2W0Q A;  4KDX A;  4NHW A;  4NMU A;  3CQF A;  4IHU A;  2OQE A;  5GAN D;  1IVX A;  4POB A;  4ZBD A;  4XCS A;  1SII A;  1GWC A;  1GUH A;  1X1W A;  3TJB A;  1DE2 A;  2CX3 A;  3G7J A;  1N8J A;  3EIN A;  4ECC A;  1AR0 A;  5ELJ A;  1Q98 A;  2JAC A;  3L0R A;  4EYC A;  1UC7 A;  2HRF A;  3PCS A;  4EUY A;  3TOT A;  3I43 A;  1Q40 B;  3D5G A;  1K9M 4;  1GH2 A;  1YVS A;  3MKI A;  5KN3 A;  1PFO A;  5EL8 A;  4IQ1 A;  4I8B A;  4AEQ A;  2JQ5 A;  1RW1 A;  4MLY A;  3FK8 A;  2E2T A;  5TGN A;  1STD A;  3ZTL A;  2JDI H;  2LRC A;  3VPT A;  2R5G A;  5EPF A;  4G0L A;  2RNT A;  4J5K A;  4L8E A;  3D0Z A;  1A2V A;  2X4A A;  1RRL A;  3PIN A;  3KXO A;  4L8P A;  3RHB A;  4KVH A;  2H74 A;  3SVA A;  1NB5 I;  4LGQ A;  4BU4 A;  3GSP A;  1RQM A;  2AAW A;  3IXR A;  3CTF A;  1Q81 4;  3BCK A;  1NWW A;  1C54 A;  4QL7 A;  2EIO A;  2IUK A;  3TJF A;  1ROA A;  3DGL A;  3A2V A;  3C73 A;  1XG8 A;  4G1M B;  4X0X A;  4IGJ A;  5CRE A;  4PQ1 A;  1BIR A;  3OWS A;  1MTC A;  1YEX A;  1PFP A;  2TRC P;  4CY6 A;  5KEJ A;  3ER7 A;  2BT3 A;  2I1U A;  1WPI A;  2ZCT A;  4FH8 A;  3IA1 A;  4GHO A;  2YZH A;  5B6M A;  4F2I A;  3JUM A;  1TKD B;  4GXZ A;  5D9W A;  3EPT A;  3HYP A;  3ZMK A;  2AJQ B;  2O3O A;  5ID2 B;  2M80 A;  1GSP A;  1VF3 A;  3WGD A;  5IOX A;  1OC9 B;  4N0Z A;  1W2B 2;  1LVN A;  1VQ6 3;  1SYR A;  2HRK A;  1WQL B;  1O8W A;  4MMY B;  1MWT A;  2BTO T;  3BD2 A;  3E9J B;  4KFE A;  3UJ1 A;  4AJ8 A;  5H5S A;  1J0F A;  4TR1 B;  3TKP A;  3Q90 A;  5F06 A;  5DAK B;  1H75 A;  8CHO A;  4XB5 A;  2CZ3 A;  3TRQ A;  4G19 A;  1SPU A;  2OAD A;  2O9U X;  3KD0 A;  1V74 A;  2W6J H;  4I5Q A;  5CK6 A;  4BL7 B;  4WBJ A;  3UAP A;  1WE0 A;  4YQU A;  4NHF A;  1BRN L;  1GSE A;  2L4V A;  3DGN A;  2CAQ A;  4K1V A;  2OE0 A;  1TXX A;  1CEW I;  1WJK A;  2K54 A;  20GS A;  1SD9 A;  1UCI A;  1HQO A;  4MZC A;  3RGR A;  2YZU A;  2CFL A;  3G4S 3;  2JU5 A;  4YKF A;  5F8B A;  2X8C A;  4O7H A;  3TGZ A;  4GSP A;  2INX A;  1YNV X;  4ZXG A;  1K8A 4;  1OAC A;  2QIY A;  3TJG A;  1UUV B;  2YN1 A;  1YIT 3;  1PKZ A;  1VQP 3;  2IL3 A;  3CME 3;  4GCI A;  1RNT A;  5J3R A;  3LWA A;  2IYJ A;  2CIU A;  3CNX A;  5AYR B;  2IA7 A;  5FT3 A;  1JV2 B;  1IDP A;  3HOH A;  1U8C B;  4IEL A;  2H1D A;  2FWF A;  1E3R A;  3ZFB A;  4JR6 A;  2GQK A;  2OE3 A;  3GHA A;  1AXD A;  3GZX B;  4G10 A;  3BB9 A;  3M9K A;  2IFQ B;  2KCD A;  5IO0 A;  1EP8 A;  4N6L A;  2B3S A;  3H3H A;  3FCS B;  5B8B A;  1GNE A;  5FHI A;  1GRX A;  4K0G A;  5KOX A;  1MWS A;  1K0C A;  1UCJ A;  1FYS A;  1YGE A;  1WMO A;  2OWP A;  5EEO A;  4K6X A;  4Q5N A;  3GKX A;  1BAN A;  4KB3 A;  2WB9 A;  4XTS A;  4IS0 A;  3RDE A;  2RUE A;  5CP1 A;  4FQU A;  1SEN A;  4ECI A;  1PQN A;  4O2H A;  1WMN A;  1JB5 A;  1Q86 4;  2K9F A;  4BVX A;  5IMA A;  4U13 A;  4CHS A;  1OKD A;  4BL7 A;  2OOV C;  5G30 A;  1W00 A;  1EGO A;  1TFO A;  2KXG A;  2FA4 A;  3TRX A;  2HSH A;  1LOV A;  3BNC A;  1Q7H A;  2P0M A;  2X8H A;  1ILO A;  2VLV A;  1K0B A;  3N8B A;  5DCG A;  3F9S A;  2YJ7 A;  2RGQ A;  2LYX A;  2XPD A;  3B4P A;  1LJR A;  4POK A;  3N5O A;  4GWR A;  3F8X A;  3DIE A;  2WFC A;  2MF7 A;  4KSO A;  1FW7 A;  3FGY A;  3HZP A;  1F3A A;  2OA7 A;  3B4O A;  1SKR B;  1BVI A;  5E4W A;  2HZE A;  1GUL A;  4OUQ A;  2CW9 A;  3NV0 A;  1EWX A;  4GF0 A;  1RLS A;  2UGI A;  2WOH A;  5F05 A;  4KW6 A;  1G6W A;  3IC8 A;  3I9V 2;  2ML6 A;  1AY7 A;  1GY7 A;  3DY5 A;  3LML A;  4XBX A;  1BRJ A;  1VQ9 3;  4TXO A;  2VCT A;  2R41 A;  4CDO A;  4I2T A;  4NV2 A;  3UBL A;  2DJK A;  2X49 A;  3L9V A;  2KUC A;  5M1A A;  1OC3 A;  4BL2 A;  4P3Y B;  2C0F A;  4BVY B;  2GEX A;  2YNX A;  3BU4 A;  4Z2R A;  3IJE B;  3UEM A;  3TJK A;  4V2M A;  1OF5 B;  3DML A;  2K6V A;  2PN8 A;  1RK4 A;  1FUT A;  3VK9 A;  4O32 A;  4F9Z A;  1KD1 4;  3CPO A;  4FYB A;  3BLZ A;  1MGW A;  4HOJ A;  3L78 A;  4XRD A;  3NBR A;  3NXJ A;  4GB5 A;  4BVY A;  3UVT A;  3HIG A;  2P0X A;  5IER A;  5ECI B;  2DSA A;  2R0P A;  5D73 A;  2F8F A;  3FR6 A;  1V9W A;  1OPY A;  2WGR A;  4WP5 A;  3FZ4 A;  4HS1 A;  1QVG 2;  4EV5 A;  1OE7 A;  3VF1 A;  1W5Z A;  4LMI A;  2MMO A;  1YI2 3;  3LQ7 A;  3FRC A;  2Z76 A;  1MD4 A;  4WFO A;  3HVV A;  1JRQ A;  5JWR B;  4AF2 A;  1BRS A;  2RII A;  4WKW A;  1BSA A;  5AI1 A;  1T1V A;  1I9D A;  3KP9 A;  3WOF B;  4HZ2 A;  1DVC A;  1QFN A;  3VFI A;  3KCH A;  3ED3 A;  1K0O A;  1DVD A;  3IHG A;  4KFD A;  1UN2 A;  1MWU A;  19GS A;  1GUK A;  3NHX A;  3V1W A;  1TU5 A;  1A8Y A;  2CHC A;  3WMD A;  1XWB A;  1ZMA A;  5IMC A;  3Q18 A;  4HVN A;  4KCE A;  1M1X B;  3BJ5 A;  1KBN A;  2KOK A;  3FHK A;  1AVL A;  5A4W A;  2WGO A;  3A5E A;  4O5R A;  2QA2 A;  3NX0 A;  4KUN A;  5H5Q A;  5EVH A;  4JED A;  4Q5F A;  1RN7 A;  4N6O B;  4HZ4 A;  1QAK A;  2XHF A;  3A3T A;  3AGO A;  1XWC A;  1FGT A;  1B4P A;  4MK3 A;  1MWR A;  2VM1 A;  2O7K A;  3SWL A;  1F6M C;  1T2I A;  2W9P A;  1HKX A;  2LST A;  5AIH A;  4DSS A;  2PUK C;  3SOA A;  1YJW 3;  3IC4 A;  2BHM A;  1RHL A;  2W2C A;  4LLR A;  4TR3 A;  3I0Y A;  4OVM A;  2D42 A;  1B48 A;  1ZX2 A;  1JZD A;  1B2U A;  3V99 A;  2R0G A;  1TUH A;  2H6Y A;  3EU3 A;  1IU7 A;  5E59 A;  1J08 A;  2LNT A;  2HMK B;  3WT2 A;  2MMA A;  3H4K A;  3GL3 A;  5IIZ A;  1OF5 A;  2CC3 A;  4HM7 B;  2F9S A;  1IQY A;  3AY8 A;  3GNJ A;  3F0I A;  5CRD A;  4XS1 A;  1NO3 A;  2K18 A;  3DGY A;  4DEJ A;  3JUQ A;  2ZHX B;  2M7O A;  2L1S A;  2LQQ A;  3HII A;  1AAZ A;  1LNI A;  1X1U A;  1X1Y A;  3JUN A;  4J2F A;  5D8I A;  2FGT A;  1ON4 A;  3ZG0 A;  1BYE A;  1JN5 B;  3DUK A;  1E2Y A;  1IVU A;  1RGC A;  5IM9 A;  2DJJ A;  1SU9 A;  1UGH I;  2WJU A;  3CRT A;  3QMX A;  1N5P A;  3Q1C A;  3DXO A;  3TKR A;  4F03 A;  3FH1 A;  3DGQ A;  3P90 A;  3TDG A;  1OGX A;  1F3B A;  1YDK A;  2B1L A;  2LTK A;  4IW9 A;  1W2Z A;  4K0N A;  5DQY A;  1KTE A;  4JRF A;  2BMR B;  5D96 A;  2HZF A;  3Q6O A;  3MHE A;  1BNS A;  1FB6 A;  1OHO A;  1BRK A;  1HYU A;  2R4V A;  3D79 A;  1XWG A;  4V2N A;  3SYU A;  3N54 B;  2VCX A;  3CC7 3;  2BJX A;  2XPE A;  3WT1 A;  2OE1 A;  4I6X A;  5IOW A;  2YWO A;  1KNG A;  2C4B A;  4BVX B;  1GLP A;  3QR6 A;  3KKG A;  2ML5 A;  1JFU A;  2R3X A;  1LQG C;  2KF6 A;  5GZZ B;  4TXV A;  2H1A A;  3KIJ A;  1JKG A;  5FGO A;  3T8U A;  2CWT A;  2HLS A;  1WTH A;  3VPQ A;  3GX0 A;  5C00 A;  1O81 A;  5KP3 A;  3FZ9 A;  1O7P B;  2C1Y A;  2H66 A;  4O92 A;  4Q5Q A;  1I0X A;  1AC1 A;  2FY6 A;  3GUR A;  4BTX A;  1VGL A;  5F0G A;  3IK7 A;  5M18 A;  1FVJ A;  1TRU A;  4LSO A;  3UOM A;  1RGK A;  3G0K A;  1BGS A;  1QAF A;  3EYT A;  3JCM L;  1SL0 B;  3KM6 A;  1R26 A;  4HJ2 A;  1Z7R A;  1X5E A;  1WRY A;  1YGW A;  3SXX A;  1K0M A;  1LBK A;  4EBG A;  2H1G A;  4K61 A;  1GTA A;  2YFI B;  4K1U A;  3A5W A;  5G2G A;  2E0Q A;  2CFG A;  3GZY B;  1DE3 A;  1JKG B;  5GSP A;  3EWL A;  7GSS A;  3FLJ A;  3X3Z A;  3ME8 A;  5GSS A;  3OWU A;  2HXK A;  3MWH A;  3C8E A;  1BSE A;  1R4Y A;  2H6X A;  2DML A;  3HD5 A;  5I97 A;  1GY6 A;  2KRT A;  3FZW A;  4N6M A;  4MPG A;  2XBI A;  5J4U A;  3QAV A;  1PN0 A;  3DVX A;  3MDK A;  1TTO A;  3WOE B;  5CO3 A;  3D9R A;  3OWY A;  3R2Q A;  5L71 A;  2L59 A;  1RTU A;  5LC6 A;  1ULI B;  4MAB A;  6STD A;  2H72 A;  2E2V A;  3CYN A;  1BSB A;  3ZYW A;  2YWM A;  1M3J A;  2HI7 A;  3CCL 3;  4V1A p;  3H51 A;  1XIY A;  2HFD A;  4ZB6 A;  2VLU A;  3F14 A;  1RGA A;  2IMK A;  1S3C A;  4TR0 A;  3KTL A;  1IT8 A;  1X9M B;  1QGV A;  2GBX B;  2HE3 A;  3CC4 3;  1QK8 A;  5HR3 A;  4PX1 A;  2D2Z A;  1VRS D;  1B20 A;  3AHW A;  1UVZ A;  3M0F A;  1BU4 A;  2H6Z A;  1YF0 A;  2PWJ A;  1V2A A;  1ZCP A;  3CCU 3;  2L6C A;  2WGQ A;  3N9H A;  2PZV A;  4EDY A;  2B1K A;  1ISK A;  5DRV A;  3D3L A;  4N6T A;  1XWK A;  5HR1 A;  4TOP A;  1US1 A;  3S67 A;  1PN9 A;  4ZBB A;  5HR2 A;  1PKW A;  4IKH A;  2GLR A;  2GU3 A;  1LOW A;  5HFK A;  1RGE A;  2XR8 B;  4K9Z A;  3UNL A;  1X5C A;  1I5G A;  2XFS A;  2CV4 A;  4ZL7 A;  3O6T A;  2J9H A;  4GLT A;  3KP8 A;  4HU9 A;  1KEB A;  3L0H A;  3GMF A;  1VQ4 3;  1S3R A;  3L9U A;  1ST9 A;  4BTY A;  1Y4K A;  2XBQ A;  2DLX A;  2OAC A;  4IJ3 A;  1XWA A;  4EXJ A;  2MMZ A;  5HQP A;  2XC2 A;  4IPB A;  3IBH A;  3F4R A;  1N5H A;  4IVF A;  4HKV B;  3AGN A;  5D82 A;  2GSS A;  4RQR A;  4N6N B;  2W03 A;  5HFG A;  4ICY A;  3ZVJ A;  1TU8 A;  4J9A A;  3FMW A;  3GA4 A;  1YKA A;  2H75 A;  3FG3 A;  1BOX A;  2CVD A;  2L5L A;  2V1M A;  4STD A;  2YPM A;  3GRD A;  4DSQ A;  4XIH A;  1JB4 A;  2AAE A;  3QDN A;  2CQ9 A;  4GRF A;  1BUQ A;  2C10 A;  5KN1 A;  4X43 A;  5M19 A;  2IME A;  3MWZ A;  1AQW A;  1WIK A;  2QC7 A;  3ZVJ D;  3GKK A;  1M7T A;  4K5R A;  1RSN A;  2L5O A;  2YX9 A;  1X9S B;  2H0H A;  1DYU A;  4X4J A;  3D21 A;  2F56 A;  2Z77 A;  1QXH A;  2FXT A;  3HXS A;  3J7Y b;  1A23 A;  2OJL A;  1Z7P A;  1HNB A;  1ZO2 A;  1C72 A;  3I56 3;  2IIY A;  3BNE A;  4MA9 A;  3WD6 A;  1VF2 A;  4OFN A;  2H70 A;  4TX4 A;  1A2L A;  2YAN A;  1R7H A;  3F8H A;  3UVH A;  1RMS A;  3RBT A;  5D9V A;  3LYG A;  5CLK A;  2QKE A;  5IF6 A;  3NM7 A;  3WA3 A;  1W6Y A;  1U87 A;  4WR4 A;  4H3U A;  3IPZ A;  3KH7 A;  2OKA A;  3H93 A;  1CQG A;  1HNA A;  4YH2 A;  1BAY A;  3NM2 A;  4GSN A;  2KAA A;  1Z9H A;  4ILF A;  3FKF A;  2TIR A;  5A4U A;  2C3N A;  3D5I A;  3K0Z A;  3WR2 A;  1GTU A;  1B2Z A;  3VLN A;  5AIV A;  2K8V A;  1TRP A;  3EMP A;  1NHY A;  2AB6 A;  5F07 A;  2CFK A;  5LNK e;  3KFQ C;  4TXO B;  2IWT A;  2RLI A;  3TJJ A;  3MYT A;  3GV1 A;  1PSQ A;  3U6V A;  2Q07 A;  1UGI A;  4Z7X A;  3E3E A;  2CWV A;  9RNT A;  3KTB A;  4EDZ A;  4K90 B;  4RZM A;  2L6D A;  2A2S A;  3UL3 A;  1QMV A;  3CNM A;  5IMV A;  3ZG5 A;  5ABR A;  2MZC A;  3KZQ A;  4J57 E;  1EEJ A;  1GS3 A;  3VWU A;  5KOW A;  3ZFL A;  2P38 A;  2FNO A;  3AMO A;  5J9B A;  4FYU A;  1K3L A;  3GTU A;  4MP4 A;  4PTS A;  1IK3 A;  1CYV A;  4E8H A;  3S9F A;  3FKA A;  3D6I A;  2GZY A;  1AW9 A;  2MYG A;  2V6O A;  1TRW A;  1BNG A;  4WWU C;  3TUE A;  3LYK A;  9GSS A;  2LEG A;  3IMA B;  2MC8 A;  4JU5 A;  1B2S A;  3ZML A;  2A2P A;  3F3Q A;  3VWX A;  1FUS A;  1ZL9 A;  1HZ1 A;  3OR5 A;  1XZO A;  5IMF A;  1BRH A;  1SKW B;  2J23 A;  2HOH A;  3B7C A;  1V57 A;  4K8M A;  2GQL A;  5ELG A;  3ZRD A;  1YZX A;  4CY8 A;  3LT8 A;  4CW9 A;  1GSF A;  2JAD A;  1E3V A;  3QCP A;  4LL4 B;  4AJ6 A;  1PRX A;  3Q2P A;  1OCV A;  4L5L A;  4ML6 A;  4OMV A;  1ML6 A;  1DET A;  1THO A;  1WWJ A;  1WOU A;  1UA5 A;  5IG3 A;  4OFT A;  4J5G A;  1SL1 B;  3A5I A;  1XVW A;  3I55 3;  1THX A;  1N8Q A;  5BXQ A;  2STD A;  3F8U A;  4FYC A;  4TRX A;  2PVQ A;  4HU7 A;  2WS2 A;  2DJ3 A;  3PS8 A;  2XGL A;  2H73 A;  1B4Q A;  1IV9 A;  4WEY A;  3FF0 A;  1Z1S A;  11GS A;  3QD9 A;  5ECH B;  1MDJ A;  2CX4 A;  2GSR A;  3F63 A;  1GYB A;  4QL9 A;  2O85 A;  4HDE A;  4K7O A;  1FGO A;  1EUI C;  3GSS A;  4KAE A;  1IQ8 A;  3LTA A;  3F4S A;  2A4V A;  4FO5 A;  4K2X A;  2DJ1 A;  3NOF A;  4MZW A;  1K0N A;  3F9U A;  4OCE A;  1YJ6 A;  3GFK A;  4BA7 A;  1NHO A;  3L4N A;  3W6G A;  4FMD A;  3GAX A;  3X3X A;  3WYW A;  3ZIJ A;  4EF0 A;  1A2K A;  1ZGN A;  2I9W A;  2WUL A;  3SLU A;  1M3I A;  5BVB A;  3RNT A;  1ZYP A;  2ZUP A;  2IUJ A;  2VLT A;  5ECO B;  3TB2 A;  3LZA A;  1B2M A;  2B6M A;  1FUW A;  5CYY A;  3MAK A;  2PGT A;  1RJO A;  2HMJ B;  1GLQ A;  2IN3 A;  3X3Y A;  3F4T A;  1RDS A;  3U5R E;  1JZO A;  1RGH A;  1KQS 2;  2B5E A;  5ECL B;  3D5J A;  1D6U A;  3X40 A;  3QPM A;  1TOF A;  4G2E A;  4BIK A;  6RNT A;  4EXR A;  2HYX A;  4RUV A;  2V1L A;  4WYK B;  3RPN A;  4TR1 A;  2HMO B;  2H01 A;  5IPG A;  2NBS A;  3V98 A;  4MF5 A;  3ROB A;  2GVP A;  4IQA A;  3CCJ 3;  1TK8 B;  5BU4 A;  1TI1 A;  2MBS A;  2R0C A;  1SAR A;  2W56 B;  3ISO A;  3WHO A;  1YF1 A;  14GS A;  4E8E A;  1QQ2 A;  2Z6B A;  1QJG A;  4O3V A;  4Q5R A;  4BWS A;  1OHS A;  5GAP D;  1OUN A;  3P2A A;  3ZL5 A;  2PMT A;  2RCD A;  1QVF 2;  2R4I A;  2ZA4 A;  1BUJ A;  3Q74 A;  2CK3 H;  2K8S A;  5EY6 A;  1O7U A;  1R4C A;  4GL6 A;  2YV9 A;  4HM3 B;  3SX1 A;  4NWY A;  1M0U A;  2LRN A;  4F0B A;  2P31 A;  5EVO A;  5AGY A;  3O8Y A;  4FMA A;  2VCW A;  5CRH A;  1YHQ 3;  2CH9 A;  4G0I A;  2B1X B;  2WOF A;  4LMW A;  3NIV A;  3EVI A;  1XOB A;  1DMQ A;  3MG1 A;  3EN8 A;  3MG3 A;  4HZ9 B;  1NSW A;  2H19 A;  1UUW B;  3DGM A;  1SJI A;  3GH6 A;  1V40 A;  4Z2U A;  3RDW A;  2R6K A;  1W6C A;  3CCV 3;  3CBU A;  5DAK A;  2EIQ A;  3HJM A;  3WGX A;  1M2D A;  4LZI A;  3O76 A;  1ACV A;  1K73 4;  5IQY A;  3M9J A;  1WMJ A;  1MNL A;  1QUW A;  3BCI A;  2G2Q A;  4MH2 A;  2Z7A A;  4HM4 B;  1A2M A;  4IIA A;  1SL2 B;  1PL1 A;  2GSQ A;  5G2Z A;  6GSW A;  3ZIV A;  3MSZ A;  1BX9 A;  5IG0 A;  1EP7 A;  3VWW A;  1PYL A;  1R5A A;  1X9W B;  2EC4 A;  1VZZ A;  1UI8 A;  2IMD A;  2A4H A;  4MH3 A;  3CTG A;  1F37 A;  1M9A A;  3UIW A;  3EE2 A;  3O3T A;  5JCU A;  3HDC A;  5A5K A;  1TRS A;  1A90 A;  1OE8 A;  4HJL B;  4XBY A;  1GSY A;  1JN5 A;  1K0D A;  2DJ2 A;  3CXG A;  2CX1 A;  2IMF A;  5LCZ A;  2GZP A;  4I4K A;  4FIW A;  3PYJ A;  3CXC 2;  3IR4 A;  1BNJ A;  2WDU A;  1EQK A;  3OX9 A;  3IRA A;  5BIR A;  2QSI A;  5DVB A;  1K28 A;  5LC7 A;  4F82 A;  4JF8 A;  4HAA A;  1I8V A;  3ECF A;  1GTI A;  2YV7 A;  1GTB A;  1UUG B;  4HEA 2;  2LJK A;  3KGK A;  1TRV A;  2VL2 C;  4AKY A;  3DH2 A;  1U3I A;  5DQS A;  3DRN A;  1I2E A;  2NPB A;  3A2X A;  1PX6 A;  2R37 A;  4PUF C;  4HM1 B;  2UUG C;  1A8L A;  1RN1 A;  3PGT A;  4WF4 A;  4XDW A;  4ZM8 A;  3TCO A;  3LTC A;  1URM A;  2CG0 A;  4KF9 A;  2H71 A;  2O89 A;  2V32 A;  4WBR D;  2Z9S A;  2BNG A;  2YFL B;  4I97 A;  1T3B A;  4HQZ A;  1EOG A;  4XS4 B;  2RUF A;  2LS5 A;  4MMM A;  4ISD A;  2XGN A;  1BNE A;  3HK4 A;  3MSO A;  2NVL A;  1MDI A;  1PX7 A;  4QQ7 A;  3LEF A;  3CPW 2;  4NPB A;  1BG5 A;  4ZIJ A;  1R4W A;  2LRT A;  3C71 A;  3MG2 A;  4GTU A;  1X0R A;  3UL6 A;  1A0F A;  4V1A g;  1T00 A;  3DYR A;  2NDO A;  4HBR A;  5C04 A;  2VL2 A;  1B27 A;  5DAL A;  1GNW A;  3LW9 A;  2KP2 A;  3STD A;  1HU9 A;  2C8U A;  3S27 A;  2MMN A;  5AN1 A;  3DKS A;  4L5O A;  4MNN A;  1LRA A;  3BBY A;  6GSS A;  2F98 A;  2LJR A;  4R4K A;  1O7H B;  1T2H A;  3DXB A;  2L4C A;  2F8A A;  3LJR A;  4POL A;  3HHV A;  2P5Q A;  1Q7Y 4;  3VWV A;  1RN4 A;  2BIR A;  3EF8 A;  5JWQ B;  4PNF A;  4H61 A;  2KF3 A;  4BL3 A;  3WOD G;  2CVB A;  2K3D A;  5HFI A;  1JZW A;  3F7X A;  2VM2 A;  2HML B;  2H0G A;  4J8T A;  2M46 A;  3AMO B;  1EV9 A;  2N5F A;  2IMI A;  1CQH A;  4JR4 A;  2WCI A;  2N5A A;  4L0W A;  1RGL A;  4GST A;  4YQM A;  4X1U A;  1I2G A;  1M9B A;  5IMD A;  4YKG A;  2QGU A;  1I2F A;  1U5O A;  4FCZ A;  2DMM A;  1XVQ A;  3HZ4 A;  4OCF A;  2SBL A;  1ERT A;  3VGN A;  2YOI A;  2A15 A;  5CAX A;  3KZT A;  3FG1 A;  1XXU A;  1TK5 B;  1SKS B;  1G7E A;  2XF3 A;  3CCQ 3;  4CPK A;  1BSC A;  5IG4 A;  2GQM A;  5JBS A;  2F5M A;  1YKC A;  2HMM B;  1SJZ A;  1XW6 A;  17GS A;  4NHZ A;  1EA2 A;  1TJD A;  1R5P A;  1A2P A;  5INY A;  1I0V A;  1KC8 4;  2X8G A;  3Q19 A;  3CRU A;  3DGO A;  3C1S A;  4ML1 A;  1GD3 A;  1VQ7 3;  5A0O B;  5ECS A;  4CCV A;  1EOH A;  1YJN 3;  3ERG A;  2VCZ A;  5D9X A;  4QWT A;  3KJY A;  3OV4 A;  3M8N A;  4F0C A;  3DMC A;  2P0G A;  2DKH A;  1BNI A;  1F8N A;  1MGR A;  3X41 A;  1B2X A;  3E99 A;  3FW2 A;  1W02 A;  4BPY A;  1JLV A;  1O6J A;  4HUA A;  2V2G A;  1XW9 A;  1IVV A;  3K7C A;  2VD0 A;  5LD0 A;  3SED A;  4PUR A;  4R80 A;  4TN8 A;  3LOY A;  1JBS A;  4EL1 A;  3S5C A;  4Q53 A;  4JBB A;  1K0A A;  2C0D A;  2WZ9 A;  5DRE A;  4EW5 A;  6GSP A;  5B8A A;  2E2U A;  6GSV A;  1EG9 B;  1NDO B;  1Y25 A;  2H8L A;  4D73 A;  1V58 A;  3L9S A;  3LXU X;  18GS A;  2YWN A;  3CCR 3;  2CKF B;  4AGS A;  3G9B A;  2QA1 A;  5B6N A;  3APO A;  1IQX A;  4KA0 A;  1L5G B;  5ECP B;  1T5Y A;  2W56 A;  2Y74 A;  2H1B A;  6GSY A;  1N9E A;  4EE0 A;  4OO4 A;  4XBT A;  5ELA A;  1DSB A;  2IFQ A;  2CG1 A;  2C0E A;  2GT6 A;  1BNR A;  2GT5 A;  3HX8 A;  5JCG A;  4N30 A;  2I81 A;  3ME7 A;  5AEW B;  7GSP A;  1O7N B;  2A2R A;  3KN4 A;  1XW5 A;  2FLS A;  1NNV A;  4KFF A;  1U88 A;  1XBS A;  3UBK A;  2XRX B;  1KSI A;  3Q3F A;  1OC8 A;  1T8E B;  1GL8 A;  4HM8 B;  1JBR A;  3LFL A;  3G71 3;  4KZ1 A;  1SQW A;  4K7N A;  1AUC A;  4N3V A;  2CVK A;  1VQ5 3;  5CRG A;  2DJ0 A;  4IN0 A;  1S72 3;  1EZK A;  3CC2 3;  3FEU A;  4TKY A;  2GXF A;  1M1K 4;  1T4Y A;  1ZYN A;  2NTO A;  4NXI A;  3BNB A;  4TVE A;  4MDC A;  4KND A;  3C7M A;  7STD A;  2C0G A;  3IOS A;  22GS A;  3PCR A;  3MNG A;  4ACS A;  1O73 A;  1W4N A;  2DBC A;  2E2M A;  2FNQ A;  1EGR A;  1U3A A;  4WET A;  1EEM A;  1SJ6 A;  1QAL A;  3ERW A;  5G5F A;  1FO5 A;  3EN1 B;  1FG4 A;  5J9C A;  1YIJ 3;  1NU3 A;  2YWI A;  2PER A;  3TKS C;  1SK0 A;  4HOH A;  1CYU A;  2HRN A;  2TRX A;  5JCW A;  4ECB A;  2LKU A;  3FR9 A;  4G9H A;  8GSS A;  1DE1 A;  5IEN A;  2VOC A;  2JZS A;  3KH9 A;  2KHP A;  2KP1 A;  4TR4 A;  5IPH A;  4MJA A;  2VL3 A;  1M90 4;  3KMO A;  3CMI A;  4A5P A;  4XM4 A;  2HT9 A;  3QAG A;  3NBB A;  2WO0 A;  3ALA A;  1WP0 A;  1N2A A;  1M2A A;  6GSX A;  3IDV A;  1ZOF A;  4K1F A;  1OC9 A;  1NW2 A;  3IAS 2;  1V98 A;  1ERV A;  5JPU A;  1FZU A;  3R3E A;  5B7C A;  3JUO A;  4IJI A;  4NRE A;  4O02 B;  3FR3 A;  4FMB A;  1HD2 A;  3EU4 A;  4I2U A;  2L4Q A;  1FW1 A;  3NBJ A;  3PZW A;  4RI7 A;  1OH0 A;  2LQV A;  1TP9 A;  5J41 A;  4ZL9 A;  1BSD A;  2KLX A;  1UI7 A;  3EE1 A;  2F51 A;  2FD3 A;  3BOA A;  4D73 B;  3E0U A;  4PGT A;  3B8L A;  1AIU A;  1ZYE A;  3ZFZ A;  3F40 A;  4N6U A;  1TRQ A;  1ZS7 A;  3CSJ A;  2JL4 A;  1NM3 A;  1J9B A;  5AYS C;  1AV4 A;  2C80 A;  4WHA A;  4J56 E;  2LV3 A;  1TU7 A;  1YQ1 A;  3M1G A;  2VAF A;  3GL5 A;  3JUP A;  3EBT A;  1FA3 A;  1B9X C;  5CRW A;  1NJI 4;  2YFJ B;  4V2L A;  5DJM A;  4EC0 A;  1HNC A;  1GSU A;  3IK9 A;  5HR0 A;  4HJM A;  3BND A;  1X5D A;  2H30 A;  4MPF A;  5G5E A;  3G16 A;  2SAR A;  3WDG B;  1TI3 A;  2LJA A;  1Z3E A;  3W8S A;  4ZB8 A;  4O8S A;  3U97 A;  2M72 A;  1YY7 A;  3KEB A;  3PR8 A;  2DIY A;  3CCE 3;  1DBY A;  4R9L A;  3ZZX A;  3OXA A;  3T0U A;  1G0T A;  1RCK A;  1GOV A;  1TK0 B;  1Z6M A;  2HMN B;  4N6V 0;  3GYK A;  4ID0 A;  1IVW A;  2E7P A;  1PA3 A;  3UL5 A;  1B21 A;  3RPP A;  1HYF A;  3QAW A;  1BQ7 A;  2G0F A;  1JJ2 2;  1IYI A;  3LXZ A;  4XHM A;  4ORL A;  3EC9 A;  5EQL A;  1I3I A;  13GS A;  1MDK A;  2V6K A;  4EVM A;  4G0K A;  1ZZY A;  3VSY A;  2O8V B;  5G31 A;  3IHQ A;  2IJY A;  2AUV A;  1JB2 A;  4H86 A;  3LSZ A;  4WF5 A;  4CJN A;  2XEP A;  3HA9 A;  2VL9 A;  2O87 A;  2VUP A;  2YJH A;  2HRA A;  5A4V A;  2BMX A;  2FWG A;  1I3F A;  3FZA A;  5G1K A;  2LQO A;  1LNH A;  3S29 A;  3HI7 A;  3GN3 A;  1RRH A;  2B7J A;  4OO5 A;  2B7K A;  4FMC A;  2GDR A;  3MYD A;  3SBC A;  4X2O A;  3M3M A;  1VQQ A; 
#chains in the Genus database with same CATH homology
 4LMV A;  4MJE A;  4ZIL A;  10GS A;  1XPV A;  1F9M A;  3EC3 A;  5ID2 A;  2C3T A;  2CZ2 A;  4KGI A;  5DAL B;  1O8X A;  2CT6 A;  4ECJ A;  1FOH A;  3HCZ A;  3VI5 A;  1S3D A;  3HZ8 A;  4LL1 B;  4EIQ A;  1BJX A;  5DDL A;  2VO4 A;  3LGC A;  5IO2 A;  4JRR A;  3RAZ A;  1OVN A;  1ERU A;  5DJL A;  5FWG A;  1S3A A;  4OD7 A;  5D93 A;  3US3 A;  2FWH A;  2B5Y A;  5COH A;  4TW5 A;  4ULX A;  1B9Y C;  1B8X A;  3HVX A;  3GRX A;  4KDY A;  4O5Q A;  4NV5 A;  3KMN A;  3DEX A;  3IE3 A;  1T4Z A;  2OBI A;  3H8Q A;  2DKI A;  4JE1 A;  1MEK A;  2YP6 A;  1U6T A;  4Z2T A;  1W4V A;  2ZNM A;  3GKM A;  4DSS B;  4HI7 A;  5ECN B;  5BMU A;  3GTU B;  1T7P B;  2VD1 A;  1BED A;  2PVO C;  2ES7 A;  3P7X A;  1ZYQ B;  1Z6N A;  4WR5 A;  3RHC A;  2HZE B;  4N10 A;  4EKZ A;  1OYJ A;  1JZR A;  3GST A;  4K2D A;  5D9T A;  3H1N A;  4YAV A;  2RM6 A;  1YEP A;  2PU9 C;  1SYX A;  4BWQ A;  3LYP A;  2FCH A;  1IYH A;  1GUM A;  5G1L A;  4PQI A;  1W89 A;  1OAZ A;  4MJB A;  1ERW A;  2C4J A;  4GQC A;  4MZB A;  3GKN A;  3HVS A;  2I3Y A;  3KCM A;  2E2G A;  2OBK A;  4KH7 A;  2VCQ A;  5BRT A;  2C3Q A;  4PUA A;  3I6A A;  1H4O A;  3HY2 A;  3EMX A;  2FWE A;  3I69 A;  2I9H A;  3UAR A;  5DBQ A;  3A2W A;  1GSS A;  3LOR A;  1Z5Y E;  5ECM B;  2IPA A;  2GZZ A;  3DWV A;  4ZL8 A;  3NZN A;  2PPT A;  4AJ7 A;  16GS A;  3K8N A;  3P8W A;  1GSD A;  2QGV A;  2IY2 A;  3MIX A;  3GH9 A;  1LU4 A;  3VI7 A;  1SK2 A;  2FGX A;  3GX8 A;  2ON5 A;  2YCD A;  3D4T A;  5IMZ A;  2R2J A;  3ZRE A;  3PPU A;  3DD3 A;  4GQF A;  1FVK A;  2MBT A;  4ZBA A;  5ECK B;  3FZ5 A;  3CSI A;  3TKQ A;  1PGT A;  1XFL A;  1Y6E A;  3F3R A;  1AQV A;  1VF1 A;  2FA8 A;  1JHB A;  3F6D A;  2VCV A;  4YAP A;  1USB A;  2FUG 2;  1TDI A;  1JLW A;  5GST A;  3H79 A;  6GSU A;  1A2J A;  2CAI A;  3D22 A;  3VUR A;  4YQV A;  4IP1 A;  1PD2 1;  1TW9 A;  5JWO B;  2WRT A;  4NAX A;  3TKS E;  3PH9 A;  5H5R A;  4RI6 A;  3QFA C;  4JZQ A;  4RQX A;  1SD8 A;  1VF4 A;  4POM A;  2H0I A;  1MD3 A;  1K3Y A;  2N5B A;  5DCH A;  4O5U A;  3F6F A;  2VIM A;  4XS6 A;  5CNW A;  2CA8 A;  4ZB9 A;  4KDU A;  2PBJ A;  2F3M A;  4EO3 A;  1PMT A;  4DVC A;  3ZIT A;  4MJC A;  1E6B A;  2GST A;  4KX4 A;  6GST A;  4PNG A;  1EV4 A;  3CSH A;  4L0U A;  1G7O A;  2AV4 A;  2LNS A;  4MF7 A;  1GSQ A;  2EIR A;  4HQS A;  3J7Y k;  3WGE A;  2RM5 A;  4K7I A;  2X99 A;  3FYG A;  3TKS A;  4KCA A;  4GSS A;  2JZR A;  3HKR A;  4WXT A;  4OWY A;  1A0R P;  1DUG A;  1FAA A;  5AIX A;  1F2E A;  3GIX A;  1M99 A;  4IBP A;  4KSM A;  2JSZ A;  4PQH A;  5J5N A;  2GTU A;  4KE3 A;  2L57 A;  4USS A;  2V41 A;  2AHE A;  3QOU A;  2AYT A;  3ERF A;  3UMA A;  3APS A;  1M2B A;  4DSR A;  1O85 A;  5ECQ B;  3IV4 A;  5KN2 A;  4EIP A;  3G7I A;  2X64 A;  3LXT A;  2DIZ A;  4N0V A;  4N11 A;  4IP6 A;  3W8J A;  4XRA A;  1OKT A;  12GS A;  1G6Y A;  4K5S A;  2HSM A;  2ALB A;  4OFM A;  4MF6 A;  2REM A;  2P5R A;  3FY7 A;  2GS3 A;  3TOU A;  2H76 A;  2LUS A;  3HJO A;  2GGT A;  1GP1 A;  3D4M A;  1A24 A;  3DVW A;  3APQ A;  4LA1 A;  3TRP A;  1PL2 A;  3ZLP A;  1FB0 A;  2JZT A;  1K3O A;  2ON7 A;  2HNL A;  3C1R A;  4PXO A;  1Q4J A;  1SK1 A;  5KN0 A;  3GUS A;  2JSY A;  4XS4 A;  5ENU A;  2FHE A;  4MCU A;  2I4A A;  3EUR A;  1XCC A;  2B5X A;  1ABA A;  5AIS A;  1XOA A;  1FOV A;  2UZ8 A;  3QFB C;  1FHE A;  5ECR B;  1TTZ A;  2DC5 A;  3HJP A;  3G7Y A;  2HSY A;  3IAM 2;  1AQX A;  4NHW A;  3LG6 A;  4KDX A;  4NMU A;  5GAN D;  4IHU A;  4POB A;  4ZBD A;  4XCS A;  1GWC A;  1GUH A;  3TJB A;  1DE2 A;  2CX3 A;  3G7J A;  1N8J A;  3EIN A;  4ECC A;  1Q98 A;  2JAC A;  1UC7 A;  2HRF A;  4EUY A;  3TOT A;  3I43 A;  1GH2 A;  5KN3 A;  5EL8 A;  4IQ1 A;  4I8B A;  1RW1 A;  4MLY A;  3FK8 A;  3ZTL A;  2LRC A;  3VPT A;  2R5G A;  5EPF A;  4G0L A;  4L8E A;  3D0Z A;  2X4A A;  3PIN A;  3KXO A;  3RHB A;  2H74 A;  1RQM A;  2AAW A;  3IXR A;  3CTF A;  3BCK A;  4QL7 A;  2EIO A;  3TJF A;  3A2V A;  3C73 A;  4X0X A;  4IGJ A;  5CRE A;  4PQ1 A;  1MTC A;  1YEX A;  2TRC P;  4CY6 A;  5KEJ A;  2I1U A;  1WPI A;  2ZCT A;  4FH8 A;  3IA1 A;  2YZH A;  5B6M A;  4F2I A;  1TKD B;  4GXZ A;  5D9W A;  3EPT A;  3HYP A;  3ZMK A;  2AJQ B;  5ID2 B;  2M80 A;  1VF3 A;  3WGD A;  5IOX A;  1OC9 B;  4N0Z A;  1SYR A;  2HRK A;  1O8W A;  3E9J B;  2BTO T;  3BD2 A;  3UJ1 A;  4AJ8 A;  5H5S A;  1J0F A;  4TR1 B;  3TKP A;  5F06 A;  5DAK B;  1H75 A;  2CZ3 A;  3TRQ A;  4G19 A;  2OAD A;  3KD0 A;  4I5Q A;  4BL7 B;  4WBJ A;  3UAP A;  1WE0 A;  4YQU A;  1GSE A;  2CAQ A;  2OE0 A;  1TXX A;  1WJK A;  20GS A;  1SD9 A;  1HQO A;  4MZC A;  2YZU A;  2JU5 A;  3TGZ A;  4YKF A;  5F8B A;  2X8C A;  4O7H A;  4ZXG A;  3TJG A;  2YN1 A;  1PKZ A;  2IL3 A;  4GCI A;  5J3R A;  3LWA A;  2IYJ A;  5FT3 A;  4IEL A;  2H1D A;  2FWF A;  3ZFB A;  4JR6 A;  2GQK A;  2OE3 A;  3GHA A;  1AXD A;  4G10 A;  3M9K A;  2IFQ B;  5IO0 A;  1EP8 A;  2B3S A;  5B8B A;  1GNE A;  5FHI A;  1GRX A;  4K0G A;  5KOX A;  1K0C A;  4Q5N A;  4K6X A;  3GKX A;  4KB3 A;  2WB9 A;  4XTS A;  4IS0 A;  2RUE A;  5CP1 A;  4FQU A;  1SEN A;  4ECI A;  1PQN A;  2K9F A;  4BVX A;  5IMA A;  4CHS A;  1OKD A;  4BL7 A;  5G30 A;  1EGO A;  2FA4 A;  3TRX A;  2HSH A;  2X8H A;  1ILO A;  2VLV A;  1K0B A;  5DCG A;  2YJ7 A;  2XPD A;  1LJR A;  4POK A;  3N5O A;  4GWR A;  3DIE A;  2WFC A;  4KSO A;  1F3A A;  2OA7 A;  1SKR B;  5E4W A;  2HZE A;  1GUL A;  1EWX A;  4GF0 A;  5F05 A;  4KW6 A;  1G6W A;  3IC8 A;  3I9V 2;  4TXO A;  2VCT A;  4CDO A;  4I2T A;  4NV2 A;  3UBL A;  2DJK A;  2X49 A;  3L9V A;  2KUC A;  1OC3 A;  4P3Y B;  2C0F A;  4BVY B;  2YNX A;  4Z2R A;  3UEM A;  3TJK A;  4V2M A;  3DML A;  2K6V A;  2PN8 A;  1RK4 A;  3VK9 A;  4O32 A;  4F9Z A;  4FYB A;  4HOJ A;  3L78 A;  4XRD A;  4BVY A;  3UVT A;  5ECI B;  2DSA A;  2R0P A;  5D73 A;  2F8F A;  3FR6 A;  1V9W A;  2WGR A;  3FZ4 A;  4HS1 A;  1OE7 A;  2MMO A;  3LQ7 A;  3FRC A;  1MD4 A;  5JWR B;  3HVV A;  4AF2 A;  2RII A;  4WKW A;  1T1V A;  1I9D A;  3KP9 A;  4HZ2 A;  3VFI A;  1QFN A;  3ED3 A;  1K0O A;  3IHG A;  1UN2 A;  19GS A;  1GUK A;  3V1W A;  1A8Y A;  1XWB A;  1ZMA A;  5IMC A;  3Q18 A;  4KCE A;  3BJ5 A;  1KBN A;  2KOK A;  3FHK A;  5A4W A;  4O5R A;  2QA2 A;  4KUN A;  5H5Q A;  4Q5F A;  4JED A;  4HZ4 A;  2XHF A;  3A3T A;  1XWC A;  1B4P A;  4MK3 A;  2VM1 A;  2O7K A;  3SWL A;  1F6M C;  2LST A;  4DSS A;  2PUK C;  3IC4 A;  4LLR A;  4TR3 A;  1B48 A;  1JZD A;  2R0G A;  2H6Y A;  3EU3 A;  5E59 A;  1J08 A;  2LNT A;  3WT2 A;  2MMA A;  3H4K A;  3GL3 A;  5IIZ A;  2F9S A;  3AY8 A;  3GNJ A;  3F0I A;  5CRD A;  4XS1 A;  2K18 A;  4DEJ A;  2LQQ A;  1AAZ A;  4J2F A;  5D8I A;  1ON4 A;  1BYE A;  1E2Y A;  5IM9 A;  2DJJ A;  1SU9 A;  2WJU A;  3CRT A;  3QMX A;  3TKR A;  4F03 A;  3DGQ A;  3P90 A;  3TDG A;  1F3B A;  1YDK A;  2B1L A;  2LTK A;  4IW9 A;  4K0N A;  5DQY A;  1KTE A;  5D96 A;  2HZF A;  3Q6O A;  1FB6 A;  1HYU A;  2R4V A;  1XWG A;  4V2N A;  2VCX A;  2BJX A;  2XPE A;  3WT1 A;  2OE1 A;  4I6X A;  5IOW A;  2YWO A;  1KNG A;  4BVX B;  1GLP A;  3QR6 A;  1JFU A;  2R3X A;  5GZZ B;  4TXV A;  2H1A A;  3KIJ A;  2HLS A;  3VPQ A;  3GX0 A;  5C00 A;  1O81 A;  3FZ9 A;  2C1Y A;  2H66 A;  4O92 A;  4Q5Q A;  1AC1 A;  2FY6 A;  3GUR A;  1VGL A;  5F0G A;  3IK7 A;  1FVJ A;  1TRU A;  3UOM A;  3EYT A;  3JCM L;  1SL0 B;  3KM6 A;  1R26 A;  4HJ2 A;  1Z7R A;  1X5E A;  1WRY A;  1K0M A;  1LBK A;  2H1G A;  1GTA A;  3A5W A;  2E0Q A;  3EWL A;  7GSS A;  3ME8 A;  5GSS A;  2HXK A;  3MWH A;  3C8E A;  2H6X A;  2DML A;  3HD5 A;  4MPG A;  2XBI A;  5J4U A;  3QAV A;  1PN0 A;  3DVX A;  3MDK A;  5CO3 A;  3R2Q A;  5L71 A;  2L59 A;  4MAB A;  2H72 A;  3CYN A;  3ZYW A;  2YWM A;  2HI7 A;  4V1A p;  1XIY A;  2HFD A;  4ZB6 A;  2VLU A;  2IMK A;  1S3C A;  4TR0 A;  3KTL A;  1X9M B;  1QGV A;  2HE3 A;  1QK8 A;  5HR3 A;  4PX1 A;  2D2Z A;  1VRS D;  1UVZ A;  3M0F A;  2PWJ A;  2H6Z A;  1YF0 A;  1V2A A;  1ZCP A;  2L6C A;  4EDY A;  2B1K A;  1XWK A;  5HR1 A;  4TOP A;  1PN9 A;  4ZBB A;  5HR2 A;  1PKW A;  4IKH A;  2GLR A;  5HFK A;  4K9Z A;  1X5C A;  1I5G A;  2CV4 A;  4ZL7 A;  3O6T A;  2J9H A;  4GLT A;  3KP8 A;  4HU9 A;  1KEB A;  3L0H A;  3GMF A;  3L9U A;  1ST9 A;  2XBQ A;  2DLX A;  2OAC A;  4IJ3 A;  1XWA A;  4EXJ A;  2MMZ A;  5HQP A;  2XC2 A;  3IBH A;  3F4R A;  4IVF A;  2GSS A;  4RQR A;  5HFG A;  4ICY A;  3ZVJ A;  1TU8 A;  3FMW A;  3GA4 A;  1YKA A;  2H75 A;  2V1M A;  2L5L A;  2CVD A;  2YPM A;  4DSQ A;  4XIH A;  3QDN A;  2CQ9 A;  4GRF A;  5KN1 A;  4X43 A;  2IME A;  1AQW A;  1WIK A;  2QC7 A;  3ZVJ D;  3GKK A;  1M7T A;  4K5R A;  2L5O A;  1X9S B;  2H0H A;  4X4J A;  3D21 A;  1QXH A;  3HXS A;  3J7Y b;  1A23 A;  2OJL A;  1Z7P A;  1HNB A;  1C72 A;  2IIY A;  4MA9 A;  3WD6 A;  1VF2 A;  4OFN A;  2H70 A;  1A2L A;  2YAN A;  1R7H A;  3UVH A;  3RBT A;  5D9V A;  2QKE A;  4WR4 A;  1U87 A;  3IPZ A;  3KH7 A;  2OKA A;  3H93 A;  1CQG A;  1HNA A;  4YH2 A;  1BAY A;  4GSN A;  1Z9H A;  4ILF A;  3FKF A;  2TIR A;  5A4U A;  2C3N A;  1GTU A;  3VLN A;  5AIV A;  2K8V A;  3EMP A;  1NHY A;  2AB6 A;  5F07 A;  5LNK e;  4TXO B;  2IWT A;  2RLI A;  3TJJ A;  3GV1 A;  1PSQ A;  3U6V A;  4Z7X A;  3E3E A;  3KTB A;  4EDZ A;  2L6D A;  2A2S A;  3UL3 A;  1QMV A;  5IMV A;  5ABR A;  2MZC A;  3KZQ A;  4J57 E;  1EEJ A;  3VWU A;  5KOW A;  3ZFL A;  2FNO A;  5J9B A;  4FYU A;  1K3L A;  3GTU A;  4MP4 A;  4PTS A;  4E8H A;  3S9F A;  3D6I A;  2GZY A;  1AW9 A;  2MYG A;  2V6O A;  1TRW A;  3TUE A;  3LYK A;  9GSS A;  2LEG A;  4JU5 A;  3ZML A;  2A2P A;  3F3Q A;  3VWX A;  1ZL9 A;  3OR5 A;  5IMF A;  1XZO A;  1SKW B;  2J23 A;  1V57 A;  4K8M A;  2GQL A;  5ELG A;  3ZRD A;  1YZX A;  4CY8 A;  4CW9 A;  1GSF A;  2JAD A;  3QCP A;  4LL4 B;  4AJ6 A;  1PRX A;  4L5L A;  4ML6 A;  4OMV A;  1ML6 A;  1THO A;  1WWJ A;  1WOU A;  1UA5 A;  4OFT A;  1SL1 B;  3A5I A;  1XVW A;  1THX A;  3F8U A;  4FYC A;  4TRX A;  2PVQ A;  4HU7 A;  2WS2 A;  2DJ3 A;  2H73 A;  1B4Q A;  4WEY A;  11GS A;  3QD9 A;  5ECH B;  1MDJ A;  2CX4 A;  2GSR A;  3F63 A;  4QL9 A;  2O85 A;  4HDE A;  4K7O A;  3GSS A;  4KAE A;  4FO5 A;  3F4S A;  2A4V A;  4K2X A;  2DJ1 A;  3NOF A;  4MZW A;  1K0N A;  3F9U A;  4OCE A;  1YJ6 A;  3GFK A;  4BA7 A;  1NHO A;  3L4N A;  3W6G A;  3WYW A;  3ZIJ A;  4EF0 A;  1ZGN A;  2WUL A;  1ZYP A;  2ZUP A;  2VLT A;  5ECO B;  3TB2 A;  2B6M A;  5CYY A;  3MAK A;  2PGT A;  1GLQ A;  2IN3 A;  3F4T A;  3U5R E;  1JZO A;  2B5E A;  5ECL B;  3D5J A;  3QPM A;  1TOF A;  4G2E A;  2HYX A;  4RUV A;  3RPN A;  4TR1 A;  2H01 A;  5IPG A;  2NBS A;  4MF5 A;  2GVP A;  4IQA A;  1TK8 B;  1TI1 A;  2MBS A;  2R0C A;  3ISO A;  1YF1 A;  14GS A;  4E8E A;  1QQ2 A;  4Q5R A;  4BWS A;  5GAP D;  3P2A A;  3ZL5 A;  2PMT A;  3Q74 A;  2K8S A;  5EY6 A;  1O7U A;  2YV9 A;  4NWY A;  1M0U A;  2LRN A;  4F0B A;  2P31 A;  5EVO A;  5AGY A;  2VCW A;  5CRH A;  4G0I A;  4LMW A;  3NIV A;  3EVI A;  1XOB A;  1NSW A;  2H19 A;  1SJI A;  3GH6 A;  1V40 A;  4Z2U A;  3RDW A;  2R6K A;  3CBU A;  5DAK A;  2EIQ A;  3HJM A;  3WGX A;  1M2D A;  3O76 A;  5IQY A;  1ACV A;  3M9J A;  1WMJ A;  1QUW A;  3BCI A;  2G2Q A;  4MH2 A;  1A2M A;  1SL2 B;  1PL1 A;  2GSQ A;  5G2Z A;  6GSW A;  3ZIV A;  3MSZ A;  1BX9 A;  1EP7 A;  3VWW A;  1R5A A;  1X9W B;  2EC4 A;  2IMD A;  2A4H A;  4MH3 A;  3CTG A;  1F37 A;  1M9A A;  3UIW A;  3EE2 A;  3O3T A;  5JCU A;  3HDC A;  5A5K A;  1TRS A;  1OE8 A;  1GSY A;  1K0D A;  2DJ2 A;  3CXG A;  2IMF A;  5LCZ A;  2GZP A;  4FIW A;  3IR4 A;  2WDU A;  3IRA A;  2QSI A;  5DVB A;  4F82 A;  1GTI A;  2YV7 A;  1GTB A;  4HEA 2;  2LJK A;  3KGK A;  1TRV A;  2VL2 C;  1U3I A;  5DQS A;  3DRN A;  2NPB A;  3A2X A;  1PX6 A;  2R37 A;  4PUF C;  1A8L A;  3PGT A;  4WF4 A;  3TCO A;  1URM A;  4KF9 A;  2H71 A;  2O89 A;  2V32 A;  4WBR D;  2Z9S A;  4I97 A;  1T3B A;  4HQZ A;  1EOG A;  4XS4 B;  2RUF A;  2LS5 A;  4MMM A;  4ISD A;  2NVL A;  1MDI A;  1PX7 A;  4QQ7 A;  3LEF A;  4NPB A;  1BG5 A;  4ZIJ A;  1R4W A;  2LRT A;  3C71 A;  4GTU A;  1X0R A;  1A0F A;  4V1A g;  1T00 A;  3DYR A;  2NDO A;  5C04 A;  2VL2 A;  5DAL A;  1GNW A;  3LW9 A;  2KP2 A;  2C8U A;  2MMN A;  5AN1 A;  3DKS A;  4L5O A;  4MNN A;  3BBY A;  6GSS A;  2LJR A;  3DXB A;  2L4C A;  2F8A A;  3LJR A;  4POL A;  3HHV A;  2P5Q A;  3VWV A;  5JWQ B;  4PNF A;  2CVB A;  5HFI A;  1JZW A;  2VM2 A;  2H0G A;  2M46 A;  4JR4 A;  4L0W A;  1EV9 A;  2IMI A;  1CQH A;  2N5F A;  2WCI A;  2N5A A;  4YQM A;  4GST A;  4X1U A;  1M9B A;  5IMD A;  4YKG A;  2DMM A;  1XVQ A;  3HZ4 A;  4OCF A;  1ERT A;  2YOI A;  5CAX A;  1XXU A;  1TK5 B;  1SKS B;  1G7E A;  2GQM A;  1YKC A;  1SJZ A;  1XW6 A;  17GS A;  4NHZ A;  1TJD A;  1R5P A;  5INY A;  2X8G A;  3Q19 A;  3CRU A;  3C1S A;  4ML1 A;  5ECS A;  1EOH A;  3ERG A;  2VCZ A;  5D9X A;  3KJY A;  3M8N A;  4F0C A;  2P0G A;  2DKH A;  3FW2 A;  4BPY A;  1JLV A;  1O6J A;  4HUA A;  2V2G A;  1XW9 A;  2VD0 A;  5LD0 A;  4PUR A;  4TN8 A;  4EL1 A;  4JBB A;  1K0A A;  2C0D A;  2WZ9 A;  5B8A A;  6GSV A;  1Y25 A;  2H8L A;  4D73 A;  1V58 A;  3L9S A;  18GS A;  2YWN A;  4AGS A;  3G9B A;  2QA1 A;  5B6N A;  3APO A;  4KA0 A;  5ECP B;  2H1B A;  6GSY A;  4EE0 A;  4OO4 A;  5ELA A;  1DSB A;  2IFQ A;  2C0E A;  2GT6 A;  2GT5 A;  5JCG A;  4N30 A;  2I81 A;  3ME7 A;  2A2R A;  2FLS A;  1XW5 A;  1U88 A;  1XBS A;  3UBK A;  1OC8 A;  1T8E B;  1GL8 A;  3LFL A;  4K7N A;  1AUC A;  2CVK A;  5CRG A;  2DJ0 A;  4IN0 A;  1EZK A;  4TKY A;  3FEU A;  1ZYN A;  1T4Y A;  4NXI A;  2NTO A;  4TVE A;  4MDC A;  4KND A;  3C7M A;  2C0G A;  3IOS A;  22GS A;  3MNG A;  4ACS A;  1O73 A;  2DBC A;  2E2M A;  1EGR A;  1U3A A;  4WET A;  1EEM A;  1SJ6 A;  3ERW A;  5G5F A;  1FO5 A;  1FG4 A;  5J9C A;  2YWI A;  2PER A;  3TKS C;  1SK0 A;  2HRN A;  2TRX A;  5JCW A;  4ECB A;  2LKU A;  3FR9 A;  4G9H A;  8GSS A;  1DE1 A;  2VOC A;  2JZS A;  3KH9 A;  2KHP A;  2KP1 A;  4TR4 A;  5IPH A;  4MJA A;  2VL3 A;  3KMO A;  3CMI A;  4A5P A;  2HT9 A;  3QAG A;  1WP0 A;  1N2A A;  1M2A A;  6GSX A;  3IDV A;  1ZOF A;  4K1F A;  1OC9 A;  1NW2 A;  3IAS 2;  1V98 A;  1ERV A;  3R3E A;  5B7C A;  4IJI A;  3FR3 A;  1HD2 A;  3EU4 A;  4I2U A;  2L4Q A;  1FW1 A;  4RI7 A;  1TP9 A;  5J41 A;  4ZL9 A;  2KLX A;  2F51 A;  2FD3 A;  3BOA A;  4D73 B;  3E0U A;  4PGT A;  1ZYE A;  1AIU A;  3CSJ A;  2JL4 A;  1NM3 A;  1J9B A;  2C80 A;  4J56 E;  2LV3 A;  1TU7 A;  1YQ1 A;  3M1G A;  2VAF A;  3GL5 A;  1B9X C;  5CRW A;  4V2L A;  5DJM A;  4EC0 A;  1HNC A;  1GSU A;  3IK9 A;  5HR0 A;  4HJM A;  1X5D A;  2H30 A;  4MPF A;  5G5E A;  3W8S A;  1TI3 A;  2LJA A;  1Z3E A;  4ZB8 A;  2M72 A;  1YY7 A;  3KEB A;  3PR8 A;  2DIY A;  1DBY A;  3ZZX A;  1G0T A;  1TK0 B;  1Z6M A;  3GYK A;  4ID0 A;  2E7P A;  1PA3 A;  3RPP A;  3QAW A;  1BQ7 A;  2G0F A;  1IYI A;  3LXZ A;  4XHM A;  13GS A;  1MDK A;  2V6K A;  4EVM A;  4G0K A;  1ZZY A;  2O8V B;  5G31 A;  3IHQ A;  2IJY A;  2AUV A;  4H86 A;  4WF5 A;  3LSZ A;  3HA9 A;  2VL9 A;  2O87 A;  2VUP A;  2YJH A;  2HRA A;  5A4V A;  2BMX A;  2FWG A;  3FZA A;  5G1K A;  2LQO A;  3GN3 A;  4OO5 A;  2B7J A;  2B7K A;  2GDR A;  3MYD A;  3SBC A;  3M3M A;  3N9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...