1TJDA

The crystal structure of the reduced disulphide bond isomerase, dsbc, from escherichia coli
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
216
Chain Sequence
b'DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbC
publication title Structure of the reduced disulfide-bond isomerase DsbC from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 70
structure length 216
sequence length 216
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1tjdA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tjdA02
4GTUA 4I97A 1M9AA 2PBJA 5EPFA 4NAXA 2N5BA 5HFKA 4ACSA 1ML6A 3RBTA 1YF1A 3F4SA 3TDGA 4V2NA 3IBHA 6GSTA 4RUVA 1SKRB 2H66A 4XCSA 4CW9A 1X0RA 1JZWA 4TN8A 1MTCA 1URMA 1TJDA 4XRAA 2K8VA 3PGTA 3D4MA 1K0CA 5HFIA 5CRHA 3HA9A 2RIIA 1FAAA 1XW5A 3FW2A 2N5AA 2WB9A 3ZFLA 4O7HA 5IMFA 5B6NA 4ZL8A 2CAIA 2TRXA 2X8GA 3PH9A 2JZTA 1M99A 2O89A 3EVIA 1PN9A 2EC4A 4I6XA 4IS0A 3IV4A 1TRVA 4HZ4A 3DMLA 5CYYA 4X1UA 1GSYA 4V2LA 1KBNA 3DXBA 3GKKA 1S3CA 5A4VA 4TR1A 1M2AA 3QD9A 4G2EA 1PMTA 4HEA2 1O8WA 2E2GA 3KCMA 4TW5A 3I9V2 1CQHA 2C3TA 5AGYA 2QGVA 2WZ9A 2H6XA 3GMFA 3MDKA 3R2QA 1OE7A 3PR8A 4K7NA 2IMIA 2O7KA 4Q5RA 1QQ2A 3DKSA 2DMLA 1A2LA 5EVOA 2LJRA 4G10A 2R5GA 4ML6A 2H72A 3F4TA 5IPHA 2DJ2A 4PXOA 3Q19A 4DSSB 1T4ZA 5ABRA 1OVNA 1V58A 5D9VA 4OO4A 1XWKA 3GRXA 5ECPB 2A4VA 1B8XA 1U88A 2RUEA 3TKSE 2FLSA 1O73A 5INYA 1WOUA 3O6TA 2OBKA 4I2TA 3HY2A 2H0HA 1ZCPA 2BTOT 4L5OA 3CTGA 4F82A 1FOVA 3Q18A 3NZNA 3L78A 2YJ7A 2H70A 1R5AA 5H5RA 2LKUA 1AUCA 4K1FA 1XXUA 4YQUA 2IWTA 1MDKA 3LGCA 1CQGA 3H4KA 4F9ZA 4HU7A 2H76A 1XOAA 5JWOB 5G2ZA 3VPQA 4K9ZA 1SK0A 2IY2A 1F3AA 2V6OA 4LL4B 3M1GA 1YF0A 3FHKA 3TGZA 4MJAA 1K0OA 2FHEA 3TOTA 4HQSA 3KJYA 5AIVA 1VGLA 2FGXA 4TRXA 1MD4A 4D73B 2KP1A 1OC3A 5L71A 5DAKB 1XIYA 3FY7A 4XHMA 4KGIA 3KMOA 3TUEA 4EKZA 3D22A 4GF0A 1Z7PA 3DGQA 3GH9A 1SKWB 1GSFA 4DSSA 4E8HA 3HKRA 3LWAA 3A2WA 1TI1A 3HVVA 4IJ3A 1ACVA 2YV7A 3DIEA 5DALB 3P90A 1Z3EA 2FWGA 3GA4A 2DIYA 3M9KA 3ZIJA 1GSQA 5LD0A 3QFAC 3CYNA 2YWNA 2G2QA 4GSTA 3ZYWA 5CRWA 1HQOA 5H5QA 2OKAA 1E6BA 1EEMA 4OFNA 3ZMLA 4KSMA 2M72A 4IQAA 5JWQB 2DC5A 1SL2B 2FWEA 2IFQB 2L59A 4KNDA 5DBQA 2PU9C 1DBYA 2NPBA 4TVEA 4LMVA 4ILFA 1MD3A 1ILOA 1TK5B 4ID0A 2WS2A 4KCEA 3FEUA 5F07A 3KD0A 4RI6A 4LL1B 5FT3A 4BL7A 4D73A 5DAKA 4L0WA 3CSIA 1SK1A 1K0DA 2F8AA 5JCUA 2GSSA 2MMOA 1THOA 2XPDA 1V40A 1IYHA 2JL4A 2H30A 4KAEA 3G7IA 5IOWA 1FG4A 2QC7A 5DALA 1WE0A 4GWRA 3UIWA 2IYJA 3Q6OA 4KDYA 3LEFA 3LORA 4TR0A 3UEMA 1XWGA 1Z5YE 4QL9A 4G9HA 3F63A 1FHEA 2XHFA 2KLXA 5A4WA 1SJ6A 5DDLA 4MABA 4BVYA 4EC0A 2MMZA 4IJIA 4K2DA 1X5CA 1M0UA 2VCQA 2RM6A 2NBSA 4GSNA 3GIXA 3LSZA 12GSA 2P0GA 1ERUA 4NV5A 3UVHA 2H6YA 5DQSA 3J7Yk 2IFQA 1R5PA 4IP6A 2GVPA 3FZ5A 2GQMA 2YN1A 2CX3A 4YQVA 3L9SA 3HVSA 2H75A 1GTBA 2AB6A 2OE1A 4WF5A 1SJIA 3TJFA 2HRFA 4OWYA 3KGKA 2LQOA 1U3IA 2IIYA 1GUKA 1PD21 1T4YA 1GULA 2HNLA 2N5FA 2B3SA 2K6VA 1UA5A 3F9UA 3TOUA 3E0UA 2R3XA 3IPZA 3HYPA 4WBJA 4IQ1A 3QCPA 2VLTA 10GSA 2AUVA 3IK7A 1UVZA 3FZAA 1BEDA 4XS6A 4PQ1A 1QFNA 4JR6A 4I2UA 4DEJA 4CDOA 4OCEA 3VPTA 3C7MA 3ED3A 5CO3A 3HZ8A 4HDEA 5HR3A 1R26A 5AN1A 4IELA 3GUSA 2VCTA 2HSYA 3WYWA 1X9SB 1SYRA 1GP1A 4YH2A 2HRNA 2OADA 1EGRA 1LJRA 3KH7A 4FH8A 3FR9A 3QOUA 2CQ9A 3EMXA 2MMNA 5F0GA 2VL3A 3H1NA 1WWJA 4OFTA 1AQVA 3M9JA 2XBIA 1I9DA 3C1RA 4OCFA 1NW2A 2B1KA 1T8EB 4KE3A 3WGXA 3E9JB 2C0DA 1ERTA 4HI7A 1WP0A 3F4RA 1WMJA 1GTUA 5DJLA 1TRSA 2H71A 2IMEA 2WDUA 3RAZA 3D6IA 4P3YB 2FA8A 5ECMB 1BAYA 1EGOA 1Y25A 4HJMA 1GSEA 2R4VA 1EP7A 1ZL9A 5DJMA 1SL1B 5G30A 1SL0B 2OE3A 4NXIA 2ZUPA 1XW6A 1XFLA 4L0UA 1TKDB 5ECQB 3SWLA 3ZREA 4J2FA 1TRUA 1E2YA 3BD2A 2V6KA 4L8EA 4HS1A 5FHIA 2OACA 4Q5NA 3LXTA 4PQIA 2FUG2 2NVLA 4QL7A 3P2AA 3KM6A 2RUFA 4EF0A 3CTFA 1R4WA 4I8BA 3DRNA 4KA0A 3RPNA 4GXZA 1K0AA 1XZOA 3ZVJD 4HOJA 4JZQA 4F03A 3HJOA 1AIUA 2LQQA 2AAWA 4POBA 1ERVA 3HJMA 5COHA 4RQRA 3EWLA 4IVFA 3BCIA 2EIOA 3GNJA 3IAS2 1K0NA 1MDIA 1BX9A 3TKRA 1AW9A 1PKWA 2FWHA 2K18A 3US3A 1AAZA 2L6CA 5H5SA 4AGSA 5D9TA 4DSQA 4WBRD 3UBLA 6GSSA 5CP1A 3O3TA 1K3OA 1PL1A 2CZ3A 4Z7XA 1TP9A 1G0TA 4ISDA 3MSZA 3TRQA 3JCML 5JWRB 3FYGA 3LJRA 4TXOB 1GSSA 1YKCA 4JRRA 5HFGA 3VK9A 4BVXA 4IBPA 3MNGA 3KP9A 4MF6A 2JZRA 1USBA 3GURA 3GKXA 2D2ZA 3HJPA 4YQMA 4I5QA 4MA9A 3HXSA 3ZVJA 5LNKe 3GKMA 2H0GA 3ME8A 4BA7A 3FZ9A 4ULXA 1EOHA 4MDCA 1GNEA 3G7JA 3GX8A 1ST9A 1O85A 3NOFA 4PUFC 5IO2A 1GWCA 4JR4A 3VFIA 2ES7A 4KDUA 3VWUA 4XS1A 4XS4B 5ECSA 2H8LA 3QAVA 3A2XA 3GN3A 4YAVA 3UBKA 3A3TA 2PMTA 2B1LA 2JSZA 2VUPA 1M9BA 5E59A 2B6MA 3CMIA 1JZDA 1XWCA 1F3BA 2F8FA 2YWOA 1A24A 1FVJA 1PA3A 1YDKA 4OD7A 5IOXA 2I3YA 2HYXA 4EDZA 3HZ4A 1X9MB 1YY7A 2YNXA 2CX4A 4POLA 2GLRA 2H1BA 4F0BA 2X8CA 5IMCA 1QUWA 1H75A 1Q98A 1YQ1A 4TXOA 2YP6A 1PQNA 3F3RA 1MEKA 3IHQA 1TI3A 1F2EA 1A0RP 1GL8A 3APOA 1QXHA 3LYPA 3EU4A 4V1Ap 2XPEA 1O6JA 1OYJA 4MMMA 5GSSA 4GSSA 1XPVA 5IMDA 1GSUA 5G1KA 2HZFA 5IPGA 2DLXA 1BYEA 1V9WA 2LJAA 3FRCA 3BCKA 4AJ7A 4KCAA 4GQCA 2X8HA 2H74A 3KZQA 2C0FA 2OA7A 1V2AA 3TRXA 3EURA 1GUMA 4XIHA 3DVWA 3LYKA 6GSVA 2PUKC 1WIKA 3UL3A 4ZBBA 3IOSA 3VURA 4XS4A 4XTSA 1NM3A 4HU9A 2H0IA 4EXJA 1FW1A 2VM1A 5ID2B 2VOCA 16GSA 2H1GA 1ZYEA 4FIWA 1SD8A 2GGTA 3VLNA 5ELGA 2VCVA 1TTZA 1F9MA 1HD2A 4K7IA 4HJ2A 2EIQA 1A2JA 4MCUA 4KDXA 2IJYA 1J9BA 4AJ6A 4FYUA 4GCIA 5ECNB 1YEPA 2L5LA 2FNOA 4EDYA 7GSSA 3C1SA 4KW6A 4K0GA 5ECHB 4KX4A 1T7PB 2FWFA 2ALBA 1Z6MA 4OO5A 2BJXA 4ECIA 1J08A 3KMNA 4Q5QA 4YAPA 5IMVA 5ECOB 3IK9A 2P31A 3HHVA 3CRTA 3ERFA 1EP8A 3ERGA 4JBBA 3ZITA 3GSTA 3IA1A 2WULA 2V2GA 3IAM2 3D0ZA 1XWBA 3EINA 2YWMA 3TJBA 2DJ1A 1TK0B 2ZNMA 2DMMA 3TJJA 2O85A 3M3MA 2LUSA 1FO5A 1OE8A 5KN3A 2F51A 5B7CA 5D73A 1EV9A 2KOKA 1QMVA 2F3MA 2H19A 2O87A 4LMWA 5ID2A 2VCZA 3F8UA 4KSOA 3W6GA 1F37A 1PGTA 3FKFA 4AF2A 4X43A 2V1MA 2CAQA 4FO5A 3UVTA 3QFBC 5F06A 5D8IA 1JLVA 4ZXGA 2OE0A 1XVQA 2YZUA 4IGJA 5G31A 5HR1A 1N2AA 1TDIA 4MPFA 4WXTA 1GSDA 1AC1A 5A4UA 2PERA 3UMAA 3P7XA 3LFLA 3WT1A 1FB0A 3C8EA 2VLVA 3L4NA 2PPTA 4V2MA 6GSXA 2C0EA 2AJQB 1GTIA 20GSA 2WRTA 9GSSA 1SU9A 2E0QA 3WT2A 17GSA 4PNGA 2IL3A 4ECCA 3ZRDA 4EE0A 2IMKA 4WKWA 2B5XA 2LRCA 4K8MA 3FR6A 3HCZA 1Y6EA 3HVXA 2C1YA 2GTUA 2WGRA 2LTKA 2MYGA 2P5QA 1SKSB 1I5GA 1VF4A 1A0FA 1OAZA 3C71A 2JZSA 1RK4A 6GSWA 2CZ2A 4NHZA 4KB3A 2PGTA 3DYRA 1GH2A 5J5NA 4EL1A 3EC3A 1DE2A 2XC2A 1B48A 4BWSA 3GL5A 2B5EA 3UARA 4GRFA 2X99A 11GSA 2G0FA 3IR4A 1M2DA 5J3RA 5D9WA 1ZZYA 2Z9SA 3L9VA 4EO3A 1XCCA 2MBTA 2PVQA 2TIRA 4N11A 3UJ1A 1B9XC 1XOBA 3KEBA 4NHWA 1NHYA 2L6DA 1GLQA 2J9HA 2DJ3A 5IQYA 2E2MA 1UN2A 4DSRA 3ZFBA 1O8XA 5HR2A 3UAPA 3FZ4A 1PKZA 1AQXA 1JZRA 4ZL9A 3QPMA 5G5EA 1OC8A 2HFDA 2I9HA 3QDNA 4WR5A 4G19A 4H86A 4NMUA 4J57E 2VAFA 4Q5FA 2ON5A 4ZB8A 1X5EA 4ZILA 5IM9A 3TKSC 1EWXA 3I6AA 4PURA 3EYTA 1TU8A 2QKEA 2XBQA 13GSA 2I1UA 2GQLA 2LNSA 3F6FA 3ISOA 3APQA 2YOIA 3O76A 4ZB9A 2VCXA 2I4AA 2L57A 5D96A 3D21A 2L5OA 1B4PA 2YPMA 1TK8B 2H1DA 2MMAA 2HSHA 2FD3A 3RPPA 5C00A 2GT6A 2HT9A 5J41A 1K3LA 18GSA 2PWJA 4ZL7A 3D4TA 2CVKA 2VL9A 5B8AA 1Z6NA 2HI7A 5ECKB 3V1WA 1TOFA 2ON7A 4MJEA 2L4CA 4IHUA 3ME7A 1R7HA 3P8WA 5C04A 1OKTA 4ZB6A 3ZIVA 5IO0A 5F05A 4IW9A 2VL2C 3GTUB 4K0NA 4MPGA 3ZMKA 1XBSA 4N30A 1W4VA 4HUAA 4ZBDA 2GDRA 2AHEA 1JFUA 4LLRA 1K0BA 1U6TA 4TR3A 2YWIA 4JEDA 5LCZA 22GSA 5G5FA 2B5YA 4AJ8A 5CREA 2GQKA 1VRSD 4QQ7A 4MZBA 4KUNA 1TRWA 1RQMA 1OC9B 5ECLB 4X0XA 1T3BA 5D93A 3W8JA 2JU5A 4FYCA 1B4QA 1WPIA 14GSA 2JADA 5DVBA 2M80A 1S3AA 2E7PA 2YV9A 1J0FA 1PL2A 5EY6A 2CA8A 3CSJA 2VIMA 2GSQA 1Q4JA 4MZWA 3TKQA 1A2MA 2FA4A 2R6KA 3PINA 3GX0A 5J4UA 2OJLA 3ZL5A 5HR0A 2DJ0A 1G7EA 2C0GA 3TJGA 4L5LA 3F6DA 1RW1A 2GT5A 2DSAA 2JSYA 5KN2A 3IE3A 19GSA 4NV2A 1Z7RA 1GLPA 3E3EA 2WJUA 3IC4A 1A23A 3GTUA 1WRYA 5KEJA 2GZYA 4PUAA 3GL3A 2YJHA 3TCOA 3CBUA 5JCWA 2IMFA 4DVCA 1PX6A 3DD3A 3F3QA 3GV1A 4EUYA 1VF1A 4TKYA 3A2VA 2GSTA 3G7YA 2VD1A 2WFCA 2A2RA 3FK8A 2DJKA 1SJZA 3ZTLA 3MWHA 4OFMA 1XWAA 3IXRA 1ZGNA 1SK2A 1BJXA 2RM5A 1VF3A 1DE1A 2OBIA 1SYXA 1X5DA 2V32A 1S3DA 1OC9A 1YKAA 2C4JA 2LNTA 5HQPA 2RLIA 4ML1A 4RQXA 4TOPA 1ZYQB 4EVMA 1KNGA 2NTOA 4ZIJA 3RHBA 5J9CA 3L0HA 5G1LA 2K9FA 2CVDA 2KUCA 4MH2A 2EIRA 2O8VB 2IN3A 3KP8A 4JE1A 1K3YA 3GH6A 2AYTA 3NIVA 3K8NA 5GSTA 2LRNA 3H8QA 3GFKA 3BJ5A 5AISA 5GAND 4PX1A 3M8NA 4GQFA 3S9FA 1V57A 3D5JA 1AQWA 1F6MC 2DIZA 4RI7A 1G6YA 2LRTA 3DWVA 2YANA 5KN1A 1HNCA 2YCDA 2A2SA 1LU4A 2HLSA 1LBKA 3LQ7A 2DBCA 3KIJA 1TXXA 1V98A 2C80A 2H01A 4ZBAA 1FVKA 2FY6A 2BMXA 3N5OA 4IP1A 3WD6A 2TRCP 1FB6A 3QR6A 1EV4A 4GLTA 4O32A 4POKA 2CV4A 1U3AA 2PN8A 5CRGA 5J9BA 4PNFA 3VI7A 4F2IA 1HNBA 1O81A 1GTAA 3Q74A 2GS3A 4WEYA 2HZEB 3CXGA 3RHCA 3ERWA 1SD9A 5ECRB 1YZXA 1EEJA 2ZCTA 3KTLA 4N0ZA 4CHSA 3TJKA 1K0MA 5IMAA 2IMDA 1AXDA 4XRDA 5AIXA 4ECJA 2KP2A 3VWXA 3C73A 2LS5A 5B6MA 3A5WA 3QAWA 3KXOA 3EU3A 3CRUA 3LXZA 2V41A 1YJ6A 2MBSA 3APSA 4IKHA 2VO4A 3G9BA 4MF7A 5GZZB 3VI5A 2MZCA 2IPAA 1JZOA 3EMPA 2GZZA 4WR4A 2F9SA 3TKSA 4BWQA 4POMA 5F8BA 2M46A 1BQ7A 4V1Ag 2I81A 3EE2A 3MAKA 4HQZA 3HD5A 4MLYA 1NSWA 1KTEA 2P5RA 3KTBA 2REMA 3WGEA 2DJJA 3U6VA 2J23A 3ZLPA 1T00A 1KEBA 4MF5A 1PRXA 2C3QA 2HXKA 3GYKA 3GKNA 2CT6A 3SBCA 3GSSA 5IMZA 1PSQA 3CSHA 3I69A 3BOAA 2YZHA 2HZEA 2R37A 3LG6A 1ZOFA 1G6WA 3QAGA 3GHAA 4OMVA 4MK3A 1WJKA 1XVWA 2AV4A 5CNWA 4KH7A 3IRAA 2H1AA 4O92A 4MP4A 3UOMA 2VCWA 1YEXA 5E4WA 3VWVA 2R2JA 4N0VA 2LEGA 4F0CA 3BBYA 3I43A 1H4OA 4HZ2A 3TB2A 4WF4A 3FR3A 1EZKA 1GRXA 3N9JA 1G7OA 1NHOA 2VL2A 2GSRA 3F0IA 2NDOA 3WGDA 5ELAA 1EOGA 6GSUA 2HE3A 3KH9A 2B7JA 3H93A 4K6XA 1IYIA 5A5KA 5CRDA 2VM2A 1M7TA 1MDJA 1XW9A 1W89A 1U87A 2L4QA 4IN0A 1GUHA 5EL8A 1JLWA 1HNAA 2KHPA 4J56E 3AY8A 4N10A 3J7Yb 3U5RE 5ENUA 3QMXA 2VD0A 2B7KA 4NWYA 3H79A 4FYBA 1TU7A 2FCHA 2LV3A 2C8UA 1X9WB 5DQYA 1UC7A 5IIZA 3TRPA 2JACA 4MZCA 1Z9HA 2PVOC 3VWWA 1A8YA 1HYUA 1N8JA 1DSBA 5GAPD 3RDWA 3L9UA 1ERWA 1GNWA 5DCHA 3M0FA 4MJCA 2X64A 4BPYA 2LJKA 4O5RA 5ECIB 5FWGA 1JHBA 2CVBA 5DCGA 3W8SA 1QGVA 1C72A 1O7UA 2VLUA 3TKPA 5JCGA 1BG5A 4LA1A 2K8SA 4JU5A 4WETA 3ZZXA 4K7OA 2GZPA 2LSTA 1VF2A 1ZMAA 5KN0A 4MH3A 5D9XA 4NPBA 1ON4A 3HDCA 1M2BA 6GSYA 4TXVA 3IDVA 2H73A 4E8EA 1OKDA 2C3NA 4MJBA 4ECBA 1QK8A 4TR1B 3OR5A 5CAXA 2QSIA 4PGTA 1T1VA 4TR4A 1B9YC 1SENA 3DVXA 1DUGA 2WCIA 1TW9A 1THXA 5B8BA 1A8LA 2H6ZA 4PQHA 1PX7A 8GSSA 3DEXA 1ABAA
chains in the Genus database with same CATH superfamily
3EB8A 1F8NA 4GTUA 4I97A 1M9AA 2PBJA 5EPFA 4NAXA 2N5BA 3R3EA 4XM4A 5HFKA 3DMCA 4ACSA 1LVNA 4HM4B 1ML6A 3RBTA 1YF1A 1BNRA 3F4SA 1AQZA 3TDGA 4Z2RA 4H3UA 3X40A 4V2NA 3S67A 3IBHA 1YI23 3EBTA 4RUVA 6GSTA 1SKRB 2H66A 1UCKA 3S27A 4XCSA 2RGQA 4CW9A 2PZVA 1X0RA 1JV2B 1JZWA 3T8UA 4TN8A 1MTCA 1URMA 1TJDA 4XRAA 2K8VA 1MWTA 3CCL3 1YHQ3 3PGTA 3M8CA 3D4MA 1UUGB 1K0CA 2UX0A 5HFIA 1BOXA 5CRHA 3HA9A 2RIIA 1FAAA 1XW5A 3FW2A 1WTHA 4X2HA 1KC84 1RN7A 3MYTA 2N5AA 2WB9A 2P38A 3F8XA 3DM8A 3ZFLA 4O7HA 5IMFA 5B6NA 4ZL8A 4X2OA 2CAIA 2BMRB 2TRXA 2X8GA 3LTDA 3PH9A 2JZTA 1M99A 2O89A 3EVIA 1PN9A 4CJNA 2EC4A 1M9GA 4I6XA 4IS0A 3IV4A 1TRVA 3G8ZA 2R0CA 4HZ4A 3DMLA 5CYYA 3LXUX 4X1UA 3AGNA 4IT7A 1GSYA 2XFSA 4V2LA 1KBNA 3A76A 4O02B 3G0KA 1FGOA 3JUMA 3DXBA 3GKKA 3NM2A 1S3CA 5A4VA 3UB1A 4TR1A 1M2AA 3QD9A 2KF6A 3URPA 4G2EA 1PMTA 3GAXA 3NV0B 3RDEA 1YIT3 1BAOA 4HEA2 1O8WA 4RNYA 4EYCA 2E2GA 3KCMA 4TW5A 3I9V2 2BIRA 6RNTA 1CQHA 2C3TA 5AGYA 2IUJA 2QGVA 1TRQA 2XSOB 2WZ9A 5TGNA 2H6XA 3GMFA 3MDKA 3R2QA 1OE7A 3PR8A 3MSOA 5AIFA 4K7NA 2WOFA 2IMIA 1I3FA 3DGOA 4FCJA 2O7KA 4Q5RA 2BNGA 5KOWA 4WYKB 4XB5A 1QQ2A 3DKSA 3CCU3 3V92A 1FYSA 2DMLA 1A2LA 1X1YA 5EVOA 2LJRA 4G10A 4CY6A 2R5GA 4ML6A 2H72A 3F4TA 5IPHA 1IU7A 2DJ2A 4PXOA 3Q19A 4DSSB 1T4ZA 5ABRA 1OVNA 4MJDA 2DKHA 1HYFA 1V58A 5D9VA 4OO4A 1XWKA 5KP3A 3GRXA 3RNTA 1IYYA 2A4VA 5ECPB 1B8XA 4XDWA 1U88A 2RUEA 4XDVA 3TKSE 2FLSA 1O73A 4CCVA 5INYA 1WOUA 3O6TA 2OBKA 5KOXA 4I2TA 3HY2A 2H0HA 1ZCPA 2BTOT 1A2VA 4L5OA 4GSPA 3CTGA 4F82A 1FOVA 3Q18A 3NZNA 2CHCA 3HX8A 3L78A 2XRXB 3DXOA 2GU3A 2YJ7A 2H70A 2P05A 1R5AA 5H5RA 1RN4A 1K9M4 1LQGC 4EV5A 2LKUA 3CQFA 1AUCA 4K1FA 1XXUA 4YQUA 2XFTA 2IWTA 1MDKA 3LGCA 1B2UA 1CQGA 3H4KA 1IV9A 1WQLB 4F9ZA 4HU7A 3NV0A 2H76A 5CXOA 1XOAA 5JWOB 5G2ZA 3NBBA 3VPQA 1BGSA 4K9ZA 3O8YA 4WFOA 5AIIA 1SK0A 2IY2A 4EV2A 1F3AA 2V6OA 4LL4B 2V1LA 1ZS7A 3M1GA 1YF0A 3FHKA 4HYZA 3TGZA 4MJAA 2HMMB 1K0OA 2FHEA 3TOTA 4HQSA 1GOYA 1D6YA 3KJYA 5AIVA 1OF5B 1VGLA 2FGXA 4WYKA 1UUWB 4TRXA 4BL7B 3WMDA 1MD4A 4D73B 2KP1A 1OC3A 5L71A 5DAKB 1US1A 1XIYA 4FCZA 4RZMA 1FW7A 3FY7A 4XHMA 4KGIA 3KMOA 3TUEA 2C4BA 2GEXA 3CNMA 4EKZA 3D22A 4GF0A 1Z7PA 3DGQA 3GH9A 1EQKA 1SKWB 1GSFA 4DSSA 4E8HA 1NJI4 3HKRA 3CC23 3LWAA 5CLKA 1W6CA 4O2HA 4RNTA 1TI1A 3A2WA 1ACVA 2YV7A 3HVVA 3OWSA 4G0LA 4IJ3A 1EA2A 4LZIA 4QWTA 1WMPA 3DIEA 3P90A 1NDOB 5DALB 3HOHA 1Z3EA 2X49A 2WGQA 2FWGA 3GA4A 2DIYA 8RNTA 3M9KA 3ZIJA 1GSQA 1E3RA 3SLUA 5FW5A 5AEWB 3RGAA 5LD0A 3QFAC 3CYNA 2GXFA 2YWNA 2G2QA 2L1SA 2YFIB 4GSTA 3ZYWA 1N8R4 5CRWA 3FSDA 1HQOA 5H5QA 4LGQA 4BVYB 3WR2A 3PPUA 3K63A 2OKAA 1E6BA 1EEMA 4OFNA 3ZMLA 4KSMA 3SXXA 2M72A 3FLJA 4IQAA 5JWQB 2DC5A 1SL2B 5IF6A 1CEWI 2FWEA 2CFKA 2IFQB 2L59A 4KNDA 1BRKA 2LYXA 5DBQA 2PU9C 1DBYA 2NPBA 3PCRA 4TVEA 4LMVA 4ILFA 3FKAA 3QRDA 1MD3A 1ILOA 1TK5B 4ID0A 3KZTA 2WS2A 4O5QA 3AGOA 4KCEA 3FEUA 5BU4A 1OF5A 5F07A 3KD0A 4RI6A 4LL1B 2KF4A 3ECFA 5FT3A 4BL7A 1LOXA 1ULIB 1OUNA 3NXJA 8CHOA 4D73A 3CCJ3 5DAKA 4L0WA 3CSIA 1LNIA 1SK1A 1K0DA 2F8AA 5JCUA 2GSSA 2MMOA 2K54A 1THOA 2XPDA 4R9KA 1R4YA 2Z76A 5GSPA 1V40A 1IYHA 1MWSA 1X1WA 1Q9EA 1JKGB 2JL4A 4BL3A 4FMAA 2H30A 4KAEA 2O3OA 3G7IA 1FG4A 5IOWA 2QC7A 5DALA 1RGFA 1WE0A 4GWRA 3UIWA 2IYJA 1TFKA 5DREA 3Q6OA 4KDYA 2JDIH 1U8CB 3LEFA 3LORA 4TR0A 3SOYA 3UEMA 1XWGA 3NX0A 1ROVA 1Z5YE 4QL9A 4G9HA 1B2MA 3F63A 1YNVX 1FHEA 2XHFA 2KLXA 5A4WA 1SJ6A 5DDLA 4MABA 4BVYA 4EC0A 1TP6A 1VQP3 2MMZA 2WOHA 4IJIA 4K2DA 1X5CA 1M0UA 2VCQA 2RM6A 2NBSA 4GSNA 1FGQA 1ZO2A 3GIXA 4TX4A 1Q42A 3LSZA 3Q2PA 12GSA 1UDII 2P0GA 5IEPA 4WWUC 1ERUA 4NV5A 3CPOA 4HM6B 3UVHA 2H6YA 5DQSA 1BRNL 5IEOA 3J7Yk 4JF8A 2IFQA 1R5PA 3IMAB 4IP6A 2GVPA 2CH9A 3FZ5A 2Z7AA 2GQMA 2YN1A 5CF1A 2CX3A 3L9SA 2ZHXB 4YQVA 1KQS2 3WOEB 3NHXA 1IT8A 3HVSA 2H75A 1GTBA 2W9QA 2AB6A 2OE1A 4WF5A 2WGOA 1SJIA 3TJFA 2HRFA 4OWYA 4DKIA 3KGKA 2LQOA 1U3IA 2IIYA 3F7SA 1GUKA 1PD21 1T4YA 1GULA 2HNLA 2N5FA 3B8LA 3DGMA 2B3SA 1WMOA 3G4S3 1UA5A 2J8XB 2K6VA 3F9UA 3WDGB 3TOUA 1BNGA 3E0UA 1UGHI 2R3XA 3IPZA 3HYPA 1NNVA 1DMMA 4WBJA 4IQ1A 3QCPA 1IQYA 2VLTA 10GSA 2AUVA 3IK7A 1UVZA 1VQO3 3FZAA 1JKGA 1I8VA 1BEDA 4XS6A 4PQ1A 1KSIA 2F99A 1QFNA 4JR6A 4I2UA 3WODG 4DEJA 4K5SA 3BNCA 2CWUA 4CDOA 4OCEA 3VPTA 1EG9B 3C7MA 3Q90A 3ED3A 5CO3A 3HZ8A 4HDEA 5HR3A 1R26A 5AN1A 4IELA 5D81A 3GUSA 2VCTA 4N6UA 1Q824 2Y74A 2HSYA 5AI1A 3LTBA 1GYBA 1GMQA 1M904 3WYWA 1X9SB 1SYRA 3BNEA 1GP1A 2QA1A 4YH2A 2HRNA 3GZXB 2OADA 1EGRA 1LJRA 3KH7A 5CK6A 2MF7A 4FH8A 3HZPA 3FR9A 2C11A 3QOUA 1RGKA 2CQ9A 3EMXA 2MMNA 5F0GA 1IT7A 2VL3A 3H1NA 2FXTA 1WWJA 1NWWA 1UGIA 3KKGA 4OFTA 1AQVA 4H61A 2AAEA 2XBIA 1I9DA 3C1RA 3M9JA 4OCFA 1NW2A 1YGWA 2B1KA 2P0MA 4GHOA 1T8EB 4KE3A 3WGXA 3E9JB 3N54B 2C0DA 3LOYA 2PNCA 1ERTA 4HI7A 1WP0A 3F4RA 1WMJA 3U1WA 1GTUA 5DJLA 3ZFZA 1TRSA 4CPKA 2H71A 2IMEA 2WDUA 3RAZA 3X3YA 3D6IA 4P3YB 4MNNA 2FA8A 5ECMB 1BAYA 3MYDA 1Y25A 1EGOA 4HJMA 1GSEA 1GY6A 2R4VA 1EP7A 2CW9A 1ZL9A 5DJMA 1SL1B 1W01A 5G30A 1SL0B 2OE3A 1IQ8A 1K28A 1CH0A 3PGBA 4NXIA 2ZUPA 1XFLA 1XW6A 4L0UA 1TKDB 5ECQB 3SWLA 3CC43 1UCIA 3ZREA 4J2FA 1TRUA 3CCQ3 2KF5A 1B3SA 1E2YA 3BD2A 2V6KA 1BVIA 4BVXB 4L8EA 4HS1A 3IJEB 4N6NB 5FHIA 1FUTA 2OACA 4Q5NA 3LXTA 3LYGA 4PQIA 6STDA 2UGIA 2BU4A 2FUG2 2NVLA 3NM7A 2GEYA 3P2AA 4QL7A 3KM6A 2RUFA 4EF0A 3CTFA 1R4WA 4I8BA 7STDA 1VQQA 3DRNA 2CIUA 4KA0A 3RPNA 4GXZA 1K0AA 1XZOA 1BU4A 1LQMB 3ZVJD 4HOJA 1J2BA 4JZQA 4F03A 3ROBA 3HJOA 1IVWA 5D83A 1AIUA 1RJOA 1B20A 2LQQA 2AAWA 4POBA 1T2HA 1ERVA 3HJMA 5COHA 1W6YA 1S723 4RQRA 3EWLA 4IVFA 3BCIA 2EIOA 1BRIA 3GNJA 3IAS2 1K0NA 2Z77A 5ELUA 1DYUA 1BSAA 3JVCA 2KF3A 1GD3A 1MDIA 1BX9A 3TKRA 4FR9A 1AW9A 1PKWA 3MKIA 2FWHA 2K18A 3US3A 4L8PA 1E3VA 1AAZA 2JQ5A 1SPUA 2L6CA 5H5SA 4AGSA 1BSBA 2O9UX 5D9TA 4HM3B 4N6TA 4DSQA 4WBRD 3UBLA 4N3VA 3N8BA 2GSPA 6GSSA 5CP1A 3O3TA 1PFOA 4GL6A 4HSCX 1K3OA 1PL1A 2CZ3A 1RGCA 1PU4A 4Z7XA 1GD4A 1TP9A 1G0TA 1JNQA 4ISDA 3MSZA 3TRQA 1WMNA 3JCML 7RNTA 1BNJA 5JWRB 3FYGA 3OXAA 3LJRA 1HZ1A 4TXOB 3IC8A 5IERA 3K7CA 1GSSA 3LT9A 4N6LA 1YKCA 4JRRA 4I4KA 1S3RA 5HFGA 1N5HA 1MWUA 3VK9A 1ROAA 4BVXA 4IBPA 3MNGA 5AYSC 3I0YA 1QVG2 3KP9A 4MF6A 1OGXA 3EN1B 2F98A 1USBA 2JZRA 3GURA 3GKXA 1KWIA 1S5AA 2D2ZA 3HJPA 1QVF2 2E2UA 4YQMA 4I5QA 5D82A 3H51A 2CFWA 3HXSA 3PZWA 4MA9A 3BNDA 3ZVJA 5LNKe 3GKMA 2H0GA 3ME8A 4BA7A 4BTWA 3FZ9A 4ULXA 4HBRA 1EOHA 4MDCA 1LNHA 1GNEA 3G7JA 3GX8A 4HJLB 1ST9A 3EF8A 1O85A 4HOHA 3NOFA 1MGWA 4PUFC 5IO2A 1GWCA 4JR4A 3VFIA 2ES7A 4KDUA 3VWUA 4XS1A 4XS4B 5ECSA 2H8LA 1RGGA 1DE3A 3QAVA 2RBIA 3A2XA 1SIIA 3GN3A 3JUQA 4GB5A 4YAVA 3UBKA 3PS8A 3A3TA 2PMTA 3SOAA 4PTSA 3AHSA 2B1LA 4HZ9B 2JSZA 4N6OB 2VUPA 1M9BA 2Z6BA 5E59A 5BVBA 4HM5B 5G2GA 1Q40B 2QEX3 1Q7Y4 2B6MA 3CMIA 2XEPA 1F3BA 1JZDA 1XWCA 2F8FA 2YWOA 1FGRA 1A24A 4R1KA 1FVJA 1PA3A 1DVDA 3U97A 3LT8A 1YDKA 4OD7A 1W2ZA 3UJMA 1BSDA 6GSPA 2I3YA 5IOXA 2HYXA 4EDZA 3HZ4A 1X9MB 2UZ8A 1YY7A 3KSPA 2B24B 2BHMA 2YNXA 4G0KA 2CX4A 4POLA 2GLRA 2H1BA 4FQUA 4F0BA 2X8CA 5IMCA 1QUWA 1H75A 1Q98A 1YQ1A 4TXOA 1ULJB 2YP6A 4Z2TA 1PQNA 3Q1CA 1M1K4 3F3RA 1C7HA 5AYRB 1MEKA 3IHQA 1TI3A 1F2EA 1A0RP 1GL8A 3APOA 1QXHA 3MPHA 3LYPA 3LTAA 1ZYPA 3EU4A 3UL6A 4V1Ap 2XPEA 1I0VA 1O6JA 1MGRA 1OYJA 4MMMA 5GSSA 4GSSA 1XPVA 2SARA 5IMDA 1GSUA 1B2XA 5G1KA 2QA43 2F4YA 2HZFA 5M18A 5IPGA 2DLXA 1BYEA 1V9WA 2LJAA 3FRCA 3BCKA 4AJ7A 4KCAA 4GQCA 1WNHA 2X8HA 3GZYB 2H74A 3KZQA 1JJ22 2C0FA 2OA7A 3WHOA 1BSCA 1V2AA 3TRXA 3EURA 1GUMA 4XIHA 3DVWA 3LYKA 4LSOA 1YVSA 2PUKC 6GSVA 1WIKA 1FGMA 3UL3A 4ZBBA 3IOSA 3VURA 4CY8A 4XS4A 4XTSA 2STDA 1NM3A 1PYLA 4HU9A 2H0IA 4LMIA 4EXJA 1OCVA 1FW1A 2VM1A 1RCLA 5JPUA 5ID2B 4KZ1A 2VOCA 3B4OA 2OWPA 16GSA 2H1GA 1ZYEA 4FIWA 1SD8A 2WO0A 1BNIA 4R9LA 2GGTA 3VLNA 5ELGA 4HKVB 1Q40A 2VCVA 2HMOB 1TTZA 1F9MA 1PFPA 3JUPA 5DRVA 1HD2A 4OVMA 1IVVA 4K7IA 5BXQA 4HM8B 4N6V0 2EIQA 4HJ2A 1FUSA 3SX1A 1A2JA 1LXEA 4MCUA 3G16A 4KDXA 2IJYA 5EQLA 1J9BA 4AJ6A 4FYUA 4GCIA 5ECNB 1YEPA 1BANA 4BTXA 2L5LA 2FNOA 4EDYA 3HI7A 7GSSA 3C1SA 2F5WA 3CMA3 4KW6A 1AY7A 5JPPA 1JBSA 4K0GA 4WP5A 4KX4A 5ECHB 4ORLA 1T7PB 2FWFA 2ALBA 3MIXA 1Z6MA 4OO5A 1JBTA 2BJXA 4R80A 4ECIA 1J08A 3KMNA 3L0RA 4Q5QA 2KXGA 4IPBA 4KFFA 4YAPA 5IMVA 1IVUA 5ECOB 1MNLA 3IK9A 1BRHA 2P31A 3HHVA 1B2SA 3CRTA 4MMZB 3ERFA 1EP8A 3ERGA 4BIKA 3F14A 4JBBA 3FG3A 2RSXA 2HSMA 3ZITA 3GSTA 3FG4A 1IDPA 3IA1A 2WULA 2V2GA 3IAM2 3D0ZA 4ZM8A 2CK3H 3CCM3 1XWBA 3EINA 2YWMA 3TJBA 2DJ1A 1IVXA 1TK0B 2BMOB 3HVNA 3EJVA 2ZNMA 2DMMA 3TJJA 3CME3 3S5CA 2O85A 3M3MA 1RLSA 2LUSA 1FO5A 1DMNA 1BUQA 1OE8A 1HU9A 2ML5A 4EIQA 3T8NA 5KN3A 2F51A 3OWUA 5B7CA 5D73A 3MG3A 1EV9A 3D79A 2KOKA 1QMVA 2F3MA 2H19A 2O87A 4LMWA 5ID2A 2ZDJA 2CG0A 1QAFA 2VCZA 3F8UA 1AV4A 3T0UA 4K61A 4KSOA 3MG1A 2X4AA 3W6GA 1F37A 5JBSA 2HMJB 3CPW2 1PGTA 1FZUA 1QALA 3FKFA 4AF2A 3SEDA 2V1MA 4X43A 2CAQA 3HIGA 4FO5A 3UVTA 3FH1A 3NUVA 3QFBC 5F06A 1JLVA 5D8IA 1NB5I 4ZXGA 2OE0A 3H3HA 1XVQA 2YZUA 4IGJA 1JBRA 1XG8A 4G1MB 5G31A 5HR1A 3I563 3PYJA 1N2AA 1TDIA 1C54A 4MPFA 1BIRA 4WXTA 1GSDA 1AC1A 5A4UA 1LRAA 1N9EA 1SARA 2PERA 3UMAA 3P7XA 3E99A 3LFLA 3WT1A 3NBRA 1FB0A 3C8EA 3GZRA 5IG3A 2VLVA 1OH0A 1VQK3 1E97A 2PPTA 3L4NA 4V2MA 3BNBA 6GSXA 2C0EA 3VSYA 2AJQB 4K90B 4MMXB 1GTIA 20GSA 4K2XA 2WRTA 2HMLB 9GSSA 3JUNA 3FCSB 1W00A 1SU9A 2E0QA 3WT2A 17GSA 4PNGA 2IL3A 4ECCA 1O7WB 1B27A 3ZRDA 4EE0A 2XGLA 2IMKA 4WKWA 1RKYA 2B5XA 2LRCA 4K8MA 1W6GA 3FR6A 3HCZA 1Y6EA 1FUWA 3HVXA 2C1YA 2GTUA 2CG1A 1NB3I 2WGRA 1X1XA 1TIJA 2LTKA 2MYGA 2P5QA 1SKSB 1I5GA 1VF4A 1A0FA 3J7Yd 1OAZA 3C71A 2JZSA 1RK4A 6GSWA 2CZ2A 4NHZA 1ZX2A 4N6MA 4KB3A 2PGTA 2YFLB 2RFRA 4RBNA 5BRTA 3EPTA 3BB9A 3DYRA 1GH2A 5J5NA 3MHEA 4EL1A 2IA7A 3EC3A 2CX0A 1ASKA 1DE2A 2XC2A 1B48A 4BWSA 3GL5A 3X3ZA 2CKFB 2B5EA 3OW22 3UARA 2SBLA 1GSPA 4GRFA 2X99A 11GSA 2HOHA 2G0FA 1O7NB 3IR4A 1M2DA 5J3RA 5D9WA 4YKFA 1ZZYA 2Z9SA 3L9VA 4EO3A 3GSPA 1XCCA 2R4IA 2MBTA 3DGLA 2PVQA 2TIRA 3GRDA 1D6ZA 4N11A 3UJ1A 1UI8A 1B9XC 1XOBA 4FMBA 3HK4A 3KEBA 4NHWA 1NHYA 2L6DA 1GLQA 2J9HA 2DJ3A 5IQYA 3KIIA 3K5TA 1KD14 2E2MA 3NBJA 1N5PA 1UN2A 1JB4A 4DSRA 3FMWA 3S29A 1O8XA 3ZFBA 5HR2A 3UAPA 3D5GA 3FZ4A 1PKZA 1AQXA 1JZRA 4ZL9A 3QPMA 5G5EA 1JB2A 1OC8A 1R4CA 2HFDA 2I9HA 5STDA 3QDNA 4WR5A 4G19A 1LOYA 2CX1A 4H86A 4NMUA 2OOVC 4J57E 2VAFA 1TUHA 4Q5FA 2ON5A 4ZB8A 1X5EA 1BNFA 4J5GA 4ZILA 1UCJA 5IM9A 3TKSC 1EWXA 3B7CA 4K1VA 2ML6A 3I6AA 4PURA 2CC3A 1YJW3 3NQZA 3EYTA 2KCDA 1TU8A 2QKEA 2XBQA 13GSA 2I1UA 2GQLA 1M1XB 2LNSA 1NU3A 3F6FA 3ISOA 3APQA 1N8QA 2YOIA 3O76A 4ZB9A 2VCXA 2I4AA 2L57A 5D96A 2BT3A 1CYUA 2XGNA 3D21A 2L5OA 1B4PA 2YPMA 4BIRA 1TK8B 2HMKB 1W5ZA 2W2CA 2H1DA 2MMAA 4WHAA 2HSHA 2P09A 3RGRA 2FD3A 5AIGA 5A0OB 3FZWA 2HRAA 3RPPA 5C00A 5EVHA 2GT6A 2HT9A 1UCLA 5J41A 4OK0A 1K3LA 18GSA 2PWJA 4ZL7A 1CQSA 1K41A 1TRPA 1Q814 4U13A 5IG4A 3D4TA 2CVKA 2VL9A 5B8AA 1G96A 2CWVA 1Z6NA 2HI7A 3DY5A 5ECKB 3V1WA 4O5UA 1TOFA 1VQN3 2IMJA 2ON7A 4L7KA 3EC9A 4MJEA 3X41A 2L4CA 3STDA 4IHUA 1QMAA 3ME7A 1R7HA 3P8WA 5C04A 1FOHA 1NO3A 1T2IA 1OPYA 1RGEA 1OKTA 1VQ43 3VF1A 4ZB6A 3ZIVA 5IO0A 5F05A 4K1UA 4XBXA 3CC73 4IW9A 2VL2C 3GTUB 1VQ63 3FF2A 4K0NA 4MPGA 3ZMKA 1JN5B 1XBSA 4N30A 2QGUA 1W4VA 3G713 4HUAA 4ZBDA 2GDRA 2MC8A 3LTCA 2AHEA 1DETA 1STFI 3KFQC 1M3JA 1JFUA 4LLRA 2E2VA 2CFDA 1K0BA 3LW9A 1O7GB 1U6TA 4TR3A 1Z1SA 2YWIA 4JEDA 1RN1A 5LCZA 22GSA 1V74A 3F9SA 4FCMA 2B5YA 1VZZA 5G5FA 4AJ8A 3WA2X 2OQEC 5CREA 2GQKA 4HVNA 1K734 1M3IA 1VRSD 1RNTA 4QQ7A 4MZBA 4KUNA 1HKXA 3X42A 3MWZA 1TRWA 1RQMA 1BUJA 1OC9B 5ECLB 1I0XA 4X0XA 1T3BA 5D93A 3W8JA 5M19A 5LC7A 2JU5A 4FYCA 1B4QA 1WPIA 2FGTA 14GSA 4AKZA 2JADA 5DVBA 3DGYA 2W04A 2M80A 1S3AA 3EX9A 2E7PA 1ZGXA 2YV9A 1J0FA 1PL2A 2UUGC 5EY6A 2CA8A 3CSJA 2VIMA 1EKMA 2GSQA 2HMNB 5IG0A 1Q4JA 4MZWA 3TKQA 1A2MA 2FA4A 2R6KA 3PINA 3ER7A 1B21A 1U5OA 3GX0A 1YIJ3 5J4UA 4J9AA 2OJLA 3PCSA 3ZL5A 2GU1A 3KE7A 5HR0A 2DJ0A 1OHSA 1MWRA 1G7EA 2C0GA 5IENA 1BNEA 4NREA 4L5LA 3F6DA 3TJGA 1RW1A 1TFOA 1IV7A 3OV4A 2GT5A 2DSAA 1W4NA 2JSYA 3IE3A 2W0QA 5KN2A 3WOFB 4X4JA 1I2FA 4KF9A 19GSA 4HAAA 4BL2A 3CCV3 3I553 4NV2A 1Z7RA 1GLPA 1Q864 4NHFA 1RRHA 3GWRA 3E3EA 2WJUA 3IC4A 1A23A 2QA2A 1WRYA 3GTUA 5KEJA 2A15A 2GZYA 4PUAA 3GL3A 2YJHA 3TCOA 1JN5A 3CBUA 1RHLA 4J8TA 5JCWA 2IMFA 2OCTA 4DVCA 4A5PA 1PX6A 3DD3A 3AMOB 3F3QA 3GV1A 3CXC2 1LOWA 4EUYA 1VF1A 4TKYA 4EXRA 5BMUA 3K0ZA 1SQWA 2C10A 3WA3A 2GSTA 3A2VA 3F8HA 2VD1A 2WFCA 3G7YA 3ZG0A 1MOLA 1O7HB 2A2RA 3FK8A 2DJKA 1SJZA 3ZTLA 3NQYA 1VQM3 3MWHA 4OFMA 1XWAA 3IXRA 1ZGNA 1SK2A 1BJXA 4AKYA 4BU4A 2RM5A 3CNXA 3CU3A 1O7PB 1VF3A 1DE1A 2OBIA 1SYXA 1X5DA 3D3LA 2V32A 1S3DA 3MG2A 1DMQA 5AEUB 1OC9A 1YKAA 2A4HA 2C4JA 1W7CA 1OHPA 4KVHA 2LNTA 5HQPA 2RLIA 4ML1A 3EHCA 4RQXA 4TOPA 1ZYQB 4PEJA 1VQ93 2IUKA 4EVMA 1KNGA 2NTOA 4ZIJA 3RHBA 5J9CA 3L0HA 5G1LA 2K9FA 2CVDA 2KUCA 1L5GB 4MH2A 1AVKA 4HM0B 2EIRA 2IN3A 2O8VB 3KP8A 4JE1A 4EIPA 1K3YA 1W02A 3GH6A 2GBWB 3V98A 2AYTA 1Y4KA 2I9WA 3NIVA 1RCKA 1YVBI 3K8NA 5GSTA 2LRNA 3H8QA 3GFKA 3BJ5A 5AISA 5GAND 4PX1A 1A2KA 3M8NA 4GQFA 3S9FA 1V57A 2W56B 2XSHB 1A90A 1K8A4 3D5JA 1AQWA 4O3VA 2R41A 3GZBA 1F6MC 3VGNA 5CF2A 2DIZA 4RI7A 1G6YA 2LRTA 3DWVA 4YKGA 5IW9A 3FGYA 2YANA 5KN1A 1HNCA 1VQ83 1PN0A 2YCDA 2A2SA 2DKIA 3CD63 1LU4A 2HLSA 1BRJA 3AMOA 4LYLB 3X3XA 1LBKA 3LQ7A 2DBCA 3KIJA 1TXXA 5ELJA 1V98A 2OTJ3 2W03A 2C80A 2RNTA 2H01A 1A67A 3JUOA 1BRSA 4ZBAA 1FVKA 2FY6A 2BMXA 4O8SA 3N5OA 4IP1A 1OGZA 3WD6A 3BLZA 3Q3FA 2TRCP 1FB6A 3QR6A 1EV4A 4GLTA 4O32A 1STDA 2BO9B 4POKA 2CV4A 1UW1A 1RRLA 1U3AA 2PN8A 1LOVA 5CRGA 1VQ73 5J9BA 4PNFA 1RMSA 3EN8A 3VI7A 1RNBA 4F2IA 5BIRA 1HNBA 4EBGA 1O81A 2Y73A 1GTAA 3Q74A 2R0PA 2GS3A 4WEYA 2HZEB 3V99A 3CCS3 2YFJB 3UNLA 4L8OA 3CXGA 3RHCA 3ERWA 1SD9A 4HM1B 5ECRB 1YZXA 3BIRA 1EEJA 2ZCTA 3KTLA 4N0ZA 5LC6A 4ICYA 1O7MB 4CHSA 3TJKA 3A5IA 1TTOA 3D9RA 4RNZA 1K0MA 4K5RA 5IMAA 2R0GA 2IMDA 1AXDA 4XRDA 5AIXA 4ECJA 2KP2A 1GOUA 3VWXA 4J5KA 3C73A 2LS5A 5B6MA 3D4AA 3A5WA 3QAWA 3KXOA 3EU3A 3CRUA 3LXZA 3K9MC 1QAKA 4LEHA 2V41A 2W56A 3F40A 1YJ6A 2MBSA 3APSA 4IKHA 2L4VA 2VO4A 3G9BA 4MF7A 5GZZB 1T5YA 3VI5A 2MZCA 2IPAA 1ISKA 1JZOA 1OHOA 1A2PA 2OOVA 2GZZA 3EMPA 4WR4A 2F9SA 1SJWA 1YJN3 4HZBB 5AIHA 3TKSA 4BWQA 4POMA 5F8BA 4JRFA 2M46A 4Z2UA 1BQ7A 4V1Ag 1AVLA 2I81A 1BNSA 3EE2A 3LMLA 3LZAA 4XBTA 3MAKA 3HD5A 4AEQA 4HQZA 3CCE3 3IPTA 4MLYA 2Q07A 5HOHA 1NSWA 1KTEA 2P5RA 1I70A 3KTBA 4HM7B 2REMA 2OTL3 3WGEA 2DJJA 3DGNA 2J23A 3U6VA 3ZLPA 2LQVA 1X1UA 1T00A 1FA3A 2D1WA 1KEBA 4MF5A 1PRXA 2C3QA 2HXKA 4EW5A 3F7XA 3GYKA 5RNTA 3GKNA 1D6UA 2CT6A 3SBCA 1DVCA 2F56A 3GSSA 5IMZA 1PSQA 3DH2A 3SYUA 2W9PA 4KT3B 3CSHA 2YX9A 3BOAA 2YZHA 3I69A 5HGRA 2HZEA 2R37A 3LG6A 1ZOFA 1G6WA 2XH9A 5I97A 1G02A 3QAGA 2INXA 1RGHA 3GHAA 4OMVA 1JRQA 4MK3A 3DZLA 2KRTA 4MEIA 1WJKA 3ALAA 1XVWA 1QJGA 2AV4A 4USSA 5CNWA 4KH7A 3BU4A 3IRAA 2H1AA 3DUKA 4O92A 4MP4A 3UOMA 4IIAA 1GY7A 1RSNA 3S28A 2VCWA 1YEXA 5E4WA 3VWVA 2R2JA 1EUIC 4N0VA 3OX9A 3SVAA 2LEGA 4F0CA 3BBYA 3I43A 1H4OA 1ZYNA 4HZ2A 3TB2A 3N9HA 4WF4A 1UI7A 3FR3A 1EZKA 1GRXA 1RGLA 3N9JA 1G7OA 1NHOA 3EBYA 2VL2A 2GSRA 1RTUA 3F0IA 2XF3A 2NDOA 3WGDA 5ELAA 2AADA 1EOGA 6GSUA 1BSEA 2HE3A 4HM2B 2B7JA 3H93A 3KH9A 4K6XA 4STDA 1I2GA 1IYIA 3QK9A 5A5KA 2KAAA 5CRDA 2VM2A 4Q53A 1OACA 1M7TA 2CWTA 1MDJA 1XW9A 1W89A 1U87A 2L4QA 4IN0A 1GUHA 4FMCA 2QIYA 5EL8A 1JLWA 1IK3A 1HNAA 7GSPA 2KHPA 4J56E 3AY8A 1FGTA 4N10A 3J7Yb 3G6E3 1Q7HA 1N9JA 3A5EA 2OQEA 5IG5A 4MMYB 3U5RE 5ENUA 2F86B 1TU5A 3QMXA 2VD0A 2K0MA 1GS3A 2B7KA 4NWYA 3UL5A 3D5IA 3H79A 4FYBA 2M7OA 1VQL3 1TU7A 1I3IA 4OUQA 3EE1A 4KFEA 2FCHA 2LV3A 1GMRA 2C8UA 1X9WB 5DQYA 1UC7A 2D42A 5IIZA 3TRPA 2JACA 4MZCA 3AHWA 1Z9HA 2PVOC 2GBXB 4FMDA 3VWWA 3KCHA 1A8YA 1HYUA 1CYVA 2ZL8A 3HIIA 1N8JA 1DSBA 1RDSA 5GAPD 3RDWA 3L9UA 3KSED 4BTYA 5KP4A 1ERWA 1JB5A 1GNWA 1VQ53 5DCHA 1BRGA 3M0FA 4MJCA 2B1XB 1YJ93 2F5MA 2K3DA 2X64A 4BPYA 2LJKA 5M1AA 4O5RA 5ECIB 2A2PA 1SIHA 2HRKA 5FWGA 1JHBA 1GY5A 3FF0A 2CVBA 1B2ZA 5DCGA 2RCDA 3W8SA 1QGVA 5EEOA 1C72A 3B4PA 1O7UA 2VLUA 3TKPA 5JCGA 1YGEA 2E2TA 2XR8B 1BG5A 1IQXA 4LA1A 1AR0A 2K8SA 4JU5A 4WETA 3ZZXA 4XBYA 4K7OA 2GZPA 2LSTA 1VF2A 4R4KA 2CFLA 1ZMAA 3ZG5A 5KN0A 4MH3A 3PXMA 4KFDA 4CDLA 5KP1A 5FGOA 5D9XA 2FNQA 3FG1A 1ON4A 4NPBA 9RNTA 3HDCA 1M2BA 6GSYA 4TXVA 1W2B2 2ZA4A 1GMPA 2BMQB 3IDVA 2H73A 3LH4A 3CCR3 4E8EA 1OKDA 2C3NA 2P0XA 4MJBA 2W6JH 1I2EA 4ECBA 1QK8A 4TR1B 1PY3A 3OR5A 5CAXA 2QSIA 4PGTA 3KN4A 3EQQB 4G0IA 1T1VA 4TR4A 1B9YC 1SENA 3OWYA 1UUVB 3DVXA 1DUGA 2WCIA 1TW9A 1THXA 5B8BA 4EC6A 2CFGA 1A8LA 2H6ZA 4PQHA 1PX7A 1GOVA 1RGAA 3IHGA 8GSSA 3DEXA 1ABAA
chains in the Genus database with same CATH topology
4GTUA 4I97A 1M9AA 2PBJA 5EPFA 4NAXA 2N5BA 3R3EA 5HFKA 4ACSA 1ML6A 3RBTA 1YF1A 3F4SA 3TDGA 4Z2RA 4V2NA 3IBHA 6GSTA 4RUVA 1SKRB 2H66A 4XCSA 4CW9A 1X0RA 1JZWA 4TN8A 1MTCA 1URMA 1TJDA 4XRAA 2K8VA 3PGTA 3D4MA 1K0CA 5HFIA 5CRHA 3HA9A 2RIIA 1FAAA 1XW5A 3FW2A 2N5AA 2WB9A 3ZFLA 4O7HA 5IMFA 5B6NA 4ZL8A 2CAIA 2TRXA 2X8GA 3PH9A 2JZTA 1M99A 2O89A 3EVIA 1PN9A 2EC4A 4I6XA 4IS0A 3IV4A 1TRVA 2R0CA 4HZ4A 3DMLA 5CYYA 4X1UA 1GSYA 4V2LA 1KBNA 3DXBA 3GKKA 1S3CA 5A4VA 4TR1A 1M2AA 3QD9A 4G2EA 1PMTA 4HEA2 1O8WA 2E2GA 3KCMA 4TW5A 3I9V2 1CQHA 2C3TA 5AGYA 2QGVA 2WZ9A 2H6XA 3GMFA 3MDKA 3R2QA 1OE7A 3PR8A 4K7NA 2IMIA 2O7KA 4Q5RA 5KOWA 1QQ2A 3DKSA 2DMLA 1A2LA 5EVOA 2LJRA 4G10A 4CY6A 2R5GA 4ML6A 2H72A 3F4TA 5IPHA 2DJ2A 4PXOA 3Q19A 4DSSB 1T4ZA 5ABRA 1OVNA 2DKHA 1V58A 5D9VA 4OO4A 1XWKA 3GRXA 5ECPB 2A4VA 1B8XA 1U88A 2RUEA 3TKSE 2FLSA 1O73A 5INYA 1WOUA 3O6TA 2OBKA 5KOXA 4I2TA 3HY2A 2H0HA 1ZCPA 2BTOT 4L5OA 3CTGA 4F82A 1FOVA 3Q18A 3NZNA 3L78A 2YJ7A 2H70A 1R5AA 5H5RA 2LKUA 1AUCA 4K1FA 1XXUA 4YQUA 2IWTA 1MDKA 3LGCA 1CQGA 3H4KA 4F9ZA 4HU7A 2H76A 1XOAA 5JWOB 5G2ZA 3VPQA 4K9ZA 1SK0A 2IY2A 1F3AA 2V6OA 4LL4B 3M1GA 1YF0A 3FHKA 3TGZA 4MJAA 1K0OA 2FHEA 3TOTA 4HQSA 3KJYA 5AIVA 1VGLA 2FGXA 4TRXA 4BL7B 1MD4A 4D73B 2KP1A 1OC3A 5L71A 5DAKB 1XIYA 3FY7A 4XHMA 4KGIA 3KMOA 3TUEA 4EKZA 3D22A 4GF0A 1Z7PA 3DGQA 3GH9A 1SKWB 1GSFA 4DSSA 4E8HA 3HKRA 3LWAA 3A2WA 1TI1A 4IJ3A 3HVVA 4G0LA 1ACVA 2YV7A 3DIEA 5DALB 3P90A 1Z3EA 2X49A 2FWGA 3GA4A 2DIYA 3M9KA 3ZIJA 1GSQA 5LD0A 3QFAC 3CYNA 2YWNA 2G2QA 4GSTA 3ZYWA 5CRWA 1HQOA 5H5QA 4BVYB 3PPUA 2OKAA 1E6BA 1EEMA 4OFNA 3ZMLA 4KSMA 2M72A 4IQAA 5JWQB 2DC5A 1SL2B 2FWEA 2IFQB 2L59A 4KNDA 5DBQA 2PU9C 1DBYA 2NPBA 4TVEA 4LMVA 4ILFA 1MD3A 1ILOA 1TK5B 4ID0A 2WS2A 4O5QA 4KCEA 3FEUA 5F07A 3KD0A 4RI6A 4LL1B 5FT3A 4BL7A 4D73A 5DAKA 4L0WA 3CSIA 1SK1A 1K0DA 2F8AA 5JCUA 2GSSA 2MMOA 1THOA 2XPDA 1V40A 1IYHA 2JL4A 2H30A 4KAEA 3G7IA 5IOWA 1FG4A 2QC7A 5DALA 1WE0A 4GWRA 3UIWA 2IYJA 3Q6OA 4KDYA 3LEFA 3LORA 4TR0A 3UEMA 1XWGA 1Z5YE 4QL9A 4G9HA 3F63A 1FHEA 2XHFA 2KLXA 5A4WA 1SJ6A 5DDLA 4MABA 4BVYA 4EC0A 2MMZA 4IJIA 4K2DA 1X5CA 1M0UA 2VCQA 2RM6A 2NBSA 4GSNA 3GIXA 3LSZA 12GSA 2P0GA 1ERUA 4NV5A 3UVHA 2H6YA 5DQSA 3J7Yk 2IFQA 1R5PA 4IP6A 2GVPA 3FZ5A 2GQMA 2YN1A 2CX3A 4YQVA 3L9SA 3HVSA 2H75A 1GTBA 2AB6A 2OE1A 4WF5A 1SJIA 3TJFA 2HRFA 4OWYA 3KGKA 2LQOA 1U3IA 2IIYA 1GUKA 1PD21 1T4YA 1GULA 2HNLA 2N5FA 2B3SA 2K6VA 1UA5A 3F9UA 3TOUA 3E0UA 2R3XA 3IPZA 3HYPA 4WBJA 4IQ1A 3QCPA 2VLTA 10GSA 2AUVA 3IK7A 1UVZA 3FZAA 1BEDA 4XS6A 4PQ1A 1QFNA 4JR6A 4I2UA 4DEJA 4K5SA 4CDOA 4OCEA 3VPTA 3C7MA 3ED3A 5CO3A 3HZ8A 4HDEA 5HR3A 1R26A 5AN1A 4IELA 3GUSA 2VCTA 2HSYA 3WYWA 1X9SB 1SYRA 1GP1A 2QA1A 4YH2A 2HRNA 2OADA 1EGRA 1LJRA 3KH7A 4FH8A 3FR9A 3QOUA 2CQ9A 3EMXA 2MMNA 5F0GA 2VL3A 3H1NA 1WWJA 4OFTA 1AQVA 3M9JA 2XBIA 1I9DA 3C1RA 4OCFA 1NW2A 2B1KA 1T8EB 4KE3A 3WGXA 3E9JB 2C0DA 1ERTA 4HI7A 1WP0A 3F4RA 1WMJA 1GTUA 5DJLA 1TRSA 2H71A 2IMEA 2WDUA 3RAZA 3D6IA 4P3YB 4MNNA 2FA8A 5ECMB 1BAYA 3MYDA 1Y25A 1EGOA 4HJMA 1GSEA 2R4VA 1EP7A 1ZL9A 5DJMA 1SL1B 5G30A 1SL0B 2OE3A 4NXIA 2ZUPA 1XW6A 1XFLA 4L0UA 1TKDB 5ECQB 3SWLA 3ZREA 4J2FA 1TRUA 1E2YA 3BD2A 2V6KA 4BVXB 4L8EA 4HS1A 5FHIA 2OACA 4Q5NA 3LXTA 4PQIA 2FUG2 2NVLA 4QL7A 3P2AA 3KM6A 2RUFA 4EF0A 3CTFA 1R4WA 4I8BA 3DRNA 4KA0A 3RPNA 4GXZA 1K0AA 1XZOA 3ZVJD 4HOJA 4JZQA 4F03A 3HJOA 1AIUA 2LQQA 2AAWA 4POBA 1ERVA 3HJMA 5COHA 4RQRA 3EWLA 4IVFA 3BCIA 2EIOA 3GNJA 3IAS2 1K0NA 1MDIA 1BX9A 3TKRA 1AW9A 1PKWA 2FWHA 2K18A 3US3A 1AAZA 2L6CA 5H5SA 4AGSA 5D9TA 4DSQA 4WBRD 3UBLA 6GSSA 5CP1A 3O3TA 1K3OA 1PL1A 2CZ3A 4Z7XA 1TP9A 1G0TA 4ISDA 3MSZA 3TRQA 3JCML 5JWRB 3FYGA 3LJRA 4TXOB 3IC8A 1GSSA 1YKCA 4JRRA 5HFGA 3VK9A 4BVXA 4IBPA 3MNGA 3KP9A 4MF6A 2JZRA 1USBA 3GURA 3GKXA 2D2ZA 3HJPA 4YQMA 4I5QA 4MA9A 3HXSA 3ZVJA 5LNKe 3GKMA 2H0GA 3ME8A 4BA7A 3FZ9A 4ULXA 1EOHA 4MDCA 1GNEA 3G7JA 3GX8A 1ST9A 1O85A 3NOFA 4PUFC 5IO2A 1GWCA 4JR4A 3VFIA 2ES7A 4KDUA 3VWUA 4XS1A 4XS4B 5ECSA 2H8LA 3QAVA 3A2XA 3GN3A 4YAVA 3UBKA 3A3TA 2PMTA 4PTSA 2B1LA 2JSZA 2VUPA 1M9BA 5E59A 2B6MA 3CMIA 1JZDA 1F3BA 1XWCA 2F8FA 2YWOA 1A24A 1FVJA 1PA3A 1YDKA 4OD7A 5IOXA 2I3YA 2HYXA 4EDZA 3HZ4A 1X9MB 2UZ8A 1YY7A 2YNXA 4G0KA 2CX4A 4POLA 2GLRA 2H1BA 4FQUA 4F0BA 2X8CA 5IMCA 1QUWA 1H75A 1Q98A 1YQ1A 4TXOA 2YP6A 4Z2TA 1PQNA 3F3RA 1MEKA 3IHQA 1TI3A 1F2EA 1A0RP 1GL8A 3APOA 1QXHA 3LYPA 1ZYPA 3EU4A 4V1Ap 2XPEA 1O6JA 1OYJA 4MMMA 5GSSA 4GSSA 1XPVA 5IMDA 1GSUA 5G1KA 2HZFA 5IPGA 2DLXA 1BYEA 1V9WA 2LJAA 3FRCA 3BCKA 4AJ7A 4KCAA 4GQCA 2X8HA 2H74A 3KZQA 2C0FA 2OA7A 1V2AA 3TRXA 3EURA 1GUMA 4XIHA 3DVWA 3LYKA 6GSVA 2PUKC 1WIKA 3UL3A 4ZBBA 3IOSA 3VURA 4CY8A 4XS4A 4XTSA 1NM3A 4HU9A 2H0IA 4EXJA 1FW1A 2VM1A 5ID2B 2VOCA 16GSA 2H1GA 1ZYEA 4FIWA 1SD8A 2GGTA 3VLNA 5ELGA 2VCVA 1TTZA 1F9MA 1HD2A 4K7IA 4HJ2A 2EIQA 1A2JA 4MCUA 4KDXA 2IJYA 1J9BA 4AJ6A 4FYUA 4GCIA 5ECNB 1YEPA 2L5LA 2FNOA 4EDYA 7GSSA 3C1SA 4KW6A 4K0GA 5ECHB 4KX4A 1T7PB 2FWFA 2ALBA 3MIXA 1Z6MA 4OO5A 2BJXA 4ECIA 1J08A 3KMNA 4Q5QA 4YAPA 5IMVA 5ECOB 3IK9A 2P31A 3HHVA 3CRTA 3ERFA 1EP8A 3ERGA 4JBBA 2HSMA 3ZITA 3GSTA 3IA1A 2WULA 2V2GA 3IAM2 3D0ZA 1XWBA 3EINA 2YWMA 3TJBA 2DJ1A 1TK0B 2ZNMA 2DMMA 3TJJA 2O85A 3M3MA 2LUSA 1FO5A 1OE8A 4EIQA 5KN3A 2F51A 5B7CA 5D73A 1EV9A 2KOKA 1QMVA 2F3MA 2H19A 2O87A 4LMWA 5ID2A 2VCZA 3F8UA 4KSOA 3W6GA 2X4AA 1F37A 1PGTA 3FKFA 4AF2A 4X43A 2V1MA 2CAQA 4FO5A 3UVTA 3QFBC 5F06A 1JLVA 5D8IA 4ZXGA 2OE0A 1XVQA 2YZUA 4IGJA 5G31A 5HR1A 1N2AA 1TDIA 4MPFA 4WXTA 1GSDA 1AC1A 5A4UA 2PERA 3UMAA 3P7XA 3LFLA 3WT1A 1FB0A 3C8EA 2VLVA 3L4NA 2PPTA 4V2MA 6GSXA 2C0EA 2AJQB 1GTIA 20GSA 4K2XA 2WRTA 9GSSA 1SU9A 2E0QA 3WT2A 17GSA 4PNGA 2IL3A 4ECCA 3ZRDA 4EE0A 2IMKA 4WKWA 2B5XA 2LRCA 4K8MA 3FR6A 3HCZA 1Y6EA 3HVXA 2C1YA 2GTUA 2WGRA 2LTKA 2MYGA 2P5QA 1SKSB 1I5GA 1VF4A 1A0FA 1OAZA 3C71A 2JZSA 1RK4A 6GSWA 2CZ2A 4NHZA 4KB3A 2PGTA 5BRTA 3EPTA 3DYRA 1GH2A 5J5NA 4EL1A 3EC3A 1DE2A 2XC2A 1B48A 4BWSA 3GL5A 2B5EA 3UARA 4GRFA 2X99A 11GSA 2G0FA 3IR4A 1M2DA 5J3RA 5D9WA 4YKFA 1ZZYA 2Z9SA 3L9VA 4EO3A 1XCCA 2MBTA 2PVQA 2TIRA 4N11A 3UJ1A 1B9XC 1XOBA 3KEBA 4NHWA 1NHYA 2L6DA 1GLQA 2J9HA 2DJ3A 5IQYA 2E2MA 1UN2A 4DSRA 3FMWA 3ZFBA 1O8XA 5HR2A 3UAPA 3FZ4A 1PKZA 1AQXA 1JZRA 4ZL9A 3QPMA 5G5EA 1OC8A 2HFDA 2I9HA 3QDNA 4WR5A 4G19A 4H86A 4NMUA 4J57E 2VAFA 4Q5FA 2ON5A 4ZB8A 1X5EA 4ZILA 5IM9A 3TKSC 1EWXA 3I6AA 4PURA 3EYTA 1TU8A 2QKEA 2XBQA 13GSA 2I1UA 2GQLA 2LNSA 3F6FA 3ISOA 3APQA 2YOIA 3O76A 4ZB9A 2VCXA 2I4AA 2L57A 5D96A 3D21A 2L5OA 1B4PA 2YPMA 1TK8B 2H1DA 2MMAA 2HSHA 2FD3A 2HRAA 3RPPA 5C00A 2GT6A 2HT9A 5J41A 1K3LA 18GSA 2PWJA 4ZL7A 3D4TA 2CVKA 2VL9A 5B8AA 1Z6NA 2HI7A 5ECKB 3V1WA 4O5UA 1TOFA 2ON7A 4MJEA 2L4CA 4IHUA 3ME7A 1R7HA 3P8WA 5C04A 1FOHA 1OKTA 4ZB6A 3ZIVA 5IO0A 5F05A 4IW9A 2VL2C 3GTUB 4K0NA 4MPGA 3ZMKA 1XBSA 4N30A 1W4VA 4HUAA 4ZBDA 2GDRA 2AHEA 1JFUA 4LLRA 1K0BA 3LW9A 1U6TA 4TR3A 2YWIA 4JEDA 5LCZA 22GSA 5G5FA 2B5YA 4AJ8A 5CREA 2GQKA 1VRSD 4QQ7A 4MZBA 4KUNA 1TRWA 1RQMA 1OC9B 5ECLB 4X0XA 1T3BA 5D93A 3W8JA 2JU5A 4FYCA 1B4QA 1WPIA 14GSA 2JADA 5DVBA 2M80A 1S3AA 2E7PA 2YV9A 1J0FA 1PL2A 5EY6A 2CA8A 3CSJA 2VIMA 2GSQA 1Q4JA 4MZWA 3TKQA 1A2MA 2FA4A 2R6KA 3PINA 3GX0A 5J4UA 2OJLA 3ZL5A 5HR0A 2DJ0A 1G7EA 2C0GA 3TJGA 4L5LA 3F6DA 1RW1A 2GT5A 2DSAA 2JSYA 5KN2A 3IE3A 4X4JA 4KF9A 19GSA 4NV2A 1Z7RA 1GLPA 3E3EA 2WJUA 3IC4A 1A23A 2QA2A 1WRYA 3GTUA 5KEJA 2GZYA 4PUAA 3GL3A 2YJHA 3TCOA 3CBUA 5JCWA 2IMFA 4DVCA 4A5PA 1PX6A 3DD3A 3F3QA 3GV1A 4EUYA 1VF1A 4TKYA 5BMUA 3A2VA 2GSTA 3G7YA 2VD1A 2WFCA 2A2RA 3FK8A 2DJKA 1SJZA 3ZTLA 3MWHA 4OFMA 1XWAA 3IXRA 1ZGNA 1SK2A 1BJXA 2RM5A 1VF3A 1DE1A 2OBIA 1SYXA 1X5DA 2V32A 1S3DA 1OC9A 1YKAA 2A4HA 2C4JA 2LNTA 5HQPA 2RLIA 4ML1A 4RQXA 4TOPA 1ZYQB 4EVMA 1KNGA 2NTOA 4ZIJA 3RHBA 5J9CA 3L0HA 5G1LA 2K9FA 2CVDA 2KUCA 4MH2A 2EIRA 2O8VB 2IN3A 3KP8A 4JE1A 4EIPA 1K3YA 3GH6A 2AYTA 3NIVA 3K8NA 5GSTA 2LRNA 3H8QA 3GFKA 3BJ5A 5AISA 5GAND 4PX1A 3M8NA 4GQFA 3S9FA 1V57A 3D5JA 1AQWA 1F6MC 2DIZA 4RI7A 1G6YA 2LRTA 3DWVA 4YKGA 2YANA 5KN1A 1HNCA 1PN0A 2YCDA 2A2SA 2DKIA 1LU4A 2HLSA 1LBKA 3LQ7A 2DBCA 3KIJA 1TXXA 1V98A 2C80A 2H01A 4ZBAA 1FVKA 2FY6A 2BMXA 3N5OA 4IP1A 3WD6A 2TRCP 1FB6A 3QR6A 1EV4A 4GLTA 4O32A 4POKA 2CV4A 1U3AA 2PN8A 5CRGA 5J9BA 4PNFA 3VI7A 4F2IA 1HNBA 1O81A 1GTAA 3Q74A 2R0PA 2GS3A 4WEYA 2HZEB 3CXGA 3RHCA 3ERWA 1SD9A 5ECRB 1YZXA 1EEJA 2ZCTA 3KTLA 4N0ZA 4ICYA 4CHSA 3TJKA 3A5IA 1K0MA 4K5RA 5IMAA 2R0GA 2IMDA 1AXDA 4XRDA 5AIXA 4ECJA 2KP2A 3VWXA 3C73A 2LS5A 5B6MA 3A5WA 3QAWA 3KXOA 3EU3A 3CRUA 3LXZA 2V41A 1YJ6A 2MBSA 3APSA 4IKHA 2VO4A 3G9BA 4MF7A 5GZZB 3VI5A 2MZCA 2IPAA 1JZOA 3EMPA 2GZZA 4WR4A 2F9SA 3TKSA 4BWQA 4POMA 5F8BA 2M46A 4Z2UA 1BQ7A 4V1Ag 2I81A 3EE2A 3MAKA 4HQZA 3HD5A 4MLYA 1NSWA 1KTEA 2P5RA 3KTBA 2REMA 3WGEA 2DJJA 3U6VA 2J23A 3ZLPA 1T00A 1KEBA 4MF5A 1PRXA 2C3QA 2HXKA 3GYKA 3GKNA 2CT6A 3SBCA 3GSSA 5IMZA 1PSQA 3CSHA 3I69A 3BOAA 2YZHA 2HZEA 2R37A 3LG6A 1ZOFA 1G6WA 3QAGA 3GHAA 4OMVA 4MK3A 1WJKA 1XVWA 2AV4A 4USSA 5CNWA 4KH7A 3IRAA 2H1AA 4O92A 4MP4A 3UOMA 2VCWA 1YEXA 5E4WA 3VWVA 2R2JA 4N0VA 2LEGA 4F0CA 3BBYA 3I43A 1H4OA 1ZYNA 4HZ2A 3TB2A 4WF4A 3FR3A 1EZKA 1GRXA 3N9JA 1G7OA 1NHOA 2VL2A 2GSRA 3F0IA 2NDOA 3WGDA 5ELAA 1EOGA 6GSUA 2HE3A 3KH9A 2B7JA 3H93A 4K6XA 1IYIA 5A5KA 5CRDA 2VM2A 1M7TA 1MDJA 1XW9A 1W89A 1U87A 2L4QA 4IN0A 1GUHA 5EL8A 1JLWA 1HNAA 2KHPA 4J56E 3AY8A 4N10A 3J7Yb 3U5RE 5ENUA 3QMXA 2VD0A 2B7KA 4NWYA 3H79A 4FYBA 1TU7A 2FCHA 2LV3A 2C8UA 1X9WB 5DQYA 1UC7A 5IIZA 3TRPA 2JACA 4MZCA 1Z9HA 2PVOC 3VWWA 1A8YA 1HYUA 1N8JA 1DSBA 5GAPD 3RDWA 3L9UA 1ERWA 1GNWA 5DCHA 3M0FA 4MJCA 2X64A 4BPYA 2LJKA 4O5RA 5ECIB 2A2PA 2HRKA 5FWGA 1JHBA 2CVBA 5DCGA 3W8SA 1QGVA 1C72A 1O7UA 2VLUA 3TKPA 5JCGA 1BG5A 4LA1A 2K8SA 4JU5A 4WETA 3ZZXA 4K7OA 2GZPA 2LSTA 1VF2A 1ZMAA 5KN0A 4MH3A 5D9XA 4NPBA 1ON4A 3HDCA 1M2BA 6GSYA 4TXVA 3IDVA 2H73A 4E8EA 1OKDA 2C3NA 4MJBA 4ECBA 1QK8A 4TR1B 3OR5A 5CAXA 2QSIA 4PGTA 4G0IA 1T1VA 4TR4A 1B9YC 1SENA 3DVXA 1DUGA 2WCIA 1TW9A 1THXA 5B8BA 1A8LA 2H6ZA 4PQHA 1PX7A 3IHGA 8GSSA 3DEXA 1ABAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTU A;  4I97 A;  1M9A A;  2PBJ A;  5EPF A;  4NAX A;  2N5B A;  5HFK A;  4ACS A;  1ML6 A;  3RBT A;  1YF1 A;  3F4S A;  3TDG A;  4V2N A;  3IBH A;  6GST A;  4RUV A;  1SKR B;  2H66 A;  4XCS A;  4CW9 A;  1X0R A;  1JZW A;  4TN8 A;  1MTC A;  1URM A;  1TJD A;  4XRA A;  2K8V A;  3PGT A;  3D4M A;  1K0C A;  5HFI A;  5CRH A;  3HA9 A;  2RII A;  1FAA A;  1XW5 A;  3FW2 A;  2N5A A;  2WB9 A;  3ZFL A;  4O7H A;  5IMF A;  5B6N A;  4ZL8 A;  2CAI A;  2TRX A;  2X8G A;  3PH9 A;  2JZT A;  1M99 A;  2O89 A;  3EVI A;  1PN9 A;  2EC4 A;  4I6X A;  4IS0 A;  3IV4 A;  1TRV A;  4HZ4 A;  3DML A;  5CYY A;  4X1U A;  1GSY A;  4V2L A;  1KBN A;  3DXB A;  3GKK A;  1S3C A;  5A4V A;  4TR1 A;  1M2A A;  3QD9 A;  4G2E A;  1PMT A;  4HEA 2;  1O8W A;  2E2G A;  3KCM A;  4TW5 A;  3I9V 2;  1CQH A;  2C3T A;  5AGY A;  2QGV A;  2WZ9 A;  2H6X A;  3GMF A;  3MDK A;  3R2Q A;  1OE7 A;  3PR8 A;  4K7N A;  2IMI A;  2O7K A;  4Q5R A;  1QQ2 A;  3DKS A;  2DML A;  1A2L A;  5EVO A;  2LJR A;  4G10 A;  2R5G A;  4ML6 A;  2H72 A;  3F4T A;  5IPH A;  2DJ2 A;  4PXO A;  3Q19 A;  4DSS B;  1T4Z A;  5ABR A;  1OVN A;  1V58 A;  5D9V A;  4OO4 A;  1XWK A;  3GRX A;  5ECP B;  2A4V A;  1B8X A;  1U88 A;  2RUE A;  3TKS E;  2FLS A;  1O73 A;  5INY A;  1WOU A;  3O6T A;  2OBK A;  4I2T A;  3HY2 A;  2H0H A;  1ZCP A;  2BTO T;  4L5O A;  3CTG A;  4F82 A;  1FOV A;  3Q18 A;  3NZN A;  3L78 A;  2YJ7 A;  2H70 A;  1R5A A;  5H5R A;  2LKU A;  1AUC A;  4K1F A;  1XXU A;  4YQU A;  2IWT A;  1MDK A;  3LGC A;  1CQG A;  3H4K A;  4F9Z A;  4HU7 A;  2H76 A;  1XOA A;  5JWO B;  5G2Z A;  3VPQ A;  4K9Z A;  1SK0 A;  2IY2 A;  1F3A A;  2V6O A;  4LL4 B;  3M1G A;  1YF0 A;  3FHK A;  3TGZ A;  4MJA A;  1K0O A;  2FHE A;  3TOT A;  4HQS A;  3KJY A;  5AIV A;  1VGL A;  2FGX A;  4TRX A;  1MD4 A;  4D73 B;  2KP1 A;  1OC3 A;  5L71 A;  5DAK B;  1XIY A;  3FY7 A;  4XHM A;  4KGI A;  3KMO A;  3TUE A;  4EKZ A;  3D22 A;  4GF0 A;  1Z7P A;  3DGQ A;  3GH9 A;  1SKW B;  1GSF A;  4DSS A;  4E8H A;  3HKR A;  3LWA A;  3A2W A;  1TI1 A;  3HVV A;  4IJ3 A;  1ACV A;  2YV7 A;  3DIE A;  5DAL B;  3P90 A;  1Z3E A;  2FWG A;  3GA4 A;  2DIY A;  3M9K A;  3ZIJ A;  1GSQ A;  5LD0 A;  3QFA C;  3CYN A;  2YWN A;  2G2Q A;  4GST A;  3ZYW A;  5CRW A;  1HQO A;  5H5Q A;  2OKA A;  1E6B A;  1EEM A;  4OFN A;  3ZML A;  4KSM A;  2M72 A;  4IQA A;  5JWQ B;  2DC5 A;  1SL2 B;  2FWE A;  2IFQ B;  2L59 A;  4KND A;  5DBQ A;  2PU9 C;  1DBY A;  2NPB A;  4TVE A;  4LMV A;  4ILF A;  1MD3 A;  1ILO A;  1TK5 B;  4ID0 A;  2WS2 A;  4KCE A;  3FEU A;  5F07 A;  3KD0 A;  4RI6 A;  4LL1 B;  5FT3 A;  4BL7 A;  4D73 A;  5DAK A;  4L0W A;  3CSI A;  1SK1 A;  1K0D A;  2F8A A;  5JCU A;  2GSS A;  2MMO A;  1THO A;  2XPD A;  1V40 A;  1IYH A;  2JL4 A;  2H30 A;  4KAE A;  3G7I A;  5IOW A;  1FG4 A;  2QC7 A;  5DAL A;  1WE0 A;  4GWR A;  3UIW A;  2IYJ A;  3Q6O A;  4KDY A;  3LEF A;  3LOR A;  4TR0 A;  3UEM A;  1XWG A;  1Z5Y E;  4QL9 A;  4G9H A;  3F63 A;  1FHE A;  2XHF A;  2KLX A;  5A4W A;  1SJ6 A;  5DDL A;  4MAB A;  4BVY A;  4EC0 A;  2MMZ A;  4IJI A;  4K2D A;  1X5C A;  1M0U A;  2VCQ A;  2RM6 A;  2NBS A;  4GSN A;  3GIX A;  3LSZ A;  12GS A;  2P0G A;  1ERU A;  4NV5 A;  3UVH A;  2H6Y A;  5DQS A;  3J7Y k;  2IFQ A;  1R5P A;  4IP6 A;  2GVP A;  3FZ5 A;  2GQM A;  2YN1 A;  2CX3 A;  4YQV A;  3L9S A;  3HVS A;  2H75 A;  1GTB A;  2AB6 A;  2OE1 A;  4WF5 A;  1SJI A;  3TJF A;  2HRF A;  4OWY A;  3KGK A;  2LQO A;  1U3I A;  2IIY A;  1GUK A;  1PD2 1;  1T4Y A;  1GUL A;  2HNL A;  2N5F A;  2B3S A;  2K6V A;  1UA5 A;  3F9U A;  3TOU A;  3E0U A;  2R3X A;  3IPZ A;  3HYP A;  4WBJ A;  4IQ1 A;  3QCP A;  2VLT A;  10GS A;  2AUV A;  3IK7 A;  1UVZ A;  3FZA A;  1BED A;  4XS6 A;  4PQ1 A;  1QFN A;  4JR6 A;  4I2U A;  4DEJ A;  4CDO A;  4OCE A;  3VPT A;  3C7M A;  3ED3 A;  5CO3 A;  3HZ8 A;  4HDE A;  5HR3 A;  1R26 A;  5AN1 A;  4IEL A;  3GUS A;  2VCT A;  2HSY A;  3WYW A;  1X9S B;  1SYR A;  1GP1 A;  4YH2 A;  2HRN A;  2OAD A;  1EGR A;  1LJR A;  3KH7 A;  4FH8 A;  3FR9 A;  3QOU A;  2CQ9 A;  3EMX A;  2MMN A;  5F0G A;  2VL3 A;  3H1N A;  1WWJ A;  4OFT A;  1AQV A;  3M9J A;  2XBI A;  1I9D A;  3C1R A;  4OCF A;  1NW2 A;  2B1K A;  1T8E B;  4KE3 A;  3WGX A;  3E9J B;  2C0D A;  1ERT A;  4HI7 A;  1WP0 A;  3F4R A;  1WMJ A;  1GTU A;  5DJL A;  1TRS A;  2H71 A;  2IME A;  2WDU A;  3RAZ A;  3D6I A;  4P3Y B;  2FA8 A;  5ECM B;  1BAY A;  1EGO A;  1Y25 A;  4HJM A;  1GSE A;  2R4V A;  1EP7 A;  1ZL9 A;  5DJM A;  1SL1 B;  5G30 A;  1SL0 B;  2OE3 A;  4NXI A;  2ZUP A;  1XW6 A;  1XFL A;  4L0U A;  1TKD B;  5ECQ B;  3SWL A;  3ZRE A;  4J2F A;  1TRU A;  1E2Y A;  3BD2 A;  2V6K A;  4L8E A;  4HS1 A;  5FHI A;  2OAC A;  4Q5N A;  3LXT A;  4PQI A;  2FUG 2;  2NVL A;  4QL7 A;  3P2A A;  3KM6 A;  2RUF A;  4EF0 A;  3CTF A;  1R4W A;  4I8B A;  3DRN A;  4KA0 A;  3RPN A;  4GXZ A;  1K0A A;  1XZO A;  3ZVJ D;  4HOJ A;  4JZQ A;  4F03 A;  3HJO A;  1AIU A;  2LQQ A;  2AAW A;  4POB A;  1ERV A;  3HJM A;  5COH A;  4RQR A;  3EWL A;  4IVF A;  3BCI A;  2EIO A;  3GNJ A;  3IAS 2;  1K0N A;  1MDI A;  1BX9 A;  3TKR A;  1AW9 A;  1PKW A;  2FWH A;  2K18 A;  3US3 A;  1AAZ A;  2L6C A;  5H5S A;  4AGS A;  5D9T A;  4DSQ A;  4WBR D;  3UBL A;  6GSS A;  5CP1 A;  3O3T A;  1K3O A;  1PL1 A;  2CZ3 A;  4Z7X A;  1TP9 A;  1G0T A;  4ISD A;  3MSZ A;  3TRQ A;  3JCM L;  5JWR B;  3FYG A;  3LJR A;  4TXO B;  1GSS A;  1YKC A;  4JRR A;  5HFG A;  3VK9 A;  4BVX A;  4IBP A;  3MNG A;  3KP9 A;  4MF6 A;  2JZR A;  1USB A;  3GUR A;  3GKX A;  2D2Z A;  3HJP A;  4YQM A;  4I5Q A;  4MA9 A;  3HXS A;  3ZVJ A;  5LNK e;  3GKM A;  2H0G A;  3ME8 A;  4BA7 A;  3FZ9 A;  4ULX A;  1EOH A;  4MDC A;  1GNE A;  3G7J A;  3GX8 A;  1ST9 A;  1O85 A;  3NOF A;  4PUF C;  5IO2 A;  1GWC A;  4JR4 A;  3VFI A;  2ES7 A;  4KDU A;  3VWU A;  4XS1 A;  4XS4 B;  5ECS A;  2H8L A;  3QAV A;  3A2X A;  3GN3 A;  4YAV A;  3UBK A;  3A3T A;  2PMT A;  2B1L A;  2JSZ A;  2VUP A;  1M9B A;  5E59 A;  2B6M A;  3CMI A;  1JZD A;  1XWC A;  1F3B A;  2F8F A;  2YWO A;  1A24 A;  1FVJ A;  1PA3 A;  1YDK A;  4OD7 A;  5IOX A;  2I3Y A;  2HYX A;  4EDZ A;  3HZ4 A;  1X9M B;  1YY7 A;  2YNX A;  2CX4 A;  4POL A;  2GLR A;  2H1B A;  4F0B A;  2X8C A;  5IMC A;  1QUW A;  1H75 A;  1Q98 A;  1YQ1 A;  4TXO A;  2YP6 A;  1PQN A;  3F3R A;  1MEK A;  3IHQ A;  1TI3 A;  1F2E A;  1A0R P;  1GL8 A;  3APO A;  1QXH A;  3LYP A;  3EU4 A;  4V1A p;  2XPE A;  1O6J A;  1OYJ A;  4MMM A;  5GSS A;  4GSS A;  1XPV A;  5IMD A;  1GSU A;  5G1K A;  2HZF A;  5IPG A;  2DLX A;  1BYE A;  1V9W A;  2LJA A;  3FRC A;  3BCK A;  4AJ7 A;  4KCA A;  4GQC A;  2X8H A;  2H74 A;  3KZQ A;  2C0F A;  2OA7 A;  1V2A A;  3TRX A;  3EUR A;  1GUM A;  4XIH A;  3DVW A;  3LYK A;  6GSV A;  2PUK C;  1WIK A;  3UL3 A;  4ZBB A;  3IOS A;  3VUR A;  4XS4 A;  4XTS A;  1NM3 A;  4HU9 A;  2H0I A;  4EXJ A;  1FW1 A;  2VM1 A;  5ID2 B;  2VOC A;  16GS A;  2H1G A;  1ZYE A;  4FIW A;  1SD8 A;  2GGT A;  3VLN A;  5ELG A;  2VCV A;  1TTZ A;  1F9M A;  1HD2 A;  4K7I A;  4HJ2 A;  2EIQ A;  1A2J A;  4MCU A;  4KDX A;  2IJY A;  1J9B A;  4AJ6 A;  4FYU A;  4GCI A;  5ECN B;  1YEP A;  2L5L A;  2FNO A;  4EDY A;  7GSS A;  3C1S A;  4KW6 A;  4K0G A;  5ECH B;  4KX4 A;  1T7P B;  2FWF A;  2ALB A;  1Z6M A;  4OO5 A;  2BJX A;  4ECI A;  1J08 A;  3KMN A;  4Q5Q A;  4YAP A;  5IMV A;  5ECO B;  3IK9 A;  2P31 A;  3HHV A;  3CRT A;  3ERF A;  1EP8 A;  3ERG A;  4JBB A;  3ZIT A;  3GST A;  3IA1 A;  2WUL A;  2V2G A;  3IAM 2;  3D0Z A;  1XWB A;  3EIN A;  2YWM A;  3TJB A;  2DJ1 A;  1TK0 B;  2ZNM A;  2DMM A;  3TJJ A;  2O85 A;  3M3M A;  2LUS A;  1FO5 A;  1OE8 A;  5KN3 A;  2F51 A;  5B7C A;  5D73 A;  1EV9 A;  2KOK A;  1QMV A;  2F3M A;  2H19 A;  2O87 A;  4LMW A;  5ID2 A;  2VCZ A;  3F8U A;  4KSO A;  3W6G A;  1F37 A;  1PGT A;  3FKF A;  4AF2 A;  4X43 A;  2V1M A;  2CAQ A;  4FO5 A;  3UVT A;  3QFB C;  5F06 A;  5D8I A;  1JLV A;  4ZXG A;  2OE0 A;  1XVQ A;  2YZU A;  4IGJ A;  5G31 A;  5HR1 A;  1N2A A;  1TDI A;  4MPF A;  4WXT A;  1GSD A;  1AC1 A;  5A4U A;  2PER A;  3UMA A;  3P7X A;  3LFL A;  3WT1 A;  1FB0 A;  3C8E A;  2VLV A;  3L4N A;  2PPT A;  4V2M A;  6GSX A;  2C0E A;  2AJQ B;  1GTI A;  20GS A;  2WRT A;  9GSS A;  1SU9 A;  2E0Q A;  3WT2 A;  17GS A;  4PNG A;  2IL3 A;  4ECC A;  3ZRD A;  4EE0 A;  2IMK A;  4WKW A;  2B5X A;  2LRC A;  4K8M A;  3FR6 A;  3HCZ A;  1Y6E A;  3HVX A;  2C1Y A;  2GTU A;  2WGR A;  2LTK A;  2MYG A;  2P5Q A;  1SKS B;  1I5G A;  1VF4 A;  1A0F A;  1OAZ A;  3C71 A;  2JZS A;  1RK4 A;  6GSW A;  2CZ2 A;  4NHZ A;  4KB3 A;  2PGT A;  3DYR A;  1GH2 A;  5J5N A;  4EL1 A;  3EC3 A;  1DE2 A;  2XC2 A;  1B48 A;  4BWS A;  3GL5 A;  2B5E A;  3UAR A;  4GRF A;  2X99 A;  11GS A;  2G0F A;  3IR4 A;  1M2D A;  5J3R A;  5D9W A;  1ZZY A;  2Z9S A;  3L9V A;  4EO3 A;  1XCC A;  2MBT A;  2PVQ A;  2TIR A;  4N11 A;  3UJ1 A;  1B9X C;  1XOB A;  3KEB A;  4NHW A;  1NHY A;  2L6D A;  1GLQ A;  2J9H A;  2DJ3 A;  5IQY A;  2E2M A;  1UN2 A;  4DSR A;  3ZFB A;  1O8X A;  5HR2 A;  3UAP A;  3FZ4 A;  1PKZ A;  1AQX A;  1JZR A;  4ZL9 A;  3QPM A;  5G5E A;  1OC8 A;  2HFD A;  2I9H A;  3QDN A;  4WR5 A;  4G19 A;  4H86 A;  4NMU A;  4J57 E;  2VAF A;  4Q5F A;  2ON5 A;  4ZB8 A;  1X5E A;  4ZIL A;  5IM9 A;  3TKS C;  1EWX A;  3I6A A;  4PUR A;  3EYT A;  1TU8 A;  2QKE A;  2XBQ A;  13GS A;  2I1U A;  2GQL A;  2LNS A;  3F6F A;  3ISO A;  3APQ A;  2YOI A;  3O76 A;  4ZB9 A;  2VCX A;  2I4A A;  2L57 A;  5D96 A;  3D21 A;  2L5O A;  1B4P A;  2YPM A;  1TK8 B;  2H1D A;  2MMA A;  2HSH A;  2FD3 A;  3RPP A;  5C00 A;  2GT6 A;  2HT9 A;  5J41 A;  1K3L A;  18GS A;  2PWJ A;  4ZL7 A;  3D4T A;  2CVK A;  2VL9 A;  5B8A A;  1Z6N A;  2HI7 A;  5ECK B;  3V1W A;  1TOF A;  2ON7 A;  4MJE A;  2L4C A;  4IHU A;  3ME7 A;  1R7H A;  3P8W A;  5C04 A;  1OKT A;  4ZB6 A;  3ZIV A;  5IO0 A;  5F05 A;  4IW9 A;  2VL2 C;  3GTU B;  4K0N A;  4MPG A;  3ZMK A;  1XBS A;  4N30 A;  1W4V A;  4HUA A;  4ZBD A;  2GDR A;  2AHE A;  1JFU A;  4LLR A;  1K0B A;  1U6T A;  4TR3 A;  2YWI A;  4JED A;  5LCZ A;  22GS A;  5G5F A;  2B5Y A;  4AJ8 A;  5CRE A;  2GQK A;  1VRS D;  4QQ7 A;  4MZB A;  4KUN A;  1TRW A;  1RQM A;  1OC9 B;  5ECL B;  4X0X A;  1T3B A;  5D93 A;  3W8J A;  2JU5 A;  4FYC A;  1B4Q A;  1WPI A;  14GS A;  2JAD A;  5DVB A;  2M80 A;  1S3A A;  2E7P A;  2YV9 A;  1J0F A;  1PL2 A;  5EY6 A;  2CA8 A;  3CSJ A;  2VIM A;  2GSQ A;  1Q4J A;  4MZW A;  3TKQ A;  1A2M A;  2FA4 A;  2R6K A;  3PIN A;  3GX0 A;  5J4U A;  2OJL A;  3ZL5 A;  5HR0 A;  2DJ0 A;  1G7E A;  2C0G A;  3TJG A;  4L5L A;  3F6D A;  1RW1 A;  2GT5 A;  2DSA A;  2JSY A;  5KN2 A;  3IE3 A;  19GS A;  4NV2 A;  1Z7R A;  1GLP A;  3E3E A;  2WJU A;  3IC4 A;  1A23 A;  3GTU A;  1WRY A;  5KEJ A;  2GZY A;  4PUA A;  3GL3 A;  2YJH A;  3TCO A;  3CBU A;  5JCW A;  2IMF A;  4DVC A;  1PX6 A;  3DD3 A;  3F3Q A;  3GV1 A;  4EUY A;  1VF1 A;  4TKY A;  3A2V A;  2GST A;  3G7Y A;  2VD1 A;  2WFC A;  2A2R A;  3FK8 A;  2DJK A;  1SJZ A;  3ZTL A;  3MWH A;  4OFM A;  1XWA A;  3IXR A;  1ZGN A;  1SK2 A;  1BJX A;  2RM5 A;  1VF3 A;  1DE1 A;  2OBI A;  1SYX A;  1X5D A;  2V32 A;  1S3D A;  1OC9 A;  1YKA A;  2C4J A;  2LNT A;  5HQP A;  2RLI A;  4ML1 A;  4RQX A;  4TOP A;  1ZYQ B;  4EVM A;  1KNG A;  2NTO A;  4ZIJ A;  3RHB A;  5J9C A;  3L0H A;  5G1L A;  2K9F A;  2CVD A;  2KUC A;  4MH2 A;  2EIR A;  2O8V B;  2IN3 A;  3KP8 A;  4JE1 A;  1K3Y A;  3GH6 A;  2AYT A;  3NIV A;  3K8N A;  5GST A;  2LRN A;  3H8Q A;  3GFK A;  3BJ5 A;  5AIS A;  5GAN D;  4PX1 A;  3M8N A;  4GQF A;  3S9F A;  1V57 A;  3D5J A;  1AQW A;  1F6M C;  2DIZ A;  4RI7 A;  1G6Y A;  2LRT A;  3DWV A;  2YAN A;  5KN1 A;  1HNC A;  2YCD A;  2A2S A;  1LU4 A;  2HLS A;  1LBK A;  3LQ7 A;  2DBC A;  3KIJ A;  1TXX A;  1V98 A;  2C80 A;  2H01 A;  4ZBA A;  1FVK A;  2FY6 A;  2BMX A;  3N5O A;  4IP1 A;  3WD6 A;  2TRC P;  1FB6 A;  3QR6 A;  1EV4 A;  4GLT A;  4O32 A;  4POK A;  2CV4 A;  1U3A A;  2PN8 A;  5CRG A;  5J9B A;  4PNF A;  3VI7 A;  4F2I A;  1HNB A;  1O81 A;  1GTA A;  3Q74 A;  2GS3 A;  4WEY A;  2HZE B;  3CXG A;  3RHC A;  3ERW A;  1SD9 A;  5ECR B;  1YZX A;  1EEJ A;  2ZCT A;  3KTL A;  4N0Z A;  4CHS A;  3TJK A;  1K0M A;  5IMA A;  2IMD A;  1AXD A;  4XRD A;  5AIX A;  4ECJ A;  2KP2 A;  3VWX A;  3C73 A;  2LS5 A;  5B6M A;  3A5W A;  3QAW A;  3KXO A;  3EU3 A;  3CRU A;  3LXZ A;  2V41 A;  1YJ6 A;  2MBS A;  3APS A;  4IKH A;  2VO4 A;  3G9B A;  4MF7 A;  5GZZ B;  3VI5 A;  2MZC A;  2IPA A;  1JZO A;  3EMP A;  2GZZ A;  4WR4 A;  2F9S A;  3TKS A;  4BWQ A;  4POM A;  5F8B A;  2M46 A;  1BQ7 A;  4V1A g;  2I81 A;  3EE2 A;  3MAK A;  4HQZ A;  3HD5 A;  4MLY A;  1NSW A;  1KTE A;  2P5R A;  3KTB A;  2REM A;  3WGE A;  2DJJ A;  3U6V A;  2J23 A;  3ZLP A;  1T00 A;  1KEB A;  4MF5 A;  1PRX A;  2C3Q A;  2HXK A;  3GYK A;  3GKN A;  2CT6 A;  3SBC A;  3GSS A;  5IMZ A;  1PSQ A;  3CSH A;  3I69 A;  3BOA A;  2YZH A;  2HZE A;  2R37 A;  3LG6 A;  1ZOF A;  1G6W A;  3QAG A;  3GHA A;  4OMV A;  4MK3 A;  1WJK A;  1XVW A;  2AV4 A;  5CNW A;  4KH7 A;  3IRA A;  2H1A A;  4O92 A;  4MP4 A;  3UOM A;  2VCW A;  1YEX A;  5E4W A;  3VWV A;  2R2J A;  4N0V A;  2LEG A;  4F0C A;  3BBY A;  3I43 A;  1H4O A;  4HZ2 A;  3TB2 A;  4WF4 A;  3FR3 A;  1EZK A;  1GRX A;  3N9J A;  1G7O A;  1NHO A;  2VL2 A;  2GSR A;  3F0I A;  2NDO A;  3WGD A;  5ELA A;  1EOG A;  6GSU A;  2HE3 A;  3KH9 A;  2B7J A;  3H93 A;  4K6X A;  1IYI A;  5A5K A;  5CRD A;  2VM2 A;  1M7T A;  1MDJ A;  1XW9 A;  1W89 A;  1U87 A;  2L4Q A;  4IN0 A;  1GUH A;  5EL8 A;  1JLW A;  1HNA A;  2KHP A;  4J56 E;  3AY8 A;  4N10 A;  3J7Y b;  3U5R E;  5ENU A;  3QMX A;  2VD0 A;  2B7K A;  4NWY A;  3H79 A;  4FYB A;  1TU7 A;  2FCH A;  2LV3 A;  2C8U A;  1X9W B;  5DQY A;  1UC7 A;  5IIZ A;  3TRP A;  2JAC A;  4MZC A;  1Z9H A;  2PVO C;  3VWW A;  1A8Y A;  1HYU A;  1N8J A;  1DSB A;  5GAP D;  3RDW A;  3L9U A;  1ERW A;  1GNW A;  5DCH A;  3M0F A;  4MJC A;  2X64 A;  4BPY A;  2LJK A;  4O5R A;  5ECI B;  5FWG A;  1JHB A;  2CVB A;  5DCG A;  3W8S A;  1QGV A;  1C72 A;  1O7U A;  2VLU A;  3TKP A;  5JCG A;  1BG5 A;  4LA1 A;  2K8S A;  4JU5 A;  4WET A;  3ZZX A;  4K7O A;  2GZP A;  2LST A;  1VF2 A;  1ZMA A;  5KN0 A;  4MH3 A;  5D9X A;  4NPB A;  1ON4 A;  3HDC A;  1M2B A;  6GSY A;  4TXV A;  3IDV A;  2H73 A;  4E8E A;  1OKD A;  2C3N A;  4MJB A;  4ECB A;  1QK8 A;  4TR1 B;  3OR5 A;  5CAX A;  2QSI A;  4PGT A;  1T1V A;  4TR4 A;  1B9Y C;  1SEN A;  3DVX A;  1DUG A;  2WCI A;  1TW9 A;  1THX A;  5B8B A;  1A8L A;  2H6Z A;  4PQH A;  1PX7 A;  8GSS A;  3DEX A;  1ABA A; 
#chains in the Genus database with same CATH topology
 3EB8 A;  1F8N A;  4GTU A;  4I97 A;  1M9A A;  2PBJ A;  5EPF A;  4NAX A;  2N5B A;  3R3E A;  4XM4 A;  5HFK A;  3DMC A;  4ACS A;  1LVN A;  4HM4 B;  1ML6 A;  3RBT A;  1YF1 A;  1BNR A;  3F4S A;  1AQZ A;  3TDG A;  4Z2R A;  4H3U A;  3X40 A;  4V2N A;  3S67 A;  3IBH A;  1YI2 3;  3EBT A;  4RUV A;  6GST A;  1SKR B;  2H66 A;  1UCK A;  3S27 A;  4XCS A;  2RGQ A;  4CW9 A;  2PZV A;  1X0R A;  1JV2 B;  1JZW A;  3T8U A;  4TN8 A;  1MTC A;  1URM A;  1TJD A;  4XRA A;  2K8V A;  1MWT A;  3CCL 3;  1YHQ 3;  3PGT A;  3M8C A;  3D4M A;  1UUG B;  1K0C A;  2UX0 A;  5HFI A;  1BOX A;  5CRH A;  3HA9 A;  2RII A;  1FAA A;  1XW5 A;  3FW2 A;  1WTH A;  4X2H A;  1KC8 4;  1RN7 A;  3MYT A;  2N5A A;  2WB9 A;  2P38 A;  3F8X A;  3DM8 A;  3ZFL A;  4O7H A;  5IMF A;  5B6N A;  4ZL8 A;  4X2O A;  2CAI A;  2BMR B;  2TRX A;  2X8G A;  3LTD A;  3PH9 A;  2JZT A;  1M99 A;  2O89 A;  3EVI A;  1PN9 A;  4CJN A;  2EC4 A;  1M9G A;  4I6X A;  4IS0 A;  3IV4 A;  1TRV A;  3G8Z A;  2R0C A;  4HZ4 A;  3DML A;  5CYY A;  3LXU X;  4X1U A;  3AGN A;  4IT7 A;  1GSY A;  2XFS A;  4V2L A;  1KBN A;  3A76 A;  4O02 B;  3G0K A;  1FGO A;  3JUM A;  3DXB A;  3GKK A;  3NM2 A;  1S3C A;  5A4V A;  3UB1 A;  4TR1 A;  1M2A A;  3QD9 A;  2KF6 A;  3URP A;  4G2E A;  1PMT A;  3GAX A;  3NV0 B;  3RDE A;  1YIT 3;  1BAO A;  4HEA 2;  1O8W A;  4RNY A;  4EYC A;  2E2G A;  3KCM A;  4TW5 A;  3I9V 2;  2BIR A;  6RNT A;  1CQH A;  2C3T A;  5AGY A;  2IUJ A;  2QGV A;  1TRQ A;  2XSO B;  2WZ9 A;  5TGN A;  2H6X A;  3GMF A;  3MDK A;  3R2Q A;  1OE7 A;  3PR8 A;  3MSO A;  5AIF A;  4K7N A;  2WOF A;  2IMI A;  1I3F A;  3DGO A;  4FCJ A;  2O7K A;  4Q5R A;  2BNG A;  5KOW A;  4WYK B;  4XB5 A;  1QQ2 A;  3DKS A;  3CCU 3;  3V92 A;  1FYS A;  2DML A;  1A2L A;  1X1Y A;  5EVO A;  2LJR A;  4G10 A;  4CY6 A;  2R5G A;  4ML6 A;  2H72 A;  3F4T A;  5IPH A;  1IU7 A;  2DJ2 A;  4PXO A;  3Q19 A;  4DSS B;  1T4Z A;  5ABR A;  1OVN A;  4MJD A;  2DKH A;  1HYF A;  1V58 A;  5D9V A;  4OO4 A;  1XWK A;  5KP3 A;  3GRX A;  3RNT A;  1IYY A;  2A4V A;  5ECP B;  1B8X A;  4XDW A;  1U88 A;  2RUE A;  4XDV A;  3TKS E;  2FLS A;  1O73 A;  4CCV A;  5INY A;  1WOU A;  3O6T A;  2OBK A;  5KOX A;  4I2T A;  3HY2 A;  2H0H A;  1ZCP A;  2BTO T;  1A2V A;  4L5O A;  4GSP A;  3CTG A;  4F82 A;  1FOV A;  3Q18 A;  3NZN A;  2CHC A;  3HX8 A;  3L78 A;  2XRX B;  3DXO A;  2GU3 A;  2YJ7 A;  2H70 A;  2P05 A;  1R5A A;  5H5R A;  1RN4 A;  1K9M 4;  1LQG C;  4EV5 A;  2LKU A;  3CQF A;  1AUC A;  4K1F A;  1XXU A;  4YQU A;  2XFT A;  2IWT A;  1MDK A;  3LGC A;  1B2U A;  1CQG A;  3H4K A;  1IV9 A;  1WQL B;  4F9Z A;  4HU7 A;  3NV0 A;  2H76 A;  5CXO A;  1XOA A;  5JWO B;  5G2Z A;  3NBB A;  3VPQ A;  1BGS A;  4K9Z A;  3O8Y A;  4WFO A;  5AII A;  1SK0 A;  2IY2 A;  4EV2 A;  1F3A A;  2V6O A;  4LL4 B;  2V1L A;  1ZS7 A;  3M1G A;  1YF0 A;  3FHK A;  4HYZ A;  3TGZ A;  4MJA A;  2HMM B;  1K0O A;  2FHE A;  3TOT A;  4HQS A;  1GOY A;  1D6Y A;  3KJY A;  5AIV A;  1OF5 B;  1VGL A;  2FGX A;  4WYK A;  1UUW B;  4TRX A;  4BL7 B;  3WMD A;  1MD4 A;  4D73 B;  2KP1 A;  1OC3 A;  5L71 A;  5DAK B;  1US1 A;  1XIY A;  4FCZ A;  4RZM A;  1FW7 A;  3FY7 A;  4XHM A;  4KGI A;  3KMO A;  3TUE A;  2C4B A;  2GEX A;  3CNM A;  4EKZ A;  3D22 A;  4GF0 A;  1Z7P A;  3DGQ A;  3GH9 A;  1EQK A;  1SKW B;  1GSF A;  4DSS A;  4E8H A;  1NJI 4;  3HKR A;  3CC2 3;  3LWA A;  5CLK A;  1W6C A;  4O2H A;  4RNT A;  1TI1 A;  3A2W A;  1ACV A;  2YV7 A;  3HVV A;  3OWS A;  4G0L A;  4IJ3 A;  1EA2 A;  4LZI A;  4QWT A;  1WMP A;  3DIE A;  3P90 A;  1NDO B;  5DAL B;  3HOH A;  1Z3E A;  2X49 A;  2WGQ A;  2FWG A;  3GA4 A;  2DIY A;  8RNT A;  3M9K A;  3ZIJ A;  1GSQ A;  1E3R A;  3SLU A;  5FW5 A;  5AEW B;  3RGA A;  5LD0 A;  3QFA C;  3CYN A;  2GXF A;  2YWN A;  2G2Q A;  2L1S A;  2YFI B;  4GST A;  3ZYW A;  1N8R 4;  5CRW A;  3FSD A;  1HQO A;  5H5Q A;  4LGQ A;  4BVY B;  3WR2 A;  3PPU A;  3K63 A;  2OKA A;  1E6B A;  1EEM A;  4OFN A;  3ZML A;  4KSM A;  3SXX A;  2M72 A;  3FLJ A;  4IQA A;  5JWQ B;  2DC5 A;  1SL2 B;  5IF6 A;  1CEW I;  2FWE A;  2CFK A;  2IFQ B;  2L59 A;  4KND A;  1BRK A;  2LYX A;  5DBQ A;  2PU9 C;  1DBY A;  2NPB A;  3PCR A;  4TVE A;  4LMV A;  4ILF A;  3FKA A;  3QRD A;  1MD3 A;  1ILO A;  1TK5 B;  4ID0 A;  3KZT A;  2WS2 A;  4O5Q A;  3AGO A;  4KCE A;  3FEU A;  5BU4 A;  1OF5 A;  5F07 A;  3KD0 A;  4RI6 A;  4LL1 B;  2KF4 A;  3ECF A;  5FT3 A;  4BL7 A;  1LOX A;  1ULI B;  1OUN A;  3NXJ A;  8CHO A;  4D73 A;  3CCJ 3;  5DAK A;  4L0W A;  3CSI A;  1LNI A;  1SK1 A;  1K0D A;  2F8A A;  5JCU A;  2GSS A;  2MMO A;  2K54 A;  1THO A;  2XPD A;  4R9K A;  1R4Y A;  2Z76 A;  5GSP A;  1V40 A;  1IYH A;  1MWS A;  1X1W A;  1Q9E A;  1JKG B;  2JL4 A;  4BL3 A;  4FMA A;  2H30 A;  4KAE A;  2O3O A;  3G7I A;  1FG4 A;  5IOW A;  2QC7 A;  5DAL A;  1RGF A;  1WE0 A;  4GWR A;  3UIW A;  2IYJ A;  1TFK A;  5DRE A;  3Q6O A;  4KDY A;  2JDI H;  1U8C B;  3LEF A;  3LOR A;  4TR0 A;  3SOY A;  3UEM A;  1XWG A;  3NX0 A;  1ROV A;  1Z5Y E;  4QL9 A;  4G9H A;  1B2M A;  3F63 A;  1YNV X;  1FHE A;  2XHF A;  2KLX A;  5A4W A;  1SJ6 A;  5DDL A;  4MAB A;  4BVY A;  4EC0 A;  1TP6 A;  1VQP 3;  2MMZ A;  2WOH A;  4IJI A;  4K2D A;  1X5C A;  1M0U A;  2VCQ A;  2RM6 A;  2NBS A;  4GSN A;  1FGQ A;  1ZO2 A;  3GIX A;  4TX4 A;  1Q42 A;  3LSZ A;  3Q2P A;  12GS A;  1UDI I;  2P0G A;  5IEP A;  4WWU C;  1ERU A;  4NV5 A;  3CPO A;  4HM6 B;  3UVH A;  2H6Y A;  5DQS A;  1BRN L;  5IEO A;  3J7Y k;  4JF8 A;  2IFQ A;  1R5P A;  3IMA B;  4IP6 A;  2GVP A;  2CH9 A;  3FZ5 A;  2Z7A A;  2GQM A;  2YN1 A;  5CF1 A;  2CX3 A;  3L9S A;  2ZHX B;  4YQV A;  1KQS 2;  3WOE B;  3NHX A;  1IT8 A;  3HVS A;  2H75 A;  1GTB A;  2W9Q A;  2AB6 A;  2OE1 A;  4WF5 A;  2WGO A;  1SJI A;  3TJF A;  2HRF A;  4OWY A;  4DKI A;  3KGK A;  2LQO A;  1U3I A;  2IIY A;  3F7S A;  1GUK A;  1PD2 1;  1T4Y A;  1GUL A;  2HNL A;  2N5F A;  3B8L A;  3DGM A;  2B3S A;  1WMO A;  3G4S 3;  1UA5 A;  2J8X B;  2K6V A;  3F9U A;  3WDG B;  3TOU A;  1BNG A;  3E0U A;  1UGH I;  2R3X A;  3IPZ A;  3HYP A;  1NNV A;  1DMM A;  4WBJ A;  4IQ1 A;  3QCP A;  1IQY A;  2VLT A;  10GS A;  2AUV A;  3IK7 A;  1UVZ A;  1VQO 3;  3FZA A;  1JKG A;  1I8V A;  1BED A;  4XS6 A;  4PQ1 A;  1KSI A;  2F99 A;  1QFN A;  4JR6 A;  4I2U A;  3WOD G;  4DEJ A;  4K5S A;  3BNC A;  2CWU A;  4CDO A;  4OCE A;  3VPT A;  1EG9 B;  3C7M A;  3Q90 A;  3ED3 A;  5CO3 A;  3HZ8 A;  4HDE A;  5HR3 A;  1R26 A;  5AN1 A;  4IEL A;  5D81 A;  3GUS A;  2VCT A;  4N6U A;  1Q82 4;  2Y74 A;  2HSY A;  5AI1 A;  3LTB A;  1GYB A;  1GMQ A;  1M90 4;  3WYW A;  1X9S B;  1SYR A;  3BNE A;  1GP1 A;  2QA1 A;  4YH2 A;  2HRN A;  3GZX B;  2OAD A;  1EGR A;  1LJR A;  3KH7 A;  5CK6 A;  2MF7 A;  4FH8 A;  3HZP A;  3FR9 A;  2C11 A;  3QOU A;  1RGK A;  2CQ9 A;  3EMX A;  2MMN A;  5F0G A;  1IT7 A;  2VL3 A;  3H1N A;  2FXT A;  1WWJ A;  1NWW A;  1UGI A;  3KKG A;  4OFT A;  1AQV A;  4H61 A;  2AAE A;  2XBI A;  1I9D A;  3C1R A;  3M9J A;  4OCF A;  1NW2 A;  1YGW A;  2B1K A;  2P0M A;  4GHO A;  1T8E B;  4KE3 A;  3WGX A;  3E9J B;  3N54 B;  2C0D A;  3LOY A;  2PNC A;  1ERT A;  4HI7 A;  1WP0 A;  3F4R A;  1WMJ A;  3U1W A;  1GTU A;  5DJL A;  3ZFZ A;  1TRS A;  4CPK A;  2H71 A;  2IME A;  2WDU A;  3RAZ A;  3X3Y A;  3D6I A;  4P3Y B;  4MNN A;  2FA8 A;  5ECM B;  1BAY A;  3MYD A;  1Y25 A;  1EGO A;  4HJM A;  1GSE A;  1GY6 A;  2R4V A;  1EP7 A;  2CW9 A;  1ZL9 A;  5DJM A;  1SL1 B;  1W01 A;  5G30 A;  1SL0 B;  2OE3 A;  1IQ8 A;  1K28 A;  1CH0 A;  3PGB A;  4NXI A;  2ZUP A;  1XFL A;  1XW6 A;  4L0U A;  1TKD B;  5ECQ B;  3SWL A;  3CC4 3;  1UCI A;  3ZRE A;  4J2F A;  1TRU A;  3CCQ 3;  2KF5 A;  1B3S A;  1E2Y A;  3BD2 A;  2V6K A;  1BVI A;  4BVX B;  4L8E A;  4HS1 A;  3IJE B;  4N6N B;  5FHI A;  1FUT A;  2OAC A;  4Q5N A;  3LXT A;  3LYG A;  4PQI A;  6STD A;  2UGI A;  2BU4 A;  2FUG 2;  2NVL A;  3NM7 A;  2GEY A;  3P2A A;  4QL7 A;  3KM6 A;  2RUF A;  4EF0 A;  3CTF A;  1R4W A;  4I8B A;  7STD A;  1VQQ A;  3DRN A;  2CIU A;  4KA0 A;  3RPN A;  4GXZ A;  1K0A A;  1XZO A;  1BU4 A;  1LQM B;  3ZVJ D;  4HOJ A;  1J2B A;  4JZQ A;  4F03 A;  3ROB A;  3HJO A;  1IVW A;  5D83 A;  1AIU A;  1RJO A;  1B20 A;  2LQQ A;  2AAW A;  4POB A;  1T2H A;  1ERV A;  3HJM A;  5COH A;  1W6Y A;  1S72 3;  4RQR A;  3EWL A;  4IVF A;  3BCI A;  2EIO A;  1BRI A;  3GNJ A;  3IAS 2;  1K0N A;  2Z77 A;  5ELU A;  1DYU A;  1BSA A;  3JVC A;  2KF3 A;  1GD3 A;  1MDI A;  1BX9 A;  3TKR A;  4FR9 A;  1AW9 A;  1PKW A;  3MKI A;  2FWH A;  2K18 A;  3US3 A;  4L8P A;  1E3V A;  1AAZ A;  2JQ5 A;  1SPU A;  2L6C A;  5H5S A;  4AGS A;  1BSB A;  2O9U X;  5D9T A;  4HM3 B;  4N6T A;  4DSQ A;  4WBR D;  3UBL A;  4N3V A;  3N8B A;  2GSP A;  6GSS A;  5CP1 A;  3O3T A;  1PFO A;  4GL6 A;  4HSC X;  1K3O A;  1PL1 A;  2CZ3 A;  1RGC A;  1PU4 A;  4Z7X A;  1GD4 A;  1TP9 A;  1G0T A;  1JNQ A;  4ISD A;  3MSZ A;  3TRQ A;  1WMN A;  3JCM L;  7RNT A;  1BNJ A;  5JWR B;  3FYG A;  3OXA A;  3LJR A;  1HZ1 A;  4TXO B;  3IC8 A;  5IER A;  3K7C A;  1GSS A;  3LT9 A;  4N6L A;  1YKC A;  4JRR A;  4I4K A;  1S3R A;  5HFG A;  1N5H A;  1MWU A;  3VK9 A;  1ROA A;  4BVX A;  4IBP A;  3MNG A;  5AYS C;  3I0Y A;  1QVG 2;  3KP9 A;  4MF6 A;  1OGX A;  3EN1 B;  2F98 A;  1USB A;  2JZR A;  3GUR A;  3GKX A;  1KWI A;  1S5A A;  2D2Z A;  3HJP A;  1QVF 2;  2E2U A;  4YQM A;  4I5Q A;  5D82 A;  3H51 A;  2CFW A;  3HXS A;  3PZW A;  4MA9 A;  3BND A;  3ZVJ A;  5LNK e;  3GKM A;  2H0G A;  3ME8 A;  4BA7 A;  4BTW A;  3FZ9 A;  4ULX A;  4HBR A;  1EOH A;  4MDC A;  1LNH A;  1GNE A;  3G7J A;  3GX8 A;  4HJL B;  1ST9 A;  3EF8 A;  1O85 A;  4HOH A;  3NOF A;  1MGW A;  4PUF C;  5IO2 A;  1GWC A;  4JR4 A;  3VFI A;  2ES7 A;  4KDU A;  3VWU A;  4XS1 A;  4XS4 B;  5ECS A;  2H8L A;  1RGG A;  1DE3 A;  3QAV A;  2RBI A;  3A2X A;  1SII A;  3GN3 A;  3JUQ A;  4GB5 A;  4YAV A;  3UBK A;  3PS8 A;  3A3T A;  2PMT A;  3SOA A;  4PTS A;  3AHS A;  2B1L A;  4HZ9 B;  2JSZ A;  4N6O B;  2VUP A;  1M9B A;  2Z6B A;  5E59 A;  5BVB A;  4HM5 B;  5G2G A;  1Q40 B;  2QEX 3;  1Q7Y 4;  2B6M A;  3CMI A;  2XEP A;  1F3B A;  1JZD A;  1XWC A;  2F8F A;  2YWO A;  1FGR A;  1A24 A;  4R1K A;  1FVJ A;  1PA3 A;  1DVD A;  3U97 A;  3LT8 A;  1YDK A;  4OD7 A;  1W2Z A;  3UJM A;  1BSD A;  6GSP A;  2I3Y A;  5IOX A;  2HYX A;  4EDZ A;  3HZ4 A;  1X9M B;  2UZ8 A;  1YY7 A;  3KSP A;  2B24 B;  2BHM A;  2YNX A;  4G0K A;  2CX4 A;  4POL A;  2GLR A;  2H1B A;  4FQU A;  4F0B A;  2X8C A;  5IMC A;  1QUW A;  1H75 A;  1Q98 A;  1YQ1 A;  4TXO A;  1ULJ B;  2YP6 A;  4Z2T A;  1PQN A;  3Q1C A;  1M1K 4;  3F3R A;  1C7H A;  5AYR B;  1MEK A;  3IHQ A;  1TI3 A;  1F2E A;  1A0R P;  1GL8 A;  3APO A;  1QXH A;  3MPH A;  3LYP A;  3LTA A;  1ZYP A;  3EU4 A;  3UL6 A;  4V1A p;  2XPE A;  1I0V A;  1O6J A;  1MGR A;  1OYJ A;  4MMM A;  5GSS A;  4GSS A;  1XPV A;  2SAR A;  5IMD A;  1GSU A;  1B2X A;  5G1K A;  2QA4 3;  2F4Y A;  2HZF A;  5M18 A;  5IPG A;  2DLX A;  1BYE A;  1V9W A;  2LJA A;  3FRC A;  3BCK A;  4AJ7 A;  4KCA A;  4GQC A;  1WNH A;  2X8H A;  3GZY B;  2H74 A;  3KZQ A;  1JJ2 2;  2C0F A;  2OA7 A;  3WHO A;  1BSC A;  1V2A A;  3TRX A;  3EUR A;  1GUM A;  4XIH A;  3DVW A;  3LYK A;  4LSO A;  1YVS A;  2PUK C;  6GSV A;  1WIK A;  1FGM A;  3UL3 A;  4ZBB A;  3IOS A;  3VUR A;  4CY8 A;  4XS4 A;  4XTS A;  2STD A;  1NM3 A;  1PYL A;  4HU9 A;  2H0I A;  4LMI A;  4EXJ A;  1OCV A;  1FW1 A;  2VM1 A;  1RCL A;  5JPU A;  5ID2 B;  4KZ1 A;  2VOC A;  3B4O A;  2OWP A;  16GS A;  2H1G A;  1ZYE A;  4FIW A;  1SD8 A;  2WO0 A;  1BNI A;  4R9L A;  2GGT A;  3VLN A;  5ELG A;  4HKV B;  1Q40 A;  2VCV A;  2HMO B;  1TTZ A;  1F9M A;  1PFP A;  3JUP A;  5DRV A;  1HD2 A;  4OVM A;  1IVV A;  4K7I A;  5BXQ A;  4HM8 B;  4N6V 0;  2EIQ A;  4HJ2 A;  1FUS A;  3SX1 A;  1A2J A;  1LXE A;  4MCU A;  3G16 A;  4KDX A;  2IJY A;  5EQL A;  1J9B A;  4AJ6 A;  4FYU A;  4GCI A;  5ECN B;  1YEP A;  1BAN A;  4BTX A;  2L5L A;  2FNO A;  4EDY A;  3HI7 A;  7GSS A;  3C1S A;  2F5W A;  3CMA 3;  4KW6 A;  1AY7 A;  5JPP A;  1JBS A;  4K0G A;  4WP5 A;  4KX4 A;  5ECH B;  4ORL A;  1T7P B;  2FWF A;  2ALB A;  3MIX A;  1Z6M A;  4OO5 A;  1JBT A;  2BJX A;  4R80 A;  4ECI A;  1J08 A;  3KMN A;  3L0R A;  4Q5Q A;  2KXG A;  4IPB A;  4KFF A;  4YAP A;  5IMV A;  1IVU A;  5ECO B;  1MNL A;  3IK9 A;  1BRH A;  2P31 A;  3HHV A;  1B2S A;  3CRT A;  4MMZ B;  3ERF A;  1EP8 A;  3ERG A;  4BIK A;  3F14 A;  4JBB A;  3FG3 A;  2RSX A;  2HSM A;  3ZIT A;  3GST A;  3FG4 A;  1IDP A;  3IA1 A;  2WUL A;  2V2G A;  3IAM 2;  3D0Z A;  4ZM8 A;  2CK3 H;  3CCM 3;  1XWB A;  3EIN A;  2YWM A;  3TJB A;  2DJ1 A;  1IVX A;  1TK0 B;  2BMO B;  3HVN A;  3EJV A;  2ZNM A;  2DMM A;  3TJJ A;  3CME 3;  3S5C A;  2O85 A;  3M3M A;  1RLS A;  2LUS A;  1FO5 A;  1DMN A;  1BUQ A;  1OE8 A;  1HU9 A;  2ML5 A;  4EIQ A;  3T8N A;  5KN3 A;  2F51 A;  3OWU A;  5B7C A;  5D73 A;  3MG3 A;  1EV9 A;  3D79 A;  2KOK A;  1QMV A;  2F3M A;  2H19 A;  2O87 A;  4LMW A;  5ID2 A;  2ZDJ A;  2CG0 A;  1QAF A;  2VCZ A;  3F8U A;  1AV4 A;  3T0U A;  4K61 A;  4KSO A;  3MG1 A;  2X4A A;  3W6G A;  1F37 A;  5JBS A;  2HMJ B;  3CPW 2;  1PGT A;  1FZU A;  1QAL A;  3FKF A;  4AF2 A;  3SED A;  2V1M A;  4X43 A;  2CAQ A;  3HIG A;  4FO5 A;  3UVT A;  3FH1 A;  3NUV A;  3QFB C;  5F06 A;  1JLV A;  5D8I A;  1NB5 I;  4ZXG A;  2OE0 A;  3H3H A;  1XVQ A;  2YZU A;  4IGJ A;  1JBR A;  1XG8 A;  4G1M B;  5G31 A;  5HR1 A;  3I56 3;  3PYJ A;  1N2A A;  1TDI A;  1C54 A;  4MPF A;  1BIR A;  4WXT A;  1GSD A;  1AC1 A;  5A4U A;  1LRA A;  1N9E A;  1SAR A;  2PER A;  3UMA A;  3P7X A;  3E99 A;  3LFL A;  3WT1 A;  3NBR A;  1FB0 A;  3C8E A;  3GZR A;  5IG3 A;  2VLV A;  1OH0 A;  1VQK 3;  1E97 A;  2PPT A;  3L4N A;  4V2M A;  3BNB A;  6GSX A;  2C0E A;  3VSY A;  2AJQ B;  4K90 B;  4MMX B;  1GTI A;  20GS A;  4K2X A;  2WRT A;  2HML B;  9GSS A;  3JUN A;  3FCS B;  1W00 A;  1SU9 A;  2E0Q A;  3WT2 A;  17GS A;  4PNG A;  2IL3 A;  4ECC A;  1O7W B;  1B27 A;  3ZRD A;  4EE0 A;  2XGL A;  2IMK A;  4WKW A;  1RKY A;  2B5X A;  2LRC A;  4K8M A;  1W6G A;  3FR6 A;  3HCZ A;  1Y6E A;  1FUW A;  3HVX A;  2C1Y A;  2GTU A;  2CG1 A;  1NB3 I;  2WGR A;  1X1X A;  1TIJ A;  2LTK A;  2MYG A;  2P5Q A;  1SKS B;  1I5G A;  1VF4 A;  1A0F A;  3J7Y d;  1OAZ A;  3C71 A;  2JZS A;  1RK4 A;  6GSW A;  2CZ2 A;  4NHZ A;  1ZX2 A;  4N6M A;  4KB3 A;  2PGT A;  2YFL B;  2RFR A;  4RBN A;  5BRT A;  3EPT A;  3BB9 A;  3DYR A;  1GH2 A;  5J5N A;  3MHE A;  4EL1 A;  2IA7 A;  3EC3 A;  2CX0 A;  1ASK A;  1DE2 A;  2XC2 A;  1B48 A;  4BWS A;  3GL5 A;  3X3Z A;  2CKF B;  2B5E A;  3OW2 2;  3UAR A;  2SBL A;  1GSP A;  4GRF A;  2X99 A;  11GS A;  2HOH A;  2G0F A;  1O7N B;  3IR4 A;  1M2D A;  5J3R A;  5D9W A;  4YKF A;  1ZZY A;  2Z9S A;  3L9V A;  4EO3 A;  3GSP A;  1XCC A;  2R4I A;  2MBT A;  3DGL A;  2PVQ A;  2TIR A;  3GRD A;  1D6Z A;  4N11 A;  3UJ1 A;  1UI8 A;  1B9X C;  1XOB A;  4FMB A;  3HK4 A;  3KEB A;  4NHW A;  1NHY A;  2L6D A;  1GLQ A;  2J9H A;  2DJ3 A;  5IQY A;  3KII A;  3K5T A;  1KD1 4;  2E2M A;  3NBJ A;  1N5P A;  1UN2 A;  1JB4 A;  4DSR A;  3FMW A;  3S29 A;  1O8X A;  3ZFB A;  5HR2 A;  3UAP A;  3D5G A;  3FZ4 A;  1PKZ A;  1AQX A;  1JZR A;  4ZL9 A;  3QPM A;  5G5E A;  1JB2 A;  1OC8 A;  1R4C A;  2HFD A;  2I9H A;  5STD A;  3QDN A;  4WR5 A;  4G19 A;  1LOY A;  2CX1 A;  4H86 A;  4NMU A;  2OOV C;  4J57 E;  2VAF A;  1TUH A;  4Q5F A;  2ON5 A;  4ZB8 A;  1X5E A;  1BNF A;  4J5G A;  4ZIL A;  1UCJ A;  5IM9 A;  3TKS C;  1EWX A;  3B7C A;  4K1V A;  2ML6 A;  3I6A A;  4PUR A;  2CC3 A;  1YJW 3;  3NQZ A;  3EYT A;  2KCD A;  1TU8 A;  2QKE A;  2XBQ A;  13GS A;  2I1U A;  2GQL A;  1M1X B;  2LNS A;  1NU3 A;  3F6F A;  3ISO A;  3APQ A;  1N8Q A;  2YOI A;  3O76 A;  4ZB9 A;  2VCX A;  2I4A A;  2L57 A;  5D96 A;  2BT3 A;  1CYU A;  2XGN A;  3D21 A;  2L5O A;  1B4P A;  2YPM A;  4BIR A;  1TK8 B;  2HMK B;  1W5Z A;  2W2C A;  2H1D A;  2MMA A;  4WHA A;  2HSH A;  2P09 A;  3RGR A;  2FD3 A;  5AIG A;  5A0O B;  3FZW A;  2HRA A;  3RPP A;  5C00 A;  5EVH A;  2GT6 A;  2HT9 A;  1UCL A;  5J41 A;  4OK0 A;  1K3L A;  18GS A;  2PWJ A;  4ZL7 A;  1CQS A;  1K41 A;  1TRP A;  1Q81 4;  4U13 A;  5IG4 A;  3D4T A;  2CVK A;  2VL9 A;  5B8A A;  1G96 A;  2CWV A;  1Z6N A;  2HI7 A;  3DY5 A;  5ECK B;  3V1W A;  4O5U A;  1TOF A;  1VQN 3;  2IMJ A;  2ON7 A;  4L7K A;  3EC9 A;  4MJE A;  3X41 A;  2L4C A;  3STD A;  4IHU A;  1QMA A;  3ME7 A;  1R7H A;  3P8W A;  5C04 A;  1FOH A;  1NO3 A;  1T2I A;  1OPY A;  1RGE A;  1OKT A;  1VQ4 3;  3VF1 A;  4ZB6 A;  3ZIV A;  5IO0 A;  5F05 A;  4K1U A;  4XBX A;  3CC7 3;  4IW9 A;  2VL2 C;  3GTU B;  1VQ6 3;  3FF2 A;  4K0N A;  4MPG A;  3ZMK A;  1JN5 B;  1XBS A;  4N30 A;  2QGU A;  1W4V A;  3G71 3;  4HUA A;  4ZBD A;  2GDR A;  2MC8 A;  3LTC A;  2AHE A;  1DET A;  1STF I;  3KFQ C;  1M3J A;  1JFU A;  4LLR A;  2E2V A;  2CFD A;  1K0B A;  3LW9 A;  1O7G B;  1U6T A;  4TR3 A;  1Z1S A;  2YWI A;  4JED A;  1RN1 A;  5LCZ A;  22GS A;  1V74 A;  3F9S A;  4FCM A;  2B5Y A;  1VZZ A;  5G5F A;  4AJ8 A;  3WA2 X;  2OQE C;  5CRE A;  2GQK A;  4HVN A;  1K73 4;  1M3I A;  1VRS D;  1RNT A;  4QQ7 A;  4MZB A;  4KUN A;  1HKX A;  3X42 A;  3MWZ A;  1TRW A;  1RQM A;  1BUJ A;  1OC9 B;  5ECL B;  1I0X A;  4X0X A;  1T3B A;  5D93 A;  3W8J A;  5M19 A;  5LC7 A;  2JU5 A;  4FYC A;  1B4Q A;  1WPI A;  2FGT A;  14GS A;  4AKZ A;  2JAD A;  5DVB A;  3DGY A;  2W04 A;  2M80 A;  1S3A A;  3EX9 A;  2E7P A;  1ZGX A;  2YV9 A;  1J0F A;  1PL2 A;  2UUG C;  5EY6 A;  2CA8 A;  3CSJ A;  2VIM A;  1EKM A;  2GSQ A;  2HMN B;  5IG0 A;  1Q4J A;  4MZW A;  3TKQ A;  1A2M A;  2FA4 A;  2R6K A;  3PIN A;  3ER7 A;  1B21 A;  1U5O A;  3GX0 A;  1YIJ 3;  5J4U A;  4J9A A;  2OJL A;  3PCS A;  3ZL5 A;  2GU1 A;  3KE7 A;  5HR0 A;  2DJ0 A;  1OHS A;  1MWR A;  1G7E A;  2C0G A;  5IEN A;  1BNE A;  4NRE A;  4L5L A;  3F6D A;  3TJG A;  1RW1 A;  1TFO A;  1IV7 A;  3OV4 A;  2GT5 A;  2DSA A;  1W4N A;  2JSY A;  3IE3 A;  2W0Q A;  5KN2 A;  3WOF B;  4X4J A;  1I2F A;  4KF9 A;  19GS A;  4HAA A;  4BL2 A;  3CCV 3;  3I55 3;  4NV2 A;  1Z7R A;  1GLP A;  1Q86 4;  4NHF A;  1RRH A;  3GWR A;  3E3E A;  2WJU A;  3IC4 A;  1A23 A;  2QA2 A;  1WRY A;  3GTU A;  5KEJ A;  2A15 A;  2GZY A;  4PUA A;  3GL3 A;  2YJH A;  3TCO A;  1JN5 A;  3CBU A;  1RHL A;  4J8T A;  5JCW A;  2IMF A;  2OCT A;  4DVC A;  4A5P A;  1PX6 A;  3DD3 A;  3AMO B;  3F3Q A;  3GV1 A;  3CXC 2;  1LOW A;  4EUY A;  1VF1 A;  4TKY A;  4EXR A;  5BMU A;  3K0Z A;  1SQW A;  2C10 A;  3WA3 A;  2GST A;  3A2V A;  3F8H A;  2VD1 A;  2WFC A;  3G7Y A;  3ZG0 A;  1MOL A;  1O7H B;  2A2R A;  3FK8 A;  2DJK A;  1SJZ A;  3ZTL A;  3NQY A;  1VQM 3;  3MWH A;  4OFM A;  1XWA A;  3IXR A;  1ZGN A;  1SK2 A;  1BJX A;  4AKY A;  4BU4 A;  2RM5 A;  3CNX A;  3CU3 A;  1O7P B;  1VF3 A;  1DE1 A;  2OBI A;  1SYX A;  1X5D A;  3D3L A;  2V32 A;  1S3D A;  3MG2 A;  1DMQ A;  5AEU B;  1OC9 A;  1YKA A;  2A4H A;  2C4J A;  1W7C A;  1OHP A;  4KVH A;  2LNT A;  5HQP A;  2RLI A;  4ML1 A;  3EHC A;  4RQX A;  4TOP A;  1ZYQ B;  4PEJ A;  1VQ9 3;  2IUK A;  4EVM A;  1KNG A;  2NTO A;  4ZIJ A;  3RHB A;  5J9C A;  3L0H A;  5G1L A;  2K9F A;  2CVD A;  2KUC A;  1L5G B;  4MH2 A;  1AVK A;  4HM0 B;  2EIR A;  2IN3 A;  2O8V B;  3KP8 A;  4JE1 A;  4EIP A;  1K3Y A;  1W02 A;  3GH6 A;  2GBW B;  3V98 A;  2AYT A;  1Y4K A;  2I9W A;  3NIV A;  1RCK A;  1YVB I;  3K8N A;  5GST A;  2LRN A;  3H8Q A;  3GFK A;  3BJ5 A;  5AIS A;  5GAN D;  4PX1 A;  1A2K A;  3M8N A;  4GQF A;  3S9F A;  1V57 A;  2W56 B;  2XSH B;  1A90 A;  1K8A 4;  3D5J A;  1AQW A;  4O3V A;  2R41 A;  3GZB A;  1F6M C;  3VGN A;  5CF2 A;  2DIZ A;  4RI7 A;  1G6Y A;  2LRT A;  3DWV A;  4YKG A;  5IW9 A;  3FGY A;  2YAN A;  5KN1 A;  1HNC A;  1VQ8 3;  1PN0 A;  2YCD A;  2A2S A;  2DKI A;  3CD6 3;  1LU4 A;  2HLS A;  1BRJ A;  3AMO A;  4LYL B;  3X3X A;  1LBK A;  3LQ7 A;  2DBC A;  3KIJ A;  1TXX A;  5ELJ A;  1V98 A;  2OTJ 3;  2W03 A;  2C80 A;  2RNT A;  2H01 A;  1A67 A;  3JUO A;  1BRS A;  4ZBA A;  1FVK A;  2FY6 A;  2BMX A;  4O8S A;  3N5O A;  4IP1 A;  1OGZ A;  3WD6 A;  3BLZ A;  3Q3F A;  2TRC P;  1FB6 A;  3QR6 A;  1EV4 A;  4GLT A;  4O32 A;  1STD A;  2BO9 B;  4POK A;  2CV4 A;  1UW1 A;  1RRL A;  1U3A A;  2PN8 A;  1LOV A;  5CRG A;  1VQ7 3;  5J9B A;  4PNF A;  1RMS A;  3EN8 A;  3VI7 A;  1RNB A;  4F2I A;  5BIR A;  1HNB A;  4EBG A;  1O81 A;  2Y73 A;  1GTA A;  3Q74 A;  2R0P A;  2GS3 A;  4WEY A;  2HZE B;  3V99 A;  3CCS 3;  2YFJ B;  3UNL A;  4L8O A;  3CXG A;  3RHC A;  3ERW A;  1SD9 A;  4HM1 B;  5ECR B;  1YZX A;  3BIR A;  1EEJ A;  2ZCT A;  3KTL A;  4N0Z A;  5LC6 A;  4ICY A;  1O7M B;  4CHS A;  3TJK A;  3A5I A;  1TTO A;  3D9R A;  4RNZ A;  1K0M A;  4K5R A;  5IMA A;  2R0G A;  2IMD A;  1AXD A;  4XRD A;  5AIX A;  4ECJ A;  2KP2 A;  1GOU A;  3VWX A;  4J5K A;  3C73 A;  2LS5 A;  5B6M A;  3D4A A;  3A5W A;  3QAW A;  3KXO A;  3EU3 A;  3CRU A;  3LXZ A;  3K9M C;  1QAK A;  4LEH A;  2V41 A;  2W56 A;  3F40 A;  1YJ6 A;  2MBS A;  3APS A;  4IKH A;  2L4V A;  2VO4 A;  3G9B A;  4MF7 A;  5GZZ B;  1T5Y A;  3VI5 A;  2MZC A;  2IPA A;  1ISK A;  1JZO A;  1OHO A;  1A2P A;  2OOV A;  2GZZ A;  3EMP A;  4WR4 A;  2F9S A;  1SJW A;  1YJN 3;  4HZB B;  5AIH A;  3TKS A;  4BWQ A;  4POM A;  5F8B A;  4JRF A;  2M46 A;  4Z2U A;  1BQ7 A;  4V1A g;  1AVL A;  2I81 A;  1BNS A;  3EE2 A;  3LML A;  3LZA A;  4XBT A;  3MAK A;  3HD5 A;  4AEQ A;  4HQZ A;  3CCE 3;  3IPT A;  4MLY A;  2Q07 A;  5HOH A;  1NSW A;  1KTE A;  2P5R A;  1I70 A;  3KTB A;  4HM7 B;  2REM A;  2OTL 3;  3WGE A;  2DJJ A;  3DGN A;  2J23 A;  3U6V A;  3ZLP A;  2LQV A;  1X1U A;  1T00 A;  1FA3 A;  2D1W A;  1KEB A;  4MF5 A;  1PRX A;  2C3Q A;  2HXK A;  4EW5 A;  3F7X A;  3GYK A;  5RNT A;  3GKN A;  1D6U A;  2CT6 A;  3SBC A;  1DVC A;  2F56 A;  3GSS A;  5IMZ A;  1PSQ A;  3DH2 A;  3SYU A;  2W9P A;  4KT3 B;  3CSH A;  2YX9 A;  3BOA A;  2YZH A;  3I69 A;  5HGR A;  2HZE A;  2R37 A;  3LG6 A;  1ZOF A;  1G6W A;  2XH9 A;  5I97 A;  1G02 A;  3QAG A;  2INX A;  1RGH A;  3GHA A;  4OMV A;  1JRQ A;  4MK3 A;  3DZL A;  2KRT A;  4MEI A;  1WJK A;  3ALA A;  1XVW A;  1QJG A;  2AV4 A;  4USS A;  5CNW A;  4KH7 A;  3BU4 A;  3IRA A;  2H1A A;  3DUK A;  4O92 A;  4MP4 A;  3UOM A;  4IIA A;  1GY7 A;  1RSN A;  3S28 A;  2VCW A;  1YEX A;  5E4W A;  3VWV A;  2R2J A;  1EUI C;  4N0V A;  3OX9 A;  3SVA A;  2LEG A;  4F0C A;  3BBY A;  3I43 A;  1H4O A;  1ZYN A;  4HZ2 A;  3TB2 A;  3N9H A;  4WF4 A;  1UI7 A;  3FR3 A;  1EZK A;  1GRX A;  1RGL A;  3N9J A;  1G7O A;  1NHO A;  3EBY A;  2VL2 A;  2GSR A;  1RTU A;  3F0I A;  2XF3 A;  2NDO A;  3WGD A;  5ELA A;  2AAD A;  1EOG A;  6GSU A;  1BSE A;  2HE3 A;  4HM2 B;  2B7J A;  3H93 A;  3KH9 A;  4K6X A;  4STD A;  1I2G A;  1IYI A;  3QK9 A;  5A5K A;  2KAA A;  5CRD A;  2VM2 A;  4Q53 A;  1OAC A;  1M7T A;  2CWT A;  1MDJ A;  1XW9 A;  1W89 A;  1U87 A;  2L4Q A;  4IN0 A;  1GUH A;  4FMC A;  2QIY A;  5EL8 A;  1JLW A;  1IK3 A;  1HNA A;  7GSP A;  2KHP A;  4J56 E;  3AY8 A;  1FGT A;  4N10 A;  3J7Y b;  3G6E 3;  1Q7H A;  1N9J A;  3A5E A;  2OQE A;  5IG5 A;  4MMY B;  3U5R E;  5ENU A;  2F86 B;  1TU5 A;  3QMX A;  2VD0 A;  2K0M A;  1GS3 A;  2B7K A;  4NWY A;  3UL5 A;  3D5I A;  3H79 A;  4FYB A;  2M7O A;  1VQL 3;  1TU7 A;  1I3I A;  4OUQ A;  3EE1 A;  4KFE A;  2FCH A;  2LV3 A;  1GMR A;  2C8U A;  1X9W B;  5DQY A;  1UC7 A;  2D42 A;  5IIZ A;  3TRP A;  2JAC A;  4MZC A;  3AHW A;  1Z9H A;  2PVO C;  2GBX B;  4FMD A;  3VWW A;  3KCH A;  1A8Y A;  1HYU A;  1CYV A;  2ZL8 A;  3HII A;  1N8J A;  1DSB A;  1RDS A;  5GAP D;  3RDW A;  3L9U A;  3KSE D;  4BTY A;  5KP4 A;  1ERW A;  1JB5 A;  1GNW A;  1VQ5 3;  5DCH A;  1BRG A;  3M0F A;  4MJC A;  2B1X B;  1YJ9 3;  2F5M A;  2K3D A;  2X64 A;  4BPY A;  2LJK A;  5M1A A;  4O5R A;  5ECI B;  2A2P A;  1SIH A;  2HRK A;  5FWG A;  1JHB A;  1GY5 A;  3FF0 A;  2CVB A;  1B2Z A;  5DCG A;  2RCD A;  3W8S A;  1QGV A;  5EEO A;  1C72 A;  3B4P A;  1O7U A;  2VLU A;  3TKP A;  5JCG A;  1YGE A;  2E2T A;  2XR8 B;  1BG5 A;  1IQX A;  4LA1 A;  1AR0 A;  2K8S A;  4JU5 A;  4WET A;  3ZZX A;  4XBY A;  4K7O A;  2GZP A;  2LST A;  1VF2 A;  4R4K A;  2CFL A;  1ZMA A;  3ZG5 A;  5KN0 A;  4MH3 A;  3PXM A;  4KFD A;  4CDL A;  5KP1 A;  5FGO A;  5D9X A;  2FNQ A;  3FG1 A;  1ON4 A;  4NPB A;  9RNT A;  3HDC A;  1M2B A;  6GSY A;  4TXV A;  1W2B 2;  2ZA4 A;  1GMP A;  2BMQ B;  3IDV A;  2H73 A;  3LH4 A;  3CCR 3;  4E8E A;  1OKD A;  2C3N A;  2P0X A;  4MJB A;  2W6J H;  1I2E A;  4ECB A;  1QK8 A;  4TR1 B;  1PY3 A;  3OR5 A;  5CAX A;  2QSI A;  4PGT A;  3KN4 A;  3EQQ B;  4G0I A;  1T1V A;  4TR4 A;  1B9Y C;  1SEN A;  3OWY A;  1UUV B;  3DVX A;  1DUG A;  2WCI A;  1TW9 A;  1THX A;  5B8B A;  4EC6 A;  2CFG A;  1A8L A;  2H6Z A;  4PQH A;  1PX7 A;  1GOV A;  1RGA A;  3IHG A;  8GSS A;  3DEX A;  1ABA A; 
#chains in the Genus database with same CATH homology
 4GTU A;  4I97 A;  1M9A A;  2PBJ A;  5EPF A;  4NAX A;  2N5B A;  3R3E A;  5HFK A;  4ACS A;  1ML6 A;  3RBT A;  1YF1 A;  3F4S A;  3TDG A;  4Z2R A;  4V2N A;  3IBH A;  6GST A;  4RUV A;  1SKR B;  2H66 A;  4XCS A;  4CW9 A;  1X0R A;  1JZW A;  4TN8 A;  1MTC A;  1URM A;  1TJD A;  4XRA A;  2K8V A;  3PGT A;  3D4M A;  1K0C A;  5HFI A;  5CRH A;  3HA9 A;  2RII A;  1FAA A;  1XW5 A;  3FW2 A;  2N5A A;  2WB9 A;  3ZFL A;  4O7H A;  5IMF A;  5B6N A;  4ZL8 A;  2CAI A;  2TRX A;  2X8G A;  3PH9 A;  2JZT A;  1M99 A;  2O89 A;  3EVI A;  1PN9 A;  2EC4 A;  4I6X A;  4IS0 A;  3IV4 A;  1TRV A;  2R0C A;  4HZ4 A;  3DML A;  5CYY A;  4X1U A;  1GSY A;  4V2L A;  1KBN A;  3DXB A;  3GKK A;  1S3C A;  5A4V A;  4TR1 A;  1M2A A;  3QD9 A;  4G2E A;  1PMT A;  4HEA 2;  1O8W A;  2E2G A;  3KCM A;  4TW5 A;  3I9V 2;  1CQH A;  2C3T A;  5AGY A;  2QGV A;  2WZ9 A;  2H6X A;  3GMF A;  3MDK A;  3R2Q A;  1OE7 A;  3PR8 A;  4K7N A;  2IMI A;  2O7K A;  4Q5R A;  5KOW A;  1QQ2 A;  3DKS A;  2DML A;  1A2L A;  5EVO A;  2LJR A;  4G10 A;  4CY6 A;  2R5G A;  4ML6 A;  2H72 A;  3F4T A;  5IPH A;  2DJ2 A;  4PXO A;  3Q19 A;  4DSS B;  1T4Z A;  5ABR A;  1OVN A;  2DKH A;  1V58 A;  5D9V A;  4OO4 A;  1XWK A;  3GRX A;  5ECP B;  2A4V A;  1B8X A;  1U88 A;  2RUE A;  3TKS E;  2FLS A;  1O73 A;  5INY A;  1WOU A;  3O6T A;  2OBK A;  5KOX A;  4I2T A;  3HY2 A;  2H0H A;  1ZCP A;  2BTO T;  4L5O A;  3CTG A;  4F82 A;  1FOV A;  3Q18 A;  3NZN A;  3L78 A;  2YJ7 A;  2H70 A;  1R5A A;  5H5R A;  2LKU A;  1AUC A;  4K1F A;  1XXU A;  4YQU A;  2IWT A;  1MDK A;  3LGC A;  1CQG A;  3H4K A;  4F9Z A;  4HU7 A;  2H76 A;  1XOA A;  5JWO B;  5G2Z A;  3VPQ A;  4K9Z A;  1SK0 A;  2IY2 A;  1F3A A;  2V6O A;  4LL4 B;  3M1G A;  1YF0 A;  3FHK A;  3TGZ A;  4MJA A;  1K0O A;  2FHE A;  3TOT A;  4HQS A;  3KJY A;  5AIV A;  1VGL A;  2FGX A;  4TRX A;  4BL7 B;  1MD4 A;  4D73 B;  2KP1 A;  1OC3 A;  5L71 A;  5DAK B;  1XIY A;  3FY7 A;  4XHM A;  4KGI A;  3KMO A;  3TUE A;  4EKZ A;  3D22 A;  4GF0 A;  1Z7P A;  3DGQ A;  3GH9 A;  1SKW B;  1GSF A;  4DSS A;  4E8H A;  3HKR A;  3LWA A;  3A2W A;  1TI1 A;  4IJ3 A;  3HVV A;  4G0L A;  1ACV A;  2YV7 A;  3DIE A;  5DAL B;  3P90 A;  1Z3E A;  2X49 A;  2FWG A;  3GA4 A;  2DIY A;  3M9K A;  3ZIJ A;  1GSQ A;  5LD0 A;  3QFA C;  3CYN A;  2YWN A;  2G2Q A;  4GST A;  3ZYW A;  5CRW A;  1HQO A;  5H5Q A;  4BVY B;  3PPU A;  2OKA A;  1E6B A;  1EEM A;  4OFN A;  3ZML A;  4KSM A;  2M72 A;  4IQA A;  5JWQ B;  2DC5 A;  1SL2 B;  2FWE A;  2IFQ B;  2L59 A;  4KND A;  5DBQ A;  2PU9 C;  1DBY A;  2NPB A;  4TVE A;  4LMV A;  4ILF A;  1MD3 A;  1ILO A;  1TK5 B;  4ID0 A;  2WS2 A;  4O5Q A;  4KCE A;  3FEU A;  5F07 A;  3KD0 A;  4RI6 A;  4LL1 B;  5FT3 A;  4BL7 A;  4D73 A;  5DAK A;  4L0W A;  3CSI A;  1SK1 A;  1K0D A;  2F8A A;  5JCU A;  2GSS A;  2MMO A;  1THO A;  2XPD A;  1V40 A;  1IYH A;  2JL4 A;  2H30 A;  4KAE A;  3G7I A;  5IOW A;  1FG4 A;  2QC7 A;  5DAL A;  1WE0 A;  4GWR A;  3UIW A;  2IYJ A;  3Q6O A;  4KDY A;  3LEF A;  3LOR A;  4TR0 A;  3UEM A;  1XWG A;  1Z5Y E;  4QL9 A;  4G9H A;  3F63 A;  1FHE A;  2XHF A;  2KLX A;  5A4W A;  1SJ6 A;  5DDL A;  4MAB A;  4BVY A;  4EC0 A;  2MMZ A;  4IJI A;  4K2D A;  1X5C A;  1M0U A;  2VCQ A;  2RM6 A;  2NBS A;  4GSN A;  3GIX A;  3LSZ A;  12GS A;  2P0G A;  1ERU A;  4NV5 A;  3UVH A;  2H6Y A;  5DQS A;  3J7Y k;  2IFQ A;  1R5P A;  4IP6 A;  2GVP A;  3FZ5 A;  2GQM A;  2YN1 A;  2CX3 A;  4YQV A;  3L9S A;  3HVS A;  2H75 A;  1GTB A;  2AB6 A;  2OE1 A;  4WF5 A;  1SJI A;  3TJF A;  2HRF A;  4OWY A;  3KGK A;  2LQO A;  1U3I A;  2IIY A;  1GUK A;  1PD2 1;  1T4Y A;  1GUL A;  2HNL A;  2N5F A;  2B3S A;  2K6V A;  1UA5 A;  3F9U A;  3TOU A;  3E0U A;  2R3X A;  3IPZ A;  3HYP A;  4WBJ A;  4IQ1 A;  3QCP A;  2VLT A;  10GS A;  2AUV A;  3IK7 A;  1UVZ A;  3FZA A;  1BED A;  4XS6 A;  4PQ1 A;  1QFN A;  4JR6 A;  4I2U A;  4DEJ A;  4K5S A;  4CDO A;  4OCE A;  3VPT A;  3C7M A;  3ED3 A;  5CO3 A;  3HZ8 A;  4HDE A;  5HR3 A;  1R26 A;  5AN1 A;  4IEL A;  3GUS A;  2VCT A;  2HSY A;  3WYW A;  1X9S B;  1SYR A;  1GP1 A;  2QA1 A;  4YH2 A;  2HRN A;  2OAD A;  1EGR A;  1LJR A;  3KH7 A;  4FH8 A;  3FR9 A;  3QOU A;  2CQ9 A;  3EMX A;  2MMN A;  5F0G A;  2VL3 A;  3H1N A;  1WWJ A;  4OFT A;  1AQV A;  3M9J A;  2XBI A;  1I9D A;  3C1R A;  4OCF A;  1NW2 A;  2B1K A;  1T8E B;  4KE3 A;  3WGX A;  3E9J B;  2C0D A;  1ERT A;  4HI7 A;  1WP0 A;  3F4R A;  1WMJ A;  1GTU A;  5DJL A;  1TRS A;  2H71 A;  2IME A;  2WDU A;  3RAZ A;  3D6I A;  4P3Y B;  4MNN A;  2FA8 A;  5ECM B;  1BAY A;  3MYD A;  1Y25 A;  1EGO A;  4HJM A;  1GSE A;  2R4V A;  1EP7 A;  1ZL9 A;  5DJM A;  1SL1 B;  5G30 A;  1SL0 B;  2OE3 A;  4NXI A;  2ZUP A;  1XW6 A;  1XFL A;  4L0U A;  1TKD B;  5ECQ B;  3SWL A;  3ZRE A;  4J2F A;  1TRU A;  1E2Y A;  3BD2 A;  2V6K A;  4BVX B;  4L8E A;  4HS1 A;  5FHI A;  2OAC A;  4Q5N A;  3LXT A;  4PQI A;  2FUG 2;  2NVL A;  4QL7 A;  3P2A A;  3KM6 A;  2RUF A;  4EF0 A;  3CTF A;  1R4W A;  4I8B A;  3DRN A;  4KA0 A;  3RPN A;  4GXZ A;  1K0A A;  1XZO A;  3ZVJ D;  4HOJ A;  4JZQ A;  4F03 A;  3HJO A;  1AIU A;  2LQQ A;  2AAW A;  4POB A;  1ERV A;  3HJM A;  5COH A;  4RQR A;  3EWL A;  4IVF A;  3BCI A;  2EIO A;  3GNJ A;  3IAS 2;  1K0N A;  1MDI A;  1BX9 A;  3TKR A;  1AW9 A;  1PKW A;  2FWH A;  2K18 A;  3US3 A;  1AAZ A;  2L6C A;  5H5S A;  4AGS A;  5D9T A;  4DSQ A;  4WBR D;  3UBL A;  6GSS A;  5CP1 A;  3O3T A;  1K3O A;  1PL1 A;  2CZ3 A;  4Z7X A;  1TP9 A;  1G0T A;  4ISD A;  3MSZ A;  3TRQ A;  3JCM L;  5JWR B;  3FYG A;  3LJR A;  4TXO B;  3IC8 A;  1GSS A;  1YKC A;  4JRR A;  5HFG A;  3VK9 A;  4BVX A;  4IBP A;  3MNG A;  3KP9 A;  4MF6 A;  2JZR A;  1USB A;  3GUR A;  3GKX A;  2D2Z A;  3HJP A;  4YQM A;  4I5Q A;  4MA9 A;  3HXS A;  3ZVJ A;  5LNK e;  3GKM A;  2H0G A;  3ME8 A;  4BA7 A;  3FZ9 A;  4ULX A;  1EOH A;  4MDC A;  1GNE A;  3G7J A;  3GX8 A;  1ST9 A;  1O85 A;  3NOF A;  4PUF C;  5IO2 A;  1GWC A;  4JR4 A;  3VFI A;  2ES7 A;  4KDU A;  3VWU A;  4XS1 A;  4XS4 B;  5ECS A;  2H8L A;  3QAV A;  3A2X A;  3GN3 A;  4YAV A;  3UBK A;  3A3T A;  2PMT A;  4PTS A;  2B1L A;  2JSZ A;  2VUP A;  1M9B A;  5E59 A;  2B6M A;  3CMI A;  1JZD A;  1F3B A;  1XWC A;  2F8F A;  2YWO A;  1A24 A;  1FVJ A;  1PA3 A;  1YDK A;  4OD7 A;  5IOX A;  2I3Y A;  2HYX A;  4EDZ A;  3HZ4 A;  1X9M B;  2UZ8 A;  1YY7 A;  2YNX A;  4G0K A;  2CX4 A;  4POL A;  2GLR A;  2H1B A;  4FQU A;  4F0B A;  2X8C A;  5IMC A;  1QUW A;  1H75 A;  1Q98 A;  1YQ1 A;  4TXO A;  2YP6 A;  4Z2T A;  1PQN A;  3F3R A;  1MEK A;  3IHQ A;  1TI3 A;  1F2E A;  1A0R P;  1GL8 A;  3APO A;  1QXH A;  3LYP A;  1ZYP A;  3EU4 A;  4V1A p;  2XPE A;  1O6J A;  1OYJ A;  4MMM A;  5GSS A;  4GSS A;  1XPV A;  5IMD A;  1GSU A;  5G1K A;  2HZF A;  5IPG A;  2DLX A;  1BYE A;  1V9W A;  2LJA A;  3FRC A;  3BCK A;  4AJ7 A;  4KCA A;  4GQC A;  2X8H A;  2H74 A;  3KZQ A;  2C0F A;  2OA7 A;  1V2A A;  3TRX A;  3EUR A;  1GUM A;  4XIH A;  3DVW A;  3LYK A;  6GSV A;  2PUK C;  1WIK A;  3UL3 A;  4ZBB A;  3IOS A;  3VUR A;  4CY8 A;  4XS4 A;  4XTS A;  1NM3 A;  4HU9 A;  2H0I A;  4EXJ A;  1FW1 A;  2VM1 A;  5ID2 B;  2VOC A;  16GS A;  2H1G A;  1ZYE A;  4FIW A;  1SD8 A;  2GGT A;  3VLN A;  5ELG A;  2VCV A;  1TTZ A;  1F9M A;  1HD2 A;  4K7I A;  4HJ2 A;  2EIQ A;  1A2J A;  4MCU A;  4KDX A;  2IJY A;  1J9B A;  4AJ6 A;  4FYU A;  4GCI A;  5ECN B;  1YEP A;  2L5L A;  2FNO A;  4EDY A;  7GSS A;  3C1S A;  4KW6 A;  4K0G A;  5ECH B;  4KX4 A;  1T7P B;  2FWF A;  2ALB A;  3MIX A;  1Z6M A;  4OO5 A;  2BJX A;  4ECI A;  1J08 A;  3KMN A;  4Q5Q A;  4YAP A;  5IMV A;  5ECO B;  3IK9 A;  2P31 A;  3HHV A;  3CRT A;  3ERF A;  1EP8 A;  3ERG A;  4JBB A;  2HSM A;  3ZIT A;  3GST A;  3IA1 A;  2WUL A;  2V2G A;  3IAM 2;  3D0Z A;  1XWB A;  3EIN A;  2YWM A;  3TJB A;  2DJ1 A;  1TK0 B;  2ZNM A;  2DMM A;  3TJJ A;  2O85 A;  3M3M A;  2LUS A;  1FO5 A;  1OE8 A;  4EIQ A;  5KN3 A;  2F51 A;  5B7C A;  5D73 A;  1EV9 A;  2KOK A;  1QMV A;  2F3M A;  2H19 A;  2O87 A;  4LMW A;  5ID2 A;  2VCZ A;  3F8U A;  4KSO A;  3W6G A;  2X4A A;  1F37 A;  1PGT A;  3FKF A;  4AF2 A;  4X43 A;  2V1M A;  2CAQ A;  4FO5 A;  3UVT A;  3QFB C;  5F06 A;  1JLV A;  5D8I A;  4ZXG A;  2OE0 A;  1XVQ A;  2YZU A;  4IGJ A;  5G31 A;  5HR1 A;  1N2A A;  1TDI A;  4MPF A;  4WXT A;  1GSD A;  1AC1 A;  5A4U A;  2PER A;  3UMA A;  3P7X A;  3LFL A;  3WT1 A;  1FB0 A;  3C8E A;  2VLV A;  3L4N A;  2PPT A;  4V2M A;  6GSX A;  2C0E A;  2AJQ B;  1GTI A;  20GS A;  4K2X A;  2WRT A;  9GSS A;  1SU9 A;  2E0Q A;  3WT2 A;  17GS A;  4PNG A;  2IL3 A;  4ECC A;  3ZRD A;  4EE0 A;  2IMK A;  4WKW A;  2B5X A;  2LRC A;  4K8M A;  3FR6 A;  3HCZ A;  1Y6E A;  3HVX A;  2C1Y A;  2GTU A;  2WGR A;  2LTK A;  2MYG A;  2P5Q A;  1SKS B;  1I5G A;  1VF4 A;  1A0F A;  1OAZ A;  3C71 A;  2JZS A;  1RK4 A;  6GSW A;  2CZ2 A;  4NHZ A;  4KB3 A;  2PGT A;  5BRT A;  3EPT A;  3DYR A;  1GH2 A;  5J5N A;  4EL1 A;  3EC3 A;  1DE2 A;  2XC2 A;  1B48 A;  4BWS A;  3GL5 A;  2B5E A;  3UAR A;  4GRF A;  2X99 A;  11GS A;  2G0F A;  3IR4 A;  1M2D A;  5J3R A;  5D9W A;  4YKF A;  1ZZY A;  2Z9S A;  3L9V A;  4EO3 A;  1XCC A;  2MBT A;  2PVQ A;  2TIR A;  4N11 A;  3UJ1 A;  1B9X C;  1XOB A;  3KEB A;  4NHW A;  1NHY A;  2L6D A;  1GLQ A;  2J9H A;  2DJ3 A;  5IQY A;  2E2M A;  1UN2 A;  4DSR A;  3FMW A;  3ZFB A;  1O8X A;  5HR2 A;  3UAP A;  3FZ4 A;  1PKZ A;  1AQX A;  1JZR A;  4ZL9 A;  3QPM A;  5G5E A;  1OC8 A;  2HFD A;  2I9H A;  3QDN A;  4WR5 A;  4G19 A;  4H86 A;  4NMU A;  4J57 E;  2VAF A;  4Q5F A;  2ON5 A;  4ZB8 A;  1X5E A;  4ZIL A;  5IM9 A;  3TKS C;  1EWX A;  3I6A A;  4PUR A;  3EYT A;  1TU8 A;  2QKE A;  2XBQ A;  13GS A;  2I1U A;  2GQL A;  2LNS A;  3F6F A;  3ISO A;  3APQ A;  2YOI A;  3O76 A;  4ZB9 A;  2VCX A;  2I4A A;  2L57 A;  5D96 A;  3D21 A;  2L5O A;  1B4P A;  2YPM A;  1TK8 B;  2H1D A;  2MMA A;  2HSH A;  2FD3 A;  2HRA A;  3RPP A;  5C00 A;  2GT6 A;  2HT9 A;  5J41 A;  1K3L A;  18GS A;  2PWJ A;  4ZL7 A;  3D4T A;  2CVK A;  2VL9 A;  5B8A A;  1Z6N A;  2HI7 A;  5ECK B;  3V1W A;  4O5U A;  1TOF A;  2ON7 A;  4MJE A;  2L4C A;  4IHU A;  3ME7 A;  1R7H A;  3P8W A;  5C04 A;  1FOH A;  1OKT A;  4ZB6 A;  3ZIV A;  5IO0 A;  5F05 A;  4IW9 A;  2VL2 C;  3GTU B;  4K0N A;  4MPG A;  3ZMK A;  1XBS A;  4N30 A;  1W4V A;  4HUA A;  4ZBD A;  2GDR A;  2AHE A;  1JFU A;  4LLR A;  1K0B A;  3LW9 A;  1U6T A;  4TR3 A;  2YWI A;  4JED A;  5LCZ A;  22GS A;  5G5F A;  2B5Y A;  4AJ8 A;  5CRE A;  2GQK A;  1VRS D;  4QQ7 A;  4MZB A;  4KUN A;  1TRW A;  1RQM A;  1OC9 B;  5ECL B;  4X0X A;  1T3B A;  5D93 A;  3W8J A;  2JU5 A;  4FYC A;  1B4Q A;  1WPI A;  14GS A;  2JAD A;  5DVB A;  2M80 A;  1S3A A;  2E7P A;  2YV9 A;  1J0F A;  1PL2 A;  5EY6 A;  2CA8 A;  3CSJ A;  2VIM A;  2GSQ A;  1Q4J A;  4MZW A;  3TKQ A;  1A2M A;  2FA4 A;  2R6K A;  3PIN A;  3GX0 A;  5J4U A;  2OJL A;  3ZL5 A;  5HR0 A;  2DJ0 A;  1G7E A;  2C0G A;  3TJG A;  4L5L A;  3F6D A;  1RW1 A;  2GT5 A;  2DSA A;  2JSY A;  5KN2 A;  3IE3 A;  4X4J A;  4KF9 A;  19GS A;  4NV2 A;  1Z7R A;  1GLP A;  3E3E A;  2WJU A;  3IC4 A;  1A23 A;  2QA2 A;  1WRY A;  3GTU A;  5KEJ A;  2GZY A;  4PUA A;  3GL3 A;  2YJH A;  3TCO A;  3CBU A;  5JCW A;  2IMF A;  4DVC A;  4A5P A;  1PX6 A;  3DD3 A;  3F3Q A;  3GV1 A;  4EUY A;  1VF1 A;  4TKY A;  5BMU A;  3A2V A;  2GST A;  3G7Y A;  2VD1 A;  2WFC A;  2A2R A;  3FK8 A;  2DJK A;  1SJZ A;  3ZTL A;  3MWH A;  4OFM A;  1XWA A;  3IXR A;  1ZGN A;  1SK2 A;  1BJX A;  2RM5 A;  1VF3 A;  1DE1 A;  2OBI A;  1SYX A;  1X5D A;  2V32 A;  1S3D A;  1OC9 A;  1YKA A;  2A4H A;  2C4J A;  2LNT A;  5HQP A;  2RLI A;  4ML1 A;  4RQX A;  4TOP A;  1ZYQ B;  4EVM A;  1KNG A;  2NTO A;  4ZIJ A;  3RHB A;  5J9C A;  3L0H A;  5G1L A;  2K9F A;  2CVD A;  2KUC A;  4MH2 A;  2EIR A;  2O8V B;  2IN3 A;  3KP8 A;  4JE1 A;  4EIP A;  1K3Y A;  3GH6 A;  2AYT A;  3NIV A;  3K8N A;  5GST A;  2LRN A;  3H8Q A;  3GFK A;  3BJ5 A;  5AIS A;  5GAN D;  4PX1 A;  3M8N A;  4GQF A;  3S9F A;  1V57 A;  3D5J A;  1AQW A;  1F6M C;  2DIZ A;  4RI7 A;  1G6Y A;  2LRT A;  3DWV A;  4YKG A;  2YAN A;  5KN1 A;  1HNC A;  1PN0 A;  2YCD A;  2A2S A;  2DKI A;  1LU4 A;  2HLS A;  1LBK A;  3LQ7 A;  2DBC A;  3KIJ A;  1TXX A;  1V98 A;  2C80 A;  2H01 A;  4ZBA A;  1FVK A;  2FY6 A;  2BMX A;  3N5O A;  4IP1 A;  3WD6 A;  2TRC P;  1FB6 A;  3QR6 A;  1EV4 A;  4GLT A;  4O32 A;  4POK A;  2CV4 A;  1U3A A;  2PN8 A;  5CRG A;  5J9B A;  4PNF A;  3VI7 A;  4F2I A;  1HNB A;  1O81 A;  1GTA A;  3Q74 A;  2R0P A;  2GS3 A;  4WEY A;  2HZE B;  3CXG A;  3RHC A;  3ERW A;  1SD9 A;  5ECR B;  1YZX A;  1EEJ A;  2ZCT A;  3KTL A;  4N0Z A;  4ICY A;  4CHS A;  3TJK A;  3A5I A;  1K0M A;  4K5R A;  5IMA A;  2R0G A;  2IMD A;  1AXD A;  4XRD A;  5AIX A;  4ECJ A;  2KP2 A;  3VWX A;  3C73 A;  2LS5 A;  5B6M A;  3A5W A;  3QAW A;  3KXO A;  3EU3 A;  3CRU A;  3LXZ A;  2V41 A;  1YJ6 A;  2MBS A;  3APS A;  4IKH A;  2VO4 A;  3G9B A;  4MF7 A;  5GZZ B;  3VI5 A;  2MZC A;  2IPA A;  1JZO A;  3EMP A;  2GZZ A;  4WR4 A;  2F9S A;  3TKS A;  4BWQ A;  4POM A;  5F8B A;  2M46 A;  4Z2U A;  1BQ7 A;  4V1A g;  2I81 A;  3EE2 A;  3MAK A;  4HQZ A;  3HD5 A;  4MLY A;  1NSW A;  1KTE A;  2P5R A;  3KTB A;  2REM A;  3WGE A;  2DJJ A;  3U6V A;  2J23 A;  3ZLP A;  1T00 A;  1KEB A;  4MF5 A;  1PRX A;  2C3Q A;  2HXK A;  3GYK A;  3GKN A;  2CT6 A;  3SBC A;  3GSS A;  5IMZ A;  1PSQ A;  3CSH A;  3I69 A;  3BOA A;  2YZH A;  2HZE A;  2R37 A;  3LG6 A;  1ZOF A;  1G6W A;  3QAG A;  3GHA A;  4OMV A;  4MK3 A;  1WJK A;  1XVW A;  2AV4 A;  4USS A;  5CNW A;  4KH7 A;  3IRA A;  2H1A A;  4O92 A;  4MP4 A;  3UOM A;  2VCW A;  1YEX A;  5E4W A;  3VWV A;  2R2J A;  4N0V A;  2LEG A;  4F0C A;  3BBY A;  3I43 A;  1H4O A;  1ZYN A;  4HZ2 A;  3TB2 A;  4WF4 A;  3FR3 A;  1EZK A;  1GRX A;  3N9J A;  1G7O A;  1NHO A;  2VL2 A;  2GSR A;  3F0I A;  2NDO A;  3WGD A;  5ELA A;  1EOG A;  6GSU A;  2HE3 A;  3KH9 A;  2B7J A;  3H93 A;  4K6X A;  1IYI A;  5A5K A;  5CRD A;  2VM2 A;  1M7T A;  1MDJ A;  1XW9 A;  1W89 A;  1U87 A;  2L4Q A;  4IN0 A;  1GUH A;  5EL8 A;  1JLW A;  1HNA A;  2KHP A;  4J56 E;  3AY8 A;  4N10 A;  3J7Y b;  3U5R E;  5ENU A;  3QMX A;  2VD0 A;  2B7K A;  4NWY A;  3H79 A;  4FYB A;  1TU7 A;  2FCH A;  2LV3 A;  2C8U A;  1X9W B;  5DQY A;  1UC7 A;  5IIZ A;  3TRP A;  2JAC A;  4MZC A;  1Z9H A;  2PVO C;  3VWW A;  1A8Y A;  1HYU A;  1N8J A;  1DSB A;  5GAP D;  3RDW A;  3L9U A;  1ERW A;  1GNW A;  5DCH A;  3M0F A;  4MJC A;  2X64 A;  4BPY A;  2LJK A;  4O5R A;  5ECI B;  2A2P A;  2HRK A;  5FWG A;  1JHB A;  2CVB A;  5DCG A;  3W8S A;  1QGV A;  1C72 A;  1O7U A;  2VLU A;  3TKP A;  5JCG A;  1BG5 A;  4LA1 A;  2K8S A;  4JU5 A;  4WET A;  3ZZX A;  4K7O A;  2GZP A;  2LST A;  1VF2 A;  1ZMA A;  5KN0 A;  4MH3 A;  5D9X A;  4NPB A;  1ON4 A;  3HDC A;  1M2B A;  6GSY A;  4TXV A;  3IDV A;  2H73 A;  4E8E A;  1OKD A;  2C3N A;  4MJB A;  4ECB A;  1QK8 A;  4TR1 B;  3OR5 A;  5CAX A;  2QSI A;  4PGT A;  4G0I A;  1T1V A;  4TR4 A;  1B9Y C;  1SEN A;  3DVX A;  1DUG A;  2WCI A;  1TW9 A;  1THX A;  5B8B A;  1A8L A;  2H6Z A;  4PQH A;  1PX7 A;  3IHG A;  8GSS A;  3DEX A;  1ABA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...