3G8ZA

Crystal structure of protein of unknown function with cystatin-like fold (np_639274.1) from xanthomonas campestris at 1.90 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
MNTIDIAKSYITAIQTGDHATLGSIISPDVIWHQPGNHQFSGTHRGMAVVGPMLGKMMEVSNGTFAISRADDYMASGDWVAITLEFSGQANGVTLKQAGVDLLRIEDGKIVEVRLFSADQTQEDAFWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function with cystatin-like fold
publication title Crystal structure of protein of unknown function with cystatin-like fold (NP_639274.1) from Xanthomonas campestris at 1.90 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Structural genomics, unknown function
total genus 34
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3g8zA00
1GS3A 3EN1B 3FZWA 2BMQB 4XB5A 3HK4A 4HM7B 3EN8A 1ASKA 3F14A 4L8PA 4ORLA 4OUQA 5KP4A 5AEWB 2QGUA 1GY5A 3MG2A 4N3VA 3NHXA 3LZAA 3M8CA 4PEJA 3SOAA 1NWWA 4STDA 4HM3B 3S5CA 3EBYA 1DMMA 3FSDA 4WWUC 3ROBA 3VGNA 3BB9A 1Q40B 3F40A 1W00A 4HM8B 4L7KA 3KE7A 4HM5B 1EA2A 3JUQA 4WYKB 3NBRA 3NM2A 4LGQA 3HZPA 3T8UA 3EX9A 1K41A 1BUQA 1O7PB 5D82A 5KP1A 3EBTA 5BXQA 4HM2B 2PZVA 3KZTA 3DMCA 3EC9A 3OV4A 3OWSA 5D83A 1A2KA 3GZRA 1QJGA 4XM4A 3SOYA 1OHPA 5AEUB 4R9KA 5CK6A 1NDOB 1STDA 1GY6A 1JN5B 5AIGA 2STDA 2XR8B 5CF2A 3F7SA 4MJDA 3D9RA 3UJMA 4HZBB 3F9SA 1UUVB 1O7MB 3STDA 4HM1B 1TP6A 4WP5A 2HMNB 3G16A 3Q90A 3BLZA 2HMMB 5IEOA 5DREA 3NUVA 2R4IA 1JB4A 3CNXA 2A15A 3OWYA 1C7HA 5IERA 5IG4A 2XRXB 1JKGB 1Q40A 2F86B 1S5AA 3FF0A 5STDA 3HX8A 5KP3A 1OGZA 2W2CA 4WYKA 5IEPA 1Z1SA 5CXOA 2HMJB 4XDVA 4CDLA 1DMNA 1O7HB 3I0YA 3T8NA 3OWUA 2XSOB 1E3VA 1ZX2A 4J9AA 1Q42A 4HM4B 3NV0B 2HMOB 1JN5A 3GRDA 4HM6B 4HM0B 2I9WA 2JQ5A 4R9LA 3FLJA 2GEXA 2F98A 4FCJA 2CKFB 4H3UA 3IPTA 4L8OA 1O7GB 1W6YA 3K0ZA 3DUKA 3OXAA 1O7NB 5AIFA 2HMLB 1OF5A 1HKXA 3WMDA 3B7CA 1OUNA 3K7CA 3FF2A 1ISKA 4Q53A 3GWRA 3JUPA 4XBTA 1W02A 1OHSA 2BNGA 4I4KA 1JB2A 3G8ZA 1OF5B 3H3HA 5CF1A 2CHCA 3E99A 2Z77A 3MKIA 2HMKB 1JKGA 3FGYA 1W01A 1NU3A 6STDA 3JUOA 3MYTA 1VZZA 1O7WB 3A76A 3FH1A 2IMJA 1WQLB 4GB5A 3G0KA 5FW5A 3JUNA 3DM8A 3JUMA 5HGRA 2GBWB 5JPPA 5CLKA 2GXFA 3H51A 5BVBA 3ER7A 2YFLB 2YFIB 2OWPA 1OH0A 3RGRA 5AIHA 3F8HA 5AI1A 3MHEA 4U13A 4R1KA 2K54A 3VSYA 4FCMA 3NV0A 1CQSA 2Z76A 5IENA 2B24B 2GEYA 3B4PA 1GY7A 5JPUA 1OGXA 5TGNA 1UUWB 3EJVA 3EHCA 5IG3A 1OPYA 1OHOA 5IF6A 4X2OA 7STDA 3EQQB 2F99A 1TUHA 2BMRB 2RGQA 3MSOA 4K1UA 1SJWA 2XSHB 1JB5A 1E97A 1OCVA 4XDWA 3UNLA 4RZMA 3MG1A 4X2HA 3ECFA 3GZYB 4IIAA 3CPOA 1IDPA 3OX9A 3RGAA 3MG3A 2BMOB 5IG0A 4OVMA 3B4OA 3B8LA 3GZBA 2RFRA 3DZLA 4XBXA 4HZ9B 5DRVA 5EVHA 4LMIA 2Z7AA 4LEHA 3F8XA 1ULJB 2GBXB 2UX0A 1DMQA 3EF8A 3KSPA 3FKAA 3SEDA 1QMAA 5IG5A 4J8TA 2B1XB 2QIYA 1EG9B 3KKGA 4K1VA 4HVNA 1AR0A 5AIIA 2YFJB 1U5OA 4HKVB 1ULIB 2INXA 5G2GA 3CU3A 1E3RA 1ZO2A 3F7XA 3DXOA 4HJLB 4KVHA 3GZXB 3NXJA 8CHOA 1GYBA 3CNMA 2RCDA 3LYGA 4XBYA 5D81A
chains in the Genus database with same CATH superfamily
1BRHA 1GS3A 3EN1B 2O3OA 3DH2A 2BMQB 3FZWA 4HBRA 3VF1A 3UB1A 3URPA 2Z6BA 5M18A 1RDSA 1RGEA 1BNSA 2BU4A 1LQMB 2OQEC 1TU5A 1PFPA 4N6OB 1FUSA 4XB5A 3S27A 5G1KA 3WOEB 3HK4A 4HM7B 2KF4A 3IMAB 3EN8A 1YIJ3 2W04A 1ASKA 3F14A 1K9M4 4L8PA 4KZ1A 2LYXA 3BNDA 4NHFA 4OK0A 1ROVA 3I563 4ORLA 4WHAA 3S67A 3X3ZA 1AV4A 1B3SA 1FYSA 1IVUA 2XF3A 1V58A 4OUQA 5KP4A 1RN4A 5AEWB 2QGUA 3WR2A 3N8BA 1GY5A 3FCSB 3MG2A 4N3VA 5RNTA 3GSPA 3NHXA 4K90B 1BSDA 3LZAA 4EV5A 1YJ93 2D42A 3V98A 1BNFA 1RGGA 1IQXA 3M8CA 4PEJA 2BHMA 3SOAA 1NWWA 3DGNA 4STDA 2MC8A 3DGOA 3LTDA 4HM3B 2OTJ3 3EB8A 3S5CA 3EBYA 1DMMA 3FSDA 1TIJA 4WWUC 3ROBA 3SVAA 4EXRA 1I3IA 2XEPA 3VGNA 1CYVA 1BRIA 1HYFA 3BB9A 1Q40B 1RHLA 2OTL3 3F40A 1W00A 1BU4A 1BVIA 4HM8B 3QRDA 3KE7A 4L7KA 2RBIA 1EA2A 4HM5B 1R4CA 2C4BA 1PY3A 2WO0A 1NB5I 3JUQA 4WYKB 1UGIA 3NBRA 3NM2A 4LGQA 1J2BA 1HZ1A 3HZPA 3T8UA 4MMYB 1BUJA 1JJ22 1RGCA 1GD3A 1K41A 3EX9A 4N6UA 1EKMA 4TX4A 5EEOA 3SLUA 3L0RA 1A90A 1BUQA 1BNEA 1O7PB 1WMNA 2IYJA 1I2FA 2XGLA 3S29A 1VQ53 1W5ZA 2ZA4A 3AMOA 3CCE3 1YIT3 2W03A 1QAFA 5D82A 5KP1A 3EBTA 3A5EA 5BXQA 4HM2B 2PZVA 3KZTA 3CCS3 1B2MA 3OW22 2H0GA 3CXC2 1RCLA 4ILFA 3DMCA 3EC9A 3OV4A 4WFOA 3OWSA 1M904 1JBRA 4N6NB 1K28A 1WNHA 5D83A 3NBBA 1A2KA 2WGOA 3CME3 1LVNA 3GZRA 5AYRB 3PYJA 2KF6A 3UL6A 2KF5A 3WA3A 1QJGA 1BNRA 1A2PA 1Y4KA 4XM4A 3SOYA 1OHPA 5AEUB 4R9KA 1WMPA 5CK6A 1NDOB 1STDA 3S28A 4FMCA 3D3LA 2SARA 1B20A 1GY6A 4HYZA 4NPBA 1IVWA 1NB3I 1JN5B 1SARA 3CC73 5JBSA 1W2B2 3LTAA 5AIGA 2Y73A 3CC23 4GHOA 2R41A 2STDA 4N6LA 2XR8B 1A2VA 3AHSA 5CF2A 2OOVA 1MOLA 1RLSA 3F7SA 1GMRA 4MJDA 4EBGA 1T2IA 1N8QA 3D9RA 1M1XB 4HZBB 2BIRA 3F9SA 1BIRA 3UJMA 1JNQA 1UUVB 1BGSA 3LH4A 1O7MB 2CX1A 1GMPA 2XH9A 3STDA 4R80A 1I3FA 4RNTA 3D79A 2E2TA 1RRHA 1VQ43 9RNTA 2L4VA 3K5TA 4HM1B 3J7Yd 2K3DA 2FGTA 1RGKA 1TP6A 2CFLA 3MWZA 4J5KA 4HAAA 2Q07A 4WP5A 2H0IA 2CX0A 2CWTA 2PNCA 6GSPA 1LOWA 1TRQA 1TFKA 2HMNB 3G16A 3Q90A 1M9GA 1D6YA 1T2HA 3BLZA 4LYLB 1LNHA 1T5YA 4R4KA 2HMMB 2OCTA 5IEOA 7GSPA 4EW5A 3FG4A 5DREA 4EC6A 2CWUA 1QALA 3NUVA 2R4IA 3ZG0A 1KC84 1NJI4 3ZFZA 1JB4A 3U1WA 3CCM3 1CH0A 1BRGA 2A15A 3CNXA 3Q3FA 4BTWA 2SBLA 1BOXA 3PS8A 1IYYA 1DE3A 1BSEA 3OWYA 1C7HA 4BIRA 1UI7A 2W6JH 2CC3A 3KFQC 4EV2A 5IERA 5I97A 1N5HA 3LTBA 3MPHA 1T3BA 3X3XA 4EYCA 2P0MA 1BRJA 5IG4A 2K0MA 7RNTA 2ZDJA 3GAXA 1LQGC 2F4YA 1IK3A 2F56A 2XRXB 5IW9A 1JKGB 5M19A 1Q40A 3BNCA 3NQYA 3LXUX 2WOFA 2F86B 2J8XB 4RBNA 1DYUA 3ALAA 2O9UX 1S5AA 3FF0A 4FMAA 5STDA 2P05A 1RGFA 2CG0A 3HX8A 1OGZA 5KP3A 4BL2A 1RGAA 1BRSA 2W2CA 4WYKA 5IEPA 1Z1SA 1N5PA 1JBTA 3PGBA 3WDGB 3CCQ3 1BSBA 5CXOA 1U8CB 1QAKA 2C10A 1D6UA 2HMJB 3AGOA 1IV7A 4XDVA 2RNTA 4CDLA 3G713 1DMNA 4CCVA 1Q864 2CWVA 1O7HB 1US1A 3I0YA 1UCLA 1W4NA 2IY2A 3QK9A 3T8NA 3NQZA 2QA43 4K61A 4BL3A 1IV9A 3WA2X 1MNLA 4AKZA 3OWUA 2CH9A 1JV2B 1FGOA 2AAEA 1CEWI 3CMA3 2XSOB 3LT8A 4QWTA 2W56B 2W9QA 4N6MA 2XFSA 2WGQA 1BAOA 1K734 1V74A 1E3VA 2KRTA 3CCU3 1ZX2A 4J9AA 1Q42A 4HM4B 2H0HA 1TRPA 1UI8A 1SIHA 1MWSA 1V57A 3NV0B 2HMOB 1GD4A 2W9PA 3FG3A 1JN5A 3GRDA 4HM6B 2IUJA 2HOHA 2FNQA 4FCZA 1WTHA 4HM0B 3CCV3 2I9WA 2JQ5A 4R9LA 3FLJA 2GEXA 4G1MB 2F98A 5M1AA 4FCJA 1NNVA 1MWUA 1B2UA 2CKFB 4H3UA 3IPTA 4KFFA 4NREA 4KT3B 4L8OA 4LSOA 1O7GB 3N9HA 1L5GB 1UCJA 1W6YA 3K0ZA 3DUKA 3KIIA 3OXAA 1IT7A 1AY7A 1O7NB 5AIFA 1OACA 3NM7A 5ELJA 2HMLB 1OF5A 4RNYA 1VQQA 3NX0A 5G1LA 1HKXA 1IQYA 3KCHA 1X1XA 3WMDA 1AVLA 3B7CA 1OUNA 2P0XA 4IPBA 3ZG5A 6RNTA 3D4AA 1N9EA 1Q9EA 1RN1A 3LMLA 3DY5A 1GOUA 3K7CA 3X42A 1GSPA 3FF2A 1KD14 1JRQA 1ISKA 3JVCA 1SIIA 4Q53A 1JBSA 3GWRA 2CFGA 2OQEA 4O3VA 3V92A 3JUPA 1DVCA 4XBTA 3RDEA 1W02A 2M7OA 4KFEA 4O2HA 3K63A 5HOHA 1A67A 1OHSA 2BNGA 4I4KA 1W7CA 1JB2A 3O8YA 3G8ZA 1VQM3 3HI7A 1RTUA 2QEX3 1OF5B 3H3HA 4AEQA 5CF1A 3SX1A 2CHCA 1IT8A 1G96A 3E99A 1UCIA 1LRAA 2Z77A 3HIIA 3IJEB 3MKIA 1BNIA 2MF7A 1BANA 2HMKB 1B2ZA 1JKGA 1IQ8A 1LNIA 1PYLA 1MWTA 3FGYA 5AYSC 1W01A 1NU3A 1RMSA 1ZGXA 3JUOA 6STDA 2D1WA 1EQKA 1GMQA 2UGIA 3MYTA 1YVSA 5A0OB 1RGHA 2ML5A 1HU9A 3CCR3 1VZZA 3BNEA 1BNJA 1G0TA 2E2UA 3BU4A 1VQ73 1LOXA 1O7WB 3A76A 1Q824 1VQL3 1YVBI 3X41A 4CJNA 1C54A 3FH1A 2IMJA 1WQLB 4GB5A 3G0KA 1WMOA 5FW5A 3JUNA 1FW7A 2ZHXB 3LOYA 4IT7A 1D6ZA 2IUKA 2GSPA 4FMDA 3DM8A 3KSED 1DETA 3JUMA 2GBWB 5HGRA 1TJDA 5JPPA 1BSCA 5CLKA 1I0XA 2CK3H 4I5QA 2ZL8A 2GXFA 1RNTA 1KSIA 1W6GA 4H61A 1IVVA 1LOVA 4GL6A 3H51A 5BVBA 1NO3A 2W56A 3ER7A 5EQLA 1RGLA 5LC6A 1RCKA 2OOVC 1BSAA 2V1LA 2YFLB 4MMXB 2XFTA 3TDGA 1YJN3 2YX9A 1UGHI 1BRKA 1KWIA 2YFIB 2OWPA 2LQVA 1OH0A 3RGRA 1ROAA 3DGMA 5AIHA 3F8HA 4BTYA 5AI1A 1S723 3MHEA 4U13A 5LC7A 4R1KA 1YJW3 2Y74A 2K54A 3VSYA 4FCMA 4LZIA 1PU4A 1VQN3 3NV0A 1CQSA 2Z76A 2JDIH 4N6TA 5IENA 2B24B 2GEYA 3B4PA 3V99A 3DGYA 1JZDA 1SPUA 1X1UA 1YGEA 4J5GA 5GSPA 1EEJA 4RNZA 1GY7A 5JPUA 4AKYA 1OGXA 5TGNA 3CD63 4FMBA 1UUWB 3EJVA 3EHCA 5IG3A 1OPYA 1RSNA 1FUWA 1FGTA 1GOYA 1ZS7A 1B2XA 2CW9A 1OHOA 5IF6A 2F5MA 4X2OA 1RKYA 1X1WA 1KQS2 1I2EA 7STDA 1W6CA 4JF8A 3SXXA 3EQQB 1B21A 1TTOA 3HOHA 4N6V0 2F99A 2F5WA 3FG1A 1SQWA 1BNGA 1TUHA 1UCKA 2BMRB 4CPKA 3G4S3 2RGQA 3MSOA 2P09A 4K1UA 1SJWA 2CG1A 2FXTA 4GSPA 3WODG 1Q814 2XSHB 1Q7HA 3LT9A 1JB5A 1E97A 2UUGC 3D5GA 1I2GA 1UDII 1CYUA 1VQ83 2XGNA 3WOFB 1OCVA 4XDWA 4KFDA 1STFI 3UNLA 3G6E3 4RZMA 2RSXA 3MG1A 4X2HA 3ECFA 3DGLA 3CC43 3GZYB 4IIAA 3Q2PA 3CPOA 1IDPA 3OX9A 3RGAA 5BIRA 1G02A 3MG3A 2BMOB 5IG0A 2E2VA 1LOYA 4OVMA 3B4OA 3B8LA 3SYUA 3GZBA 2AADA 1RRLA 2RFRA 3DZLA 1BRNL 4XBXA 1N8R4 1AQZA 3I553 1YI23 1FGMA 1UW1A 4HZ9B 5DRVA 4DKIA 1X1YA 3N54B 4LMIA 5EVHA 2Z7AA 3X3YA 4LEHA 3X40A 3UL5A 3F8XA 1GOVA 1ULJB 5FGOA 3T0UA 1VQ93 4O02B 1JZOA 2GBXB 1EUIC 3KN4A 1RN7A 3PCSA 3CCJ3 1VQO3 3D5IA 3U97A 1YHQ3 3PZWA 1UUGB 1IVXA 1F8NA 2CFDA 2KF3A 2UX0A 1DMQA 2P38A 1AVKA 3AMOB 3EF8A 3KSPA 2WOHA 1Q7Y4 1VQ63 1YNVX 3PCRA 1VQK3 3FKAA 3SEDA 4HOHA 1RNBA 2KCDA 1FUTA 3AHWA 1QMAA 4JRFA 4ZM8A 5BU4A 4J8TA 5IG5A 3CPW2 1LXEA 2B1XB 1MWRA 1RJOA 2QIYA 5ELUA 1B2SA 1MGWA 4FR9A 1EG9B 1FZUA 1TFOA 2IA7A 3KKGA 4K1VA 1FGQA 2CFWA 2C11A 4HVNA 1N9JA 4MMZB 1I70A 1AR0A 3RNTA 3K9MC 3LTCA 1I8VA 2ML6A 2W0QA 3CCL3 5AIIA 4MEIA 3BNBA 1YGWA 2CFKA 2GU1A 1U5OA 2YFJB 4HKVB 1W2ZA 1ULIB 2INXA 4BU4A 1QVF2 8RNTA 2BT3A 5G2GA 1MGRA 3PXMA 1QVG2 2L1SA 1M1K4 2BO9B 3CU3A 1E3RA 3BIRA 1I0VA 1ZO2A 3F7XA 2GU3A 2KXGA 3DXOA 3WHOA 4O8SA 4HJLB 4KVHA 2CIUA 1IU7A 3AGNA 3EE1A 1DVDA 1FA3A 3GZXB 3NXJA 3HIGA 3Q1CA 8CHOA 1GYBA 3CNMA 2RCDA 1B27A 3NBJA 1K8A4 3LYGA 4BTXA 1FGRA 2KAAA 4XBYA 1VQP3 1R4YA 5D81A
chains in the Genus database with same CATH topology
4HBRA 1GS3A 3EN1B 2O3OA 3FZWA 2BMQB 3VF1A 3UB1A 2Z6BA 2OQEC 1TU5A 1PFPA 4N6OB 4XB5A 3S27A 3WOEB 3HK4A 4HM7B 3IMAB 3EN8A 1YIJ3 2W04A 1ASKA 3F14A 1K9M4 4L8PA 4KZ1A 2LYXA 3BNDA 4NHFA 4OK0A 1ROVA 3I563 4ORLA 4WHAA 3S67A 3X3ZA 1AV4A 1IVUA 2XF3A 4OUQA 5KP4A 5AEWB 2QGUA 3N8BA 1GY5A 3FCSB 3MG2A 4N3VA 3NHXA 4K90B 3LZAA 4EV5A 1YJ93 2D42A 3V98A 1IQXA 3M8CA 4PEJA 2BHMA 3SOAA 1NWWA 3DGNA 4STDA 2MC8A 3DGOA 3LTDA 4HM3B 2OTJ3 3EB8A 3S5CA 3EBYA 1DMMA 3FSDA 1TIJA 4WWUC 3ROBA 3SVAA 4EXRA 2XEPA 3VGNA 1CYVA 3BB9A 1Q40B 2OTL3 3F40A 1W00A 4HM8B 4L7KA 3QRDA 3KE7A 4HM5B 1EA2A 1R4CA 2WO0A 1NB5I 3JUQA 4WYKB 1J2BA 3NBRA 3NM2A 4LGQA 3HZPA 3T8UA 4MMYB 1JJ22 3EX9A 1GD3A 1K41A 4N6UA 1EKMA 4TX4A 5EEOA 3SLUA 3L0RA 1A90A 1BUQA 1O7PB 1WMNA 2XGLA 3S29A 1VQ53 1W5ZA 3AMOA 3CCE3 1YIT3 2W03A 1QAFA 5D82A 5KP1A 3EBTA 5BXQA 4HM2B 2PZVA 3KZTA 3CCS3 3OW22 3CXC2 3DMCA 3EC9A 3OV4A 4WFOA 3OWSA 1M904 4N6NB 1K28A 1WNHA 5D83A 3NBBA 1A2KA 2WGOA 3CME3 1LVNA 3GZRA 5AYRB 3PYJA 3UL6A 3WA3A 1QJGA 1Y4KA 4XM4A 3SOYA 1OHPA 5AEUB 4R9KA 1WMPA 5CK6A 1NDOB 1STDA 3S28A 4FMCA 3D3LA 1GY6A 4HYZA 1IVWA 1NB3I 1JN5B 3CC73 5JBSA 1W2B2 3LTAA 5AIGA 2Y73A 3CC23 2STDA 4N6LA 2XR8B 1A2VA 5CF2A 2OOVA 1MOLA 3F7SA 4MJDA 4EBGA 1N8QA 3D9RA 1M1XB 4HZBB 3UJMA 3F9SA 1JNQA 1UUVB 3LH4A 1O7MB 3STDA 2XH9A 4R80A 2E2TA 1RRHA 1VQ43 2L4VA 3K5TA 4HM1B 3J7Yd 2FGTA 1TP6A 2CFLA 3MWZA 2Q07A 4WP5A 2CWTA 2PNCA 1TFKA 2HMNB 3G16A 3Q90A 1M9GA 1D6YA 3BLZA 1LNHA 1T5YA 4R4KA 2HMMB 2OCTA 5IEOA 3FG4A 5DREA 4EC6A 2CWUA 1QALA 3NUVA 2R4IA 1KC84 1NJI4 1JB4A 3U1WA 3CCM3 3CNXA 2A15A 4BTWA 2SBLA 3PS8A 3OWYA 1C7HA 1UI7A 2W6JH 2CC3A 3KFQC 4EV2A 5IERA 5I97A 1N5HA 3LTBA 3MPHA 3X3XA 4EYCA 2P0MA 5IG4A 2K0MA 2ZDJA 3GAXA 1IK3A 2XRXB 5IW9A 1JKGB 1Q40A 3BNCA 3NQYA 3LXUX 2WOFA 2F86B 4RBNA 1DYUA 3ALAA 2O9UX 1S5AA 3FF0A 4FMAA 5STDA 2P05A 2CG0A 3HX8A 5KP3A 1OGZA 2W2CA 4WYKA 5IEPA 1Z1SA 1N5PA 3PGBA 3WDGB 3CCQ3 5CXOA 1U8CB 1QAKA 2C10A 1D6UA 2HMJB 4XDVA 1IV7A 4CDLA 3G713 1DMNA 4CCVA 1Q864 2CWVA 1O7HB 1US1A 3I0YA 1W4NA 3QK9A 3T8NA 3NQZA 2QA43 4K61A 1IV9A 3WA2X 1MNLA 4AKZA 3OWUA 2CH9A 1JV2B 1FGOA 1CEWI 3CMA3 2XSOB 3LT8A 4QWTA 2W56B 2W9QA 4N6MA 2XFSA 2WGQA 1K734 1V74A 1E3VA 2KRTA 3CCU3 1ZX2A 4J9AA 1Q42A 4HM4B 1UI8A 1SIHA 3NV0B 2HMOB 1GD4A 2W9PA 3FG3A 1JN5A 3GRDA 4HM6B 2IUJA 4FCZA 2FNQA 1WTHA 4HM0B 3CCV3 2I9WA 2JQ5A 4R9LA 3FLJA 2GEXA 4G1MB 2F98A 4FCJA 2CKFB 4H3UA 3IPTA 4KFFA 4NREA 4L8OA 4LSOA 1O7GB 3N9HA 1L5GB 1W6YA 3K0ZA 3DUKA 3KIIA 3OXAA 1IT7A 1O7NB 5AIFA 1OACA 3NM7A 5ELJA 2HMLB 1OF5A 4RNYA 3NX0A 1HKXA 1IQYA 3WMDA 1AVLA 3B7CA 1OUNA 2P0XA 4IPBA 1N9EA 3LMLA 3DY5A 3K7CA 3X42A 3FF2A 1KD14 1JRQA 1ISKA 3JVCA 1SIIA 4Q53A 3GWRA 2CFGA 2OQEA 4O3VA 3V92A 3JUPA 1DVCA 4XBTA 3RDEA 1W02A 2M7OA 4KFEA 4O2HA 3K63A 1A67A 1OHSA 2BNGA 4I4KA 1W7CA 1JB2A 3O8YA 3G8ZA 1VQM3 3HI7A 2QEX3 1OF5B 3H3HA 4AEQA 5CF1A 3SX1A 2CHCA 1IT8A 1G96A 3E99A 2Z77A 3HIIA 3IJEB 3MKIA 2MF7A 2HMKB 1JKGA 1IQ8A 3FGYA 5AYSC 1W01A 1NU3A 6STDA 3JUOA 2D1WA 1EQKA 3MYTA 5A0OB 2ML5A 1HU9A 3CCR3 1VZZA 3BNEA 2E2UA 1VQ73 1LOXA 1O7WB 3A76A 1Q824 1VQL3 1YVBI 3X41A 3FH1A 2IMJA 1WQLB 4GB5A 3G0KA 1WMOA 5FW5A 3JUNA 3LOYA 4IT7A 1D6ZA 2IUKA 4FMDA 3DM8A 3KSED 3JUMA 5HGRA 2GBWB 5JPPA 5CLKA 2CK3H 2ZL8A 2GXFA 1KSIA 1W6GA 4H61A 1IVVA 4GL6A 3H51A 5BVBA 1NO3A 2W56A 3ER7A 5EQLA 5LC6A 2OOVC 4MMXB 2V1LA 2YFLB 2XFTA 3TDGA 1YJN3 2YX9A 2YFIB 1KWIA 2OWPA 2LQVA 1OH0A 3RGRA 1ROAA 3DGMA 5AIHA 3F8HA 4BTYA 5AI1A 1S723 3MHEA 4U13A 5LC7A 4R1KA 1YJW3 2Y74A 2K54A 3VSYA 4FCMA 4LZIA 1PU4A 1VQN3 3NV0A 1CQSA 2Z76A 2JDIH 4N6TA 5IENA 2B24B 2GEYA 3B4PA 3V99A 1SPUA 1YGEA 4RNZA 1GY7A 5JPUA 4AKYA 1OGXA 5TGNA 3CD63 4FMBA 1UUWB 3EJVA 3EHCA 5IG3A 1OPYA 1FUWA 1FGTA 2CW9A 1OHOA 5IF6A 4X2OA 1RKYA 1KQS2 7STDA 1W6CA 4JF8A 3SXXA 3EQQB 4N6V0 2F99A 3FG1A 1SQWA 1TUHA 2BMRB 3G4S3 2RGQA 3MSOA 2P09A 4K1UA 1SJWA 2CG1A 2FXTA 3WODG 1Q814 2XSHB 3LT9A 1JB5A 1E97A 1CYUA 1VQ83 2XGNA 3WOFB 1OCVA 4XDWA 4KFDA 1STFI 3UNLA 3G6E3 4RZMA 2RSXA 3MG1A 4X2HA 3ECFA 3DGLA 3CC43 3GZYB 4IIAA 3Q2PA 3CPOA 1IDPA 3OX9A 3RGAA 3MG3A 2BMOB 5IG0A 2E2VA 4OVMA 3B4OA 3B8LA 3GZBA 1RRLA 2RFRA 3DZLA 4XBXA 1N8R4 3I553 1YI23 1FGMA 1UW1A 4HZ9B 5DRVA 3N54B 4LMIA 5EVHA 2Z7AA 3X3YA 4LEHA 3X40A 3UL5A 3F8XA 1ULJB 5FGOA 3T0UA 1VQ93 4O02B 2GBXB 3PCSA 3KN4A 1RN7A 3CCJ3 1VQO3 3U97A 1YHQ3 3PZWA 1IVXA 1F8NA 2CFDA 2UX0A 1DMQA 2P38A 1AVKA 3AMOB 3EF8A 3KSPA 2WOHA 1Q7Y4 1VQ63 3PCRA 1VQK3 3FKAA 3SEDA 2KCDA 4ZM8A 1QMAA 4JRFA 5IG5A 4J8TA 3CPW2 1LXEA 2B1XB 1RJOA 2QIYA 5ELUA 4FR9A 1EG9B 1TFOA 2IA7A 3KKGA 4K1VA 1FGQA 2CFWA 2C11A 4HVNA 1N9JA 4MMZB 1AR0A 3K9MC 3LTCA 2ML6A 2W0QA 3CCL3 5AIIA 4MEIA 3BNBA 2GU1A 2YFJB 2CFKA 1U5OA 4HKVB 1W2ZA 1ULIB 2INXA 1QVF2 2BT3A 5G2GA 3PXMA 1QVG2 1M1K4 2BO9B 3CU3A 1E3RA 1ZO2A 3F7XA 2GU3A 2KXGA 3DXOA 4O8SA 4HJLB 4KVHA 2CIUA 1IU7A 1DVDA 3EE1A 1FA3A 3GZXB 3NXJA 3HIGA 3Q1CA 8CHOA 1GYBA 3CNMA 2RCDA 3NBJA 1K8A4 3LYGA 4BTXA 1FGRA 4XBYA 1VQP3 5D81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GS3 A;  3EN1 B;  3FZW A;  2BMQ B;  4XB5 A;  3HK4 A;  4HM7 B;  3EN8 A;  1ASK A;  3F14 A;  4L8P A;  4ORL A;  4OUQ A;  5KP4 A;  5AEW B;  2QGU A;  1GY5 A;  3MG2 A;  4N3V A;  3NHX A;  3LZA A;  3M8C A;  4PEJ A;  3SOA A;  1NWW A;  4STD A;  4HM3 B;  3S5C A;  3EBY A;  1DMM A;  3FSD A;  4WWU C;  3ROB A;  3VGN A;  3BB9 A;  1Q40 B;  3F40 A;  1W00 A;  4HM8 B;  4L7K A;  3KE7 A;  4HM5 B;  1EA2 A;  3JUQ A;  4WYK B;  3NBR A;  3NM2 A;  4LGQ A;  3HZP A;  3T8U A;  3EX9 A;  1K41 A;  1BUQ A;  1O7P B;  5D82 A;  5KP1 A;  3EBT A;  5BXQ A;  4HM2 B;  2PZV A;  3KZT A;  3DMC A;  3EC9 A;  3OV4 A;  3OWS A;  5D83 A;  1A2K A;  3GZR A;  1QJG A;  4XM4 A;  3SOY A;  1OHP A;  5AEU B;  4R9K A;  5CK6 A;  1NDO B;  1STD A;  1GY6 A;  1JN5 B;  5AIG A;  2STD A;  2XR8 B;  5CF2 A;  3F7S A;  4MJD A;  3D9R A;  3UJM A;  4HZB B;  3F9S A;  1UUV B;  1O7M B;  3STD A;  4HM1 B;  1TP6 A;  4WP5 A;  2HMN B;  3G16 A;  3Q90 A;  3BLZ A;  2HMM B;  5IEO A;  5DRE A;  3NUV A;  2R4I A;  1JB4 A;  3CNX A;  2A15 A;  3OWY A;  1C7H A;  5IER A;  5IG4 A;  2XRX B;  1JKG B;  1Q40 A;  2F86 B;  1S5A A;  3FF0 A;  5STD A;  3HX8 A;  5KP3 A;  1OGZ A;  2W2C A;  4WYK A;  5IEP A;  1Z1S A;  5CXO A;  2HMJ B;  4XDV A;  4CDL A;  1DMN A;  1O7H B;  3I0Y A;  3T8N A;  3OWU A;  2XSO B;  1E3V A;  1ZX2 A;  4J9A A;  1Q42 A;  4HM4 B;  3NV0 B;  2HMO B;  1JN5 A;  3GRD A;  4HM6 B;  4HM0 B;  2I9W A;  2JQ5 A;  4R9L A;  3FLJ A;  2GEX A;  2F98 A;  4FCJ A;  2CKF B;  4H3U A;  3IPT A;  4L8O A;  1O7G B;  1W6Y A;  3K0Z A;  3DUK A;  3OXA A;  1O7N B;  5AIF A;  2HML B;  1OF5 A;  1HKX A;  3WMD A;  3B7C A;  1OUN A;  3K7C A;  3FF2 A;  1ISK A;  4Q53 A;  3GWR A;  3JUP A;  4XBT A;  1W02 A;  1OHS A;  2BNG A;  4I4K A;  1JB2 A;  3G8Z A;  1OF5 B;  3H3H A;  5CF1 A;  2CHC A;  3E99 A;  2Z77 A;  3MKI A;  2HMK B;  1JKG A;  3FGY A;  1W01 A;  1NU3 A;  6STD A;  3JUO A;  3MYT A;  1VZZ A;  1O7W B;  3A76 A;  3FH1 A;  2IMJ A;  1WQL B;  4GB5 A;  3G0K A;  5FW5 A;  3JUN A;  3DM8 A;  3JUM A;  5HGR A;  2GBW B;  5JPP A;  5CLK A;  2GXF A;  3H51 A;  5BVB A;  3ER7 A;  2YFL B;  2YFI B;  2OWP A;  1OH0 A;  3RGR A;  5AIH A;  3F8H A;  5AI1 A;  3MHE A;  4U13 A;  4R1K A;  2K54 A;  3VSY A;  4FCM A;  3NV0 A;  1CQS A;  2Z76 A;  5IEN A;  2B24 B;  2GEY A;  3B4P A;  1GY7 A;  5JPU A;  1OGX A;  5TGN A;  1UUW B;  3EJV A;  3EHC A;  5IG3 A;  1OPY A;  1OHO A;  5IF6 A;  4X2O A;  7STD A;  3EQQ B;  2F99 A;  1TUH A;  2BMR B;  2RGQ A;  3MSO A;  4K1U A;  1SJW A;  2XSH B;  1JB5 A;  1E97 A;  1OCV A;  4XDW A;  3UNL A;  4RZM A;  3MG1 A;  4X2H A;  3ECF A;  3GZY B;  4IIA A;  3CPO A;  1IDP A;  3OX9 A;  3RGA A;  3MG3 A;  2BMO B;  5IG0 A;  4OVM A;  3B4O A;  3B8L A;  3GZB A;  2RFR A;  3DZL A;  4XBX A;  4HZ9 B;  5DRV A;  5EVH A;  4LMI A;  2Z7A A;  4LEH A;  3F8X A;  1ULJ B;  2GBX B;  2UX0 A;  1DMQ A;  3EF8 A;  3KSP A;  3FKA A;  3SED A;  1QMA A;  5IG5 A;  4J8T A;  2B1X B;  2QIY A;  1EG9 B;  3KKG A;  4K1V A;  4HVN A;  1AR0 A;  5AII A;  2YFJ B;  1U5O A;  4HKV B;  1ULI B;  2INX A;  5G2G A;  3CU3 A;  1E3R A;  1ZO2 A;  3F7X A;  3DXO A;  4HJL B;  4KVH A;  3GZX B;  3NXJ A;  8CHO A;  1GYB A;  3CNM A;  2RCD A;  3LYG A;  4XBY A;  5D81 A; 
#chains in the Genus database with same CATH topology
 1BRH A;  1GS3 A;  3EN1 B;  2O3O A;  3DH2 A;  2BMQ B;  3FZW A;  4HBR A;  3VF1 A;  3UB1 A;  3URP A;  2Z6B A;  5M18 A;  1RDS A;  1RGE A;  1BNS A;  2BU4 A;  1LQM B;  2OQE C;  1TU5 A;  1PFP A;  4N6O B;  1FUS A;  4XB5 A;  3S27 A;  5G1K A;  3WOE B;  3HK4 A;  4HM7 B;  2KF4 A;  3IMA B;  3EN8 A;  1YIJ 3;  2W04 A;  1ASK A;  3F14 A;  1K9M 4;  4L8P A;  4KZ1 A;  2LYX A;  3BND A;  4NHF A;  4OK0 A;  1ROV A;  3I56 3;  4ORL A;  4WHA A;  3S67 A;  3X3Z A;  1AV4 A;  1B3S A;  1FYS A;  1IVU A;  2XF3 A;  1V58 A;  4OUQ A;  5KP4 A;  1RN4 A;  5AEW B;  2QGU A;  3WR2 A;  3N8B A;  1GY5 A;  3FCS B;  3MG2 A;  4N3V A;  5RNT A;  3GSP A;  3NHX A;  4K90 B;  1BSD A;  3LZA A;  4EV5 A;  1YJ9 3;  2D42 A;  3V98 A;  1BNF A;  1RGG A;  1IQX A;  3M8C A;  4PEJ A;  2BHM A;  3SOA A;  1NWW A;  3DGN A;  4STD A;  2MC8 A;  3DGO A;  3LTD A;  4HM3 B;  2OTJ 3;  3EB8 A;  3S5C A;  3EBY A;  1DMM A;  3FSD A;  1TIJ A;  4WWU C;  3ROB A;  3SVA A;  4EXR A;  1I3I A;  2XEP A;  3VGN A;  1CYV A;  1BRI A;  1HYF A;  3BB9 A;  1Q40 B;  1RHL A;  2OTL 3;  3F40 A;  1W00 A;  1BU4 A;  1BVI A;  4HM8 B;  3QRD A;  3KE7 A;  4L7K A;  2RBI A;  1EA2 A;  4HM5 B;  1R4C A;  2C4B A;  1PY3 A;  2WO0 A;  1NB5 I;  3JUQ A;  4WYK B;  1UGI A;  3NBR A;  3NM2 A;  4LGQ A;  1J2B A;  1HZ1 A;  3HZP A;  3T8U A;  4MMY B;  1BUJ A;  1JJ2 2;  1RGC A;  1GD3 A;  1K41 A;  3EX9 A;  4N6U A;  1EKM A;  4TX4 A;  5EEO A;  3SLU A;  3L0R A;  1A90 A;  1BUQ A;  1BNE A;  1O7P B;  1WMN A;  2IYJ A;  1I2F A;  2XGL A;  3S29 A;  1VQ5 3;  1W5Z A;  2ZA4 A;  3AMO A;  3CCE 3;  1YIT 3;  2W03 A;  1QAF A;  5D82 A;  5KP1 A;  3EBT A;  3A5E A;  5BXQ A;  4HM2 B;  2PZV A;  3KZT A;  3CCS 3;  1B2M A;  3OW2 2;  2H0G A;  3CXC 2;  1RCL A;  4ILF A;  3DMC A;  3EC9 A;  3OV4 A;  4WFO A;  3OWS A;  1M90 4;  1JBR A;  4N6N B;  1K28 A;  1WNH A;  5D83 A;  3NBB A;  1A2K A;  2WGO A;  3CME 3;  1LVN A;  3GZR A;  5AYR B;  3PYJ A;  2KF6 A;  3UL6 A;  2KF5 A;  3WA3 A;  1QJG A;  1BNR A;  1A2P A;  1Y4K A;  4XM4 A;  3SOY A;  1OHP A;  5AEU B;  4R9K A;  1WMP A;  5CK6 A;  1NDO B;  1STD A;  3S28 A;  4FMC A;  3D3L A;  2SAR A;  1B20 A;  1GY6 A;  4HYZ A;  4NPB A;  1IVW A;  1NB3 I;  1JN5 B;  1SAR A;  3CC7 3;  5JBS A;  1W2B 2;  3LTA A;  5AIG A;  2Y73 A;  3CC2 3;  4GHO A;  2R41 A;  2STD A;  4N6L A;  2XR8 B;  1A2V A;  3AHS A;  5CF2 A;  2OOV A;  1MOL A;  1RLS A;  3F7S A;  1GMR A;  4MJD A;  4EBG A;  1T2I A;  1N8Q A;  3D9R A;  1M1X B;  4HZB B;  2BIR A;  3F9S A;  1BIR A;  3UJM A;  1JNQ A;  1UUV B;  1BGS A;  3LH4 A;  1O7M B;  2CX1 A;  1GMP A;  2XH9 A;  3STD A;  4R80 A;  1I3F A;  4RNT A;  3D79 A;  2E2T A;  1RRH A;  1VQ4 3;  9RNT A;  2L4V A;  3K5T A;  4HM1 B;  3J7Y d;  2K3D A;  2FGT A;  1RGK A;  1TP6 A;  2CFL A;  3MWZ A;  4J5K A;  4HAA A;  2Q07 A;  4WP5 A;  2H0I A;  2CX0 A;  2CWT A;  2PNC A;  6GSP A;  1LOW A;  1TRQ A;  1TFK A;  2HMN B;  3G16 A;  3Q90 A;  1M9G A;  1D6Y A;  1T2H A;  3BLZ A;  4LYL B;  1LNH A;  1T5Y A;  4R4K A;  2HMM B;  2OCT A;  5IEO A;  7GSP A;  4EW5 A;  3FG4 A;  5DRE A;  4EC6 A;  2CWU A;  1QAL A;  3NUV A;  2R4I A;  3ZG0 A;  1KC8 4;  1NJI 4;  3ZFZ A;  1JB4 A;  3U1W A;  3CCM 3;  1CH0 A;  1BRG A;  2A15 A;  3CNX A;  3Q3F A;  4BTW A;  2SBL A;  1BOX A;  3PS8 A;  1IYY A;  1DE3 A;  1BSE A;  3OWY A;  1C7H A;  4BIR A;  1UI7 A;  2W6J H;  2CC3 A;  3KFQ C;  4EV2 A;  5IER A;  5I97 A;  1N5H A;  3LTB A;  3MPH A;  1T3B A;  3X3X A;  4EYC A;  2P0M A;  1BRJ A;  5IG4 A;  2K0M A;  7RNT A;  2ZDJ A;  3GAX A;  1LQG C;  2F4Y A;  1IK3 A;  2F56 A;  2XRX B;  5IW9 A;  1JKG B;  5M19 A;  1Q40 A;  3BNC A;  3NQY A;  3LXU X;  2WOF A;  2F86 B;  2J8X B;  4RBN A;  1DYU A;  3ALA A;  2O9U X;  1S5A A;  3FF0 A;  4FMA A;  5STD A;  2P05 A;  1RGF A;  2CG0 A;  3HX8 A;  1OGZ A;  5KP3 A;  4BL2 A;  1RGA A;  1BRS A;  2W2C A;  4WYK A;  5IEP A;  1Z1S A;  1N5P A;  1JBT A;  3PGB A;  3WDG B;  3CCQ 3;  1BSB A;  5CXO A;  1U8C B;  1QAK A;  2C10 A;  1D6U A;  2HMJ B;  3AGO A;  1IV7 A;  4XDV A;  2RNT A;  4CDL A;  3G71 3;  1DMN A;  4CCV A;  1Q86 4;  2CWV A;  1O7H B;  1US1 A;  3I0Y A;  1UCL A;  1W4N A;  2IY2 A;  3QK9 A;  3T8N A;  3NQZ A;  2QA4 3;  4K61 A;  4BL3 A;  1IV9 A;  3WA2 X;  1MNL A;  4AKZ A;  3OWU A;  2CH9 A;  1JV2 B;  1FGO A;  2AAE A;  1CEW I;  3CMA 3;  2XSO B;  3LT8 A;  4QWT A;  2W56 B;  2W9Q A;  4N6M A;  2XFS A;  2WGQ A;  1BAO A;  1K73 4;  1V74 A;  1E3V A;  2KRT A;  3CCU 3;  1ZX2 A;  4J9A A;  1Q42 A;  4HM4 B;  2H0H A;  1TRP A;  1UI8 A;  1SIH A;  1MWS A;  1V57 A;  3NV0 B;  2HMO B;  1GD4 A;  2W9P A;  3FG3 A;  1JN5 A;  3GRD A;  4HM6 B;  2IUJ A;  2HOH A;  2FNQ A;  4FCZ A;  1WTH A;  4HM0 B;  3CCV 3;  2I9W A;  2JQ5 A;  4R9L A;  3FLJ A;  2GEX A;  4G1M B;  2F98 A;  5M1A A;  4FCJ A;  1NNV A;  1MWU A;  1B2U A;  2CKF B;  4H3U A;  3IPT A;  4KFF A;  4NRE A;  4KT3 B;  4L8O A;  4LSO A;  1O7G B;  3N9H A;  1L5G B;  1UCJ A;  1W6Y A;  3K0Z A;  3DUK A;  3KII A;  3OXA A;  1IT7 A;  1AY7 A;  1O7N B;  5AIF A;  1OAC A;  3NM7 A;  5ELJ A;  2HML B;  1OF5 A;  4RNY A;  1VQQ A;  3NX0 A;  5G1L A;  1HKX A;  1IQY A;  3KCH A;  1X1X A;  3WMD A;  1AVL A;  3B7C A;  1OUN A;  2P0X A;  4IPB A;  3ZG5 A;  6RNT A;  3D4A A;  1N9E A;  1Q9E A;  1RN1 A;  3LML A;  3DY5 A;  1GOU A;  3K7C A;  3X42 A;  1GSP A;  3FF2 A;  1KD1 4;  1JRQ A;  1ISK A;  3JVC A;  1SII A;  4Q53 A;  1JBS A;  3GWR A;  2CFG A;  2OQE A;  4O3V A;  3V92 A;  3JUP A;  1DVC A;  4XBT A;  3RDE A;  1W02 A;  2M7O A;  4KFE A;  4O2H A;  3K63 A;  5HOH A;  1A67 A;  1OHS A;  2BNG A;  4I4K A;  1W7C A;  1JB2 A;  3O8Y A;  3G8Z A;  1VQM 3;  3HI7 A;  1RTU A;  2QEX 3;  1OF5 B;  3H3H A;  4AEQ A;  5CF1 A;  3SX1 A;  2CHC A;  1IT8 A;  1G96 A;  3E99 A;  1UCI A;  1LRA A;  2Z77 A;  3HII A;  3IJE B;  3MKI A;  1BNI A;  2MF7 A;  1BAN A;  2HMK B;  1B2Z A;  1JKG A;  1IQ8 A;  1LNI A;  1PYL A;  1MWT A;  3FGY A;  5AYS C;  1W01 A;  1NU3 A;  1RMS A;  1ZGX A;  3JUO A;  6STD A;  2D1W A;  1EQK A;  1GMQ A;  2UGI A;  3MYT A;  1YVS A;  5A0O B;  1RGH A;  2ML5 A;  1HU9 A;  3CCR 3;  1VZZ A;  3BNE A;  1BNJ A;  1G0T A;  2E2U A;  3BU4 A;  1VQ7 3;  1LOX A;  1O7W B;  3A76 A;  1Q82 4;  1VQL 3;  1YVB I;  3X41 A;  4CJN A;  1C54 A;  3FH1 A;  2IMJ A;  1WQL B;  4GB5 A;  3G0K A;  1WMO A;  5FW5 A;  3JUN A;  1FW7 A;  2ZHX B;  3LOY A;  4IT7 A;  1D6Z A;  2IUK A;  2GSP A;  4FMD A;  3DM8 A;  3KSE D;  1DET A;  3JUM A;  2GBW B;  5HGR A;  1TJD A;  5JPP A;  1BSC A;  5CLK A;  1I0X A;  2CK3 H;  4I5Q A;  2ZL8 A;  2GXF A;  1RNT A;  1KSI A;  1W6G A;  4H61 A;  1IVV A;  1LOV A;  4GL6 A;  3H51 A;  5BVB A;  1NO3 A;  2W56 A;  3ER7 A;  5EQL A;  1RGL A;  5LC6 A;  1RCK A;  2OOV C;  1BSA A;  2V1L A;  2YFL B;  4MMX B;  2XFT A;  3TDG A;  1YJN 3;  2YX9 A;  1UGH I;  1BRK A;  1KWI A;  2YFI B;  2OWP A;  2LQV A;  1OH0 A;  3RGR A;  1ROA A;  3DGM A;  5AIH A;  3F8H A;  4BTY A;  5AI1 A;  1S72 3;  3MHE A;  4U13 A;  5LC7 A;  4R1K A;  1YJW 3;  2Y74 A;  2K54 A;  3VSY A;  4FCM A;  4LZI A;  1PU4 A;  1VQN 3;  3NV0 A;  1CQS A;  2Z76 A;  2JDI H;  4N6T A;  5IEN A;  2B24 B;  2GEY A;  3B4P A;  3V99 A;  3DGY A;  1JZD A;  1SPU A;  1X1U A;  1YGE A;  4J5G A;  5GSP A;  1EEJ A;  4RNZ A;  1GY7 A;  5JPU A;  4AKY A;  1OGX A;  5TGN A;  3CD6 3;  4FMB A;  1UUW B;  3EJV A;  3EHC A;  5IG3 A;  1OPY A;  1RSN A;  1FUW A;  1FGT A;  1GOY A;  1ZS7 A;  1B2X A;  2CW9 A;  1OHO A;  5IF6 A;  2F5M A;  4X2O A;  1RKY A;  1X1W A;  1KQS 2;  1I2E A;  7STD A;  1W6C A;  4JF8 A;  3SXX A;  3EQQ B;  1B21 A;  1TTO A;  3HOH A;  4N6V 0;  2F99 A;  2F5W A;  3FG1 A;  1SQW A;  1BNG A;  1TUH A;  1UCK A;  2BMR B;  4CPK A;  3G4S 3;  2RGQ A;  3MSO A;  2P09 A;  4K1U A;  1SJW A;  2CG1 A;  2FXT A;  4GSP A;  3WOD G;  1Q81 4;  2XSH B;  1Q7H A;  3LT9 A;  1JB5 A;  1E97 A;  2UUG C;  3D5G A;  1I2G A;  1UDI I;  1CYU A;  1VQ8 3;  2XGN A;  3WOF B;  1OCV A;  4XDW A;  4KFD A;  1STF I;  3UNL A;  3G6E 3;  4RZM A;  2RSX A;  3MG1 A;  4X2H A;  3ECF A;  3DGL A;  3CC4 3;  3GZY B;  4IIA A;  3Q2P A;  3CPO A;  1IDP A;  3OX9 A;  3RGA A;  5BIR A;  1G02 A;  3MG3 A;  2BMO B;  5IG0 A;  2E2V A;  1LOY A;  4OVM A;  3B4O A;  3B8L A;  3SYU A;  3GZB A;  2AAD A;  1RRL A;  2RFR A;  3DZL A;  1BRN L;  4XBX A;  1N8R 4;  1AQZ A;  3I55 3;  1YI2 3;  1FGM A;  1UW1 A;  4HZ9 B;  5DRV A;  4DKI A;  1X1Y A;  3N54 B;  4LMI A;  5EVH A;  2Z7A A;  3X3Y A;  4LEH A;  3X40 A;  3UL5 A;  3F8X A;  1GOV A;  1ULJ B;  5FGO A;  3T0U A;  1VQ9 3;  4O02 B;  1JZO A;  2GBX B;  1EUI C;  3KN4 A;  1RN7 A;  3PCS A;  3CCJ 3;  1VQO 3;  3D5I A;  3U97 A;  1YHQ 3;  3PZW A;  1UUG B;  1IVX A;  1F8N A;  2CFD A;  2KF3 A;  2UX0 A;  1DMQ A;  2P38 A;  1AVK A;  3AMO B;  3EF8 A;  3KSP A;  2WOH A;  1Q7Y 4;  1VQ6 3;  1YNV X;  3PCR A;  1VQK 3;  3FKA A;  3SED A;  4HOH A;  1RNB A;  2KCD A;  1FUT A;  3AHW A;  1QMA A;  4JRF A;  4ZM8 A;  5BU4 A;  4J8T A;  5IG5 A;  3CPW 2;  1LXE A;  2B1X B;  1MWR A;  1RJO A;  2QIY A;  5ELU A;  1B2S A;  1MGW A;  4FR9 A;  1EG9 B;  1FZU A;  1TFO A;  2IA7 A;  3KKG A;  4K1V A;  1FGQ A;  2CFW A;  2C11 A;  4HVN A;  1N9J A;  4MMZ B;  1I70 A;  1AR0 A;  3RNT A;  3K9M C;  3LTC A;  1I8V A;  2ML6 A;  2W0Q A;  3CCL 3;  5AII A;  4MEI A;  3BNB A;  1YGW A;  2CFK A;  2GU1 A;  1U5O A;  2YFJ B;  4HKV B;  1W2Z A;  1ULI B;  2INX A;  4BU4 A;  1QVF 2;  8RNT A;  2BT3 A;  5G2G A;  1MGR A;  3PXM A;  1QVG 2;  2L1S A;  1M1K 4;  2BO9 B;  3CU3 A;  1E3R A;  3BIR A;  1I0V A;  1ZO2 A;  3F7X A;  2GU3 A;  2KXG A;  3DXO A;  3WHO A;  4O8S A;  4HJL B;  4KVH A;  2CIU A;  1IU7 A;  3AGN A;  3EE1 A;  1DVD A;  1FA3 A;  3GZX B;  3NXJ A;  3HIG A;  3Q1C A;  8CHO A;  1GYB A;  3CNM A;  2RCD A;  1B27 A;  3NBJ A;  1K8A 4;  3LYG A;  4BTX A;  1FGR A;  2KAA A;  4XBY A;  1VQP 3;  1R4Y A;  5D81 A; 
#chains in the Genus database with same CATH homology
 4HBR A;  1GS3 A;  3EN1 B;  2O3O A;  3FZW A;  2BMQ B;  3VF1 A;  3UB1 A;  2Z6B A;  2OQE C;  1TU5 A;  1PFP A;  4N6O B;  4XB5 A;  3S27 A;  3WOE B;  3HK4 A;  4HM7 B;  3IMA B;  3EN8 A;  1YIJ 3;  2W04 A;  1ASK A;  3F14 A;  1K9M 4;  4L8P A;  4KZ1 A;  2LYX A;  3BND A;  4NHF A;  4OK0 A;  1ROV A;  3I56 3;  4ORL A;  4WHA A;  3S67 A;  3X3Z A;  1AV4 A;  1IVU A;  2XF3 A;  4OUQ A;  5KP4 A;  5AEW B;  2QGU A;  3N8B A;  1GY5 A;  3FCS B;  3MG2 A;  4N3V A;  3NHX A;  4K90 B;  3LZA A;  4EV5 A;  1YJ9 3;  2D42 A;  3V98 A;  1IQX A;  3M8C A;  4PEJ A;  2BHM A;  3SOA A;  1NWW A;  3DGN A;  4STD A;  2MC8 A;  3DGO A;  3LTD A;  4HM3 B;  2OTJ 3;  3EB8 A;  3S5C A;  3EBY A;  1DMM A;  3FSD A;  1TIJ A;  4WWU C;  3ROB A;  3SVA A;  4EXR A;  2XEP A;  3VGN A;  1CYV A;  3BB9 A;  1Q40 B;  2OTL 3;  3F40 A;  1W00 A;  4HM8 B;  4L7K A;  3QRD A;  3KE7 A;  4HM5 B;  1EA2 A;  1R4C A;  2WO0 A;  1NB5 I;  3JUQ A;  4WYK B;  1J2B A;  3NBR A;  3NM2 A;  4LGQ A;  3HZP A;  3T8U A;  4MMY B;  1JJ2 2;  3EX9 A;  1GD3 A;  1K41 A;  4N6U A;  1EKM A;  4TX4 A;  5EEO A;  3SLU A;  3L0R A;  1A90 A;  1BUQ A;  1O7P B;  1WMN A;  2XGL A;  3S29 A;  1VQ5 3;  1W5Z A;  3AMO A;  3CCE 3;  1YIT 3;  2W03 A;  1QAF A;  5D82 A;  5KP1 A;  3EBT A;  5BXQ A;  4HM2 B;  2PZV A;  3KZT A;  3CCS 3;  3OW2 2;  3CXC 2;  3DMC A;  3EC9 A;  3OV4 A;  4WFO A;  3OWS A;  1M90 4;  4N6N B;  1K28 A;  1WNH A;  5D83 A;  3NBB A;  1A2K A;  2WGO A;  3CME 3;  1LVN A;  3GZR A;  5AYR B;  3PYJ A;  3UL6 A;  3WA3 A;  1QJG A;  1Y4K A;  4XM4 A;  3SOY A;  1OHP A;  5AEU B;  4R9K A;  1WMP A;  5CK6 A;  1NDO B;  1STD A;  3S28 A;  4FMC A;  3D3L A;  1GY6 A;  4HYZ A;  1IVW A;  1NB3 I;  1JN5 B;  3CC7 3;  5JBS A;  1W2B 2;  3LTA A;  5AIG A;  2Y73 A;  3CC2 3;  2STD A;  4N6L A;  2XR8 B;  1A2V A;  5CF2 A;  2OOV A;  1MOL A;  3F7S A;  4MJD A;  4EBG A;  1N8Q A;  3D9R A;  1M1X B;  4HZB B;  3UJM A;  3F9S A;  1JNQ A;  1UUV B;  3LH4 A;  1O7M B;  3STD A;  2XH9 A;  4R80 A;  2E2T A;  1RRH A;  1VQ4 3;  2L4V A;  3K5T A;  4HM1 B;  3J7Y d;  2FGT A;  1TP6 A;  2CFL A;  3MWZ A;  2Q07 A;  4WP5 A;  2CWT A;  2PNC A;  1TFK A;  2HMN B;  3G16 A;  3Q90 A;  1M9G A;  1D6Y A;  3BLZ A;  1LNH A;  1T5Y A;  4R4K A;  2HMM B;  2OCT A;  5IEO A;  3FG4 A;  5DRE A;  4EC6 A;  2CWU A;  1QAL A;  3NUV A;  2R4I A;  1KC8 4;  1NJI 4;  1JB4 A;  3U1W A;  3CCM 3;  3CNX A;  2A15 A;  4BTW A;  2SBL A;  3PS8 A;  3OWY A;  1C7H A;  1UI7 A;  2W6J H;  2CC3 A;  3KFQ C;  4EV2 A;  5IER A;  5I97 A;  1N5H A;  3LTB A;  3MPH A;  3X3X A;  4EYC A;  2P0M A;  5IG4 A;  2K0M A;  2ZDJ A;  3GAX A;  1IK3 A;  2XRX B;  5IW9 A;  1JKG B;  1Q40 A;  3BNC A;  3NQY A;  3LXU X;  2WOF A;  2F86 B;  4RBN A;  1DYU A;  3ALA A;  2O9U X;  1S5A A;  3FF0 A;  4FMA A;  5STD A;  2P05 A;  2CG0 A;  3HX8 A;  5KP3 A;  1OGZ A;  2W2C A;  4WYK A;  5IEP A;  1Z1S A;  1N5P A;  3PGB A;  3WDG B;  3CCQ 3;  5CXO A;  1U8C B;  1QAK A;  2C10 A;  1D6U A;  2HMJ B;  4XDV A;  1IV7 A;  4CDL A;  3G71 3;  1DMN A;  4CCV A;  1Q86 4;  2CWV A;  1O7H B;  1US1 A;  3I0Y A;  1W4N A;  3QK9 A;  3T8N A;  3NQZ A;  2QA4 3;  4K61 A;  1IV9 A;  3WA2 X;  1MNL A;  4AKZ A;  3OWU A;  2CH9 A;  1JV2 B;  1FGO A;  1CEW I;  3CMA 3;  2XSO B;  3LT8 A;  4QWT A;  2W56 B;  2W9Q A;  4N6M A;  2XFS A;  2WGQ A;  1K73 4;  1V74 A;  1E3V A;  2KRT A;  3CCU 3;  1ZX2 A;  4J9A A;  1Q42 A;  4HM4 B;  1UI8 A;  1SIH A;  3NV0 B;  2HMO B;  1GD4 A;  2W9P A;  3FG3 A;  1JN5 A;  3GRD A;  4HM6 B;  2IUJ A;  4FCZ A;  2FNQ A;  1WTH A;  4HM0 B;  3CCV 3;  2I9W A;  2JQ5 A;  4R9L A;  3FLJ A;  2GEX A;  4G1M B;  2F98 A;  4FCJ A;  2CKF B;  4H3U A;  3IPT A;  4KFF A;  4NRE A;  4L8O A;  4LSO A;  1O7G B;  3N9H A;  1L5G B;  1W6Y A;  3K0Z A;  3DUK A;  3KII A;  3OXA A;  1IT7 A;  1O7N B;  5AIF A;  1OAC A;  3NM7 A;  5ELJ A;  2HML B;  1OF5 A;  4RNY A;  3NX0 A;  1HKX A;  1IQY A;  3WMD A;  1AVL A;  3B7C A;  1OUN A;  2P0X A;  4IPB A;  1N9E A;  3LML A;  3DY5 A;  3K7C A;  3X42 A;  3FF2 A;  1KD1 4;  1JRQ A;  1ISK A;  3JVC A;  1SII A;  4Q53 A;  3GWR A;  2CFG A;  2OQE A;  4O3V A;  3V92 A;  3JUP A;  1DVC A;  4XBT A;  3RDE A;  1W02 A;  2M7O A;  4KFE A;  4O2H A;  3K63 A;  1A67 A;  1OHS A;  2BNG A;  4I4K A;  1W7C A;  1JB2 A;  3O8Y A;  3G8Z A;  1VQM 3;  3HI7 A;  2QEX 3;  1OF5 B;  3H3H A;  4AEQ A;  5CF1 A;  3SX1 A;  2CHC A;  1IT8 A;  1G96 A;  3E99 A;  2Z77 A;  3HII A;  3IJE B;  3MKI A;  2MF7 A;  2HMK B;  1JKG A;  1IQ8 A;  3FGY A;  5AYS C;  1W01 A;  1NU3 A;  6STD A;  3JUO A;  2D1W A;  1EQK A;  3MYT A;  5A0O B;  2ML5 A;  1HU9 A;  3CCR 3;  1VZZ A;  3BNE A;  2E2U A;  1VQ7 3;  1LOX A;  1O7W B;  3A76 A;  1Q82 4;  1VQL 3;  1YVB I;  3X41 A;  3FH1 A;  2IMJ A;  1WQL B;  4GB5 A;  3G0K A;  1WMO A;  5FW5 A;  3JUN A;  3LOY A;  4IT7 A;  1D6Z A;  2IUK A;  4FMD A;  3DM8 A;  3KSE D;  3JUM A;  5HGR A;  2GBW B;  5JPP A;  5CLK A;  2CK3 H;  2ZL8 A;  2GXF A;  1KSI A;  1W6G A;  4H61 A;  1IVV A;  4GL6 A;  3H51 A;  5BVB A;  1NO3 A;  2W56 A;  3ER7 A;  5EQL A;  5LC6 A;  2OOV C;  4MMX B;  2V1L A;  2YFL B;  2XFT A;  3TDG A;  1YJN 3;  2YX9 A;  2YFI B;  1KWI A;  2OWP A;  2LQV A;  1OH0 A;  3RGR A;  1ROA A;  3DGM A;  5AIH A;  3F8H A;  4BTY A;  5AI1 A;  1S72 3;  3MHE A;  4U13 A;  5LC7 A;  4R1K A;  1YJW 3;  2Y74 A;  2K54 A;  3VSY A;  4FCM A;  4LZI A;  1PU4 A;  1VQN 3;  3NV0 A;  1CQS A;  2Z76 A;  2JDI H;  4N6T A;  5IEN A;  2B24 B;  2GEY A;  3B4P A;  3V99 A;  1SPU A;  1YGE A;  4RNZ A;  1GY7 A;  5JPU A;  4AKY A;  1OGX A;  5TGN A;  3CD6 3;  4FMB A;  1UUW B;  3EJV A;  3EHC A;  5IG3 A;  1OPY A;  1FUW A;  1FGT A;  2CW9 A;  1OHO A;  5IF6 A;  4X2O A;  1RKY A;  1KQS 2;  7STD A;  1W6C A;  4JF8 A;  3SXX A;  3EQQ B;  4N6V 0;  2F99 A;  3FG1 A;  1SQW A;  1TUH A;  2BMR B;  3G4S 3;  2RGQ A;  3MSO A;  2P09 A;  4K1U A;  1SJW A;  2CG1 A;  2FXT A;  3WOD G;  1Q81 4;  2XSH B;  3LT9 A;  1JB5 A;  1E97 A;  1CYU A;  1VQ8 3;  2XGN A;  3WOF B;  1OCV A;  4XDW A;  4KFD A;  1STF I;  3UNL A;  3G6E 3;  4RZM A;  2RSX A;  3MG1 A;  4X2H A;  3ECF A;  3DGL A;  3CC4 3;  3GZY B;  4IIA A;  3Q2P A;  3CPO A;  1IDP A;  3OX9 A;  3RGA A;  3MG3 A;  2BMO B;  5IG0 A;  2E2V A;  4OVM A;  3B4O A;  3B8L A;  3GZB A;  1RRL A;  2RFR A;  3DZL A;  4XBX A;  1N8R 4;  3I55 3;  1YI2 3;  1FGM A;  1UW1 A;  4HZ9 B;  5DRV A;  3N54 B;  4LMI A;  5EVH A;  2Z7A A;  3X3Y A;  4LEH A;  3X40 A;  3UL5 A;  3F8X A;  1ULJ B;  5FGO A;  3T0U A;  1VQ9 3;  4O02 B;  2GBX B;  3PCS A;  3KN4 A;  1RN7 A;  3CCJ 3;  1VQO 3;  3U97 A;  1YHQ 3;  3PZW A;  1IVX A;  1F8N A;  2CFD A;  2UX0 A;  1DMQ A;  2P38 A;  1AVK A;  3AMO B;  3EF8 A;  3KSP A;  2WOH A;  1Q7Y 4;  1VQ6 3;  3PCR A;  1VQK 3;  3FKA A;  3SED A;  2KCD A;  4ZM8 A;  1QMA A;  4JRF A;  5IG5 A;  4J8T A;  3CPW 2;  1LXE A;  2B1X B;  1RJO A;  2QIY A;  5ELU A;  4FR9 A;  1EG9 B;  1TFO A;  2IA7 A;  3KKG A;  4K1V A;  1FGQ A;  2CFW A;  2C11 A;  4HVN A;  1N9J A;  4MMZ B;  1AR0 A;  3K9M C;  3LTC A;  2ML6 A;  2W0Q A;  3CCL 3;  5AII A;  4MEI A;  3BNB A;  2GU1 A;  2YFJ B;  2CFK A;  1U5O A;  4HKV B;  1W2Z A;  1ULI B;  2INX A;  1QVF 2;  2BT3 A;  5G2G A;  3PXM A;  1QVG 2;  1M1K 4;  2BO9 B;  3CU3 A;  1E3R A;  1ZO2 A;  3F7X A;  2GU3 A;  2KXG A;  3DXO A;  4O8S A;  4HJL B;  4KVH A;  2CIU A;  1IU7 A;  1DVD A;  3EE1 A;  1FA3 A;  3GZX B;  3NXJ A;  3HIG A;  3Q1C A;  8CHO A;  1GYB A;  3CNM A;  2RCD A;  3NBJ A;  1K8A 4;  3LYG A;  4BTX A;  1FGR A;  4XBY A;  1VQP 3;  5D81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...