3G8ZA

Crystal structure of protein of unknown function with cystatin-like fold (np_639274.1) from xanthomonas campestris at 1.90 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
MNTIDIAKSYITAIQTGDHATLGSIISPDVIWHQPGNHQFSGTHRGMAVVGPMLGKMMEVSNGTFAISRADDYMASGDWVAITLEFSGQANGVTLKQAGVDLLRIEDGKIVEVRLFSADQTQEDAFWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein of unknown function with cystatin-like fold
publication title Crystal structure of protein of unknown function with cystatin-like fold (NP_639274.1) from Xanthomonas campestris at 1.90 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
total genus 34
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3g8zA00
5CF1A 1W00A 2XRXB 3GWRA 5BXQA 2B1XB 4HZ9B 4XBYA 3BLZA 5HGRA 1OHSA 1W02A 1IDPA 1OF5B 3EHCA 3OV4A 4L8OA 5KP3A 2Z76A 3F9SA 5KP4A 3HX8A 4IIAA 3GRDA 3EN8A 2BMRB 5D82A 3JUOA 1S5AA 3OWSA 3JUQA 4CDLA 4ORLA 3VSYA 4WYKA 1TUHA 3M8CA 1DMMA 2XSOB 1ZX2A 3G16A 1DMQA 1BUQA 3S5CA 3DXOA 2GBWB 1E97A 3FH1A 6STDA 4WYKB 4HVNA 5IG5A 1ULJB 3NM2A 3F7SA 3FF2A 5AIIA 3OXAA 4XBTA 4LGQA 1OCVA 1OGZA 5IG4A 1VZZA 1O7WB 1NWWA 2QIYA 3SOYA 1O7GB 5IG3A 5AIHA 5IERA 1JKGA 3OX9A 3MSOA 3OWYA 3GZBA 3VGNA 4LMIA 4OVMA 1ISKA 2RFRA 1U5OA 4HZBB 3F8HA 5AIFA 1W6YA 2HMMB 4XBXA 4K1VA 3F7XA 2HMJB 1UUVB 1OGXA 1NU3A 5IEOA 4FCJA 3JUNA 3KKGA 3FSDA 3T8UA 5BVBA 5IF6A 1OPYA 3EBYA 1OF5A 1OH0A 2F99A 4OUQA 2HMNB 3NV0B 2UX0A 4WP5A 4HKVB 1OHPA 3H3HA 3B4OA 4J8TA 3EX9A 1DMNA 2STDA 1W01A 2HMKB 4HM4B 3K7CA 2PZVA 3DZLA 3G8ZA 3JUMA 1JB5A 3NUVA 3EF8A 1CQSA 1AR0A 3EBTA 4GB5A 4XM4A 1NDOB 1SJWA 2YFLB 3SOAA 2I9WA 2F86B 2BMQB 5CK6A 5DREA 4HM0B 4X2HA 1K41A 7STDA 3MYTA 5AI1A 2YFIB 4HM5B 3OWUA 1EG9B 3NXJA 5TGNA 3F8XA 1O7PB 3G0KA 5KP1A 4STDA 3KZTA 1JN5B 1JB4A 1GS3A 1Z1SA 4L7KA 3CNXA 3B7CA 3H51A 2RCDA 3LYGA 5JPUA 4R1KA 1STDA 3I0YA 2JQ5A 3MG2A 1ASKA 2B24B 3EC9A 3NHXA 4N3VA 1GY7A 5D83A 1QJGA 3FZWA 3WMDA 1QMAA 3NV0A 5IENA 3B8LA 2GEXA 3K0ZA 3SEDA 4HM1B 3CU3A 3FGYA 3HZPA 2CHCA 2INXA 1ZO2A 5CXOA 3FLJA 5JPPA 2W2CA 3MHEA 1O7MB 3DUKA 4MJDA 3DMCA 3LZAA 1C7HA 3E99A 3JUPA 3UNLA 4R9KA 3F40A 2GBXB 4J9AA 1Q40B 4L8PA 2BMOB 2IMJA 1WQLB 5EVHA 3D9RA 3UJMA 1O7NB 3MG3A 2YFJB 4HM7B 5IEPA 4HM3B 4KVHA 3T8NA 1EA2A 2RGQA 2XSHB 3HK4A 1ULIB 3GZXB 1HKXA 5IG0A 3GZRA 4XDWA 5STDA 1Q42A 1JB2A 2OWPA 5AIGA 5D81A 3A76A 4HJLB 2QGUA 3EQQB 4LEHA 4Q53A 4PEJA 1E3RA 2K54A 4WWUC 3RGRA 4FCMA 4XDVA 2GEYA 1OUNA 3EJVA 1TP6A 4HM6B 3IPTA 3F14A 3MG1A 1UUWB 4HM8B 5DRVA 5AEWB 4R9LA 1JN5A 1O7HB 2R4IA 5CLKA 2A15A 3STDA 3KE7A 3FF0A 2Z7AA 2HMOB 2Z77A 3NBRA 3MKIA 4X2OA 1E3VA 2XR8B 3EN1B 4H3UA 4K1UA 4U13A 3CPOA 3B4PA 3FKAA 2F98A 2GXFA 5G2GA 5CF2A 3CNMA 3RGAA 4I4KA 3Q90A 1OHOA 5FW5A 1A2KA 8CHOA 3ER7A 1JKGB 3GZYB 5AEUB 1GYBA 3KSPA 2CKFB 2HMLB 3BB9A 1GY6A 3ROBA 3ECFA 4RZMA 4XB5A 4HM2B 1GY5A 1Q40A 2BNGA 3DM8A
chains in the Genus database with same CATH superfamily
5CF1A 3LTCA 4FCZA 3IMAB 5LC7A 3G713 2LYXA 1R4YA 1W00A 2XRXB 3GWRA 3WOFB 3CC23 5BXQA 3WHOA 1RGFA 2B1XB 2XFTA 1ROAA 4HZ9B 4XBYA 2CIUA 1M1XB 1BIRA 3BLZA 2KRTA 3CC73 1BRSA 2MC8A 4MEIA 2ZHXB 4AKZA 2W56A 5HGRA 1IQYA 1BGSA 3KFQC 1BRNL 2OCTA 1OHSA 3CCV3 3BNBA 1LOXA 1W02A 1BRJA 4RNZA 1JBRA 1IDPA 2KXGA 3X3ZA 4LYLB 1I2EA 1QAFA 1BRGA 4N6NB 1OF5B 3EHCA 3QK9A 2XH9A 3CCU3 1UCJA 1BNRA 4TX4A 3OV4A 1BNFA 7GSPA 1GD4A 2XFSA 3N9HA 3PGBA 1BUJA 1TRPA 3SVAA 4L8OA 1M1K4 2H0IA 5KP3A 1A90A 3NX0A 3CCS3 1Q7Y4 1IVUA 2CFWA 2Z76A 3LXUX 3F9SA 1IU7A 5HOHA 1US1A 2ML5A 1YI23 1Q864 1A67A 1B2ZA 5KP4A 3HX8A 3LOYA 3ZG5A 1YGWA 4NREA 2L4VA 3V99A 1BNIA 3BNDA 4IIAA 3GRDA 4KZ1A 3EN8A 2BMRB 2O9UX 3JUOA 2K0MA 3K5TA 3LT9A 1S5AA 5D82A 1VQM3 3OWSA 4NHFA 3PS8A 3JUQA 1TU5A 1QALA 1RTUA 2BHMA 2D42A 1BSDA 1DYUA 2GU3A 4CDLA 4ORLA 4FMBA 3D3LA 3VSYA 1J2BA 4WYKA 1MGRA 1TUHA 1LNHA 6GSPA 3M8CA 1Y4KA 1DMMA 2XSOB 1B20A 2RNTA 1HYFA 1I8VA 1HZ1A 1ZX2A 3G16A 1MWUA 1W6GA 3UB1A 2W6JH 4CPKA 1DMQA 5LC6A 1BUQA 2BT3A 1ZGXA 3S5CA 3DXOA 4RNTA 1BNEA 2P0MA 3BIRA 2GBWB 3JVCA 1NJI4 3FG4A 1E97A 3FH1A 6STDA 1RGCA 4HVNA 1FGQA 1ROVA 4WYKB 1AY7A 1ULJB 5IG5A 3NM2A 4O02B 2UGIA 2ZL8A 3F7SA 3WDGB 2P05A 3WA2X 3FF2A 4RBNA 4ILFA 2W03A 2IYJA 5AIIA 1YJN3 3OXAA 1B2XA 2Y74A 1BRKA 5ELUA 4XBTA 4LGQA 2KF6A 1FGOA 5IW9A 1OCVA 3PCSA 1OGZA 2O3OA 3Q3FA 4OK0A 1X1WA 2CFKA 1MWTA 2CG0A 5IG4A 5M19A 1VZZA 1JJ22 1O7WB 1NWWA 1Q9EA 2QIYA 3AHWA 1B2UA 1CYVA 1O7GB 2P38A 4R80A 1GMRA 1AV4A 5AIHA 3SOYA 5IG3A 1T2IA 3WOEB 5IERA 3CCR3 1UGIA 1UDII 5A0OB 1FGRA 1JKGA 2CX1A 3PXMA 2GSPA 4MMXB 1KWIA 3IJEB 4FMCA 2V1LA 3OX9A 3DY5A 2IY2A 3MSOA 3CMA3 2Q07A 1RGLA 3D79A 1UGHI 3OWYA 3GZBA 3VGNA 2ZDJA 2OTL3 4LMIA 1LQMB 4OVMA 3CD63 3EE1A 1ISKA 2RFRA 4N6OB 1U5OA 3AGOA 4HZBB 3F8HA 5AIFA 1W6YA 1OACA 4IPBA 2ML6A 1LRAA 2HMMB 1RMSA 2CK3H 5I97A 4XBXA 1N8R4 4K1VA 1JBSA 1GD3A 2CFLA 3F7XA 2HMJB 2JDIH 3CXC2 1UUVB 2WOFA 1OGXA 1YNVX 4EXRA 2QA43 1JNQA 3DH2A 1NU3A 4GSPA 3URPA 1FA3A 5IEOA 1FGTA 3FG3A 1B21A 2C11A 4N6V0 3A5EA 1K28A 4FCJA 3SYUA 4BU4A 3HIGA 3JUNA 3KKGA 3FSDA 3KN4A 1QAKA 3LTBA 3T8UA 5BVBA 4NPBA 1PY3A 5IF6A 2P0XA 3CCL3 1N5HA 1OPYA 3EBYA 5BU4A 1OF5A 1OH0A 2F99A 4OUQA 2KF3A 1TRQA 1B2MA 6RNTA 3ZFZA 1D6ZA 2HMNB 1RDSA 1VQ73 1UCKA 4EC6A 3V92A 1Q7HA 4BTWA 2L1SA 1G0TA 2F5MA 5AYSC 3NV0B 4RNYA 1IK3A 2CW9A 2WGQA 2UX0A 5G1KA 4AEQA 1R4CA 2KAAA 2WOHA 1W6CA 2OQEA 1YGEA 4HKVB 4WP5A 1OHPA 2XGLA 4H61A 3EB8A 4O3VA 2BIRA 2D1WA 3H3HA 4BIRA 3B4OA 3J7Yd 1X1UA 1RGEA 4J8TA 4HBRA 3FCSB 3EX9A 3FG1A 2CH9A 1DMNA 4KFDA 2STDA 3S29A 3ZG0A 1W01A 2HMKB 5RNTA 4HM4B 3K7CA 3V98A 1RCKA 3KCHA 5M1AA 1TFOA 1TFKA 2PZVA 3DZLA 3G8ZA 2F5WA 2SARA 2SBLA 3BNCA 3DGYA 3JUMA 1JB5A 1KSIA 2KF5A 3NUVA 4CJNA 2E2UA 3EF8A 1EUIC 2K3DA 2XEPA 1SPUA 1CQSA 2W0QA 3PYJA 1CH0A 1YIJ3 1AR0A 1W4NA 3DGOA 3EBTA 3CME3 1QVG2 2FNQA 3N54B 1BOXA 4FR9A 3G6E3 4WHAA 1C54A 1DVDA 4GB5A 1I2FA 4O8SA 1VQQA 1BSAA 4XM4A 1NDOB 5EQLA 1SJWA 2YFLB 4FMDA 1LQGC 3SOAA 1N9JA 4JRFA 3PZWA 3X41A 1PFPA 2I9WA 3Q2PA 2F86B 3TDGA 4EV5A 1UCLA 2BMQB 5CK6A 3AMOB 1TJDA 1AVLA 2J8XB 3RNTA 1I0XA 2CWUA 4N6TA 5DREA 4WFOA 4HM0B 2H0GA 2IUKA 4X2HA 4CCVA 3D5GA 3NQYA 4N6UA 1YVSA 1VQO3 1EEJA 1DETA 1JZOA 1K41A 1W5ZA 7STDA 1RJOA 1FUSA 1S723 3MYTA 5AI1A 1LOWA 5JBSA 1LOVA 1I2GA 1BNGA 2YFIB 3CPW2 2H0HA 1LXEA 1MGWA 3LMLA 4HM5B 3OWUA 1EG9B 3AGNA 3ALAA 1GOYA 1HU9A 4KFEA 1WTHA 1NNVA 3NXJA 4QWTA 5TGNA 1FUTA 3F8XA 1O7PB 3O8YA 3G0KA 5KP1A 4STDA 2CC3A 1GMQA 3KZTA 4I5QA 1JN5B 4BTXA 1JB4A 1GS3A 1W7CA 1Z1SA 3SLUA 1Q814 1EQKA 4L7KA 3CNXA 1BVIA 4GHOA 1I0VA 4BL3A 1IV9A 1M904 3B7CA 1BRIA 1K9M4 4ZM8A 3X40A 2CFGA 3H51A 1SQWA 1VQ53 2RCDA 1IVXA 4O2HA 3LYGA 1WMPA 5JPUA 1L5GB 4R1KA 3T0UA 4FMAA 3N8BA 1STDA 1B27A 1IQ8A 1F8NA 3I0YA 2OOVA 1BAOA 4MMZB 2FGTA 2JQ5A 3MG2A 2GU1A 1ASKA 1GSPA 3PCRA 1V74A 2ZA4A 3X42A 2B24B 1N9EA 2F4YA 3EC9A 3NHXA 4DKIA 1GMPA 5ELJA 1LOYA 1MWRA 4N3VA 1GY7A 5D83A 1IVWA 1JZDA 1QJGA 3FZWA 3WMDA 1QMAA 3NV0A 4EV2A 1BSCA 1FGMA 2FXTA 1B3SA 1WNHA 5IENA 1RGKA 1RGHA 3B8LA 2CG1A 2GEXA 3K0ZA 4J5GA 1YJ93 3SEDA 4LSOA 4HM1B 3CU3A 1MOLA 3FGYA 3HZPA 3CCM3 2CHCA 2INXA 1YVBI 1ZO2A 1VQP3 3WA3A 5CXOA 1N8QA 2WGOA 3DGLA 3FLJA 2PNCA 3WR2A 5JPPA 3I563 2W2CA 4R4KA 4AKYA 3MHEA 1O7MB 2CWTA 2P09A 1D6UA 3DUKA 4MJDA 3DMCA 1T3BA 4BL2A 1RCLA 3K63A 2W04A 1WMOA 3HI7A 3CCQ3 4GL6A 1UI8A 4EBGA 2W9PA 3SXXA 3NBBA 1RGGA 3S67A 3LZAA 2IA7A 1C7HA 4HAAA 3E99A 5G1LA 1BNJA 1IQXA 3JUPA 3UNLA 4R9KA 3D5IA 3F40A 3VF1A 3WODG 2GBXB 2QEX3 4J9AA 1BU4A 1Q40B 4L8PA 2BMOB 2IMJA 1WQLB 5EVHA 1TTOA 2Y73A 3KIIA 4HYZA 1WMNA 2CWVA 3D9RA 7RNTA 1M9GA 3GAXA 5M18A 3UJMA 1UCIA 1G02A 1O7NB 1SIIA 1MWSA 2BO9B 3MG3A 1CYUA 3DGMA 1DE3A 2YFJB 2M7OA 4HM7B 2Z6BA 5IEPA 4HM3B 2W56B 1KD14 4KVHA 3T8NA 1EA2A 2RGQA 2XSHB 3U1WA 1VQ83 1FZUA 1RN4A 1ULIB 3AMOA 3GZXB 3HK4A 1HKXA 3Q1CA 2OQEC 3GZRA 4XDWA 1B2SA 5IG0A 5STDA 1LNIA 1Q42A 2C4BA 1CEWI 2IUJA 1JB2A 2OWPA 5AIGA 1PU4A 2E2TA 2UUGC 3A76A 5D81A 1X1YA 1Q824 1RLSA 3LT8A 3CCJ3 1X1XA 4HJLB 3GSPA 2QGUA 1BNSA 3K9MC 3U97A 3EQQB 2F56A 1A2PA 2RBIA 5BIRA 4LZIA 4LEHA 4Q53A 3NM7A 1I3IA 1JV2B 4KT3B 3NBJA 4PEJA 3CCE3 3SX1A 1E3RA 2K54A 1UI7A 1GOVA 4WWUC 3UL5A 3RGRA 3S28A 2LQVA 1IVVA 4FCMA 4XDVA 3CC43 2GEYA 4G1MB 1OUNA 4MMYB 3X3YA 1FW7A 3EJVA 1TP6A 1JRQA 1NB5I 1G96A 4HM6B 1RHLA 2MF7A 3G4S3 2XGNA 3IPTA 1KC84 1W2B2 3F14A 3MG1A 1UUWB 4HM8B 4EW5A 5DRVA 3LTAA 5AEWB 1RRHA 4R9LA 1VQL3 1AVKA 1JN5A 1BSEA 1O7HB 1VQN3 1D6YA 2AAEA 1IYYA 2YX9A 3LTDA 2OTJ3 2R4IA 1ZS7A 5CLKA 3BNEA 2A15A 1BANA 1T2HA 2E2VA 4KFFA 3STDA 3KE7A 1BRHA 3AHSA 2W9QA 3RDEA 3L0RA 3FF0A 2BU4A 4JF8A 3MWZA 1N5PA 2Z7AA 1IT8A 2HMOB 4N6MA 4HOHA 2Z77A 3NBRA 3MKIA 1VQ43 3QRDA 1E3VA 2XR8B 4X2OA 2RSXA 1RN7A 3EN1B 4J5KA 1YHQ3 3LH4A 2AADA 4H3UA 1RRLA 9RNTA 5EEOA 3S27A 4K1UA 4U13A 3CPOA 8RNTA 1A2VA 3B4PA 3FKAA 2F98A 2GXFA 5G2GA 1YJW3 5CF2A 3CNMA 1NO3A 1IV7A 1YIT3 2XF3A 3RGAA 4I4KA 1AQZA 2WO0A 3Q90A 1BSBA 1OHOA 2C10A 5FW5A 4BTYA 1VQ63 1NB3I 3MPHA 1A2KA 8CHOA 3HIIA 1MNLA 1UW1A 3ER7A 1JBTA 1TIJA 3X3XA 1FUWA 1SARA 1JKGB 1RGAA 1VQK3 4N6LA 3KSED 1T5YA 1STFI 2HOHA 3GZYB 5AEUB 1I3FA 1V58A 1GYBA 4IT7A 1K8A4 3D4AA 1FYSA 2KCDA 1GOUA 5AYRB 2CX0A 3I553 1U8CB 5GSPA 1UUGB 1EKMA 1V57A 3KSPA 1PYLA 4K61A 4EYCA 1KQS2 1LVNA 2CKFB 4K90B 1VQ93 2HMLB 1RKYA 1RSNA 3BB9A 1SIHA 1RNBA 2R41A 1IT7A 1GY6A 1DVCA 1I70A 3ROBA 1K734 3DGNA 1RNTA 3NQZA 3ECFA 3HOHA 3UL6A 4RZMA 1QVF2 4XB5A 1RN1A 1W2ZA 1GY5A 4HM2B 2KF4A 5FGOA 3OW22 1Q40A 2BNGA 3BU4A 2OOVC 2CFDA 3DM8A
chains in the Genus database with same CATH topology
5CF1A 3LTCA 4FCZA 3IMAB 5LC7A 3G713 2LYXA 1W00A 2XRXB 3GWRA 3WOFB 3CC23 5BXQA 2B1XB 2XFTA 1ROAA 4HZ9B 4XBYA 2CIUA 1M1XB 3BLZA 2KRTA 3CC73 2MC8A 4MEIA 4AKZA 2W56A 5HGRA 1IQYA 3KFQC 2OCTA 1OHSA 3CCV3 3BNBA 1LOXA 1W02A 4RNZA 1IDPA 2KXGA 3X3ZA 1QAFA 4N6NB 1OF5B 3EHCA 3QK9A 2XH9A 3CCU3 4TX4A 3OV4A 1GD4A 2XFSA 3N9HA 3PGBA 3SVAA 4L8OA 1M1K4 5KP3A 1A90A 3NX0A 3CCS3 1Q7Y4 1IVUA 2CFWA 2Z76A 3LXUX 3F9SA 1IU7A 1US1A 2ML5A 1YI23 1Q864 1A67A 5KP4A 3HX8A 3LOYA 3V99A 4NREA 2L4VA 3BNDA 4IIAA 3GRDA 4KZ1A 3EN8A 2BMRB 2O9UX 3JUOA 2K0MA 3K5TA 3LT9A 1S5AA 5D82A 1VQM3 3OWSA 4NHFA 3PS8A 3JUQA 1TU5A 1QALA 2BHMA 2D42A 1DYUA 2GU3A 4CDLA 4ORLA 4FMBA 3D3LA 3VSYA 1J2BA 4WYKA 1TUHA 1LNHA 3M8CA 1Y4KA 1DMMA 2XSOB 1ZX2A 3G16A 1W6GA 3UB1A 2W6JH 1DMQA 5LC6A 1BUQA 2BT3A 3S5CA 3DXOA 2P0MA 3JVCA 2GBWB 1NJI4 3FG4A 1E97A 3FH1A 6STDA 4HVNA 1FGQA 1ROVA 4WYKB 5IG5A 1ULJB 3NM2A 4O02B 2ZL8A 3F7SA 3WDGB 2P05A 3WA2X 3FF2A 4RBNA 2W03A 5AIIA 1YJN3 3OXAA 2Y74A 5ELUA 4XBTA 4LGQA 1FGOA 5IW9A 1OCVA 3PCSA 1OGZA 2O3OA 4OK0A 2CFKA 2CG0A 5IG4A 1VZZA 1JJ22 1O7WB 1NWWA 2QIYA 4R80A 1CYVA 2P38A 1O7GB 3SOYA 5IG3A 1AV4A 5AIHA 3WOEB 5IERA 3CCR3 5A0OB 1FGRA 1JKGA 3PXMA 4MMXB 1KWIA 3IJEB 4FMCA 2V1LA 3OX9A 3DY5A 3MSOA 3CMA3 2Q07A 3OWYA 3GZBA 3VGNA 2ZDJA 2OTL3 4LMIA 4OVMA 3CD63 3EE1A 1ISKA 2RFRA 4N6OB 1U5OA 4HZBB 3F8HA 5AIFA 1W6YA 1OACA 4IPBA 2ML6A 2HMMB 2CK3H 5I97A 4XBXA 1N8R4 4K1VA 1GD3A 2CFLA 3F7XA 2HMJB 2JDIH 3CXC2 1UUVB 2WOFA 1OGXA 4EXRA 2QA43 1JNQA 1NU3A 1FA3A 5IEOA 1FGTA 3FG3A 2C11A 4N6V0 1K28A 4FCJA 3HIGA 3JUNA 3KKGA 3FSDA 3KN4A 1QAKA 3LTBA 3T8UA 5BVBA 5IF6A 2P0XA 3CCL3 1N5HA 1OPYA 3EBYA 1OF5A 1OH0A 2F99A 4OUQA 1D6ZA 2HMNB 1VQ73 4EC6A 3V92A 4BTWA 5AYSC 3NV0B 4RNYA 1IK3A 2CW9A 2WGQA 2UX0A 4AEQA 1R4CA 2OQEA 2WOHA 1W6CA 1YGEA 4HKVB 4WP5A 1OHPA 2XGLA 4H61A 3EB8A 4O3VA 2D1WA 3H3HA 3B4OA 3J7Yd 4J8TA 4HBRA 3FCSB 3EX9A 3FG1A 2CH9A 1DMNA 4KFDA 2STDA 3S29A 1W01A 2HMKB 4HM4B 3K7CA 3V98A 1TFOA 1TFKA 2PZVA 3DZLA 3G8ZA 3BNCA 2SBLA 3JUMA 1JB5A 1KSIA 3NUVA 2E2UA 3EF8A 2XEPA 1SPUA 1CQSA 2W0QA 3PYJA 1YIJ3 1AR0A 1W4NA 3DGOA 3EBTA 3CME3 1QVG2 2FNQA 3N54B 4FR9A 3G6E3 4WHAA 1DVDA 4GB5A 4O8SA 4XM4A 1NDOB 5EQLA 1SJWA 2YFLB 4FMDA 3SOAA 1N9JA 4JRFA 3PZWA 3X41A 1PFPA 2I9WA 3Q2PA 2F86B 3TDGA 4EV5A 2BMQB 5CK6A 3AMOB 1AVLA 2CWUA 4N6TA 5DREA 4WFOA 4HM0B 2IUKA 4X2HA 4CCVA 3NQYA 4N6UA 1VQO3 1K41A 1W5ZA 7STDA 1RJOA 1S723 3MYTA 5AI1A 5JBSA 2YFIB 3CPW2 1LXEA 3LMLA 4HM5B 3OWUA 1EG9B 3ALAA 1HU9A 4KFEA 1WTHA 3NXJA 4QWTA 5TGNA 3F8XA 1O7PB 3O8YA 3G0KA 5KP1A 4STDA 2CC3A 3KZTA 1JN5B 4BTXA 1JB4A 1GS3A 1W7CA 1Z1SA 3SLUA 1Q814 1EQKA 4L7KA 3CNXA 1IV9A 1M904 3B7CA 1K9M4 4ZM8A 3X40A 2CFGA 3H51A 1SQWA 1VQ53 2RCDA 1IVXA 4O2HA 3LYGA 1WMPA 5JPUA 1L5GB 4R1KA 3T0UA 4FMAA 3N8BA 1STDA 1IQ8A 1F8NA 3I0YA 2OOVA 4MMZB 2FGTA 2JQ5A 3MG2A 2GU1A 1ASKA 3PCRA 1V74A 3X42A 2B24B 1N9EA 3EC9A 3NHXA 5ELJA 4N3VA 1GY7A 5D83A 1IVWA 1QJGA 3FZWA 3WMDA 1QMAA 3NV0A 4EV2A 1FGMA 2FXTA 1WNHA 5IENA 3B8LA 2CG1A 2GEXA 3K0ZA 1YJ93 3SEDA 4LSOA 4HM1B 3CU3A 1MOLA 3FGYA 3HZPA 3CCM3 2CHCA 2INXA 1YVBI 1ZO2A 1VQP3 3WA3A 5CXOA 1N8QA 2WGOA 3DGLA 3FLJA 2PNCA 5JPPA 3I563 2W2CA 4R4KA 4AKYA 3MHEA 1O7MB 2CWTA 2P09A 1D6UA 3DUKA 4MJDA 3DMCA 3K63A 3CCQ3 2W04A 1WMOA 3HI7A 4GL6A 1UI8A 4EBGA 2W9PA 3SXXA 3NBBA 3S67A 3LZAA 2IA7A 1C7HA 3E99A 3JUPA 1IQXA 3UNLA 4R9KA 3F40A 3WODG 3VF1A 2GBXB 2QEX3 4J9AA 1Q40B 4L8PA 2BMOB 2IMJA 1WQLB 5EVHA 2Y73A 3KIIA 4HYZA 1WMNA 2CWVA 3D9RA 1M9GA 3GAXA 3UJMA 1O7NB 1SIIA 2BO9B 3MG3A 1CYUA 3DGMA 2YFJB 2M7OA 4HM7B 2Z6BA 5IEPA 4HM3B 2W56B 1KD14 4KVHA 3T8NA 1EA2A 2RGQA 2XSHB 3U1WA 1VQ83 3HK4A 1ULIB 3AMOA 3GZXB 1HKXA 3Q1CA 2OQEC 3GZRA 4XDWA 5IG0A 5STDA 1Q42A 1CEWI 2IUJA 1JB2A 2OWPA 5AIGA 1PU4A 2E2TA 5D81A 3A76A 1Q824 3LT8A 3CCJ3 4HJLB 2QGUA 3U97A 3K9MC 3EQQB 4LZIA 4LEHA 4Q53A 3NM7A 1JV2B 4PEJA 3NBJA 3CCE3 3SX1A 1E3RA 2K54A 1UI7A 4WWUC 3UL5A 3RGRA 3S28A 2LQVA 1IVVA 4FCMA 4XDVA 3CC43 2GEYA 4G1MB 1OUNA 4MMYB 3X3YA 3EJVA 1TP6A 1JRQA 1NB5I 1G96A 4HM6B 2MF7A 3G4S3 2XGNA 3IPTA 1KC84 1W2B2 3F14A 3MG1A 1UUWB 4HM8B 5DRVA 3LTAA 5AEWB 1RRHA 4R9LA 1VQL3 1AVKA 1JN5A 1O7HB 1VQN3 1D6YA 2YX9A 3LTDA 2OTJ3 2R4IA 5CLKA 3BNEA 2A15A 4KFFA 2E2VA 3STDA 3KE7A 2W9QA 3RDEA 3L0RA 3FF0A 4JF8A 3MWZA 2Z7AA 1N5PA 1IT8A 2HMOB 4N6MA 2Z77A 3NBRA 3MKIA 1VQ43 3QRDA 1E3VA 2XR8B 4X2OA 2RSXA 1RN7A 3EN1B 1YHQ3 3LH4A 4H3UA 1RRLA 5EEOA 3S27A 4K1UA 4U13A 3CPOA 1A2VA 3B4PA 3FKAA 2F98A 2GXFA 5G2GA 1YJW3 5CF2A 3CNMA 1NO3A 1IV7A 1YIT3 2XF3A 3RGAA 4I4KA 2WO0A 3Q90A 1OHOA 2C10A 5FW5A 4BTYA 1VQ63 1NB3I 3MPHA 1A2KA 8CHOA 3HIIA 1MNLA 1UW1A 3ER7A 1TIJA 3X3XA 1FUWA 1JKGB 1VQK3 4N6LA 3KSED 1T5YA 1STFI 3GZYB 5AEUB 1GYBA 4IT7A 1K8A4 2KCDA 5AYRB 3I553 1U8CB 1EKMA 3KSPA 4K61A 4EYCA 1KQS2 1LVNA 2CKFB 4K90B 1VQ93 2HMLB 1RKYA 3BB9A 1SIHA 1IT7A 1GY6A 1DVCA 1K734 3ROBA 3DGNA 1QVF2 3NQZA 3ECFA 3UL6A 4RZMA 4XB5A 3OW22 1W2ZA 1GY5A 4HM2B 5FGOA 1Q40A 2BNGA 2OOVC 2CFDA 3DM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CF1 A;  1W00 A;  2XRX B;  3GWR A;  5BXQ A;  2B1X B;  4HZ9 B;  4XBY A;  3BLZ A;  5HGR A;  1OHS A;  1W02 A;  1IDP A;  1OF5 B;  3EHC A;  3OV4 A;  4L8O A;  5KP3 A;  2Z76 A;  3F9S A;  5KP4 A;  3HX8 A;  4IIA A;  3GRD A;  3EN8 A;  2BMR B;  5D82 A;  3JUO A;  1S5A A;  3OWS A;  3JUQ A;  4CDL A;  4ORL A;  3VSY A;  4WYK A;  1TUH A;  3M8C A;  1DMM A;  2XSO B;  1ZX2 A;  3G16 A;  1DMQ A;  1BUQ A;  3S5C A;  3DXO A;  2GBW B;  1E97 A;  3FH1 A;  6STD A;  4WYK B;  4HVN A;  5IG5 A;  1ULJ B;  3NM2 A;  3F7S A;  3FF2 A;  5AII A;  3OXA A;  4XBT A;  4LGQ A;  1OCV A;  1OGZ A;  5IG4 A;  1VZZ A;  1O7W B;  1NWW A;  2QIY A;  3SOY A;  1O7G B;  5IG3 A;  5AIH A;  5IER A;  1JKG A;  3OX9 A;  3MSO A;  3OWY A;  3GZB A;  3VGN A;  4LMI A;  4OVM A;  1ISK A;  2RFR A;  1U5O A;  4HZB B;  3F8H A;  5AIF A;  1W6Y A;  2HMM B;  4XBX A;  4K1V A;  3F7X A;  2HMJ B;  1UUV B;  1OGX A;  1NU3 A;  5IEO A;  4FCJ A;  3JUN A;  3KKG A;  3FSD A;  3T8U A;  5BVB A;  5IF6 A;  1OPY A;  3EBY A;  1OF5 A;  1OH0 A;  2F99 A;  4OUQ A;  2HMN B;  3NV0 B;  2UX0 A;  4WP5 A;  4HKV B;  1OHP A;  3H3H A;  3B4O A;  4J8T A;  3EX9 A;  1DMN A;  2STD A;  1W01 A;  2HMK B;  4HM4 B;  3K7C A;  2PZV A;  3DZL A;  3G8Z A;  3JUM A;  1JB5 A;  3NUV A;  3EF8 A;  1CQS A;  1AR0 A;  3EBT A;  4GB5 A;  4XM4 A;  1NDO B;  1SJW A;  2YFL B;  3SOA A;  2I9W A;  2F86 B;  2BMQ B;  5CK6 A;  5DRE A;  4HM0 B;  4X2H A;  1K41 A;  7STD A;  3MYT A;  5AI1 A;  2YFI B;  4HM5 B;  3OWU A;  1EG9 B;  3NXJ A;  5TGN A;  3F8X A;  1O7P B;  3G0K A;  5KP1 A;  4STD A;  3KZT A;  1JN5 B;  1JB4 A;  1GS3 A;  1Z1S A;  4L7K A;  3CNX A;  3B7C A;  3H51 A;  2RCD A;  3LYG A;  5JPU A;  4R1K A;  1STD A;  3I0Y A;  2JQ5 A;  3MG2 A;  1ASK A;  2B24 B;  3EC9 A;  3NHX A;  4N3V A;  1GY7 A;  5D83 A;  1QJG A;  3FZW A;  3WMD A;  1QMA A;  3NV0 A;  5IEN A;  3B8L A;  2GEX A;  3K0Z A;  3SED A;  4HM1 B;  3CU3 A;  3FGY A;  3HZP A;  2CHC A;  2INX A;  1ZO2 A;  5CXO A;  3FLJ A;  5JPP A;  2W2C A;  3MHE A;  1O7M B;  3DUK A;  4MJD A;  3DMC A;  3LZA A;  1C7H A;  3E99 A;  3JUP A;  3UNL A;  4R9K A;  3F40 A;  2GBX B;  4J9A A;  1Q40 B;  4L8P A;  2BMO B;  2IMJ A;  1WQL B;  5EVH A;  3D9R A;  3UJM A;  1O7N B;  3MG3 A;  2YFJ B;  4HM7 B;  5IEP A;  4HM3 B;  4KVH A;  3T8N A;  1EA2 A;  2RGQ A;  2XSH B;  3HK4 A;  1ULI B;  3GZX B;  1HKX A;  5IG0 A;  3GZR A;  4XDW A;  5STD A;  1Q42 A;  1JB2 A;  2OWP A;  5AIG A;  5D81 A;  3A76 A;  4HJL B;  2QGU A;  3EQQ B;  4LEH A;  4Q53 A;  4PEJ A;  1E3R A;  2K54 A;  4WWU C;  3RGR A;  4FCM A;  4XDV A;  2GEY A;  1OUN A;  3EJV A;  1TP6 A;  4HM6 B;  3IPT A;  3F14 A;  3MG1 A;  1UUW B;  4HM8 B;  5DRV A;  5AEW B;  4R9L A;  1JN5 A;  1O7H B;  2R4I A;  5CLK A;  2A15 A;  3STD A;  3KE7 A;  3FF0 A;  2Z7A A;  2HMO B;  2Z77 A;  3NBR A;  3MKI A;  4X2O A;  1E3V A;  2XR8 B;  3EN1 B;  4H3U A;  4K1U A;  4U13 A;  3CPO A;  3B4P A;  3FKA A;  2F98 A;  2GXF A;  5G2G A;  5CF2 A;  3CNM A;  3RGA A;  4I4K A;  3Q90 A;  1OHO A;  5FW5 A;  1A2K A;  8CHO A;  3ER7 A;  1JKG B;  3GZY B;  5AEU B;  1GYB A;  3KSP A;  2CKF B;  2HML B;  3BB9 A;  1GY6 A;  3ROB A;  3ECF A;  4RZM A;  4XB5 A;  4HM2 B;  1GY5 A;  1Q40 A;  2BNG A;  3DM8 A; 
#chains in the Genus database with same CATH topology
 5CF1 A;  3LTC A;  4FCZ A;  3IMA B;  5LC7 A;  3G71 3;  2LYX A;  1R4Y A;  1W00 A;  2XRX B;  3GWR A;  3WOF B;  3CC2 3;  5BXQ A;  3WHO A;  1RGF A;  2B1X B;  2XFT A;  1ROA A;  4HZ9 B;  4XBY A;  2CIU A;  1M1X B;  1BIR A;  3BLZ A;  2KRT A;  3CC7 3;  1BRS A;  2MC8 A;  4MEI A;  2ZHX B;  4AKZ A;  2W56 A;  5HGR A;  1IQY A;  1BGS A;  3KFQ C;  1BRN L;  2OCT A;  1OHS A;  3CCV 3;  3BNB A;  1LOX A;  1W02 A;  1BRJ A;  4RNZ A;  1JBR A;  1IDP A;  2KXG A;  3X3Z A;  4LYL B;  1I2E A;  1QAF A;  1BRG A;  4N6N B;  1OF5 B;  3EHC A;  3QK9 A;  2XH9 A;  3CCU 3;  1UCJ A;  1BNR A;  4TX4 A;  3OV4 A;  1BNF A;  7GSP A;  1GD4 A;  2XFS A;  3N9H A;  3PGB A;  1BUJ A;  1TRP A;  3SVA A;  4L8O A;  1M1K 4;  2H0I A;  5KP3 A;  1A90 A;  3NX0 A;  3CCS 3;  1Q7Y 4;  1IVU A;  2CFW A;  2Z76 A;  3LXU X;  3F9S A;  1IU7 A;  5HOH A;  1US1 A;  2ML5 A;  1YI2 3;  1Q86 4;  1A67 A;  1B2Z A;  5KP4 A;  3HX8 A;  3LOY A;  3ZG5 A;  1YGW A;  4NRE A;  2L4V A;  3V99 A;  1BNI A;  3BND A;  4IIA A;  3GRD A;  4KZ1 A;  3EN8 A;  2BMR B;  2O9U X;  3JUO A;  2K0M A;  3K5T A;  3LT9 A;  1S5A A;  5D82 A;  1VQM 3;  3OWS A;  4NHF A;  3PS8 A;  3JUQ A;  1TU5 A;  1QAL A;  1RTU A;  2BHM A;  2D42 A;  1BSD A;  1DYU A;  2GU3 A;  4CDL A;  4ORL A;  4FMB A;  3D3L A;  3VSY A;  1J2B A;  4WYK A;  1MGR A;  1TUH A;  1LNH A;  6GSP A;  3M8C A;  1Y4K A;  1DMM A;  2XSO B;  1B20 A;  2RNT A;  1HYF A;  1I8V A;  1HZ1 A;  1ZX2 A;  3G16 A;  1MWU A;  1W6G A;  3UB1 A;  2W6J H;  4CPK A;  1DMQ A;  5LC6 A;  1BUQ A;  2BT3 A;  1ZGX A;  3S5C A;  3DXO A;  4RNT A;  1BNE A;  2P0M A;  3BIR A;  2GBW B;  3JVC A;  1NJI 4;  3FG4 A;  1E97 A;  3FH1 A;  6STD A;  1RGC A;  4HVN A;  1FGQ A;  1ROV A;  4WYK B;  1AY7 A;  1ULJ B;  5IG5 A;  3NM2 A;  4O02 B;  2UGI A;  2ZL8 A;  3F7S A;  3WDG B;  2P05 A;  3WA2 X;  3FF2 A;  4RBN A;  4ILF A;  2W03 A;  2IYJ A;  5AII A;  1YJN 3;  3OXA A;  1B2X A;  2Y74 A;  1BRK A;  5ELU A;  4XBT A;  4LGQ A;  2KF6 A;  1FGO A;  5IW9 A;  1OCV A;  3PCS A;  1OGZ A;  2O3O A;  3Q3F A;  4OK0 A;  1X1W A;  2CFK A;  1MWT A;  2CG0 A;  5IG4 A;  5M19 A;  1VZZ A;  1JJ2 2;  1O7W B;  1NWW A;  1Q9E A;  2QIY A;  3AHW A;  1B2U A;  1CYV A;  1O7G B;  2P38 A;  4R80 A;  1GMR A;  1AV4 A;  5AIH A;  3SOY A;  5IG3 A;  1T2I A;  3WOE B;  5IER A;  3CCR 3;  1UGI A;  1UDI I;  5A0O B;  1FGR A;  1JKG A;  2CX1 A;  3PXM A;  2GSP A;  4MMX B;  1KWI A;  3IJE B;  4FMC A;  2V1L A;  3OX9 A;  3DY5 A;  2IY2 A;  3MSO A;  3CMA 3;  2Q07 A;  1RGL A;  3D79 A;  1UGH I;  3OWY A;  3GZB A;  3VGN A;  2ZDJ A;  2OTL 3;  4LMI A;  1LQM B;  4OVM A;  3CD6 3;  3EE1 A;  1ISK A;  2RFR A;  4N6O B;  1U5O A;  3AGO A;  4HZB B;  3F8H A;  5AIF A;  1W6Y A;  1OAC A;  4IPB A;  2ML6 A;  1LRA A;  2HMM B;  1RMS A;  2CK3 H;  5I97 A;  4XBX A;  1N8R 4;  4K1V A;  1JBS A;  1GD3 A;  2CFL A;  3F7X A;  2HMJ B;  2JDI H;  3CXC 2;  1UUV B;  2WOF A;  1OGX A;  1YNV X;  4EXR A;  2QA4 3;  1JNQ A;  3DH2 A;  1NU3 A;  4GSP A;  3URP A;  1FA3 A;  5IEO A;  1FGT A;  3FG3 A;  1B21 A;  2C11 A;  4N6V 0;  3A5E A;  1K28 A;  4FCJ A;  3SYU A;  4BU4 A;  3HIG A;  3JUN A;  3KKG A;  3FSD A;  3KN4 A;  1QAK A;  3LTB A;  3T8U A;  5BVB A;  4NPB A;  1PY3 A;  5IF6 A;  2P0X A;  3CCL 3;  1N5H A;  1OPY A;  3EBY A;  5BU4 A;  1OF5 A;  1OH0 A;  2F99 A;  4OUQ A;  2KF3 A;  1TRQ A;  1B2M A;  6RNT A;  3ZFZ A;  1D6Z A;  2HMN B;  1RDS A;  1VQ7 3;  1UCK A;  4EC6 A;  3V92 A;  1Q7H A;  4BTW A;  2L1S A;  1G0T A;  2F5M A;  5AYS C;  3NV0 B;  4RNY A;  1IK3 A;  2CW9 A;  2WGQ A;  2UX0 A;  5G1K A;  4AEQ A;  1R4C A;  2KAA A;  2WOH A;  1W6C A;  2OQE A;  1YGE A;  4HKV B;  4WP5 A;  1OHP A;  2XGL A;  4H61 A;  3EB8 A;  4O3V A;  2BIR A;  2D1W A;  3H3H A;  4BIR A;  3B4O A;  3J7Y d;  1X1U A;  1RGE A;  4J8T A;  4HBR A;  3FCS B;  3EX9 A;  3FG1 A;  2CH9 A;  1DMN A;  4KFD A;  2STD A;  3S29 A;  3ZG0 A;  1W01 A;  2HMK B;  5RNT A;  4HM4 B;  3K7C A;  3V98 A;  1RCK A;  3KCH A;  5M1A A;  1TFO A;  1TFK A;  2PZV A;  3DZL A;  3G8Z A;  2F5W A;  2SAR A;  2SBL A;  3BNC A;  3DGY A;  3JUM A;  1JB5 A;  1KSI A;  2KF5 A;  3NUV A;  4CJN A;  2E2U A;  3EF8 A;  1EUI C;  2K3D A;  2XEP A;  1SPU A;  1CQS A;  2W0Q A;  3PYJ A;  1CH0 A;  1YIJ 3;  1AR0 A;  1W4N A;  3DGO A;  3EBT A;  3CME 3;  1QVG 2;  2FNQ A;  3N54 B;  1BOX A;  4FR9 A;  3G6E 3;  4WHA A;  1C54 A;  1DVD A;  4GB5 A;  1I2F A;  4O8S A;  1VQQ A;  1BSA A;  4XM4 A;  1NDO B;  5EQL A;  1SJW A;  2YFL B;  4FMD A;  1LQG C;  3SOA A;  1N9J A;  4JRF A;  3PZW A;  3X41 A;  1PFP A;  2I9W A;  3Q2P A;  2F86 B;  3TDG A;  4EV5 A;  1UCL A;  2BMQ B;  5CK6 A;  3AMO B;  1TJD A;  1AVL A;  2J8X B;  3RNT A;  1I0X A;  2CWU A;  4N6T A;  5DRE A;  4WFO A;  4HM0 B;  2H0G A;  2IUK A;  4X2H A;  4CCV A;  3D5G A;  3NQY A;  4N6U A;  1YVS A;  1VQO 3;  1EEJ A;  1DET A;  1JZO A;  1K41 A;  1W5Z A;  7STD A;  1RJO A;  1FUS A;  1S72 3;  3MYT A;  5AI1 A;  1LOW A;  5JBS A;  1LOV A;  1I2G A;  1BNG A;  2YFI B;  3CPW 2;  2H0H A;  1LXE A;  1MGW A;  3LML A;  4HM5 B;  3OWU A;  1EG9 B;  3AGN A;  3ALA A;  1GOY A;  1HU9 A;  4KFE A;  1WTH A;  1NNV A;  3NXJ A;  4QWT A;  5TGN A;  1FUT A;  3F8X A;  1O7P B;  3O8Y A;  3G0K A;  5KP1 A;  4STD A;  2CC3 A;  1GMQ A;  3KZT A;  4I5Q A;  1JN5 B;  4BTX A;  1JB4 A;  1GS3 A;  1W7C A;  1Z1S A;  3SLU A;  1Q81 4;  1EQK A;  4L7K A;  3CNX A;  1BVI A;  4GHO A;  1I0V A;  4BL3 A;  1IV9 A;  1M90 4;  3B7C A;  1BRI A;  1K9M 4;  4ZM8 A;  3X40 A;  2CFG A;  3H51 A;  1SQW A;  1VQ5 3;  2RCD A;  1IVX A;  4O2H A;  3LYG A;  1WMP A;  5JPU A;  1L5G B;  4R1K A;  3T0U A;  4FMA A;  3N8B A;  1STD A;  1B27 A;  1IQ8 A;  1F8N A;  3I0Y A;  2OOV A;  1BAO A;  4MMZ B;  2FGT A;  2JQ5 A;  3MG2 A;  2GU1 A;  1ASK A;  1GSP A;  3PCR A;  1V74 A;  2ZA4 A;  3X42 A;  2B24 B;  1N9E A;  2F4Y A;  3EC9 A;  3NHX A;  4DKI A;  1GMP A;  5ELJ A;  1LOY A;  1MWR A;  4N3V A;  1GY7 A;  5D83 A;  1IVW A;  1JZD A;  1QJG A;  3FZW A;  3WMD A;  1QMA A;  3NV0 A;  4EV2 A;  1BSC A;  1FGM A;  2FXT A;  1B3S A;  1WNH A;  5IEN A;  1RGK A;  1RGH A;  3B8L A;  2CG1 A;  2GEX A;  3K0Z A;  4J5G A;  1YJ9 3;  3SED A;  4LSO A;  4HM1 B;  3CU3 A;  1MOL A;  3FGY A;  3HZP A;  3CCM 3;  2CHC A;  2INX A;  1YVB I;  1ZO2 A;  1VQP 3;  3WA3 A;  5CXO A;  1N8Q A;  2WGO A;  3DGL A;  3FLJ A;  2PNC A;  3WR2 A;  5JPP A;  3I56 3;  2W2C A;  4R4K A;  4AKY A;  3MHE A;  1O7M B;  2CWT A;  2P09 A;  1D6U A;  3DUK A;  4MJD A;  3DMC A;  1T3B A;  4BL2 A;  1RCL A;  3K63 A;  2W04 A;  1WMO A;  3HI7 A;  3CCQ 3;  4GL6 A;  1UI8 A;  4EBG A;  2W9P A;  3SXX A;  3NBB A;  1RGG A;  3S67 A;  3LZA A;  2IA7 A;  1C7H A;  4HAA A;  3E99 A;  5G1L A;  1BNJ A;  1IQX A;  3JUP A;  3UNL A;  4R9K A;  3D5I A;  3F40 A;  3VF1 A;  3WOD G;  2GBX B;  2QEX 3;  4J9A A;  1BU4 A;  1Q40 B;  4L8P A;  2BMO B;  2IMJ A;  1WQL B;  5EVH A;  1TTO A;  2Y73 A;  3KII A;  4HYZ A;  1WMN A;  2CWV A;  3D9R A;  7RNT A;  1M9G A;  3GAX A;  5M18 A;  3UJM A;  1UCI A;  1G02 A;  1O7N B;  1SII A;  1MWS A;  2BO9 B;  3MG3 A;  1CYU A;  3DGM A;  1DE3 A;  2YFJ B;  2M7O A;  4HM7 B;  2Z6B A;  5IEP A;  4HM3 B;  2W56 B;  1KD1 4;  4KVH A;  3T8N A;  1EA2 A;  2RGQ A;  2XSH B;  3U1W A;  1VQ8 3;  1FZU A;  1RN4 A;  1ULI B;  3AMO A;  3GZX B;  3HK4 A;  1HKX A;  3Q1C A;  2OQE C;  3GZR A;  4XDW A;  1B2S A;  5IG0 A;  5STD A;  1LNI A;  1Q42 A;  2C4B A;  1CEW I;  2IUJ A;  1JB2 A;  2OWP A;  5AIG A;  1PU4 A;  2E2T A;  2UUG C;  3A76 A;  5D81 A;  1X1Y A;  1Q82 4;  1RLS A;  3LT8 A;  3CCJ 3;  1X1X A;  4HJL B;  3GSP A;  2QGU A;  1BNS A;  3K9M C;  3U97 A;  3EQQ B;  2F56 A;  1A2P A;  2RBI A;  5BIR A;  4LZI A;  4LEH A;  4Q53 A;  3NM7 A;  1I3I A;  1JV2 B;  4KT3 B;  3NBJ A;  4PEJ A;  3CCE 3;  3SX1 A;  1E3R A;  2K54 A;  1UI7 A;  1GOV A;  4WWU C;  3UL5 A;  3RGR A;  3S28 A;  2LQV A;  1IVV A;  4FCM A;  4XDV A;  3CC4 3;  2GEY A;  4G1M B;  1OUN A;  4MMY B;  3X3Y A;  1FW7 A;  3EJV A;  1TP6 A;  1JRQ A;  1NB5 I;  1G96 A;  4HM6 B;  1RHL A;  2MF7 A;  3G4S 3;  2XGN A;  3IPT A;  1KC8 4;  1W2B 2;  3F14 A;  3MG1 A;  1UUW B;  4HM8 B;  4EW5 A;  5DRV A;  3LTA A;  5AEW B;  1RRH A;  4R9L A;  1VQL 3;  1AVK A;  1JN5 A;  1BSE A;  1O7H B;  1VQN 3;  1D6Y A;  2AAE A;  1IYY A;  2YX9 A;  3LTD A;  2OTJ 3;  2R4I A;  1ZS7 A;  5CLK A;  3BNE A;  2A15 A;  1BAN A;  1T2H A;  2E2V A;  4KFF A;  3STD A;  3KE7 A;  1BRH A;  3AHS A;  2W9Q A;  3RDE A;  3L0R A;  3FF0 A;  2BU4 A;  4JF8 A;  3MWZ A;  1N5P A;  2Z7A A;  1IT8 A;  2HMO B;  4N6M A;  4HOH A;  2Z77 A;  3NBR A;  3MKI A;  1VQ4 3;  3QRD A;  1E3V A;  2XR8 B;  4X2O A;  2RSX A;  1RN7 A;  3EN1 B;  4J5K A;  1YHQ 3;  3LH4 A;  2AAD A;  4H3U A;  1RRL A;  9RNT A;  5EEO A;  3S27 A;  4K1U A;  4U13 A;  3CPO A;  8RNT A;  1A2V A;  3B4P A;  3FKA A;  2F98 A;  2GXF A;  5G2G A;  1YJW 3;  5CF2 A;  3CNM A;  1NO3 A;  1IV7 A;  1YIT 3;  2XF3 A;  3RGA A;  4I4K A;  1AQZ A;  2WO0 A;  3Q90 A;  1BSB A;  1OHO A;  2C10 A;  5FW5 A;  4BTY A;  1VQ6 3;  1NB3 I;  3MPH A;  1A2K A;  8CHO A;  3HII A;  1MNL A;  1UW1 A;  3ER7 A;  1JBT A;  1TIJ A;  3X3X A;  1FUW A;  1SAR A;  1JKG B;  1RGA A;  1VQK 3;  4N6L A;  3KSE D;  1T5Y A;  1STF I;  2HOH A;  3GZY B;  5AEU B;  1I3F A;  1V58 A;  1GYB A;  4IT7 A;  1K8A 4;  3D4A A;  1FYS A;  2KCD A;  1GOU A;  5AYR B;  2CX0 A;  3I55 3;  1U8C B;  5GSP A;  1UUG B;  1EKM A;  1V57 A;  3KSP A;  1PYL A;  4K61 A;  4EYC A;  1KQS 2;  1LVN A;  2CKF B;  4K90 B;  1VQ9 3;  2HML B;  1RKY A;  1RSN A;  3BB9 A;  1SIH A;  1RNB A;  2R41 A;  1IT7 A;  1GY6 A;  1DVC A;  1I70 A;  3ROB A;  1K73 4;  3DGN A;  1RNT A;  3NQZ A;  3ECF A;  3HOH A;  3UL6 A;  4RZM A;  1QVF 2;  4XB5 A;  1RN1 A;  1W2Z A;  1GY5 A;  4HM2 B;  2KF4 A;  5FGO A;  3OW2 2;  1Q40 A;  2BNG A;  3BU4 A;  2OOV C;  2CFD A;  3DM8 A; 
#chains in the Genus database with same CATH homology
 5CF1 A;  3LTC A;  4FCZ A;  3IMA B;  5LC7 A;  3G71 3;  2LYX A;  1W00 A;  2XRX B;  3GWR A;  3WOF B;  3CC2 3;  5BXQ A;  2B1X B;  2XFT A;  1ROA A;  4HZ9 B;  4XBY A;  2CIU A;  1M1X B;  3BLZ A;  2KRT A;  3CC7 3;  2MC8 A;  4MEI A;  4AKZ A;  2W56 A;  5HGR A;  1IQY A;  3KFQ C;  2OCT A;  1OHS A;  3CCV 3;  3BNB A;  1LOX A;  1W02 A;  4RNZ A;  1IDP A;  2KXG A;  3X3Z A;  1QAF A;  4N6N B;  1OF5 B;  3EHC A;  3QK9 A;  2XH9 A;  3CCU 3;  4TX4 A;  3OV4 A;  1GD4 A;  2XFS A;  3N9H A;  3PGB A;  3SVA A;  4L8O A;  1M1K 4;  5KP3 A;  1A90 A;  3NX0 A;  3CCS 3;  1Q7Y 4;  1IVU A;  2CFW A;  2Z76 A;  3LXU X;  3F9S A;  1IU7 A;  1US1 A;  2ML5 A;  1YI2 3;  1Q86 4;  1A67 A;  5KP4 A;  3HX8 A;  3LOY A;  3V99 A;  4NRE A;  2L4V A;  3BND A;  4IIA A;  3GRD A;  4KZ1 A;  3EN8 A;  2BMR B;  2O9U X;  3JUO A;  2K0M A;  3K5T A;  3LT9 A;  1S5A A;  5D82 A;  1VQM 3;  3OWS A;  4NHF A;  3PS8 A;  3JUQ A;  1TU5 A;  1QAL A;  2BHM A;  2D42 A;  1DYU A;  2GU3 A;  4CDL A;  4ORL A;  4FMB A;  3D3L A;  3VSY A;  1J2B A;  4WYK A;  1TUH A;  1LNH A;  3M8C A;  1Y4K A;  1DMM A;  2XSO B;  1ZX2 A;  3G16 A;  1W6G A;  3UB1 A;  2W6J H;  1DMQ A;  5LC6 A;  1BUQ A;  2BT3 A;  3S5C A;  3DXO A;  2P0M A;  3JVC A;  2GBW B;  1NJI 4;  3FG4 A;  1E97 A;  3FH1 A;  6STD A;  4HVN A;  1FGQ A;  1ROV A;  4WYK B;  5IG5 A;  1ULJ B;  3NM2 A;  4O02 B;  2ZL8 A;  3F7S A;  3WDG B;  2P05 A;  3WA2 X;  3FF2 A;  4RBN A;  2W03 A;  5AII A;  1YJN 3;  3OXA A;  2Y74 A;  5ELU A;  4XBT A;  4LGQ A;  1FGO A;  5IW9 A;  1OCV A;  3PCS A;  1OGZ A;  2O3O A;  4OK0 A;  2CFK A;  2CG0 A;  5IG4 A;  1VZZ A;  1JJ2 2;  1O7W B;  1NWW A;  2QIY A;  4R80 A;  1CYV A;  2P38 A;  1O7G B;  3SOY A;  5IG3 A;  1AV4 A;  5AIH A;  3WOE B;  5IER A;  3CCR 3;  5A0O B;  1FGR A;  1JKG A;  3PXM A;  4MMX B;  1KWI A;  3IJE B;  4FMC A;  2V1L A;  3OX9 A;  3DY5 A;  3MSO A;  3CMA 3;  2Q07 A;  3OWY A;  3GZB A;  3VGN A;  2ZDJ A;  2OTL 3;  4LMI A;  4OVM A;  3CD6 3;  3EE1 A;  1ISK A;  2RFR A;  4N6O B;  1U5O A;  4HZB B;  3F8H A;  5AIF A;  1W6Y A;  1OAC A;  4IPB A;  2ML6 A;  2HMM B;  2CK3 H;  5I97 A;  4XBX A;  1N8R 4;  4K1V A;  1GD3 A;  2CFL A;  3F7X A;  2HMJ B;  2JDI H;  3CXC 2;  1UUV B;  2WOF A;  1OGX A;  4EXR A;  2QA4 3;  1JNQ A;  1NU3 A;  1FA3 A;  5IEO A;  1FGT A;  3FG3 A;  2C11 A;  4N6V 0;  1K28 A;  4FCJ A;  3HIG A;  3JUN A;  3KKG A;  3FSD A;  3KN4 A;  1QAK A;  3LTB A;  3T8U A;  5BVB A;  5IF6 A;  2P0X A;  3CCL 3;  1N5H A;  1OPY A;  3EBY A;  1OF5 A;  1OH0 A;  2F99 A;  4OUQ A;  1D6Z A;  2HMN B;  1VQ7 3;  4EC6 A;  3V92 A;  4BTW A;  5AYS C;  3NV0 B;  4RNY A;  1IK3 A;  2CW9 A;  2WGQ A;  2UX0 A;  4AEQ A;  1R4C A;  2OQE A;  2WOH A;  1W6C A;  1YGE A;  4HKV B;  4WP5 A;  1OHP A;  2XGL A;  4H61 A;  3EB8 A;  4O3V A;  2D1W A;  3H3H A;  3B4O A;  3J7Y d;  4J8T A;  4HBR A;  3FCS B;  3EX9 A;  3FG1 A;  2CH9 A;  1DMN A;  4KFD A;  2STD A;  3S29 A;  1W01 A;  2HMK B;  4HM4 B;  3K7C A;  3V98 A;  1TFO A;  1TFK A;  2PZV A;  3DZL A;  3G8Z A;  3BNC A;  2SBL A;  3JUM A;  1JB5 A;  1KSI A;  3NUV A;  2E2U A;  3EF8 A;  2XEP A;  1SPU A;  1CQS A;  2W0Q A;  3PYJ A;  1YIJ 3;  1AR0 A;  1W4N A;  3DGO A;  3EBT A;  3CME 3;  1QVG 2;  2FNQ A;  3N54 B;  4FR9 A;  3G6E 3;  4WHA A;  1DVD A;  4GB5 A;  4O8S A;  4XM4 A;  1NDO B;  5EQL A;  1SJW A;  2YFL B;  4FMD A;  3SOA A;  1N9J A;  4JRF A;  3PZW A;  3X41 A;  1PFP A;  2I9W A;  3Q2P A;  2F86 B;  3TDG A;  4EV5 A;  2BMQ B;  5CK6 A;  3AMO B;  1AVL A;  2CWU A;  4N6T A;  5DRE A;  4WFO A;  4HM0 B;  2IUK A;  4X2H A;  4CCV A;  3NQY A;  4N6U A;  1VQO 3;  1K41 A;  1W5Z A;  7STD A;  1RJO A;  1S72 3;  3MYT A;  5AI1 A;  5JBS A;  2YFI B;  3CPW 2;  1LXE A;  3LML A;  4HM5 B;  3OWU A;  1EG9 B;  3ALA A;  1HU9 A;  4KFE A;  1WTH A;  3NXJ A;  4QWT A;  5TGN A;  3F8X A;  1O7P B;  3O8Y A;  3G0K A;  5KP1 A;  4STD A;  2CC3 A;  3KZT A;  1JN5 B;  4BTX A;  1JB4 A;  1GS3 A;  1W7C A;  1Z1S A;  3SLU A;  1Q81 4;  1EQK A;  4L7K A;  3CNX A;  1IV9 A;  1M90 4;  3B7C A;  1K9M 4;  4ZM8 A;  3X40 A;  2CFG A;  3H51 A;  1SQW A;  1VQ5 3;  2RCD A;  1IVX A;  4O2H A;  3LYG A;  1WMP A;  5JPU A;  1L5G B;  4R1K A;  3T0U A;  4FMA A;  3N8B A;  1STD A;  1IQ8 A;  1F8N A;  3I0Y A;  2OOV A;  4MMZ B;  2FGT A;  2JQ5 A;  3MG2 A;  2GU1 A;  1ASK A;  3PCR A;  1V74 A;  3X42 A;  2B24 B;  1N9E A;  3EC9 A;  3NHX A;  5ELJ A;  4N3V A;  1GY7 A;  5D83 A;  1IVW A;  1QJG A;  3FZW A;  3WMD A;  1QMA A;  3NV0 A;  4EV2 A;  1FGM A;  2FXT A;  1WNH A;  5IEN A;  3B8L A;  2CG1 A;  2GEX A;  3K0Z A;  1YJ9 3;  3SED A;  4LSO A;  4HM1 B;  3CU3 A;  1MOL A;  3FGY A;  3HZP A;  3CCM 3;  2CHC A;  2INX A;  1YVB I;  1ZO2 A;  1VQP 3;  3WA3 A;  5CXO A;  1N8Q A;  2WGO A;  3DGL A;  3FLJ A;  2PNC A;  5JPP A;  3I56 3;  2W2C A;  4R4K A;  4AKY A;  3MHE A;  1O7M B;  2CWT A;  2P09 A;  1D6U A;  3DUK A;  4MJD A;  3DMC A;  3K63 A;  3CCQ 3;  2W04 A;  1WMO A;  3HI7 A;  4GL6 A;  1UI8 A;  4EBG A;  2W9P A;  3SXX A;  3NBB A;  3S67 A;  3LZA A;  2IA7 A;  1C7H A;  3E99 A;  3JUP A;  1IQX A;  3UNL A;  4R9K A;  3F40 A;  3WOD G;  3VF1 A;  2GBX B;  2QEX 3;  4J9A A;  1Q40 B;  4L8P A;  2BMO B;  2IMJ A;  1WQL B;  5EVH A;  2Y73 A;  3KII A;  4HYZ A;  1WMN A;  2CWV A;  3D9R A;  1M9G A;  3GAX A;  3UJM A;  1O7N B;  1SII A;  2BO9 B;  3MG3 A;  1CYU A;  3DGM A;  2YFJ B;  2M7O A;  4HM7 B;  2Z6B A;  5IEP A;  4HM3 B;  2W56 B;  1KD1 4;  4KVH A;  3T8N A;  1EA2 A;  2RGQ A;  2XSH B;  3U1W A;  1VQ8 3;  3HK4 A;  1ULI B;  3AMO A;  3GZX B;  1HKX A;  3Q1C A;  2OQE C;  3GZR A;  4XDW A;  5IG0 A;  5STD A;  1Q42 A;  1CEW I;  2IUJ A;  1JB2 A;  2OWP A;  5AIG A;  1PU4 A;  2E2T A;  5D81 A;  3A76 A;  1Q82 4;  3LT8 A;  3CCJ 3;  4HJL B;  2QGU A;  3U97 A;  3K9M C;  3EQQ B;  4LZI A;  4LEH A;  4Q53 A;  3NM7 A;  1JV2 B;  4PEJ A;  3NBJ A;  3CCE 3;  3SX1 A;  1E3R A;  2K54 A;  1UI7 A;  4WWU C;  3UL5 A;  3RGR A;  3S28 A;  2LQV A;  1IVV A;  4FCM A;  4XDV A;  3CC4 3;  2GEY A;  4G1M B;  1OUN A;  4MMY B;  3X3Y A;  3EJV A;  1TP6 A;  1JRQ A;  1NB5 I;  1G96 A;  4HM6 B;  2MF7 A;  3G4S 3;  2XGN A;  3IPT A;  1KC8 4;  1W2B 2;  3F14 A;  3MG1 A;  1UUW B;  4HM8 B;  5DRV A;  3LTA A;  5AEW B;  1RRH A;  4R9L A;  1VQL 3;  1AVK A;  1JN5 A;  1O7H B;  1VQN 3;  1D6Y A;  2YX9 A;  3LTD A;  2OTJ 3;  2R4I A;  5CLK A;  3BNE A;  2A15 A;  4KFF A;  2E2V A;  3STD A;  3KE7 A;  2W9Q A;  3RDE A;  3L0R A;  3FF0 A;  4JF8 A;  3MWZ A;  2Z7A A;  1N5P A;  1IT8 A;  2HMO B;  4N6M A;  2Z77 A;  3NBR A;  3MKI A;  1VQ4 3;  3QRD A;  1E3V A;  2XR8 B;  4X2O A;  2RSX A;  1RN7 A;  3EN1 B;  1YHQ 3;  3LH4 A;  4H3U A;  1RRL A;  5EEO A;  3S27 A;  4K1U A;  4U13 A;  3CPO A;  1A2V A;  3B4P A;  3FKA A;  2F98 A;  2GXF A;  5G2G A;  1YJW 3;  5CF2 A;  3CNM A;  1NO3 A;  1IV7 A;  1YIT 3;  2XF3 A;  3RGA A;  4I4K A;  2WO0 A;  3Q90 A;  1OHO A;  2C10 A;  5FW5 A;  4BTY A;  1VQ6 3;  1NB3 I;  3MPH A;  1A2K A;  8CHO A;  3HII A;  1MNL A;  1UW1 A;  3ER7 A;  1TIJ A;  3X3X A;  1FUW A;  1JKG B;  1VQK 3;  4N6L A;  3KSE D;  1T5Y A;  1STF I;  3GZY B;  5AEU B;  1GYB A;  4IT7 A;  1K8A 4;  2KCD A;  5AYR B;  3I55 3;  1U8C B;  1EKM A;  3KSP A;  4K61 A;  4EYC A;  1KQS 2;  1LVN A;  2CKF B;  4K90 B;  1VQ9 3;  2HML B;  1RKY A;  3BB9 A;  1SIH A;  1IT7 A;  1GY6 A;  1DVC A;  1K73 4;  3ROB A;  3DGN A;  1QVF 2;  3NQZ A;  3ECF A;  3UL6 A;  4RZM A;  4XB5 A;  3OW2 2;  1W2Z A;  1GY5 A;  4HM2 B;  5FGO A;  1Q40 A;  2BNG A;  2OOV C;  2CFD A;  3DM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...