7STDA

Scytalone dehydratase plus inhibitor 4
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
b'GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scytalone dehydratase
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
total genus 49
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 7stdA00
3MG3A 2YFJB 5AIHA 2UX0A 4N3VA 2A15A 1STDA 3JUOA 3DM8A 3NV0B 4WYKB 1EA2A 1JB2A 2BNGA 5D81A 3OWYA 1NDOB 3MG1A 2XR8B 5CF2A 4HZBB 1JB4A 5AIGA 3GZRA 3VSYA 3EC9A 1Q40B 4XBYA 3OWSA 2JQ5A 7STDA 1GYBA 3GZYB 3Q90A 2CKFB 2HMNB 1QMAA 3S5CA 3T8UA 1JN5A 2BMRB 3F8XA 3EN1B 1E3VA 2HMLB 3EHCA 3EBTA 1DMQA 4XBXA 3SOAA 1E97A 3G16A 4OVMA 3EBYA 3WMDA 3HK4A 3ROBA 3DUKA 3JUNA 5AEUB 4ORLA 1DMMA 1EG9B 2RGQA 1Q42A 3FKAA 3CNXA 4HM2B 1O7GB 3M8CA 3ER7A 3F40A 3NXJA 3F7SA 4HM7B 5IG3A 3A76A 3FH1A 4CDLA 5CK6A 2F99A 4HM4B 2GEYA 2XSHB 5D82A 3H51A 5HGRA 1JKGB 1OCVA 3D9RA 1JKGA 3RGAA 5IEPA 4XBTA 4XB5A 3K7CA 3GZBA 4HM3B 2HMMB 3STDA 1VZZA 3EN8A 1A2KA 1BUQA 4HKVB 5BXQA 3G8ZA 3B7CA 1GY7A 2F86B 3DZLA 3CU3A 1OF5B 5AIIA 3HZPA 1O7MB 1IDPA 3CPOA 4H3UA 1OH0A 1OPYA 3B8LA 4LGQA 5AI1A 3ECFA 5CF1A 4XDVA 1O7NB 3T8NA 2CHCA 4L7KA 3SEDA 4U13A 2F98A 2GBWB 3NV0A 3OWUA 4WYKA 3I0YA 3NBRA 1NU3A 4KVHA 3GRDA 3OV4A 4XM4A 1O7HB 2HMKB 1HKXA 1W01A 1SJWA 1Q40A 1Z1SA 4STDA 3MSOA 1GY6A 1DMNA 4WWUC 1E3RA 5IF6A 4HZ9B 3BB9A 2XRXB 4K1UA 3OX9A 3FLJA 5JPPA 2BMQB 3G0KA 2STDA 1TUHA 4LEHA 1C7HA 1ZX2A 1U5OA 4J9AA 5G2GA 1W6YA 1CQSA 4R9LA 3KE7A 3FSDA 5DRVA 3MG2A 3OXAA 5CLKA 3KZTA 4FCJA 2QGUA 4WP5A 5KP4A 1ULJB 4I4KA 4IIAA 4RZMA 6STDA 3GWRA 1ULIB 5IG5A 1UUVB 3EQQB 4OUQA 2R4IA 2HMJB 4Q53A 2INXA 2YFIB 4HM8B 2GXFA 3K0ZA 4K1VA 1NWWA 5TGNA 5IERA 5KP3A 5D83A 3CNMA 5STDA 2Z76A 4HM6B 2B24B 1OF5A 3H3HA 3DMCA 4R9KA 3UJMA 3KKGA 3JUQA 1ZO2A 3LYGA 3F7XA 1OHOA 3NHXA 4L8OA 3F9SA 1GY5A 8CHOA 1ASKA 1W00A 3B4OA 4HJLB 2GEXA 5EVHA 1TP6A 5IENA 3EJVA 3F14A 2HMOB 4HVNA 3KSPA 2K54A 3VGNA 3HX8A 4FCMA 2Z77A 2RCDA 3EX9A 4XDWA 3F8HA 3RGRA 5FW5A 5KP1A 4LMIA 2YFLB 1JN5B 3DXOA 4HM1B 1K41A 1OHPA 3FF2A 1UUWB 4J8TA 5AEWB 1OUNA 1O7WB 3JUPA 4X2OA 4PEJA 1OHSA 2IMJA 5IG0A 3NM2A 5IG4A 1O7PB 4GB5A 3SOYA 2GBXB 1S5AA 3BLZA 5CXOA 1ISKA 3FGYA 2B1XB 4HM0B 4HM5B 2PZVA 3NUVA 1QJGA 2Z7AA 2BMOB 3GZXB 3MYTA 5AIFA 1W02A 1OGZA 5BVBA 5DREA 3EF8A 5JPUA 4X2HA 3IPTA 2I9WA 2OWPA 1GS3A 4R1KA 4MJDA 3JUMA 1WQLB 2W2CA 3LZAA 2XSOB 1AR0A 3MHEA 3UNLA 2RFRA 1OGXA 3B4PA 4L8PA 1JB5A 3FZWA 3FF0A 2QIYA 3E99A 5IEOA 3MKIA
chains in the Genus database with same CATH superfamily
4J5GA 3AHWA 1YVBI 3I553 3MG3A 1NB5I 1MGRA 2YFJB 3CPW2 5AIHA 1VQQA 2UX0A 4N3VA 3V92A 2A15A 1STDA 3SLUA 2IY2A 3JUOA 1N8QA 3DM8A 3KCHA 1IYYA 4HBRA 4AKYA 3LTBA 4JF8A 3VF1A 3NV0B 4WYKB 1EA2A 1B2SA 3V98A 1JBSA 8RNTA 1T5YA 1JB2A 2BNGA 2XGLA 1BSEA 2AAEA 5G1LA 5D81A 3A5EA 3OWYA 1NDOB 3MG1A 3GSPA 4RBNA 2IUKA 2KCDA 2XR8B 4FMAA 4HZBB 1JB4A 1UW1A 4N6UA 3GZRA 5AIGA 5ELUA 4BU4A 3K63A 3VSYA 3EC9A 6GSPA 1Q40B 1V74A 1YI23 1QVF2 2CW9A 4XBYA 3OWSA 2OTL3 1RN1A 3JVCA 2JQ5A 4KT3B 1YJN3 2XFSA 7STDA 1N8R4 2W03A 3WHOA 1BRHA 1GMQA 1GYBA 3D3LA 1W6GA 3GZYB 3Q90A 2CKFB 1GMPA 3BIRA 4FMCA 1FUTA 2W56A 3J7Yd 2K3DA 3I563 1JZDA 2HMNB 1RSNA 3WDGB 1QMAA 4J5KA 3S5CA 3X3ZA 1VQ53 1RGKA 3T8UA 1JN5A 2BMRB 1BU4A 3F8XA 3EN1B 1E3VA 2HMLB 1BRKA 3EHCA 3EBTA 2OQEA 1MWUA 3BU4A 1CH0A 3X3XA 1NJI4 3NBBA 1DMQA 4WFOA 1GMRA 4XBXA 3SOAA 1E97A 1N9JA 2F56A 1G0TA 3Q1CA 1QALA 1BNRA 3G16A 2BO9B 4OVMA 3EBYA 3GAXA 1QAFA 1B21A 2F5WA 3HK4A 3WMDA 2KRTA 3D4AA 1M904 3BNBA 1I70A 3N8BA 5G1KA 3ROBA 3DUKA 1T3BA 3JUNA 5AEUB 2H0IA 1YIT3 4ORLA 5A0OB 1DMMA 1EG9B 2C4BA 2JDIH 2RGQA 1BSAA 1VQ43 1Q42A 3FKAA 1LOXA 3L0RA 3CNXA 2KF4A 2ML5A 4HM2B 1O7GB 3M8CA 2CG0A 1RDSA 1N5HA 2KF3A 2CX0A 3ER7A 3F40A 3PGBA 3NXJA 3F7SA 1VQO3 1D6ZA 1ROAA 2CK3H 1X1YA 4BL2A 4HM7B 1LQGC 1GOUA 5IG3A 1C54A 3HOHA 3DGLA 3A76A 3FH1A 2E2UA 2ZL8A 4CDLA 4NREA 5CK6A 5IW9A 4BTYA 5LC7A 3LTDA 2F99A 4HM4B 3CXC2 4BL3A 1KD14 2GEYA 1RJOA 2XSHB 1RGGA 3N9HA 5D82A 3X3YA 3G713 3H51A 2OCTA 3MPHA 3PXMA 1ZS7A 1AV4A 4GSPA 4FCZA 4ILFA 5HGRA 1JKGB 4EYCA 2J8XB 3CCE3 2CX1A 1TFOA 2AADA 1F8NA 1OCVA 1SIHA 1LNHA 2D1WA 3D9RA 3DGYA 3S27A 9RNTA 1AVKA 1VQ73 1FA3A 1N9EA 1JKGA 2KF5A 2O9UX 2CFWA 2E2TA 4XBTA 1RN7A 4XB5A 3RGAA 2OQEC 5IEPA 1YJW3 2F4YA 3GZBA 3K7CA 2P0XA 2F5MA 4HM3B 2W9PA 1B2UA 1IVWA 2WO0A 3LT9A 2D42A 1RRLA 1BNIA 2HMMB 2BT3A 1EUIC 3CCR3 3STDA 1CYVA 1VZZA 3FG3A 3Q3FA 5M19A 1RN4A 3EN8A 3WA2X 1A2KA 2IA7A 1BUQA 2SARA 4HKVB 5BXQA 3G8ZA 4N6LA 1BRJA 3B7CA 2W9QA 1A90A 1JZOA 2ML6A 1GY7A 1GD4A 1FUSA 4DKIA 2F86B 1T2HA 3DZLA 3ALAA 2PNCA 3CU3A 3KIIA 2BIRA 4K61A 3N54B 1OF5B 5HOHA 5AIIA 4LSOA 1D6UA 2MF7A 1IDPA 1O7MB 3CPOA 3HZPA 4H3UA 1K734 1NNVA 1W2ZA 3KN4A 1CEWI 3QRDA 1SARA 1JNQA 2H0GA 1LQMB 1OH0A 2P38A 1OPYA 3B8LA 2XH9A 1UGIA 3HIIA 4LGQA 4TX4A 5AI1A 1DVDA 1TFKA 3SYUA 3ECFA 5CF1A 4XDVA 1I8VA 1FGOA 4EXRA 4MMXB 1O7NB 1AY7A 1B27A 1FZUA 4RNTA 1IVUA 3KSED 2CHCA 3T8NA 3ZG0A 1BRNL 1SIIA 3DGNA 4L7KA 1TRPA 1VQ63 4I5QA 3AHSA 4HOHA 3SEDA 3TDGA 4U13A 2F98A 2GBWB 3NV0A 1KWIA 1W4NA 3OWUA 4LYLB 4WYKA 2OTJ3 4N6TA 3PZWA 2ZA4A 5M18A 3I0YA 1BNEA 3X40A 2SBLA 3NBRA 2GU3A 4OK0A 1YVSA 1A2VA 1NU3A 4KVHA 3GRDA 3PCSA 3CCQ3 3OV4A 4XM4A 1O7HB 3CCJ3 2R41A 2HMKB 4HYZA 1HKXA 4JRFA 1W01A 4IPBA 4R80A 1SJWA 1Q40A 1Z1SA 4FMDA 1I0XA 4STDA 3MSOA 2OOVA 1GY6A 3PYJA 1DMNA 2CWVA 4WWUC 1E3RA 1IV9A 4K90B 1RCLA 5IF6A 1RGHA 4HZ9B 3BB9A 5ELJA 1UI8A 1MOLA 3FCSB 1M1XB 4AEQA 1BVIA 2XRXB 1IQXA 1BNFA 4K1UA 2Q07A 1RRHA 3CC23 1IV7A 1FGTA 5EQLA 3OX9A 3FLJA 2KAAA 5JPPA 1Q7HA 2BMQB 2FGTA 1M1K4 1YIJ3 1UCJA 3G0KA 2STDA 2WGQA 2BU4A 1TUHA 1VQL3 3EB8A 5RNTA 1JJ22 2Z6BA 4LEHA 4MEIA 1LOVA 3T0UA 1RKYA 2UUGC 3IMAB 3LTCA 5LC6A 3AMOB 1RMSA 6RNTA 1C7HA 5CF2A 3RNTA 2P0MA 1ZX2A 2KF6A 1UUGB 2FNQA 2QEX3 1AVLA 3CC73 1U5OA 2H0HA 1UGHI 4J9AA 5G2GA 4FMBA 3WR2A 4FR9A 3NQZA 1VQP3 3IJEB 1W6YA 3BNDA 1CQSA 3HI7A 4QWTA 1IT8A 4R9LA 2XGNA 2RNTA 1UCIA 2L4VA 4EV5A 1S723 3KE7A 1IU7A 3FSDA 1PFPA 1WMNA 3MG2A 3OXAA 5DRVA 4N6OB 5CLKA 2QA43 1JRQA 3KZTA 4FCJA 3Q2PA 5BIRA 1I2FA 2QGUA 4G1MB 4WP5A 5KP4A 1G96A 1ULJB 2OOVC 4I4KA 2CWTA 4IIAA 1PYLA 3DGMA 1YGWA 4RZMA 6STDA 1UCKA 3GWRA 1ULIB 3S28A 5IG5A 1V58A 1A67A 1GOVA 2L1SA 3U1WA 1QAKA 1UUVB 3EQQB 1NB3I 4OUQA 2R4IA 3D5IA 1BNGA 2E2VA 1K8A4 2HMJB 1BAOA 4Q53A 2V1LA 5AYRB 1Q824 1ROVA 1RHLA 2INXA 4ZM8A 2YFIB 1FGMA 1GSPA 4GHOA 4HM8B 5IERA 1BSDA 3D79A 2GXFA 1LOWA 4NPBA 1B2ZA 2GSPA 1V57A 2ZDJA 1WMOA 1JV2B 2IUJA 1BOXA 4WHAA 3K0ZA 2GU1A 4O02B 4K1VA 1NWWA 5TGNA 2C11A 1RGFA 2XFTA 5KP3A 3PS8A 2XF3A 3CNMA 1N5PA 5D83A 2UGIA 1SPUA 5STDA 2MC8A 3RDEA 2Z76A 4CPKA 4EC6A 5JBSA 4KFFA 1CYUA 4HM6B 2B24B 1OF5A 4IT7A 2CH9A 1K9M4 3H3HA 3DMCA 1D6YA 3ZG5A 4R9KA 3CME3 1RGLA 1BNSA 1RNBA 1MWTA 1B20A 1BRIA 4NHFA 1J2BA 1Q9EA 3UJMA 2CFKA 1QVG2 1MWSA 3KKGA 3JUQA 4R4KA 3UL6A 3X41A 2RBIA 2XEPA 4N6NB 3ZFZA 1ZO2A 3LYGA 3CCS3 3AGNA 1IQYA 3F7XA 1OHOA 1JBTA 3KFQC 3NHXA 3LH4A 4L8OA 1W2B2 3F9SA 3SVAA 3O8YA 1GY5A 1BSBA 1ASKA 1W00A 8CHOA 1YHQ3 3NBJA 3B4OA 1FUWA 1PY3A 3BNCA 1RNTA 4HJLB 2GEXA 5EVHA 3NQYA 1FGQA 4GL6A 1TP6A 3SXXA 1Y4KA 5EEOA 5IENA 3FG4A 1WMPA 1UI7A 1VQK3 1DE3A 4EBGA 2P05A 2HOHA 3EJVA 2YX9A 1BNJA 4EV2A 1X1WA 3F14A 1YJ93 1HYFA 1DVCA 2WGOA 5AYSC 3HIGA 1A2PA 2HMOB 4HVNA 3KSPA 3UB1A 1LNIA 2LQVA 1RTUA 2K54A 3MWZA 1FW7A 1T2IA 3VGNA 1W7CA 3G4S3 1JBRA 1I2GA 3HX8A 5GSPA 1I3IA 4AKZA 4FCMA 3UL5A 4MMYB 3EE1A 3WODG 4BIRA 3AGOA 1WNHA 1YNVX 1I2EA 2Z77A 1TJDA 4N6MA 2RCDA 1MWRA 1R4YA 1LRAA 3EX9A 1FGRA 3WOFB 3FG1A 4XDWA 1TU5A 1AQZA 3CC43 3F8HA 2W56B 3RGRA 2C10A 3DGOA 5FW5A 2CFDA 4LMIA 5KP1A 2YFLB 3CMA3 1YGEA 4RNZA 3CCL3 1JN5B 3DXOA 2WOFA 4HM1B 4HAAA 1BIRA 4CCVA 1K41A 3WOEB 1OHPA 3FF2A 3AMOA 1WTHA 1I0VA 1UUWB 2CG1A 1IT7A 4O2HA 4RNYA 4J8TA 3X42A 1HZ1A 4KFEA 3LMLA 1K28A 1BRSA 5AEWB 1OUNA 1HU9A 1B3SA 1IQ8A 1O7WB 2O3OA 1KQS2 2W6JH 3JUPA 4X2OA 1MNLA 3G6E3 1RGCA 1LVNA 1R4CA 4PEJA 1OHSA 2FXTA 7GSPA 3LTAA 1BGSA 2IMJA 5IG0A 5FGOA 3V99A 3NM2A 1W6CA 1L5GB 5IG4A 3CCU3 1ZGXA 1O7PB 2WOHA 1B2XA 1VQ93 1X1XA 4GB5A 3NM7A 1KSIA 3URPA 3SOYA 1B2MA 2KXGA 4H61A 1KC84 1BANA 1MGWA 3SX1A 2GBXB 2RSXA 2P09A 1S5AA 3BLZA 5CXOA 1U8CB 1ISKA 1UCLA 1RLSA 1W5ZA 2B1XB 2W04A 3FGYA 4HM0B 3CD63 3LXUX 4HM5B 2PZVA 5M1AA 3WA3A 4EW5A 1US1A 4O3VA 1GOYA 2IYJA 3NUVA 3PCRA 1QJGA 3U97A 4BTWA 4KZ1A 3NX0A 2Z7AA 2CWUA 2BHMA 1IVVA 3DH2A 2BMOB 3GZXB 1GD3A 3MYTA 5AIFA 3S67A 1M9GA 4MMZB 1RGEA 2K0MA 1NO3A 1W02A 1EKMA 1OGZA 1UDII 5BVBA 5DREA 7RNTA 3QK9A 1TTOA 2ZHXB 3EF8A 5BU4A 5JPUA 1EQKA 1VQM3 1TRQA 1I3FA 4X2HA 4CJNA 4N6V0 2CFGA 2Y74A 1FYSA 1DYUA 4KFDA 1BRGA 2Y73A 1RCKA 1RGAA 3IPTA 2I9WA 2OWPA 1Q814 4O8SA 3OW22 1GS3A 2M7OA 4R1KA 3K9MC 1BUJA 4MJDA 4BTXA 1PU4A 1G02A 4LZIA 1TIJA 2W0QA 3JUMA 3LOYA 1WQLB 1IK3A 2W2CA 3LZAA 1IVXA 3D5GA 3LT8A 2XSOB 1AR0A 2LYXA 3MHEA 3UNLA 2RFRA 5I97A 1LOYA 3CCM3 1OACA 3BNEA 3S29A 1X1UA 1SQWA 1Q864 1OGXA 3B4PA 1EEJA 3DY5A 4L8PA 1BSCA 1JB5A 1VQ83 1DETA 2CIUA 3FZWA 2CC3A 1VQN3 2CFLA 3K5TA 3FF0A 2QIYA 3E99A 1LXEA 5IEOA 3MKIA 3CCV3 1Q7Y4 1STFI
chains in the Genus database with same CATH topology
1YVBI 3I553 3MG3A 1NB5I 2YFJB 3CPW2 5AIHA 2UX0A 4N3VA 3V92A 2A15A 1STDA 3SLUA 3JUOA 1N8QA 3DM8A 4HBRA 4AKYA 3LTBA 4JF8A 3VF1A 3NV0B 4WYKB 1EA2A 3V98A 1T5YA 1JB2A 2BNGA 2XGLA 5D81A 3OWYA 1NDOB 3MG1A 4RBNA 2IUKA 2KCDA 2XR8B 4FMAA 4HZBB 1JB4A 1UW1A 4N6UA 3GZRA 5AIGA 5ELUA 3K63A 3VSYA 3EC9A 1QVF2 1Q40B 1V74A 1YI23 2CW9A 4XBYA 3OWSA 2OTL3 3JVCA 1YJN3 2JQ5A 1N8R4 2XFSA 7STDA 2W03A 1GYBA 3D3LA 1W6GA 3GZYB 3Q90A 2CKFB 4FMCA 2W56A 3J7Yd 3I563 2HMNB 3WDGB 1QMAA 3S5CA 1VQ53 3X3ZA 3T8UA 1JN5A 2BMRB 3F8XA 3EN1B 1E3VA 2HMLB 3EHCA 2OQEA 3EBTA 3X3XA 1NJI4 3NBBA 1DMQA 4WFOA 4XBXA 3SOAA 1E97A 1N9JA 3Q1CA 1QALA 3G16A 2BO9B 4OVMA 3EBYA 3GAXA 1QAFA 3HK4A 3WMDA 1M904 2KRTA 3BNBA 3N8BA 3ROBA 3DUKA 3JUNA 5AEUB 1YIT3 4ORLA 5A0OB 1DMMA 1EG9B 2JDIH 2RGQA 1VQ43 1Q42A 3FKAA 1LOXA 3L0RA 3CNXA 2ML5A 4HM2B 1O7GB 3M8CA 2CG0A 3ER7A 1N5HA 3F40A 3PGBA 3NXJA 3F7SA 1VQO3 1D6ZA 1ROAA 2CK3H 4HM7B 5IG3A 3DGLA 3A76A 3FH1A 2E2UA 2ZL8A 4CDLA 4NREA 5CK6A 5IW9A 4BTYA 5LC7A 3LTDA 2F99A 4HM4B 3CXC2 1KD14 2GEYA 1RJOA 2XSHB 3N9HA 5D82A 3X3YA 3G713 3H51A 2OCTA 3MPHA 3PXMA 1AV4A 4FCZA 5HGRA 1JKGB 4EYCA 3CCE3 1TFOA 2D1WA 1F8NA 1OCVA 1SIHA 1LNHA 3D9RA 3CCM3 3S27A 1VQ73 2OTJ3 1AVKA 1FA3A 1N9EA 2O9UX 1JKGA 3RGAA 2CFWA 2E2TA 4XBTA 1RN7A 4XB5A 5IEPA 2OQEC 1YJW3 3K7CA 3GZBA 2P0XA 4HM3B 2W9PA 1IVWA 2WO0A 3LT9A 2D42A 1RRLA 2HMMB 2BT3A 3CCR3 3STDA 1CYVA 1VZZA 3FG3A 3EN8A 3WA2X 1A2KA 2IA7A 1BUQA 4HKVB 5BXQA 3G8ZA 4N6LA 3B7CA 2W9QA 1A90A 2ML6A 1GY7A 1GD4A 2F86B 3DZLA 3ALAA 2PNCA 3CU3A 3KIIA 4K61A 3N54B 1OF5B 5AIIA 4LSOA 1D6UA 2MF7A 1IDPA 1O7MB 3CPOA 3HZPA 4H3UA 1K734 1W2ZA 3KN4A 1CEWI 3QRDA 1JNQA 1OH0A 2P38A 1OPYA 3B8LA 2XH9A 4LGQA 3HIIA 4TX4A 5AI1A 1DVDA 1TFKA 3ECFA 5CF1A 4XDVA 4EXRA 1FGOA 4MMXB 1O7NB 1IVUA 3KSED 2CHCA 3T8NA 1SIIA 3DGNA 4L7KA 1VQ63 3TDGA 3SEDA 4U13A 2F98A 2GBWB 3NV0A 1KWIA 1W4NA 3OWUA 4WYKA 4N6TA 3PZWA 3I0YA 3X40A 2SBLA 3NBRA 2GU3A 4OK0A 1A2VA 1NU3A 4KVHA 3GRDA 3PCSA 3CCQ3 3OV4A 4XM4A 1O7HB 3CCJ3 2HMKB 4HYZA 1HKXA 4JRFA 1W01A 4IPBA 4R80A 1SJWA 1Q40A 1Z1SA 4FMDA 4STDA 3MSOA 2OOVA 1GY6A 3PYJA 1DMNA 2CWVA 4WWUC 1E3RA 1IV9A 4K90B 5IF6A 4HZ9B 3BB9A 5ELJA 1UI8A 1MOLA 3FCSB 1M1XB 4AEQA 2XRXB 1IQXA 4K1UA 2Q07A 1RRHA 3CC23 1IV7A 1FGTA 5EQLA 3OX9A 3FLJA 5JPPA 1M1K4 2BMQB 2FGTA 1YIJ3 3G0KA 2STDA 2WGQA 1VQL3 1TUHA 3EB8A 1JJ22 2Z6BA 4LEHA 4MEIA 3T0UA 1RKYA 3IMAB 3LTCA 5LC6A 3AMOB 1C7HA 5CF2A 2P0MA 1ZX2A 2FNQA 2QEX3 1AVLA 3CC73 1U5OA 4J9AA 5G2GA 4FMBA 4FR9A 3NQZA 1VQP3 3IJEB 1W6YA 3BNDA 1CQSA 3HI7A 4QWTA 1IT8A 4R9LA 2XGNA 2L4VA 4EV5A 1S723 3KE7A 1IU7A 3FSDA 1PFPA 1WMNA 3MG2A 3OXAA 5DRVA 4N6OB 5CLKA 2QA43 1JRQA 3KZTA 4FCJA 3Q2PA 2QGUA 4G1MB 4WP5A 5KP4A 1G96A 1ULJB 2OOVC 4I4KA 2CWTA 4IIAA 3DGMA 4RZMA 6STDA 3GWRA 1ULIB 3S28A 5IG5A 1A67A 3U1WA 1QAKA 1UUVB 3EQQB 1NB3I 4OUQA 2R4IA 2E2VA 1K8A4 2HMJB 4Q53A 2V1LA 5AYRB 1Q824 1ROVA 2INXA 4ZM8A 2YFIB 1FGMA 4HM8B 5IERA 2GXFA 2ZDJA 1WMOA 1JV2B 2IUJA 4WHAA 3K0ZA 2GU1A 4O02B 4K1VA 1NWWA 5TGNA 2C11A 2XFTA 5KP3A 3PS8A 2XF3A 3CNMA 1N5PA 5D83A 5STDA 1SPUA 2MC8A 3RDEA 4EC6A 2Z76A 5JBSA 4KFFA 1CYUA 4HM6B 2B24B 1OF5A 4IT7A 2CH9A 1K9M4 3H3HA 3DMCA 1D6YA 4R9KA 3CME3 4NHFA 1J2BA 3UJMA 2CFKA 1QVG2 3KKGA 3JUQA 4R4KA 3UL6A 3X41A 4N6NB 2XEPA 3CCS3 1ZO2A 3LYGA 1IQYA 3F7XA 1OHOA 3KFQC 3NHXA 3LH4A 4L8OA 1W2B2 3F9SA 3SVAA 3O8YA 1GY5A 8CHOA 1ASKA 1W00A 1YHQ3 3NBJA 3B4OA 1FUWA 3BNCA 4HJLB 2GEXA 5EVHA 3NQYA 1FGQA 4GL6A 1TP6A 3SXXA 1Y4KA 5EEOA 5IENA 3FG4A 1WMPA 1UI7A 1VQK3 4EBGA 2P05A 3EJVA 2YX9A 4EV2A 3F14A 1YJ93 1DVCA 2WGOA 5AYSC 3HIGA 2HMOB 4HVNA 3KSPA 3UB1A 3MWZA 2LQVA 2K54A 3VGNA 1W7CA 3G4S3 3HX8A 4AKZA 4FCMA 3UL5A 4MMYB 3EE1A 3WODG 1WNHA 2Z77A 4N6MA 2RCDA 3EX9A 1FGRA 3WOFB 3FG1A 4XDWA 1TU5A 3CC43 3F8HA 2W56B 3RGRA 2C10A 3DGOA 5FW5A 2CFDA 4LMIA 5KP1A 2YFLB 3CMA3 1YGEA 4RNZA 3CCL3 1JN5B 3DXOA 2WOFA 4HM1B 4CCVA 1K41A 3WOEB 1OHPA 3FF2A 3AMOA 1WTHA 1UUWB 2CG1A 1IT7A 4O2HA 4RNYA 4J8TA 3X42A 4KFEA 3LMLA 1K28A 5AEWB 1OUNA 1HU9A 1IQ8A 1O7WB 2O3OA 1KQS2 2W6JH 3JUPA 4X2OA 1MNLA 3G6E3 1LVNA 1R4CA 4PEJA 1OHSA 2FXTA 3LTAA 2IMJA 5IG0A 5FGOA 3V99A 3NM2A 1W6CA 1L5GB 5IG4A 3CCU3 1VQ93 1O7PB 2WOHA 4GB5A 3NM7A 1KSIA 3SOYA 2KXGA 4H61A 1KC84 3SX1A 2GBXB 2RSXA 2P09A 1S5AA 3BLZA 5CXOA 1U8CB 1ISKA 3FGYA 1W5ZA 2B1XB 2W04A 4HM0B 3CD63 3LXUX 4HM5B 2PZVA 3WA3A 1US1A 4O3VA 3U97A 3NUVA 3PCRA 1QJGA 4BTWA 4KZ1A 3NX0A 2Z7AA 2CWUA 2BHMA 1IVVA 2BMOB 3GZXB 1GD3A 3MYTA 5AIFA 3S67A 1M9GA 4MMZB 2K0MA 1NO3A 1W02A 1EKMA 1OGZA 5BVBA 5DREA 1EQKA 3QK9A 3EF8A 5JPUA 1VQM3 4X2HA 4N6V0 2CFGA 2Y74A 4KFDA 1DYUA 2Y73A 3IPTA 2I9WA 2OWPA 1Q814 4O8SA 3OW22 1GS3A 2M7OA 4R1KA 3K9MC 4MJDA 4BTXA 1PU4A 4LZIA 1TIJA 2W0QA 3JUMA 3LOYA 1WQLB 1IK3A 2W2CA 3LZAA 1IVXA 3LT8A 2XSOB 1AR0A 2LYXA 3MHEA 3UNLA 2RFRA 5I97A 1OACA 3BNEA 3S29A 1Q864 1SQWA 1OGXA 3B4PA 3DY5A 4L8PA 1JB5A 1VQ83 2CIUA 3FZWA 2CC3A 1VQN3 2CFLA 3K5TA 3FF0A 2QIYA 3E99A 1LXEA 5IEOA 3MKIA 3CCV3 1Q7Y4 1STFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MG3 A;  2YFJ B;  5AIH A;  2UX0 A;  4N3V A;  2A15 A;  1STD A;  3JUO A;  3DM8 A;  3NV0 B;  4WYK B;  1EA2 A;  1JB2 A;  2BNG A;  5D81 A;  3OWY A;  1NDO B;  3MG1 A;  2XR8 B;  5CF2 A;  4HZB B;  1JB4 A;  5AIG A;  3GZR A;  3VSY A;  3EC9 A;  1Q40 B;  4XBY A;  3OWS A;  2JQ5 A;  7STD A;  1GYB A;  3GZY B;  3Q90 A;  2CKF B;  2HMN B;  1QMA A;  3S5C A;  3T8U A;  1JN5 A;  2BMR B;  3F8X A;  3EN1 B;  1E3V A;  2HML B;  3EHC A;  3EBT A;  1DMQ A;  4XBX A;  3SOA A;  1E97 A;  3G16 A;  4OVM A;  3EBY A;  3WMD A;  3HK4 A;  3ROB A;  3DUK A;  3JUN A;  5AEU B;  4ORL A;  1DMM A;  1EG9 B;  2RGQ A;  1Q42 A;  3FKA A;  3CNX A;  4HM2 B;  1O7G B;  3M8C A;  3ER7 A;  3F40 A;  3NXJ A;  3F7S A;  4HM7 B;  5IG3 A;  3A76 A;  3FH1 A;  4CDL A;  5CK6 A;  2F99 A;  4HM4 B;  2GEY A;  2XSH B;  5D82 A;  3H51 A;  5HGR A;  1JKG B;  1OCV A;  3D9R A;  1JKG A;  3RGA A;  5IEP A;  4XBT A;  4XB5 A;  3K7C A;  3GZB A;  4HM3 B;  2HMM B;  3STD A;  1VZZ A;  3EN8 A;  1A2K A;  1BUQ A;  4HKV B;  5BXQ A;  3G8Z A;  3B7C A;  1GY7 A;  2F86 B;  3DZL A;  3CU3 A;  1OF5 B;  5AII A;  3HZP A;  1O7M B;  1IDP A;  3CPO A;  4H3U A;  1OH0 A;  1OPY A;  3B8L A;  4LGQ A;  5AI1 A;  3ECF A;  5CF1 A;  4XDV A;  1O7N B;  3T8N A;  2CHC A;  4L7K A;  3SED A;  4U13 A;  2F98 A;  2GBW B;  3NV0 A;  3OWU A;  4WYK A;  3I0Y A;  3NBR A;  1NU3 A;  4KVH A;  3GRD A;  3OV4 A;  4XM4 A;  1O7H B;  2HMK B;  1HKX A;  1W01 A;  1SJW A;  1Q40 A;  1Z1S A;  4STD A;  3MSO A;  1GY6 A;  1DMN A;  4WWU C;  1E3R A;  5IF6 A;  4HZ9 B;  3BB9 A;  2XRX B;  4K1U A;  3OX9 A;  3FLJ A;  5JPP A;  2BMQ B;  3G0K A;  2STD A;  1TUH A;  4LEH A;  1C7H A;  1ZX2 A;  1U5O A;  4J9A A;  5G2G A;  1W6Y A;  1CQS A;  4R9L A;  3KE7 A;  3FSD A;  5DRV A;  3MG2 A;  3OXA A;  5CLK A;  3KZT A;  4FCJ A;  2QGU A;  4WP5 A;  5KP4 A;  1ULJ B;  4I4K A;  4IIA A;  4RZM A;  6STD A;  3GWR A;  1ULI B;  5IG5 A;  1UUV B;  3EQQ B;  4OUQ A;  2R4I A;  2HMJ B;  4Q53 A;  2INX A;  2YFI B;  4HM8 B;  2GXF A;  3K0Z A;  4K1V A;  1NWW A;  5TGN A;  5IER A;  5KP3 A;  5D83 A;  3CNM A;  5STD A;  2Z76 A;  4HM6 B;  2B24 B;  1OF5 A;  3H3H A;  3DMC A;  4R9K A;  3UJM A;  3KKG A;  3JUQ A;  1ZO2 A;  3LYG A;  3F7X A;  1OHO A;  3NHX A;  4L8O A;  3F9S A;  1GY5 A;  8CHO A;  1ASK A;  1W00 A;  3B4O A;  4HJL B;  2GEX A;  5EVH A;  1TP6 A;  5IEN A;  3EJV A;  3F14 A;  2HMO B;  4HVN A;  3KSP A;  2K54 A;  3VGN A;  3HX8 A;  4FCM A;  2Z77 A;  2RCD A;  3EX9 A;  4XDW A;  3F8H A;  3RGR A;  5FW5 A;  5KP1 A;  4LMI A;  2YFL B;  1JN5 B;  3DXO A;  4HM1 B;  1K41 A;  1OHP A;  3FF2 A;  1UUW B;  4J8T A;  5AEW B;  1OUN A;  1O7W B;  3JUP A;  4X2O A;  4PEJ A;  1OHS A;  2IMJ A;  5IG0 A;  3NM2 A;  5IG4 A;  1O7P B;  4GB5 A;  3SOY A;  2GBX B;  1S5A A;  3BLZ A;  5CXO A;  1ISK A;  3FGY A;  2B1X B;  4HM0 B;  4HM5 B;  2PZV A;  3NUV A;  1QJG A;  2Z7A A;  2BMO B;  3GZX B;  3MYT A;  5AIF A;  1W02 A;  1OGZ A;  5BVB A;  5DRE A;  3EF8 A;  5JPU A;  4X2H A;  3IPT A;  2I9W A;  2OWP A;  1GS3 A;  4R1K A;  4MJD A;  3JUM A;  1WQL B;  2W2C A;  3LZA A;  2XSO B;  1AR0 A;  3MHE A;  3UNL A;  2RFR A;  1OGX A;  3B4P A;  4L8P A;  1JB5 A;  3FZW A;  3FF0 A;  2QIY A;  3E99 A;  5IEO A;  3MKI A; 
#chains in the Genus database with same CATH topology
 4J5G A;  3AHW A;  1YVB I;  3I55 3;  3MG3 A;  1NB5 I;  1MGR A;  2YFJ B;  3CPW 2;  5AIH A;  1VQQ A;  2UX0 A;  4N3V A;  3V92 A;  2A15 A;  1STD A;  3SLU A;  2IY2 A;  3JUO A;  1N8Q A;  3DM8 A;  3KCH A;  1IYY A;  4HBR A;  4AKY A;  3LTB A;  4JF8 A;  3VF1 A;  3NV0 B;  4WYK B;  1EA2 A;  1B2S A;  3V98 A;  1JBS A;  8RNT A;  1T5Y A;  1JB2 A;  2BNG A;  2XGL A;  1BSE A;  2AAE A;  5G1L A;  5D81 A;  3A5E A;  3OWY A;  1NDO B;  3MG1 A;  3GSP A;  4RBN A;  2IUK A;  2KCD A;  2XR8 B;  4FMA A;  4HZB B;  1JB4 A;  1UW1 A;  4N6U A;  3GZR A;  5AIG A;  5ELU A;  4BU4 A;  3K63 A;  3VSY A;  3EC9 A;  6GSP A;  1Q40 B;  1V74 A;  1YI2 3;  1QVF 2;  2CW9 A;  4XBY A;  3OWS A;  2OTL 3;  1RN1 A;  3JVC A;  2JQ5 A;  4KT3 B;  1YJN 3;  2XFS A;  7STD A;  1N8R 4;  2W03 A;  3WHO A;  1BRH A;  1GMQ A;  1GYB A;  3D3L A;  1W6G A;  3GZY B;  3Q90 A;  2CKF B;  1GMP A;  3BIR A;  4FMC A;  1FUT A;  2W56 A;  3J7Y d;  2K3D A;  3I56 3;  1JZD A;  2HMN B;  1RSN A;  3WDG B;  1QMA A;  4J5K A;  3S5C A;  3X3Z A;  1VQ5 3;  1RGK A;  3T8U A;  1JN5 A;  2BMR B;  1BU4 A;  3F8X A;  3EN1 B;  1E3V A;  2HML B;  1BRK A;  3EHC A;  3EBT A;  2OQE A;  1MWU A;  3BU4 A;  1CH0 A;  3X3X A;  1NJI 4;  3NBB A;  1DMQ A;  4WFO A;  1GMR A;  4XBX A;  3SOA A;  1E97 A;  1N9J A;  2F56 A;  1G0T A;  3Q1C A;  1QAL A;  1BNR A;  3G16 A;  2BO9 B;  4OVM A;  3EBY A;  3GAX A;  1QAF A;  1B21 A;  2F5W A;  3HK4 A;  3WMD A;  2KRT A;  3D4A A;  1M90 4;  3BNB A;  1I70 A;  3N8B A;  5G1K A;  3ROB A;  3DUK A;  1T3B A;  3JUN A;  5AEU B;  2H0I A;  1YIT 3;  4ORL A;  5A0O B;  1DMM A;  1EG9 B;  2C4B A;  2JDI H;  2RGQ A;  1BSA A;  1VQ4 3;  1Q42 A;  3FKA A;  1LOX A;  3L0R A;  3CNX A;  2KF4 A;  2ML5 A;  4HM2 B;  1O7G B;  3M8C A;  2CG0 A;  1RDS A;  1N5H A;  2KF3 A;  2CX0 A;  3ER7 A;  3F40 A;  3PGB A;  3NXJ A;  3F7S A;  1VQO 3;  1D6Z A;  1ROA A;  2CK3 H;  1X1Y A;  4BL2 A;  4HM7 B;  1LQG C;  1GOU A;  5IG3 A;  1C54 A;  3HOH A;  3DGL A;  3A76 A;  3FH1 A;  2E2U A;  2ZL8 A;  4CDL A;  4NRE A;  5CK6 A;  5IW9 A;  4BTY A;  5LC7 A;  3LTD A;  2F99 A;  4HM4 B;  3CXC 2;  4BL3 A;  1KD1 4;  2GEY A;  1RJO A;  2XSH B;  1RGG A;  3N9H A;  5D82 A;  3X3Y A;  3G71 3;  3H51 A;  2OCT A;  3MPH A;  3PXM A;  1ZS7 A;  1AV4 A;  4GSP A;  4FCZ A;  4ILF A;  5HGR A;  1JKG B;  4EYC A;  2J8X B;  3CCE 3;  2CX1 A;  1TFO A;  2AAD A;  1F8N A;  1OCV A;  1SIH A;  1LNH A;  2D1W A;  3D9R A;  3DGY A;  3S27 A;  9RNT A;  1AVK A;  1VQ7 3;  1FA3 A;  1N9E A;  1JKG A;  2KF5 A;  2O9U X;  2CFW A;  2E2T A;  4XBT A;  1RN7 A;  4XB5 A;  3RGA A;  2OQE C;  5IEP A;  1YJW 3;  2F4Y A;  3GZB A;  3K7C A;  2P0X A;  2F5M A;  4HM3 B;  2W9P A;  1B2U A;  1IVW A;  2WO0 A;  3LT9 A;  2D42 A;  1RRL A;  1BNI A;  2HMM B;  2BT3 A;  1EUI C;  3CCR 3;  3STD A;  1CYV A;  1VZZ A;  3FG3 A;  3Q3F A;  5M19 A;  1RN4 A;  3EN8 A;  3WA2 X;  1A2K A;  2IA7 A;  1BUQ A;  2SAR A;  4HKV B;  5BXQ A;  3G8Z A;  4N6L A;  1BRJ A;  3B7C A;  2W9Q A;  1A90 A;  1JZO A;  2ML6 A;  1GY7 A;  1GD4 A;  1FUS A;  4DKI A;  2F86 B;  1T2H A;  3DZL A;  3ALA A;  2PNC A;  3CU3 A;  3KII A;  2BIR A;  4K61 A;  3N54 B;  1OF5 B;  5HOH A;  5AII A;  4LSO A;  1D6U A;  2MF7 A;  1IDP A;  1O7M B;  3CPO A;  3HZP A;  4H3U A;  1K73 4;  1NNV A;  1W2Z A;  3KN4 A;  1CEW I;  3QRD A;  1SAR A;  1JNQ A;  2H0G A;  1LQM B;  1OH0 A;  2P38 A;  1OPY A;  3B8L A;  2XH9 A;  1UGI A;  3HII A;  4LGQ A;  4TX4 A;  5AI1 A;  1DVD A;  1TFK A;  3SYU A;  3ECF A;  5CF1 A;  4XDV A;  1I8V A;  1FGO A;  4EXR A;  4MMX B;  1O7N B;  1AY7 A;  1B27 A;  1FZU A;  4RNT A;  1IVU A;  3KSE D;  2CHC A;  3T8N A;  3ZG0 A;  1BRN L;  1SII A;  3DGN A;  4L7K A;  1TRP A;  1VQ6 3;  4I5Q A;  3AHS A;  4HOH A;  3SED A;  3TDG A;  4U13 A;  2F98 A;  2GBW B;  3NV0 A;  1KWI A;  1W4N A;  3OWU A;  4LYL B;  4WYK A;  2OTJ 3;  4N6T A;  3PZW A;  2ZA4 A;  5M18 A;  3I0Y A;  1BNE A;  3X40 A;  2SBL A;  3NBR A;  2GU3 A;  4OK0 A;  1YVS A;  1A2V A;  1NU3 A;  4KVH A;  3GRD A;  3PCS A;  3CCQ 3;  3OV4 A;  4XM4 A;  1O7H B;  3CCJ 3;  2R41 A;  2HMK B;  4HYZ A;  1HKX A;  4JRF A;  1W01 A;  4IPB A;  4R80 A;  1SJW A;  1Q40 A;  1Z1S A;  4FMD A;  1I0X A;  4STD A;  3MSO A;  2OOV A;  1GY6 A;  3PYJ A;  1DMN A;  2CWV A;  4WWU C;  1E3R A;  1IV9 A;  4K90 B;  1RCL A;  5IF6 A;  1RGH A;  4HZ9 B;  3BB9 A;  5ELJ A;  1UI8 A;  1MOL A;  3FCS B;  1M1X B;  4AEQ A;  1BVI A;  2XRX B;  1IQX A;  1BNF A;  4K1U A;  2Q07 A;  1RRH A;  3CC2 3;  1IV7 A;  1FGT A;  5EQL A;  3OX9 A;  3FLJ A;  2KAA A;  5JPP A;  1Q7H A;  2BMQ B;  2FGT A;  1M1K 4;  1YIJ 3;  1UCJ A;  3G0K A;  2STD A;  2WGQ A;  2BU4 A;  1TUH A;  1VQL 3;  3EB8 A;  5RNT A;  1JJ2 2;  2Z6B A;  4LEH A;  4MEI A;  1LOV A;  3T0U A;  1RKY A;  2UUG C;  3IMA B;  3LTC A;  5LC6 A;  3AMO B;  1RMS A;  6RNT A;  1C7H A;  5CF2 A;  3RNT A;  2P0M A;  1ZX2 A;  2KF6 A;  1UUG B;  2FNQ A;  2QEX 3;  1AVL A;  3CC7 3;  1U5O A;  2H0H A;  1UGH I;  4J9A A;  5G2G A;  4FMB A;  3WR2 A;  4FR9 A;  3NQZ A;  1VQP 3;  3IJE B;  1W6Y A;  3BND A;  1CQS A;  3HI7 A;  4QWT A;  1IT8 A;  4R9L A;  2XGN A;  2RNT A;  1UCI A;  2L4V A;  4EV5 A;  1S72 3;  3KE7 A;  1IU7 A;  3FSD A;  1PFP A;  1WMN A;  3MG2 A;  3OXA A;  5DRV A;  4N6O B;  5CLK A;  2QA4 3;  1JRQ A;  3KZT A;  4FCJ A;  3Q2P A;  5BIR A;  1I2F A;  2QGU A;  4G1M B;  4WP5 A;  5KP4 A;  1G96 A;  1ULJ B;  2OOV C;  4I4K A;  2CWT A;  4IIA A;  1PYL A;  3DGM A;  1YGW A;  4RZM A;  6STD A;  1UCK A;  3GWR A;  1ULI B;  3S28 A;  5IG5 A;  1V58 A;  1A67 A;  1GOV A;  2L1S A;  3U1W A;  1QAK A;  1UUV B;  3EQQ B;  1NB3 I;  4OUQ A;  2R4I A;  3D5I A;  1BNG A;  2E2V A;  1K8A 4;  2HMJ B;  1BAO A;  4Q53 A;  2V1L A;  5AYR B;  1Q82 4;  1ROV A;  1RHL A;  2INX A;  4ZM8 A;  2YFI B;  1FGM A;  1GSP A;  4GHO A;  4HM8 B;  5IER A;  1BSD A;  3D79 A;  2GXF A;  1LOW A;  4NPB A;  1B2Z A;  2GSP A;  1V57 A;  2ZDJ A;  1WMO A;  1JV2 B;  2IUJ A;  1BOX A;  4WHA A;  3K0Z A;  2GU1 A;  4O02 B;  4K1V A;  1NWW A;  5TGN A;  2C11 A;  1RGF A;  2XFT A;  5KP3 A;  3PS8 A;  2XF3 A;  3CNM A;  1N5P A;  5D83 A;  2UGI A;  1SPU A;  5STD A;  2MC8 A;  3RDE A;  2Z76 A;  4CPK A;  4EC6 A;  5JBS A;  4KFF A;  1CYU A;  4HM6 B;  2B24 B;  1OF5 A;  4IT7 A;  2CH9 A;  1K9M 4;  3H3H A;  3DMC A;  1D6Y A;  3ZG5 A;  4R9K A;  3CME 3;  1RGL A;  1BNS A;  1RNB A;  1MWT A;  1B20 A;  1BRI A;  4NHF A;  1J2B A;  1Q9E A;  3UJM A;  2CFK A;  1QVG 2;  1MWS A;  3KKG A;  3JUQ A;  4R4K A;  3UL6 A;  3X41 A;  2RBI A;  2XEP A;  4N6N B;  3ZFZ A;  1ZO2 A;  3LYG A;  3CCS 3;  3AGN A;  1IQY A;  3F7X A;  1OHO A;  1JBT A;  3KFQ C;  3NHX A;  3LH4 A;  4L8O A;  1W2B 2;  3F9S A;  3SVA A;  3O8Y A;  1GY5 A;  1BSB A;  1ASK A;  1W00 A;  8CHO A;  1YHQ 3;  3NBJ A;  3B4O A;  1FUW A;  1PY3 A;  3BNC A;  1RNT A;  4HJL B;  2GEX A;  5EVH A;  3NQY A;  1FGQ A;  4GL6 A;  1TP6 A;  3SXX A;  1Y4K A;  5EEO A;  5IEN A;  3FG4 A;  1WMP A;  1UI7 A;  1VQK 3;  1DE3 A;  4EBG A;  2P05 A;  2HOH A;  3EJV A;  2YX9 A;  1BNJ A;  4EV2 A;  1X1W A;  3F14 A;  1YJ9 3;  1HYF A;  1DVC A;  2WGO A;  5AYS C;  3HIG A;  1A2P A;  2HMO B;  4HVN A;  3KSP A;  3UB1 A;  1LNI A;  2LQV A;  1RTU A;  2K54 A;  3MWZ A;  1FW7 A;  1T2I A;  3VGN A;  1W7C A;  3G4S 3;  1JBR A;  1I2G A;  3HX8 A;  5GSP A;  1I3I A;  4AKZ A;  4FCM A;  3UL5 A;  4MMY B;  3EE1 A;  3WOD G;  4BIR A;  3AGO A;  1WNH A;  1YNV X;  1I2E A;  2Z77 A;  1TJD A;  4N6M A;  2RCD A;  1MWR A;  1R4Y A;  1LRA A;  3EX9 A;  1FGR A;  3WOF B;  3FG1 A;  4XDW A;  1TU5 A;  1AQZ A;  3CC4 3;  3F8H A;  2W56 B;  3RGR A;  2C10 A;  3DGO A;  5FW5 A;  2CFD A;  4LMI A;  5KP1 A;  2YFL B;  3CMA 3;  1YGE A;  4RNZ A;  3CCL 3;  1JN5 B;  3DXO A;  2WOF A;  4HM1 B;  4HAA A;  1BIR A;  4CCV A;  1K41 A;  3WOE B;  1OHP A;  3FF2 A;  3AMO A;  1WTH A;  1I0V A;  1UUW B;  2CG1 A;  1IT7 A;  4O2H A;  4RNY A;  4J8T A;  3X42 A;  1HZ1 A;  4KFE A;  3LML A;  1K28 A;  1BRS A;  5AEW B;  1OUN A;  1HU9 A;  1B3S A;  1IQ8 A;  1O7W B;  2O3O A;  1KQS 2;  2W6J H;  3JUP A;  4X2O A;  1MNL A;  3G6E 3;  1RGC A;  1LVN A;  1R4C A;  4PEJ A;  1OHS A;  2FXT A;  7GSP A;  3LTA A;  1BGS A;  2IMJ A;  5IG0 A;  5FGO A;  3V99 A;  3NM2 A;  1W6C A;  1L5G B;  5IG4 A;  3CCU 3;  1ZGX A;  1O7P B;  2WOH A;  1B2X A;  1VQ9 3;  1X1X A;  4GB5 A;  3NM7 A;  1KSI A;  3URP A;  3SOY A;  1B2M A;  2KXG A;  4H61 A;  1KC8 4;  1BAN A;  1MGW A;  3SX1 A;  2GBX B;  2RSX A;  2P09 A;  1S5A A;  3BLZ A;  5CXO A;  1U8C B;  1ISK A;  1UCL A;  1RLS A;  1W5Z A;  2B1X B;  2W04 A;  3FGY A;  4HM0 B;  3CD6 3;  3LXU X;  4HM5 B;  2PZV A;  5M1A A;  3WA3 A;  4EW5 A;  1US1 A;  4O3V A;  1GOY A;  2IYJ A;  3NUV A;  3PCR A;  1QJG A;  3U97 A;  4BTW A;  4KZ1 A;  3NX0 A;  2Z7A A;  2CWU A;  2BHM A;  1IVV A;  3DH2 A;  2BMO B;  3GZX B;  1GD3 A;  3MYT A;  5AIF A;  3S67 A;  1M9G A;  4MMZ B;  1RGE A;  2K0M A;  1NO3 A;  1W02 A;  1EKM A;  1OGZ A;  1UDI I;  5BVB A;  5DRE A;  7RNT A;  3QK9 A;  1TTO A;  2ZHX B;  3EF8 A;  5BU4 A;  5JPU A;  1EQK A;  1VQM 3;  1TRQ A;  1I3F A;  4X2H A;  4CJN A;  4N6V 0;  2CFG A;  2Y74 A;  1FYS A;  1DYU A;  4KFD A;  1BRG A;  2Y73 A;  1RCK A;  1RGA A;  3IPT A;  2I9W A;  2OWP A;  1Q81 4;  4O8S A;  3OW2 2;  1GS3 A;  2M7O A;  4R1K A;  3K9M C;  1BUJ A;  4MJD A;  4BTX A;  1PU4 A;  1G02 A;  4LZI A;  1TIJ A;  2W0Q A;  3JUM A;  3LOY A;  1WQL B;  1IK3 A;  2W2C A;  3LZA A;  1IVX A;  3D5G A;  3LT8 A;  2XSO B;  1AR0 A;  2LYX A;  3MHE A;  3UNL A;  2RFR A;  5I97 A;  1LOY A;  3CCM 3;  1OAC A;  3BNE A;  3S29 A;  1X1U A;  1SQW A;  1Q86 4;  1OGX A;  3B4P A;  1EEJ A;  3DY5 A;  4L8P A;  1BSC A;  1JB5 A;  1VQ8 3;  1DET A;  2CIU A;  3FZW A;  2CC3 A;  1VQN 3;  2CFL A;  3K5T A;  3FF0 A;  2QIY A;  3E99 A;  1LXE A;  5IEO A;  3MKI A;  3CCV 3;  1Q7Y 4;  1STF I; 
#chains in the Genus database with same CATH homology
 1YVB I;  3I55 3;  3MG3 A;  1NB5 I;  2YFJ B;  3CPW 2;  5AIH A;  2UX0 A;  4N3V A;  3V92 A;  2A15 A;  1STD A;  3SLU A;  3JUO A;  1N8Q A;  3DM8 A;  4HBR A;  4AKY A;  3LTB A;  4JF8 A;  3VF1 A;  3NV0 B;  4WYK B;  1EA2 A;  3V98 A;  1T5Y A;  1JB2 A;  2BNG A;  2XGL A;  5D81 A;  3OWY A;  1NDO B;  3MG1 A;  4RBN A;  2IUK A;  2KCD A;  2XR8 B;  4FMA A;  4HZB B;  1JB4 A;  1UW1 A;  4N6U A;  3GZR A;  5AIG A;  5ELU A;  3K63 A;  3VSY A;  3EC9 A;  1QVF 2;  1Q40 B;  1V74 A;  1YI2 3;  2CW9 A;  4XBY A;  3OWS A;  2OTL 3;  3JVC A;  1YJN 3;  2JQ5 A;  1N8R 4;  2XFS A;  7STD A;  2W03 A;  1GYB A;  3D3L A;  1W6G A;  3GZY B;  3Q90 A;  2CKF B;  4FMC A;  2W56 A;  3J7Y d;  3I56 3;  2HMN B;  3WDG B;  1QMA A;  3S5C A;  1VQ5 3;  3X3Z A;  3T8U A;  1JN5 A;  2BMR B;  3F8X A;  3EN1 B;  1E3V A;  2HML B;  3EHC A;  2OQE A;  3EBT A;  3X3X A;  1NJI 4;  3NBB A;  1DMQ A;  4WFO A;  4XBX A;  3SOA A;  1E97 A;  1N9J A;  3Q1C A;  1QAL A;  3G16 A;  2BO9 B;  4OVM A;  3EBY A;  3GAX A;  1QAF A;  3HK4 A;  3WMD A;  1M90 4;  2KRT A;  3BNB A;  3N8B A;  3ROB A;  3DUK A;  3JUN A;  5AEU B;  1YIT 3;  4ORL A;  5A0O B;  1DMM A;  1EG9 B;  2JDI H;  2RGQ A;  1VQ4 3;  1Q42 A;  3FKA A;  1LOX A;  3L0R A;  3CNX A;  2ML5 A;  4HM2 B;  1O7G B;  3M8C A;  2CG0 A;  3ER7 A;  1N5H A;  3F40 A;  3PGB A;  3NXJ A;  3F7S A;  1VQO 3;  1D6Z A;  1ROA A;  2CK3 H;  4HM7 B;  5IG3 A;  3DGL A;  3A76 A;  3FH1 A;  2E2U A;  2ZL8 A;  4CDL A;  4NRE A;  5CK6 A;  5IW9 A;  4BTY A;  5LC7 A;  3LTD A;  2F99 A;  4HM4 B;  3CXC 2;  1KD1 4;  2GEY A;  1RJO A;  2XSH B;  3N9H A;  5D82 A;  3X3Y A;  3G71 3;  3H51 A;  2OCT A;  3MPH A;  3PXM A;  1AV4 A;  4FCZ A;  5HGR A;  1JKG B;  4EYC A;  3CCE 3;  1TFO A;  2D1W A;  1F8N A;  1OCV A;  1SIH A;  1LNH A;  3D9R A;  3CCM 3;  3S27 A;  1VQ7 3;  2OTJ 3;  1AVK A;  1FA3 A;  1N9E A;  2O9U X;  1JKG A;  3RGA A;  2CFW A;  2E2T A;  4XBT A;  1RN7 A;  4XB5 A;  5IEP A;  2OQE C;  1YJW 3;  3K7C A;  3GZB A;  2P0X A;  4HM3 B;  2W9P A;  1IVW A;  2WO0 A;  3LT9 A;  2D42 A;  1RRL A;  2HMM B;  2BT3 A;  3CCR 3;  3STD A;  1CYV A;  1VZZ A;  3FG3 A;  3EN8 A;  3WA2 X;  1A2K A;  2IA7 A;  1BUQ A;  4HKV B;  5BXQ A;  3G8Z A;  4N6L A;  3B7C A;  2W9Q A;  1A90 A;  2ML6 A;  1GY7 A;  1GD4 A;  2F86 B;  3DZL A;  3ALA A;  2PNC A;  3CU3 A;  3KII A;  4K61 A;  3N54 B;  1OF5 B;  5AII A;  4LSO A;  1D6U A;  2MF7 A;  1IDP A;  1O7M B;  3CPO A;  3HZP A;  4H3U A;  1K73 4;  1W2Z A;  3KN4 A;  1CEW I;  3QRD A;  1JNQ A;  1OH0 A;  2P38 A;  1OPY A;  3B8L A;  2XH9 A;  4LGQ A;  3HII A;  4TX4 A;  5AI1 A;  1DVD A;  1TFK A;  3ECF A;  5CF1 A;  4XDV A;  4EXR A;  1FGO A;  4MMX B;  1O7N B;  1IVU A;  3KSE D;  2CHC A;  3T8N A;  1SII A;  3DGN A;  4L7K A;  1VQ6 3;  3TDG A;  3SED A;  4U13 A;  2F98 A;  2GBW B;  3NV0 A;  1KWI A;  1W4N A;  3OWU A;  4WYK A;  4N6T A;  3PZW A;  3I0Y A;  3X40 A;  2SBL A;  3NBR A;  2GU3 A;  4OK0 A;  1A2V A;  1NU3 A;  4KVH A;  3GRD A;  3PCS A;  3CCQ 3;  3OV4 A;  4XM4 A;  1O7H B;  3CCJ 3;  2HMK B;  4HYZ A;  1HKX A;  4JRF A;  1W01 A;  4IPB A;  4R80 A;  1SJW A;  1Q40 A;  1Z1S A;  4FMD A;  4STD A;  3MSO A;  2OOV A;  1GY6 A;  3PYJ A;  1DMN A;  2CWV A;  4WWU C;  1E3R A;  1IV9 A;  4K90 B;  5IF6 A;  4HZ9 B;  3BB9 A;  5ELJ A;  1UI8 A;  1MOL A;  3FCS B;  1M1X B;  4AEQ A;  2XRX B;  1IQX A;  4K1U A;  2Q07 A;  1RRH A;  3CC2 3;  1IV7 A;  1FGT A;  5EQL A;  3OX9 A;  3FLJ A;  5JPP A;  1M1K 4;  2BMQ B;  2FGT A;  1YIJ 3;  3G0K A;  2STD A;  2WGQ A;  1VQL 3;  1TUH A;  3EB8 A;  1JJ2 2;  2Z6B A;  4LEH A;  4MEI A;  3T0U A;  1RKY A;  3IMA B;  3LTC A;  5LC6 A;  3AMO B;  1C7H A;  5CF2 A;  2P0M A;  1ZX2 A;  2FNQ A;  2QEX 3;  1AVL A;  3CC7 3;  1U5O A;  4J9A A;  5G2G A;  4FMB A;  4FR9 A;  3NQZ A;  1VQP 3;  3IJE B;  1W6Y A;  3BND A;  1CQS A;  3HI7 A;  4QWT A;  1IT8 A;  4R9L A;  2XGN A;  2L4V A;  4EV5 A;  1S72 3;  3KE7 A;  1IU7 A;  3FSD A;  1PFP A;  1WMN A;  3MG2 A;  3OXA A;  5DRV A;  4N6O B;  5CLK A;  2QA4 3;  1JRQ A;  3KZT A;  4FCJ A;  3Q2P A;  2QGU A;  4G1M B;  4WP5 A;  5KP4 A;  1G96 A;  1ULJ B;  2OOV C;  4I4K A;  2CWT A;  4IIA A;  3DGM A;  4RZM A;  6STD A;  3GWR A;  1ULI B;  3S28 A;  5IG5 A;  1A67 A;  3U1W A;  1QAK A;  1UUV B;  3EQQ B;  1NB3 I;  4OUQ A;  2R4I A;  2E2V A;  1K8A 4;  2HMJ B;  4Q53 A;  2V1L A;  5AYR B;  1Q82 4;  1ROV A;  2INX A;  4ZM8 A;  2YFI B;  1FGM A;  4HM8 B;  5IER A;  2GXF A;  2ZDJ A;  1WMO A;  1JV2 B;  2IUJ A;  4WHA A;  3K0Z A;  2GU1 A;  4O02 B;  4K1V A;  1NWW A;  5TGN A;  2C11 A;  2XFT A;  5KP3 A;  3PS8 A;  2XF3 A;  3CNM A;  1N5P A;  5D83 A;  5STD A;  1SPU A;  2MC8 A;  3RDE A;  4EC6 A;  2Z76 A;  5JBS A;  4KFF A;  1CYU A;  4HM6 B;  2B24 B;  1OF5 A;  4IT7 A;  2CH9 A;  1K9M 4;  3H3H A;  3DMC A;  1D6Y A;  4R9K A;  3CME 3;  4NHF A;  1J2B A;  3UJM A;  2CFK A;  1QVG 2;  3KKG A;  3JUQ A;  4R4K A;  3UL6 A;  3X41 A;  4N6N B;  2XEP A;  3CCS 3;  1ZO2 A;  3LYG A;  1IQY A;  3F7X A;  1OHO A;  3KFQ C;  3NHX A;  3LH4 A;  4L8O A;  1W2B 2;  3F9S A;  3SVA A;  3O8Y A;  1GY5 A;  8CHO A;  1ASK A;  1W00 A;  1YHQ 3;  3NBJ A;  3B4O A;  1FUW A;  3BNC A;  4HJL B;  2GEX A;  5EVH A;  3NQY A;  1FGQ A;  4GL6 A;  1TP6 A;  3SXX A;  1Y4K A;  5EEO A;  5IEN A;  3FG4 A;  1WMP A;  1UI7 A;  1VQK 3;  4EBG A;  2P05 A;  3EJV A;  2YX9 A;  4EV2 A;  3F14 A;  1YJ9 3;  1DVC A;  2WGO A;  5AYS C;  3HIG A;  2HMO B;  4HVN A;  3KSP A;  3UB1 A;  3MWZ A;  2LQV A;  2K54 A;  3VGN A;  1W7C A;  3G4S 3;  3HX8 A;  4AKZ A;  4FCM A;  3UL5 A;  4MMY B;  3EE1 A;  3WOD G;  1WNH A;  2Z77 A;  4N6M A;  2RCD A;  3EX9 A;  1FGR A;  3WOF B;  3FG1 A;  4XDW A;  1TU5 A;  3CC4 3;  3F8H A;  2W56 B;  3RGR A;  2C10 A;  3DGO A;  5FW5 A;  2CFD A;  4LMI A;  5KP1 A;  2YFL B;  3CMA 3;  1YGE A;  4RNZ A;  3CCL 3;  1JN5 B;  3DXO A;  2WOF A;  4HM1 B;  4CCV A;  1K41 A;  3WOE B;  1OHP A;  3FF2 A;  3AMO A;  1WTH A;  1UUW B;  2CG1 A;  1IT7 A;  4O2H A;  4RNY A;  4J8T A;  3X42 A;  4KFE A;  3LML A;  1K28 A;  5AEW B;  1OUN A;  1HU9 A;  1IQ8 A;  1O7W B;  2O3O A;  1KQS 2;  2W6J H;  3JUP A;  4X2O A;  1MNL A;  3G6E 3;  1LVN A;  1R4C A;  4PEJ A;  1OHS A;  2FXT A;  3LTA A;  2IMJ A;  5IG0 A;  5FGO A;  3V99 A;  3NM2 A;  1W6C A;  1L5G B;  5IG4 A;  3CCU 3;  1VQ9 3;  1O7P B;  2WOH A;  4GB5 A;  3NM7 A;  1KSI A;  3SOY A;  2KXG A;  4H61 A;  1KC8 4;  3SX1 A;  2GBX B;  2RSX A;  2P09 A;  1S5A A;  3BLZ A;  5CXO A;  1U8C B;  1ISK A;  3FGY A;  1W5Z A;  2B1X B;  2W04 A;  4HM0 B;  3CD6 3;  3LXU X;  4HM5 B;  2PZV A;  3WA3 A;  1US1 A;  4O3V A;  3U97 A;  3NUV A;  3PCR A;  1QJG A;  4BTW A;  4KZ1 A;  3NX0 A;  2Z7A A;  2CWU A;  2BHM A;  1IVV A;  2BMO B;  3GZX B;  1GD3 A;  3MYT A;  5AIF A;  3S67 A;  1M9G A;  4MMZ B;  2K0M A;  1NO3 A;  1W02 A;  1EKM A;  1OGZ A;  5BVB A;  5DRE A;  1EQK A;  3QK9 A;  3EF8 A;  5JPU A;  1VQM 3;  4X2H A;  4N6V 0;  2CFG A;  2Y74 A;  4KFD A;  1DYU A;  2Y73 A;  3IPT A;  2I9W A;  2OWP A;  1Q81 4;  4O8S A;  3OW2 2;  1GS3 A;  2M7O A;  4R1K A;  3K9M C;  4MJD A;  4BTX A;  1PU4 A;  4LZI A;  1TIJ A;  2W0Q A;  3JUM A;  3LOY A;  1WQL B;  1IK3 A;  2W2C A;  3LZA A;  1IVX A;  3LT8 A;  2XSO B;  1AR0 A;  2LYX A;  3MHE A;  3UNL A;  2RFR A;  5I97 A;  1OAC A;  3BNE A;  3S29 A;  1Q86 4;  1SQW A;  1OGX A;  3B4P A;  3DY5 A;  4L8P A;  1JB5 A;  1VQ8 3;  2CIU A;  3FZW A;  2CC3 A;  1VQN 3;  2CFL A;  3K5T A;  3FF0 A;  2QIY A;  3E99 A;  1LXE A;  5IEO A;  3MKI A;  3CCV 3;  1Q7Y 4;  1STF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...