7STDA

Scytalone dehydratase plus inhibitor 4
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
molecule keywords Scytalone dehydratase
total genus 49
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 7stdA00
3H3HA 2XRXB 3Q90A 4HM6B 4Q53A 4X2HA 3OXAA 3FH1A 3K0ZA 3B8LA 4ORLA 3F8HA 2XR8B 2YFJB 3FF2A 4K1UA 1BUQA 4HM7B 4FCMA 2Z7AA 5AEWB 2F99A 1O7WB 1ULIB 2YFLB 1S5AA 1AR0A 2F86B 5CLKA 5HGRA 2CKFB 1W6YA 3NXJA 1HKXA 5IENA 3VGNA 1Q40A 3F40A 1Z1SA 3FKAA 4X2OA 1QMAA 4HZBB 1DMNA 3GZBA 5BVBA 1JN5B 2BMQB 2Z76A 3FF0A 2HMMB 3FLJA 3KE7A 1EG9B 3JUMA 4IIAA 2R4IA 2HMJB 3KZTA 4MJDA 5IG0A 2HMLB 3ROBA 1GY7A 4RZMA 3WMDA 4WWUC 1Q42A 1OPYA 1O7GB 1JB4A 1OCVA 1E97A 3FGYA 3DXOA 2B1XB 4KVHA 1O7PB 3IPTA 3SOYA 5CF1A 3GWRA 5AIIA 1UUVB 5AI1A 3MG2A 1E3VA 3B4OA 3UNLA 1OF5A 1E3RA 3CU3A 3EJVA 1DMQA 4U13A 2XSHB 3MSOA 4J8TA 1IDPA 1ZO2A 3SOAA 3OWUA 3BLZA 3JUPA 3JUQA 3BB9A 3CNXA 5STDA 3K7CA 3LZAA 3SEDA 1O7NB 3B4PA 3FSDA 3HZPA 3EF8A 3EN8A 1JN5A 3KSPA 5IG4A 1ASKA 2INXA 3NV0A 3DZLA 3MYTA 5JPUA 4J9AA 4R9KA 3I0YA 2YFIB 3M8CA 3LYGA 1WQLB 3NUVA 3OWSA 1W01A 2GEXA 2HMKB 1CQSA 4L8PA 4XM4A 5JPPA 1U5OA 4XDWA 2GEYA 5IF6A 1OHSA 3MHEA 3ECFA 4HM1B 5IEOA 5CK6A 4HVNA 4H3UA 1OF5B 5BXQA 3CNMA 4WYKA 3EN1B 1C7HA 5D83A 8CHOA 2A15A 3DMCA 2BNGA 1GYBA 3JUNA 3G8ZA 3OX9A 2BMRB 5KP4A 1NU3A 3T8UA 1NDOB 3EX9A 4HM0B 4I4KA 3UJMA 3EBYA 1QJGA 5G2GA 4R9LA 4HJLB 3NM2A 1O7MB 2XSOB 3NV0B 4HKVB 4HZ9B 3FZWA 4K1VA 2W2CA 2RCDA 5D81A 5D82A 3STDA 5CXOA 3GZXB 3F14A 2RFRA 1EA2A 2CHCA 1NWWA 3NHXA 5IERA 3MKIA 1SJWA 3DUKA 1K41A 5KP3A 2B24B 1JB5A 3JUOA 1ULJB 4GB5A 2HMNB 3G16A 5AIGA 1JB2A 2K54A 3EHCA 4L7KA 1TP6A 2IMJA 2GBWB 4FCJA 4WYKB 3OV4A 5AEUB 4HM4B 3T8NA 5IEPA 3GZYB 2STDA 3ER7A 1STDA 2GXFA 3A76A 3F7XA 4XDVA 2BMOB 3B7CA 2GBXB 3EC9A 3E99A 3GZRA 3CPOA 5EVHA 5TGNA 5IG5A 6STDA 1JKGA 1VZZA 3RGAA 2Z77A 1ZX2A 1TUHA 3GRDA 3MG3A 1ISKA 4XBYA 4PEJA 4STDA 3D9RA 5AIHA 3RGRA 2QIYA 7STDA 4OVMA 4XBXA 1OHPA 1OUNA 3EBTA 3KKGA 1OH0A 4HM3B 4HM8B 4LMIA 5AIFA 2I9WA 1W02A 3H51A 3HX8A 2HMOB 4LGQA 4N3VA 1O7HB 3F7SA 4OUQA 4HM5B 4LEHA 5IG3A 3OWYA 2F98A 3DM8A 5DRVA 3F9SA 2JQ5A 3G0KA 1OGZA 3HK4A 5DREA 1GY6A 4HM2B 4XBTA 5KP1A 3MG1A 2PZVA 4L8OA 4R1KA 5CF2A 1GY5A 4XB5A 1Q40B 1W00A 1OHOA 2QGUA 3NBRA 3VSYA 1UUWB 1DMMA 1JKGB 1OGXA 2OWPA 2RGQA 4CDLA 3EQQB 1A2KA 3S5CA 4WP5A 5FW5A 3F8XA 2UX0A 1GS3A
chains in the Genus database with same CATH superfamily
5AYSC 1G0TA 1JBSA 3FH1A 1TRPA 4RBNA 3FG1A 2C11A 1IT8A 2LQVA 2XR8B 2YFJB 3F8HA 4K1UA 5ELJA 1SARA 3CC73 4O3VA 4HAAA 1N5PA 2P0XA 1S5AA 1AR0A 5CLKA 1AQZA 1YNVX 2CFDA 1B2ZA 1CEWI 2LYXA 5IENA 5ELUA 1V74A 3WOFB 2XGNA 4N6TA 1FGQA 3CC43 1FZUA 7GSPA 1DMNA 3GZBA 1JJ22 3S29A 3AHWA 3EE1A 2HMJB 1EUIC 3KZTA 4MEIA 1WMPA 3LXUX 4NREA 1BRGA 1O7GB 1RKYA 3CPW2 1YIT3 1V58A 1Q814 5HOHA 1GMQA 4KFDA 4FMBA 3U97A 3NM7A 1UUVB 1RJOA 3S27A 1K9M4 1HYFA 2GU3A 1W2ZA 2Y73A 3B4OA 1E3RA 1DE3A 2P38A 4MMYB 1DMQA 1SIHA 3MSOA 1IDPA 3SOAA 1NNVA 2CWVA 3CNXA 1IVXA 1UCLA 3K7CA 3LZAA 2W04A 3EF8A 3EN8A 3LTCA 1MWUA 3GSPA 3NV0A 1FUTA 1Y4KA 3DZLA 4BL2A 3CCV3 1YI23 1RN1A 1I3IA 3MYTA 1T3BA 3X3ZA 2F4YA 3DGNA 4J9AA 4R9KA 1GOYA 3X3YA 4WWUC 1FGRA 3DY5A 3LYGA 1B27A 3NUVA 2H0HA 1KC84 4XDWA 2GEYA 3WR2A 1WTHA 5CK6A 1IQYA 8CHOA 1B21A 1F8NA 2A15A 2BNGA 2E2TA 3DMCA 1LXEA 5G1KA 2ZHXB 3WHOA 4BTWA 2BMRB 3PCSA 4WHAA 1NDOB 1D6ZA 1RRHA 1TTOA 3PYJA 3UJMA 3EBYA 4N6UA 3WA3A 2OQEC 5GSPA 4EBGA 3PGBA 2CG1A 1BRKA 4K1VA 5BU4A 2W03A 4I5QA 1FUWA 3GZXB 1BANA 2H0GA 1RGKA 3G4S3 2FGTA 1KSIA 2W9PA 2FNQA 1K41A 2UGIA 1TJDA 2B24B 5LC7A 1N9EA 4GB5A 1QVF2 1VQ43 1I2EA 1LNIA 1GD3A 3LH4A 3EHCA 3NBJA 1I0XA 4WYKB 3J7Yd 2CFKA 3T0UA 1UI7A 1BUJA 1STDA 4XDVA 1MWSA 2BMOB 3AMOB 3DGYA 3L0RA 3CPOA 1LOVA 1RGAA 2IA7A 1MGRA 3MG3A 3X3XA 2KXGA 2RBIA 4XBYA 1IK3A 1BNSA 1OUNA 2XF3A 5I97A 3WMDA 3H51A 4N3VA 1IU7A 3HX8A 1O7HB 3F7SA 1BSDA 4LEHA 3LTBA 1BRIA 1B2XA 3F9SA 3G0KA 1IQ8A 1IVVA 1JRQA 1NO3A 3HK4A 8RNTA 1RGLA 2XEPA 4JRFA 4XBTA 2F5MA 3BU4A 3MPHA 4N6V0 3UL5A 4L8OA 1TIJA 1BNRA 3CMA3 3ALAA 1DYUA 1UGHI 2GU1A 3VSYA 3NQZA 1Q9EA 4FMCA 4CDLA 5FW5A 6GSPA 4X2HA 4ORLA 3CD63 3WOEB 3SLUA 5A0OB 4HM7B 1JBTA 4ILFA 2D42A 3CCS3 1YJW3 1M1XB 2L4VA 2YFLB 2F86B 4IT7A 3V92A 3A5EA 5HGRA 2W56B 5EQLA 1YGWA 1W6YA 3HOHA 3VGNA 3FKAA 2HOHA 1WNHA 1RHLA 2BMQB 2Z76A 3FF0A 3FLJA 5IG0A 1M1K4 1VQL3 3JUMA 5JBSA 2R4IA 3CCR3 3ROBA 1JNQA 1I2GA 3K5TA 1L5GB 1OPYA 2IUKA 3NQYA 1OCVA 4KVHA 1RGEA 2B1XB 3V99A 1O7PB 5CF1A 1BU4A 2P09A 3SXXA 1TFKA 3JVCA 2CG0A 5AI1A 3MG2A 1E3VA 4HOHA 4RNZA 3JUPA 4AKZA 1QVG2 1BNGA 3B4PA 3KSPA 1KQS2 4FMDA 4HYZA 1UUGB 1MWTA 5IW9A 3WDGB 1VQQA 2RNTA 1YVBI 5JPUA 1YVSA 2YFIB 1WQLB 3HI7A 4L8PA 1UCJA 1W01A 2HMKB 4XM4A 2H0IA 1FGMA 1U5OA 2W6JH 1LOWA 3MWZA 2ZDJA 3ECFA 4HM1B 5IEOA 1OF5B 1I0VA 1MGWA 3CNMA 3EN1B 2CX1A 3JUNA 1GYBA 3NX0A 3QRDA 2XGLA 1BNJA 2RSXA 5KP4A 1NU3A 3T8UA 3EX9A 3CCU3 2OTL3 3ZG5A 2ZA4A 3KN4A 4LYLB 2M7OA 4EV5A 1O7MB 2E2VA 1HU9A 1RTUA 3WODG 5D82A 2RCDA 2OQEA 2C10A 5CXOA 3NHXA 1C54A 1EA2A 1NWWA 1W6CA 3Q3FA 3BNEA 1IV9A 3CCL3 3AHSA 1SJWA 3CME3 3AGOA 2W9QA 1TFOA 4K90B 2CWUA 4BTXA 2CH9A 3LTDA 1BGSA 3V98A 2SARA 3AGNA 4GL6A 4HM4B 1LRAA 3D5IA 1YJN3 1NB5I 3ER7A 1X1WA 2GXFA 3B7CA 1B3SA 5M19A 1A90A 2GBXB 1RGCA 5EVHA 1N5HA 6STDA 1VZZA 3URPA 3RGAA 1TUHA 1B20A 4STDA 3D9RA 2QIYA 4RNYA 3CCJ3 1OHPA 4HM3B 4HM8B 5G2GA 4BIRA 2I9WA 5DRVA 1FGTA 2P0MA 3OWYA 1UW1A 1K28A 4OK0A 3DM8A 1RNTA 2WO0A 4HM2B 1BSEA 1D6UA 5KP1A 1KD14 5RNTA 4AKYA 5CF2A 1GSPA 4KZ1A 1BNIA 1PY3A 3BIRA 3NBRA 4XB5A 1B2MA 3KIIA 1RDSA 1UUWB 2GSPA 4BU4A 1RCLA 2D1WA 3EQQB 3S5CA 4CJNA 4G1MB 1T5YA 1GS3A 4HM6B 3OXAA 3B8LA 2ZL8A 1BIRA 1RN7A 3FF2A 1S723 1BUQA 1QAKA 3CCQ3 3N8BA 4LZIA 4AEQA 1IT7A 4FCMA 5AEWB 3ZFZA 2F99A 2R41A 1O7WB 1Q7HA 3OW22 1EKMA 2FXTA 1OACA 1FA3A 3PCRA 4FCZA 1AY7A 2BHMA 3D3LA 4KT3B 1Q40A 4X2OA 1VQ53 1QMAA 4HZBB 5BVBA 2HMMB 2BT3A 2YX9A 2HMLB 1GY7A 4RZMA 1I70A 4N6OB 2QEX3 1RGHA 3FG4A 1JB4A 3SOYA 4K61A 4DKIA 3UB1A 3Q2PA 1Q864 2SBLA 3GWRA 4EXRA 5M18A 1IVUA 3UNLA 2WOHA 5M1AA 4J5KA 4U13A 4ZM8A 2XSHB 3SYUA 1BRSA 1I3FA 3BNCA 2ML6A 1M904 3BLZA 2O9UX 3JUQA 2CIUA 1BVIA 5BIRA 2QA43 1I8VA 1O7NB 3HZPA 1K734 1NJI4 1JN5A 1W4NA 4O02B 1KWIA 1W2B2 1SQWA 1UI8A 3KCHA 1B2UA 3NBBA 2WOFA 3I0YA 1IVWA 3OWSA 3LTAA 1DVCA 2GEXA 1VQ83 1CQSA 3X42A 4GSPA 3IJEB 4EV2A 5IF6A 1V57A 3I553 5BXQA 2KRTA 4HVNA 4H3UA 3DGOA 4WYKA 5D83A 4CPKA 1TRQA 3G8ZA 3OX9A 1R4YA 1JV2B 1WMNA 4I4KA 1QJGA 1W6GA 3KSED 1BRJA 2XSOB 3NV0B 4HZ9B 3FZWA 3STDA 3DGLA 2F5WA 3F14A 1BNFA 2RFRA 2CHCA 1VQN3 1K8A4 1LNHA 1UCIA 4EYCA 3DH2A 3MKIA 3CCE3 3D4AA 5KP3A 1LQGC 1ZGXA 1W5ZA 1JB5A 1RNBA 2O3OA 2BIRA 1JB2A 2K54A 1A67A 2V1LA 1LQMB 4FCJA 1R4CA 3OV4A 2OOVA 3GZYB 1NB3I 2KCDA 1MOLA 2Z6BA 2CFWA 3RNTA 3A76A 1YJ93 3N9HA 3GZRA 2E2UA 3E99A 3EC9A 5TGNA 3S28A 3LMLA 2OTJ3 3WA2X 1RSNA 1N8R4 1GMRA 1JKGA 2J8XB 3BNBA 1ZX2A 2WGQA 3GRDA 1JZDA 1SIIA 3PXMA 1FW7A 4FR9A 4PEJA 3FG3A 5AIHA 7STDA 1AV4A 4JF8A 4XBXA 2PNCA 3EBTA 3Q1CA 1YIJ3 5AIFA 3IMAB 2C4BA 4LGQA 1VQ93 1RRLA 4OUQA 1X1YA 5G1LA 2AADA 4HM5B 2XFTA 2KF6A 5IG3A 2F98A 1TU5A 1OGZA 4R80A 2IY2A 2MF7A 1STFI 3MG1A 2WGOA 4R1KA 1GY5A 1Q40B 1W00A 1OHOA 2QGUA 1J2BA 1I2FA 1A2KA 1A2PA 1BSBA 4NPBA 4WP5A 3CCM3 1ROVA 3N54B 4HBRA 2IUJA 3DGMA 2CC3A 2XRXB 3H3HA 3Q90A 4Q53A 3G713 3K0ZA 1FGOA 2OOVC 2KF3A 3CC23 3FCSB 4NHFA 3RDEA 1BSCA 1ROAA 2KF5A 4KFEA 1BSAA 4O2HA 1QAFA 2Z7AA 2P05A 1ULIB 2KAAA 5AYRB 4O8SA 1N8QA 3PS8A 2CKFB 1U8CB 3NXJA 4EC6A 1HKXA 1IV7A 3CXC2 3F40A 1RGGA 1Z1SA 1IQXA 1JN5B 2OCTA 4IIAA 4N6NB 2KF4A 3KE7A 1EG9B 4IPBA 4MJDA 6RNTA 4CCVA 3UL6A 3TDGA 3X40A 1Q824 1Q42A 1W7CA 1LVNA 9RNTA 3FGYA 1E97A 1AVKA 1CH0A 3DXOA 4BL3A 3IPTA 4FMAA 5AIIA 1FUSA 1PFPA 1VQK3 2MC8A 1UGIA 1OF5A 3CU3A 3EB8A 2BO9B 3EJVA 7RNTA 4J8TA 4TX4A 3SX1A 3VF1A 1ZO2A 3KFQC 3OWUA 1VQ73 5STDA 3BB9A 3SEDA 1G96A 3BNDA 3FSDA 2CK3H 4KFFA 5IG4A 1ASKA 2INXA 1JZOA 2BU4A 2L1SA 2Y74A 1N9JA 1PU4A 1VQ63 1GMPA 2XFSA 3G6E3 3HIGA 3M8CA 2IYJA 3X41A 1T2HA 5JPPA 1RCKA 1GOUA 4LSOA 1OHSA 3K9MC 3MHEA 1LOXA 2CX0A 1C7HA 1AVLA 1DETA 1Q7Y4 2K3DA 1YHQ3 1A2VA 4WFOA 4EW5A 2W0QA 2F56A 4HM0B 1BOXA 1VQM3 2CFGA 4R9LA 5LC6A 1LOYA 4HJLB 3NM2A 3ZG0A 3U1WA 4HKVB 4R4KA 2W2CA 5D81A 1VQP3 3LOYA 4MMZB 4BTYA 4GHOA 4RNTA 4J5GA 5IERA 2UUGC 2CWTA 3DUKA 1BNEA 1JBRA 2K0MA 1ULJB 3JUOA 2HMNB 3G16A 5AIGA 1BRNL 1SPUA 4QWTA 1VQO3 4L7KA 1TP6A 1GD4A 2IMJA 2GBWB 5AEUB 3T8NA 2AAEA 5IEPA 1MWRA 2STDA 3F7XA 3HIIA 3PZWA 2Q07A 1RN4A 2JDIH 5IG5A 2ML5A 1D6YA 1CYVA 1RLSA 3LT8A 1CYUA 1DVDA 3LT9A 2Z77A 3D79A 3K63A 3QK9A 3D5GA 1ISKA 1FYSA 1RMSA 3RGRA 1MNLA 4N6MA 1UDII 5FGOA 4OVMA 1PYLA 1RGFA 3KKGA 1OH0A 1US1A 4LMIA 1W02A 1GOVA 4H61A 2HMOB 4N6LA 1QALA 1IYYA 3O8YA 2JQ5A 3S67A 1BRHA 1ZS7A 1YGEA 2XH9A 3GAXA 1GY6A 5DREA 1WMOA 1T2IA 2PZVA 2W56A 5EEOA 3AMOA 2CW9A 1EEJA 4MMXB 1G02A 2RGQA 1X1UA 1DMMA 1JKGB 1HZ1A 1OGXA 1X1XA 2OWPA 1BAOA 3SVAA 2CFLA 1UCKA 3F8XA 2UX0A 1B2SA 1EQKA 3I563 1M9GA
chains in the Genus database with same CATH topology
5AYSC 3FH1A 4RBNA 3FG1A 2C11A 1IT8A 2LQVA 2XR8B 2YFJB 3F8HA 4K1UA 5ELJA 3CC73 4O3VA 1N5PA 2P0XA 1S5AA 1AR0A 5CLKA 2CFDA 1CEWI 2LYXA 5IENA 5ELUA 1V74A 3WOFB 2XGNA 4N6TA 1FGQA 3CC43 1DMNA 3GZBA 1JJ22 3S29A 3EE1A 2HMJB 3KZTA 4MEIA 1WMPA 3LXUX 4NREA 1O7GB 1RKYA 1YIT3 3CPW2 1Q814 4KFDA 4FMBA 3U97A 3NM7A 1UUVB 1RJOA 3S27A 1K9M4 2Y73A 2GU3A 1W2ZA 3B4OA 1E3RA 2P38A 4MMYB 1DMQA 1SIHA 3MSOA 1IDPA 3SOAA 2CWVA 3CNXA 1IVXA 3K7CA 3LZAA 2W04A 3EF8A 3EN8A 3LTCA 3NV0A 1Y4KA 3DZLA 1YI23 3CCV3 3MYTA 3X3ZA 3DGNA 4J9AA 4R9KA 3X3YA 4WWUC 1FGRA 3DY5A 3LYGA 3NUVA 1KC84 4XDWA 2GEYA 1WTHA 5CK6A 1IQYA 8CHOA 1F8NA 2A15A 2E2TA 2BNGA 3DMCA 4BTWA 1LXEA 2BMRB 3PCSA 4WHAA 1NDOB 1D6ZA 1RRHA 3PYJA 3UJMA 3EBYA 4N6UA 3WA3A 2OQEC 4EBGA 3PGBA 2CG1A 4K1VA 2W03A 1FUWA 3GZXB 3G4S3 2FGTA 1KSIA 2W9PA 2FNQA 1K41A 5LC7A 2B24B 1N9EA 4GB5A 1QVF2 1VQ43 3LH4A 1GD3A 3EHCA 3NBJA 4WYKB 3J7Yd 2CFKA 3T0UA 1UI7A 1STDA 4XDVA 2BMOB 3AMOB 3L0RA 3CPOA 2IA7A 3MG3A 3X3XA 2KXGA 4XBYA 1IK3A 1OUNA 2XF3A 5I97A 3WMDA 3H51A 4N3VA 1IU7A 3HX8A 1O7HB 3F7SA 4LEHA 3LTBA 3F9SA 3G0KA 1IQ8A 1IVVA 1JRQA 1NO3A 3HK4A 2XEPA 4JRFA 4XBTA 3MPHA 4N6V0 3UL5A 4L8OA 1TIJA 3CMA3 3ALAA 1DYUA 2GU1A 3VSYA 3NQZA 4CDLA 4FMCA 5FW5A 4X2HA 4ORLA 3CD63 3WOEB 3SLUA 5A0OB 4HM7B 2D42A 3CCS3 1YJW3 1M1XB 2L4VA 2YFLB 2F86B 4IT7A 3V92A 5HGRA 2W56B 5EQLA 1W6YA 3VGNA 3FKAA 1WNHA 2BMQB 3FF0A 2Z76A 3FLJA 1VQL3 5IG0A 1M1K4 3JUMA 5JBSA 2R4IA 3CCR3 3ROBA 1JNQA 3K5TA 1L5GB 1OPYA 2IUKA 3NQYA 1OCVA 4KVHA 2B1XB 3V99A 1O7PB 5CF1A 2P09A 3SXXA 1TFKA 3JVCA 2CG0A 5AI1A 3MG2A 1E3VA 4RNZA 3JUPA 4AKZA 1QVG2 3B4PA 3KSPA 1KQS2 4FMDA 4HYZA 5IW9A 3WDGB 1YVBI 5JPUA 2YFIB 1WQLB 3HI7A 4L8PA 1W01A 2HMKB 4XM4A 1FGMA 1U5OA 2W6JH 3MWZA 2ZDJA 3ECFA 4HM1B 5IEOA 1OF5B 3CNMA 3EN1B 3JUNA 1GYBA 3NX0A 3QRDA 2XGLA 2RSXA 5KP4A 1NU3A 3T8UA 3EX9A 3CCU3 2OTL3 3KN4A 2M7OA 4EV5A 1O7MB 2E2VA 1HU9A 3WODG 5D82A 2RCDA 2OQEA 2C10A 5CXOA 3NHXA 1EA2A 1NWWA 1W6CA 3BNEA 1IV9A 3CCL3 1SJWA 3CME3 2W9QA 1TFOA 4K90B 2CWUA 4BTXA 2CH9A 3LTDA 3V98A 4GL6A 4HM4B 1YJN3 1NB5I 3ER7A 2GXFA 3B7CA 1A90A 2GBXB 5EVHA 1N5HA 6STDA 1VZZA 3RGAA 1TUHA 4STDA 3D9RA 2QIYA 4RNYA 3CCJ3 1OHPA 4HM3B 4HM8B 5G2GA 2I9WA 5DRVA 1FGTA 2P0MA 3OWYA 1UW1A 1K28A 4OK0A 3DM8A 2WO0A 4HM2B 1D6UA 5KP1A 1KD14 4AKYA 5CF2A 4KZ1A 4XB5A 3NBRA 3KIIA 1UUWB 2D1WA 3EQQB 3S5CA 4G1MB 1T5YA 1GS3A 4HM6B 3OXAA 3B8LA 2ZL8A 1RN7A 3FF2A 1S723 1BUQA 1QAKA 3CCQ3 3N8BA 4LZIA 4AEQA 1IT7A 4FCMA 5AEWB 2F99A 1O7WB 3OW22 1EKMA 2FXTA 1OACA 1FA3A 3PCRA 4FCZA 3D3LA 2BHMA 1Q40A 4X2OA 1VQ53 1QMAA 4HZBB 5BVBA 2HMMB 2BT3A 2YX9A 2HMLB 1GY7A 4RZMA 4N6OB 2QEX3 3FG4A 1JB4A 3SOYA 4K61A 1Q864 3UB1A 3Q2PA 2SBLA 3GWRA 4EXRA 1IVUA 3UNLA 2WOHA 4U13A 4ZM8A 2XSHB 3BNCA 2ML6A 1M904 3BLZA 2O9UX 3JUQA 2CIUA 2QA43 1O7NB 3HZPA 1K734 1NJI4 1JN5A 1W4NA 4O02B 1W2B2 1SQWA 1UI8A 3NBBA 2WOFA 3I0YA 1IVWA 3OWSA 3LTAA 1DVCA 2GEXA 1VQ83 1CQSA 3X42A 3IJEB 4EV2A 5IF6A 3I553 5BXQA 2KRTA 4HVNA 4H3UA 3DGOA 4WYKA 5D83A 3G8ZA 3OX9A 1JV2B 1WMNA 4I4KA 1QJGA 1W6GA 3KSED 2XSOB 3NV0B 4HZ9B 3FZWA 3STDA 3DGLA 3F14A 2RFRA 2CHCA 1VQN3 1K8A4 1LNHA 4EYCA 3MKIA 3CCE3 5KP3A 1W5ZA 1JB5A 2O3OA 1JB2A 2K54A 1A67A 2V1LA 4FCJA 1R4CA 3OV4A 2OOVA 3GZYB 1NB3I 2KCDA 1MOLA 2Z6BA 2CFWA 3A76A 1YJ93 3N9HA 3GZRA 2E2UA 3E99A 3EC9A 5TGNA 3S28A 3LMLA 2OTJ3 3WA2X 1N8R4 3BNBA 1JKGA 1ZX2A 2WGQA 3GRDA 1SIIA 3PXMA 4FR9A 4PEJA 3FG3A 5AIHA 7STDA 1AV4A 4JF8A 4XBXA 2PNCA 3EBTA 3Q1CA 1YIJ3 5AIFA 3IMAB 4LGQA 1VQ93 1RRLA 4OUQA 5IG3A 4HM5B 2XFTA 1M9GA 2F98A 1TU5A 1OGZA 4R80A 2MF7A 1STFI 3MG1A 2WGOA 4R1KA 1GY5A 1Q40B 1W00A 1OHOA 2QGUA 1J2BA 1A2KA 4WP5A 3CCM3 1ROVA 3N54B 4HBRA 2IUJA 3DGMA 2CC3A 2XRXB 3H3HA 3Q90A 4Q53A 3G713 3K0ZA 1FGOA 2OOVC 3CC23 3FCSB 4NHFA 3RDEA 4KFEA 1ROAA 4O2HA 1QAFA 2Z7AA 2P05A 1ULIB 5AYRB 4O8SA 1N8QA 3PS8A 2CKFB 1U8CB 3NXJA 4EC6A 1HKXA 1IV7A 3CXC2 3F40A 1Z1SA 1IQXA 1JN5B 2OCTA 4IIAA 4N6NB 4MJDA 3KE7A 1EG9B 4IPBA 4CCVA 3UL6A 3TDGA 3X40A 1Q824 1Q42A 1W7CA 1LVNA 3FGYA 1AVKA 1E97A 3DXOA 3IPTA 4FMAA 5AIIA 1PFPA 1VQK3 2MC8A 1OF5A 3CU3A 3EB8A 2BO9B 3EJVA 4J8TA 4TX4A 3SX1A 3VF1A 1ZO2A 3KFQC 3OWUA 1VQ73 5STDA 3BB9A 3SEDA 1G96A 3BNDA 3FSDA 2CK3H 4KFFA 5IG4A 1ASKA 2INXA 2Y74A 1N9JA 1PU4A 1VQ63 2XFSA 3G6E3 3HIGA 3M8CA 3X41A 5JPPA 4LSOA 1OHSA 3K9MC 3MHEA 1LOXA 1C7HA 1AVLA 1Q7Y4 1YHQ3 1A2VA 4WFOA 2W0QA 4HM0B 1VQM3 2CFGA 4R9LA 5LC6A 4HJLB 3NM2A 3U1WA 4HKVB 4R4KA 2W2CA 5D81A 1VQP3 3LOYA 4MMZB 4BTYA 5IERA 2CWTA 3DUKA 2K0MA 1ULJB 3JUOA 2HMNB 3G16A 5AIGA 1SPUA 4QWTA 1VQO3 4L7KA 1TP6A 1GD4A 2IMJA 2GBWB 5AEUB 3T8NA 5IEPA 2STDA 3F7XA 3HIIA 3PZWA 2Q07A 2JDIH 5IG5A 2ML5A 1D6YA 1CYVA 3LT8A 1CYUA 1DVDA 3LT9A 2Z77A 3K63A 3QK9A 1ISKA 3RGRA 1MNLA 4N6MA 5FGOA 4OVMA 3KKGA 1OH0A 1US1A 4LMIA 1W02A 4H61A 2HMOB 4N6LA 1QALA 3O8YA 2JQ5A 3S67A 1YGEA 2XH9A 3GAXA 1GY6A 5DREA 1WMOA 2PZVA 2W56A 5EEOA 3AMOA 2CW9A 4MMXB 2RGQA 1DMMA 1JKGB 1OGXA 2OWPA 3SVAA 2CFLA 3F8XA 2UX0A 1EQKA 3I563 1KWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3H A;  2XRX B;  3Q90 A;  4HM6 B;  4Q53 A;  4X2H A;  3OXA A;  3FH1 A;  3K0Z A;  3B8L A;  4ORL A;  3F8H A;  2XR8 B;  2YFJ B;  3FF2 A;  4K1U A;  1BUQ A;  4HM7 B;  4FCM A;  2Z7A A;  5AEW B;  2F99 A;  1O7W B;  1ULI B;  2YFL B;  1S5A A;  1AR0 A;  2F86 B;  5CLK A;  5HGR A;  2CKF B;  1W6Y A;  3NXJ A;  1HKX A;  5IEN A;  3VGN A;  1Q40 A;  3F40 A;  1Z1S A;  3FKA A;  4X2O A;  1QMA A;  4HZB B;  1DMN A;  3GZB A;  5BVB A;  1JN5 B;  2BMQ B;  2Z76 A;  3FF0 A;  2HMM B;  3FLJ A;  3KE7 A;  1EG9 B;  3JUM A;  4IIA A;  2R4I A;  2HMJ B;  3KZT A;  4MJD A;  5IG0 A;  2HML B;  3ROB A;  1GY7 A;  4RZM A;  3WMD A;  4WWU C;  1Q42 A;  1OPY A;  1O7G B;  1JB4 A;  1OCV A;  1E97 A;  3FGY A;  3DXO A;  2B1X B;  4KVH A;  1O7P B;  3IPT A;  3SOY A;  5CF1 A;  3GWR A;  5AII A;  1UUV B;  5AI1 A;  3MG2 A;  1E3V A;  3B4O A;  3UNL A;  1OF5 A;  1E3R A;  3CU3 A;  3EJV A;  1DMQ A;  4U13 A;  2XSH B;  3MSO A;  4J8T A;  1IDP A;  1ZO2 A;  3SOA A;  3OWU A;  3BLZ A;  3JUP A;  3JUQ A;  3BB9 A;  3CNX A;  5STD A;  3K7C A;  3LZA A;  3SED A;  1O7N B;  3B4P A;  3FSD A;  3HZP A;  3EF8 A;  3EN8 A;  1JN5 A;  3KSP A;  5IG4 A;  1ASK A;  2INX A;  3NV0 A;  3DZL A;  3MYT A;  5JPU A;  4J9A A;  4R9K A;  3I0Y A;  2YFI B;  3M8C A;  3LYG A;  1WQL B;  3NUV A;  3OWS A;  1W01 A;  2GEX A;  2HMK B;  1CQS A;  4L8P A;  4XM4 A;  5JPP A;  1U5O A;  4XDW A;  2GEY A;  5IF6 A;  1OHS A;  3MHE A;  3ECF A;  4HM1 B;  5IEO A;  5CK6 A;  4HVN A;  4H3U A;  1OF5 B;  5BXQ A;  3CNM A;  4WYK A;  3EN1 B;  1C7H A;  5D83 A;  8CHO A;  2A15 A;  3DMC A;  2BNG A;  1GYB A;  3JUN A;  3G8Z A;  3OX9 A;  2BMR B;  5KP4 A;  1NU3 A;  3T8U A;  1NDO B;  3EX9 A;  4HM0 B;  4I4K A;  3UJM A;  3EBY A;  1QJG A;  5G2G A;  4R9L A;  4HJL B;  3NM2 A;  1O7M B;  2XSO B;  3NV0 B;  4HKV B;  4HZ9 B;  3FZW A;  4K1V A;  2W2C A;  2RCD A;  5D81 A;  5D82 A;  3STD A;  5CXO A;  3GZX B;  3F14 A;  2RFR A;  1EA2 A;  2CHC A;  1NWW A;  3NHX A;  5IER A;  3MKI A;  1SJW A;  3DUK A;  1K41 A;  5KP3 A;  2B24 B;  1JB5 A;  3JUO A;  1ULJ B;  4GB5 A;  2HMN B;  3G16 A;  5AIG A;  1JB2 A;  2K54 A;  3EHC A;  4L7K A;  1TP6 A;  2IMJ A;  2GBW B;  4FCJ A;  4WYK B;  3OV4 A;  5AEU B;  4HM4 B;  3T8N A;  5IEP A;  3GZY B;  2STD A;  3ER7 A;  1STD A;  2GXF A;  3A76 A;  3F7X A;  4XDV A;  2BMO B;  3B7C A;  2GBX B;  3EC9 A;  3E99 A;  3GZR A;  3CPO A;  5EVH A;  5TGN A;  5IG5 A;  6STD A;  1JKG A;  1VZZ A;  3RGA A;  2Z77 A;  1ZX2 A;  1TUH A;  3GRD A;  3MG3 A;  1ISK A;  4XBY A;  4PEJ A;  4STD A;  3D9R A;  5AIH A;  3RGR A;  2QIY A;  7STD A;  4OVM A;  4XBX A;  1OHP A;  1OUN A;  3EBT A;  3KKG A;  1OH0 A;  4HM3 B;  4HM8 B;  4LMI A;  5AIF A;  2I9W A;  1W02 A;  3H51 A;  3HX8 A;  2HMO B;  4LGQ A;  4N3V A;  1O7H B;  3F7S A;  4OUQ A;  4HM5 B;  4LEH A;  5IG3 A;  3OWY A;  2F98 A;  3DM8 A;  5DRV A;  3F9S A;  2JQ5 A;  3G0K A;  1OGZ A;  3HK4 A;  5DRE A;  1GY6 A;  4HM2 B;  4XBT A;  5KP1 A;  3MG1 A;  2PZV A;  4L8O A;  4R1K A;  5CF2 A;  1GY5 A;  4XB5 A;  1Q40 B;  1W00 A;  1OHO A;  2QGU A;  3NBR A;  3VSY A;  1UUW B;  1DMM A;  1JKG B;  1OGX A;  2OWP A;  2RGQ A;  4CDL A;  3EQQ B;  1A2K A;  3S5C A;  4WP5 A;  5FW5 A;  3F8X A;  2UX0 A;  1GS3 A; 
#chains in the Genus database with same CATH topology
 5AYS C;  1G0T A;  1JBS A;  3FH1 A;  1TRP A;  4RBN A;  3FG1 A;  2C11 A;  1IT8 A;  2LQV A;  2XR8 B;  2YFJ B;  3F8H A;  4K1U A;  5ELJ A;  1SAR A;  3CC7 3;  4O3V A;  4HAA A;  1N5P A;  2P0X A;  1S5A A;  1AR0 A;  5CLK A;  1AQZ A;  1YNV X;  2CFD A;  1B2Z A;  1CEW I;  2LYX A;  5IEN A;  5ELU A;  1V74 A;  3WOF B;  2XGN A;  4N6T A;  1FGQ A;  3CC4 3;  1FZU A;  7GSP A;  1DMN A;  3GZB A;  1JJ2 2;  3S29 A;  3AHW A;  3EE1 A;  2HMJ B;  1EUI C;  3KZT A;  4MEI A;  1WMP A;  3LXU X;  4NRE A;  1BRG A;  1O7G B;  1RKY A;  3CPW 2;  1YIT 3;  1V58 A;  1Q81 4;  5HOH A;  1GMQ A;  4KFD A;  4FMB A;  3U97 A;  3NM7 A;  1UUV B;  1RJO A;  3S27 A;  1K9M 4;  1HYF A;  2GU3 A;  1W2Z A;  2Y73 A;  3B4O A;  1E3R A;  1DE3 A;  2P38 A;  4MMY B;  1DMQ A;  1SIH A;  3MSO A;  1IDP A;  3SOA A;  1NNV A;  2CWV A;  3CNX A;  1IVX A;  1UCL A;  3K7C A;  3LZA A;  2W04 A;  3EF8 A;  3EN8 A;  3LTC A;  1MWU A;  3GSP A;  3NV0 A;  1FUT A;  1Y4K A;  3DZL A;  4BL2 A;  3CCV 3;  1YI2 3;  1RN1 A;  1I3I A;  3MYT A;  1T3B A;  3X3Z A;  2F4Y A;  3DGN A;  4J9A A;  4R9K A;  1GOY A;  3X3Y A;  4WWU C;  1FGR A;  3DY5 A;  3LYG A;  1B27 A;  3NUV A;  2H0H A;  1KC8 4;  4XDW A;  2GEY A;  3WR2 A;  1WTH A;  5CK6 A;  1IQY A;  8CHO A;  1B21 A;  1F8N A;  2A15 A;  2BNG A;  2E2T A;  3DMC A;  1LXE A;  5G1K A;  2ZHX B;  3WHO A;  4BTW A;  2BMR B;  3PCS A;  4WHA A;  1NDO B;  1D6Z A;  1RRH A;  1TTO A;  3PYJ A;  3UJM A;  3EBY A;  4N6U A;  3WA3 A;  2OQE C;  5GSP A;  4EBG A;  3PGB A;  2CG1 A;  1BRK A;  4K1V A;  5BU4 A;  2W03 A;  4I5Q A;  1FUW A;  3GZX B;  1BAN A;  2H0G A;  1RGK A;  3G4S 3;  2FGT A;  1KSI A;  2W9P A;  2FNQ A;  1K41 A;  2UGI A;  1TJD A;  2B24 B;  5LC7 A;  1N9E A;  4GB5 A;  1QVF 2;  1VQ4 3;  1I2E A;  1LNI A;  1GD3 A;  3LH4 A;  3EHC A;  3NBJ A;  1I0X A;  4WYK B;  3J7Y d;  2CFK A;  3T0U A;  1UI7 A;  1BUJ A;  1STD A;  4XDV A;  1MWS A;  2BMO B;  3AMO B;  3DGY A;  3L0R A;  3CPO A;  1LOV A;  1RGA A;  2IA7 A;  1MGR A;  3MG3 A;  3X3X A;  2KXG A;  2RBI A;  4XBY A;  1IK3 A;  1BNS A;  1OUN A;  2XF3 A;  5I97 A;  3WMD A;  3H51 A;  4N3V A;  1IU7 A;  3HX8 A;  1O7H B;  3F7S A;  1BSD A;  4LEH A;  3LTB A;  1BRI A;  1B2X A;  3F9S A;  3G0K A;  1IQ8 A;  1IVV A;  1JRQ A;  1NO3 A;  3HK4 A;  8RNT A;  1RGL A;  2XEP A;  4JRF A;  4XBT A;  2F5M A;  3BU4 A;  3MPH A;  4N6V 0;  3UL5 A;  4L8O A;  1TIJ A;  1BNR A;  3CMA 3;  3ALA A;  1DYU A;  1UGH I;  2GU1 A;  3VSY A;  3NQZ A;  1Q9E A;  4FMC A;  4CDL A;  5FW5 A;  6GSP A;  4X2H A;  4ORL A;  3CD6 3;  3WOE B;  3SLU A;  5A0O B;  4HM7 B;  1JBT A;  4ILF A;  2D42 A;  3CCS 3;  1YJW 3;  1M1X B;  2L4V A;  2YFL B;  2F86 B;  4IT7 A;  3V92 A;  3A5E A;  5HGR A;  2W56 B;  5EQL A;  1YGW A;  1W6Y A;  3HOH A;  3VGN A;  3FKA A;  2HOH A;  1WNH A;  1RHL A;  2BMQ B;  2Z76 A;  3FF0 A;  3FLJ A;  5IG0 A;  1M1K 4;  1VQL 3;  3JUM A;  5JBS A;  2R4I A;  3CCR 3;  3ROB A;  1JNQ A;  1I2G A;  3K5T A;  1L5G B;  1OPY A;  2IUK A;  3NQY A;  1OCV A;  4KVH A;  1RGE A;  2B1X B;  3V99 A;  1O7P B;  5CF1 A;  1BU4 A;  2P09 A;  3SXX A;  1TFK A;  3JVC A;  2CG0 A;  5AI1 A;  3MG2 A;  1E3V A;  4HOH A;  4RNZ A;  3JUP A;  4AKZ A;  1QVG 2;  1BNG A;  3B4P A;  3KSP A;  1KQS 2;  4FMD A;  4HYZ A;  1UUG B;  1MWT A;  5IW9 A;  3WDG B;  1VQQ A;  2RNT A;  1YVB I;  5JPU A;  1YVS A;  2YFI B;  1WQL B;  3HI7 A;  4L8P A;  1UCJ A;  1W01 A;  2HMK B;  4XM4 A;  2H0I A;  1FGM A;  1U5O A;  2W6J H;  1LOW A;  3MWZ A;  2ZDJ A;  3ECF A;  4HM1 B;  5IEO A;  1OF5 B;  1I0V A;  1MGW A;  3CNM A;  3EN1 B;  2CX1 A;  3JUN A;  1GYB A;  3NX0 A;  3QRD A;  2XGL A;  1BNJ A;  2RSX A;  5KP4 A;  1NU3 A;  3T8U A;  3EX9 A;  3CCU 3;  2OTL 3;  3ZG5 A;  2ZA4 A;  3KN4 A;  4LYL B;  2M7O A;  4EV5 A;  1O7M B;  2E2V A;  1HU9 A;  1RTU A;  3WOD G;  5D82 A;  2RCD A;  2OQE A;  2C10 A;  5CXO A;  3NHX A;  1C54 A;  1EA2 A;  1NWW A;  1W6C A;  3Q3F A;  3BNE A;  1IV9 A;  3CCL 3;  3AHS A;  1SJW A;  3CME 3;  3AGO A;  2W9Q A;  1TFO A;  4K90 B;  2CWU A;  4BTX A;  2CH9 A;  3LTD A;  1BGS A;  3V98 A;  2SAR A;  3AGN A;  4GL6 A;  4HM4 B;  1LRA A;  3D5I A;  1YJN 3;  1NB5 I;  3ER7 A;  1X1W A;  2GXF A;  3B7C A;  1B3S A;  5M19 A;  1A90 A;  2GBX B;  1RGC A;  5EVH A;  1N5H A;  6STD A;  1VZZ A;  3URP A;  3RGA A;  1TUH A;  1B20 A;  4STD A;  3D9R A;  2QIY A;  4RNY A;  3CCJ 3;  1OHP A;  4HM3 B;  4HM8 B;  5G2G A;  4BIR A;  2I9W A;  5DRV A;  1FGT A;  2P0M A;  3OWY A;  1UW1 A;  1K28 A;  4OK0 A;  3DM8 A;  1RNT A;  2WO0 A;  4HM2 B;  1BSE A;  1D6U A;  5KP1 A;  1KD1 4;  5RNT A;  4AKY A;  5CF2 A;  1GSP A;  4KZ1 A;  1BNI A;  1PY3 A;  3BIR A;  3NBR A;  4XB5 A;  1B2M A;  3KII A;  1RDS A;  1UUW B;  2GSP A;  4BU4 A;  1RCL A;  2D1W A;  3EQQ B;  3S5C A;  4CJN A;  4G1M B;  1T5Y A;  1GS3 A;  4HM6 B;  3OXA A;  3B8L A;  2ZL8 A;  1BIR A;  1RN7 A;  3FF2 A;  1S72 3;  1BUQ A;  1QAK A;  3CCQ 3;  3N8B A;  4LZI A;  4AEQ A;  1IT7 A;  4FCM A;  5AEW B;  3ZFZ A;  2F99 A;  2R41 A;  1O7W B;  1Q7H A;  3OW2 2;  1EKM A;  2FXT A;  1OAC A;  1FA3 A;  3PCR A;  4FCZ A;  1AY7 A;  2BHM A;  3D3L A;  4KT3 B;  1Q40 A;  4X2O A;  1VQ5 3;  1QMA A;  4HZB B;  5BVB A;  2HMM B;  2BT3 A;  2YX9 A;  2HML B;  1GY7 A;  4RZM A;  1I70 A;  4N6O B;  2QEX 3;  1RGH A;  3FG4 A;  1JB4 A;  3SOY A;  4K61 A;  4DKI A;  3UB1 A;  3Q2P A;  1Q86 4;  2SBL A;  3GWR A;  4EXR A;  5M18 A;  1IVU A;  3UNL A;  2WOH A;  5M1A A;  4J5K A;  4U13 A;  4ZM8 A;  2XSH B;  3SYU A;  1BRS A;  1I3F A;  3BNC A;  2ML6 A;  1M90 4;  3BLZ A;  2O9U X;  3JUQ A;  2CIU A;  1BVI A;  5BIR A;  2QA4 3;  1I8V A;  1O7N B;  3HZP A;  1K73 4;  1NJI 4;  1JN5 A;  1W4N A;  4O02 B;  1KWI A;  1W2B 2;  1SQW A;  1UI8 A;  3KCH A;  1B2U A;  3NBB A;  2WOF A;  3I0Y A;  1IVW A;  3OWS A;  3LTA A;  1DVC A;  2GEX A;  1VQ8 3;  1CQS A;  3X42 A;  4GSP A;  3IJE B;  4EV2 A;  5IF6 A;  1V57 A;  3I55 3;  5BXQ A;  2KRT A;  4HVN A;  4H3U A;  3DGO A;  4WYK A;  5D83 A;  4CPK A;  1TRQ A;  3G8Z A;  3OX9 A;  1R4Y A;  1JV2 B;  1WMN A;  4I4K A;  1QJG A;  1W6G A;  3KSE D;  1BRJ A;  2XSO B;  3NV0 B;  4HZ9 B;  3FZW A;  3STD A;  3DGL A;  2F5W A;  3F14 A;  1BNF A;  2RFR A;  2CHC A;  1VQN 3;  1K8A 4;  1LNH A;  1UCI A;  4EYC A;  3DH2 A;  3MKI A;  3CCE 3;  3D4A A;  5KP3 A;  1LQG C;  1ZGX A;  1W5Z A;  1JB5 A;  1RNB A;  2O3O A;  2BIR A;  1JB2 A;  2K54 A;  1A67 A;  2V1L A;  1LQM B;  4FCJ A;  1R4C A;  3OV4 A;  2OOV A;  3GZY B;  1NB3 I;  2KCD A;  1MOL A;  2Z6B A;  2CFW A;  3RNT A;  3A76 A;  1YJ9 3;  3N9H A;  3GZR A;  2E2U A;  3E99 A;  3EC9 A;  5TGN A;  3S28 A;  3LML A;  2OTJ 3;  3WA2 X;  1RSN A;  1N8R 4;  1GMR A;  1JKG A;  2J8X B;  3BNB A;  1ZX2 A;  2WGQ A;  3GRD A;  1JZD A;  1SII A;  3PXM A;  1FW7 A;  4FR9 A;  4PEJ A;  3FG3 A;  5AIH A;  7STD A;  1AV4 A;  4JF8 A;  4XBX A;  2PNC A;  3EBT A;  3Q1C A;  1YIJ 3;  5AIF A;  3IMA B;  2C4B A;  4LGQ A;  1VQ9 3;  1RRL A;  4OUQ A;  1X1Y A;  5G1L A;  2AAD A;  4HM5 B;  2XFT A;  2KF6 A;  5IG3 A;  2F98 A;  1TU5 A;  1OGZ A;  4R80 A;  2IY2 A;  2MF7 A;  1STF I;  3MG1 A;  2WGO A;  4R1K A;  1GY5 A;  1Q40 B;  1W00 A;  1OHO A;  2QGU A;  1J2B A;  1I2F A;  1A2K A;  1A2P A;  1BSB A;  4NPB A;  4WP5 A;  3CCM 3;  1ROV A;  3N54 B;  4HBR A;  2IUJ A;  3DGM A;  2CC3 A;  2XRX B;  3H3H A;  3Q90 A;  4Q53 A;  3G71 3;  3K0Z A;  1FGO A;  2OOV C;  2KF3 A;  3CC2 3;  3FCS B;  4NHF A;  3RDE A;  1BSC A;  1ROA A;  2KF5 A;  4KFE A;  1BSA A;  4O2H A;  1QAF A;  2Z7A A;  2P05 A;  1ULI B;  2KAA A;  5AYR B;  4O8S A;  1N8Q A;  3PS8 A;  2CKF B;  1U8C B;  3NXJ A;  4EC6 A;  1HKX A;  1IV7 A;  3CXC 2;  3F40 A;  1RGG A;  1Z1S A;  1IQX A;  1JN5 B;  2OCT A;  4IIA A;  4N6N B;  2KF4 A;  3KE7 A;  1EG9 B;  4IPB A;  4MJD A;  6RNT A;  4CCV A;  3UL6 A;  3TDG A;  3X40 A;  1Q82 4;  1Q42 A;  1W7C A;  1LVN A;  9RNT A;  3FGY A;  1E97 A;  1AVK A;  1CH0 A;  3DXO A;  4BL3 A;  3IPT A;  4FMA A;  5AII A;  1FUS A;  1PFP A;  1VQK 3;  2MC8 A;  1UGI A;  1OF5 A;  3CU3 A;  3EB8 A;  2BO9 B;  3EJV A;  7RNT A;  4J8T A;  4TX4 A;  3SX1 A;  3VF1 A;  1ZO2 A;  3KFQ C;  3OWU A;  1VQ7 3;  5STD A;  3BB9 A;  3SED A;  1G96 A;  3BND A;  3FSD A;  2CK3 H;  4KFF A;  5IG4 A;  1ASK A;  2INX A;  1JZO A;  2BU4 A;  2L1S A;  2Y74 A;  1N9J A;  1PU4 A;  1VQ6 3;  1GMP A;  2XFS A;  3G6E 3;  3HIG A;  3M8C A;  2IYJ A;  3X41 A;  1T2H A;  5JPP A;  1RCK A;  1GOU A;  4LSO A;  1OHS A;  3K9M C;  3MHE A;  1LOX A;  2CX0 A;  1C7H A;  1AVL A;  1DET A;  1Q7Y 4;  2K3D A;  1YHQ 3;  1A2V A;  4WFO A;  4EW5 A;  2W0Q A;  2F56 A;  4HM0 B;  1BOX A;  1VQM 3;  2CFG A;  4R9L A;  5LC6 A;  1LOY A;  4HJL B;  3NM2 A;  3ZG0 A;  3U1W A;  4HKV B;  4R4K A;  2W2C A;  5D81 A;  1VQP 3;  3LOY A;  4MMZ B;  4BTY A;  4GHO A;  4RNT A;  4J5G A;  5IER A;  2UUG C;  2CWT A;  3DUK A;  1BNE A;  1JBR A;  2K0M A;  1ULJ B;  3JUO A;  2HMN B;  3G16 A;  5AIG A;  1BRN L;  1SPU A;  4QWT A;  1VQO 3;  4L7K A;  1TP6 A;  1GD4 A;  2IMJ A;  2GBW B;  5AEU B;  3T8N A;  2AAE A;  5IEP A;  1MWR A;  2STD A;  3F7X A;  3HII A;  3PZW A;  2Q07 A;  1RN4 A;  2JDI H;  5IG5 A;  2ML5 A;  1D6Y A;  1CYV A;  1RLS A;  3LT8 A;  1CYU A;  1DVD A;  3LT9 A;  2Z77 A;  3D79 A;  3K63 A;  3QK9 A;  3D5G A;  1ISK A;  1FYS A;  1RMS A;  3RGR A;  1MNL A;  4N6M A;  1UDI I;  5FGO A;  4OVM A;  1PYL A;  1RGF A;  3KKG A;  1OH0 A;  1US1 A;  4LMI A;  1W02 A;  1GOV A;  4H61 A;  2HMO B;  4N6L A;  1QAL A;  1IYY A;  3O8Y A;  2JQ5 A;  3S67 A;  1BRH A;  1ZS7 A;  1YGE A;  2XH9 A;  3GAX A;  1GY6 A;  5DRE A;  1WMO A;  1T2I A;  2PZV A;  2W56 A;  5EEO A;  3AMO A;  2CW9 A;  1EEJ A;  4MMX B;  1G02 A;  2RGQ A;  1X1U A;  1DMM A;  1JKG B;  1HZ1 A;  1OGX A;  1X1X A;  2OWP A;  1BAO A;  3SVA A;  2CFL A;  1UCK A;  3F8X A;  2UX0 A;  1B2S A;  1EQK A;  3I56 3;  1M9G A; 
#chains in the Genus database with same CATH homology
 5AYS C;  3FH1 A;  4RBN A;  3FG1 A;  2C11 A;  1IT8 A;  2LQV A;  2XR8 B;  2YFJ B;  3F8H A;  4K1U A;  5ELJ A;  3CC7 3;  4O3V A;  1N5P A;  2P0X A;  1S5A A;  1AR0 A;  5CLK A;  2CFD A;  1CEW I;  2LYX A;  5IEN A;  5ELU A;  1V74 A;  3WOF B;  2XGN A;  4N6T A;  1FGQ A;  3CC4 3;  1DMN A;  3GZB A;  1JJ2 2;  3S29 A;  3EE1 A;  2HMJ B;  3KZT A;  4MEI A;  1WMP A;  3LXU X;  4NRE A;  1O7G B;  1RKY A;  1YIT 3;  3CPW 2;  1Q81 4;  4KFD A;  4FMB A;  3U97 A;  3NM7 A;  1UUV B;  1RJO A;  3S27 A;  1K9M 4;  2Y73 A;  2GU3 A;  1W2Z A;  3B4O A;  1E3R A;  2P38 A;  4MMY B;  1DMQ A;  1SIH A;  3MSO A;  1IDP A;  3SOA A;  2CWV A;  3CNX A;  1IVX A;  3K7C A;  3LZA A;  2W04 A;  3EF8 A;  3EN8 A;  3LTC A;  3NV0 A;  1Y4K A;  3DZL A;  1YI2 3;  3CCV 3;  3MYT A;  3X3Z A;  3DGN A;  4J9A A;  4R9K A;  3X3Y A;  4WWU C;  1FGR A;  3DY5 A;  3LYG A;  3NUV A;  1KC8 4;  4XDW A;  2GEY A;  1WTH A;  5CK6 A;  1IQY A;  8CHO A;  1F8N A;  2A15 A;  2E2T A;  2BNG A;  3DMC A;  4BTW A;  1LXE A;  2BMR B;  3PCS A;  4WHA A;  1NDO B;  1D6Z A;  1RRH A;  3PYJ A;  3UJM A;  3EBY A;  4N6U A;  3WA3 A;  2OQE C;  4EBG A;  3PGB A;  2CG1 A;  4K1V A;  2W03 A;  1FUW A;  3GZX B;  3G4S 3;  2FGT A;  1KSI A;  2W9P A;  2FNQ A;  1K41 A;  5LC7 A;  2B24 B;  1N9E A;  4GB5 A;  1QVF 2;  1VQ4 3;  3LH4 A;  1GD3 A;  3EHC A;  3NBJ A;  4WYK B;  3J7Y d;  2CFK A;  3T0U A;  1UI7 A;  1STD A;  4XDV A;  2BMO B;  3AMO B;  3L0R A;  3CPO A;  2IA7 A;  3MG3 A;  3X3X A;  2KXG A;  4XBY A;  1IK3 A;  1OUN A;  2XF3 A;  5I97 A;  3WMD A;  3H51 A;  4N3V A;  1IU7 A;  3HX8 A;  1O7H B;  3F7S A;  4LEH A;  3LTB A;  3F9S A;  3G0K A;  1IQ8 A;  1IVV A;  1JRQ A;  1NO3 A;  3HK4 A;  2XEP A;  4JRF A;  4XBT A;  3MPH A;  4N6V 0;  3UL5 A;  4L8O A;  1TIJ A;  3CMA 3;  3ALA A;  1DYU A;  2GU1 A;  3VSY A;  3NQZ A;  4CDL A;  4FMC A;  5FW5 A;  4X2H A;  4ORL A;  3CD6 3;  3WOE B;  3SLU A;  5A0O B;  4HM7 B;  2D42 A;  3CCS 3;  1YJW 3;  1M1X B;  2L4V A;  2YFL B;  2F86 B;  4IT7 A;  3V92 A;  5HGR A;  2W56 B;  5EQL A;  1W6Y A;  3VGN A;  3FKA A;  1WNH A;  2BMQ B;  3FF0 A;  2Z76 A;  3FLJ A;  1VQL 3;  5IG0 A;  1M1K 4;  3JUM A;  5JBS A;  2R4I A;  3CCR 3;  3ROB A;  1JNQ A;  3K5T A;  1L5G B;  1OPY A;  2IUK A;  3NQY A;  1OCV A;  4KVH A;  2B1X B;  3V99 A;  1O7P B;  5CF1 A;  2P09 A;  3SXX A;  1TFK A;  3JVC A;  2CG0 A;  5AI1 A;  3MG2 A;  1E3V A;  4RNZ A;  3JUP A;  4AKZ A;  1QVG 2;  3B4P A;  3KSP A;  1KQS 2;  4FMD A;  4HYZ A;  5IW9 A;  3WDG B;  1YVB I;  5JPU A;  2YFI B;  1WQL B;  3HI7 A;  4L8P A;  1W01 A;  2HMK B;  4XM4 A;  1FGM A;  1U5O A;  2W6J H;  3MWZ A;  2ZDJ A;  3ECF A;  4HM1 B;  5IEO A;  1OF5 B;  3CNM A;  3EN1 B;  3JUN A;  1GYB A;  3NX0 A;  3QRD A;  2XGL A;  2RSX A;  5KP4 A;  1NU3 A;  3T8U A;  3EX9 A;  3CCU 3;  2OTL 3;  3KN4 A;  2M7O A;  4EV5 A;  1O7M B;  2E2V A;  1HU9 A;  3WOD G;  5D82 A;  2RCD A;  2OQE A;  2C10 A;  5CXO A;  3NHX A;  1EA2 A;  1NWW A;  1W6C A;  3BNE A;  1IV9 A;  3CCL 3;  1SJW A;  3CME 3;  2W9Q A;  1TFO A;  4K90 B;  2CWU A;  4BTX A;  2CH9 A;  3LTD A;  3V98 A;  4GL6 A;  4HM4 B;  1YJN 3;  1NB5 I;  3ER7 A;  2GXF A;  3B7C A;  1A90 A;  2GBX B;  5EVH A;  1N5H A;  6STD A;  1VZZ A;  3RGA A;  1TUH A;  4STD A;  3D9R A;  2QIY A;  4RNY A;  3CCJ 3;  1OHP A;  4HM3 B;  4HM8 B;  5G2G A;  2I9W A;  5DRV A;  1FGT A;  2P0M A;  3OWY A;  1UW1 A;  1K28 A;  4OK0 A;  3DM8 A;  2WO0 A;  4HM2 B;  1D6U A;  5KP1 A;  1KD1 4;  4AKY A;  5CF2 A;  4KZ1 A;  4XB5 A;  3NBR A;  3KII A;  1UUW B;  2D1W A;  3EQQ B;  3S5C A;  4G1M B;  1T5Y A;  1GS3 A;  4HM6 B;  3OXA A;  3B8L A;  2ZL8 A;  1RN7 A;  3FF2 A;  1S72 3;  1BUQ A;  1QAK A;  3CCQ 3;  3N8B A;  4LZI A;  4AEQ A;  1IT7 A;  4FCM A;  5AEW B;  2F99 A;  1O7W B;  3OW2 2;  1EKM A;  2FXT A;  1OAC A;  1FA3 A;  3PCR A;  4FCZ A;  3D3L A;  2BHM A;  1Q40 A;  4X2O A;  1VQ5 3;  1QMA A;  4HZB B;  5BVB A;  2HMM B;  2BT3 A;  2YX9 A;  2HML B;  1GY7 A;  4RZM A;  4N6O B;  2QEX 3;  3FG4 A;  1JB4 A;  3SOY A;  4K61 A;  1Q86 4;  3UB1 A;  3Q2P A;  2SBL A;  3GWR A;  4EXR A;  1IVU A;  3UNL A;  2WOH A;  4U13 A;  4ZM8 A;  2XSH B;  3BNC A;  2ML6 A;  1M90 4;  3BLZ A;  2O9U X;  3JUQ A;  2CIU A;  2QA4 3;  1O7N B;  3HZP A;  1K73 4;  1NJI 4;  1JN5 A;  1W4N A;  4O02 B;  1W2B 2;  1SQW A;  1UI8 A;  3NBB A;  2WOF A;  3I0Y A;  1IVW A;  3OWS A;  3LTA A;  1DVC A;  2GEX A;  1VQ8 3;  1CQS A;  3X42 A;  3IJE B;  4EV2 A;  5IF6 A;  3I55 3;  5BXQ A;  2KRT A;  4HVN A;  4H3U A;  3DGO A;  4WYK A;  5D83 A;  3G8Z A;  3OX9 A;  1JV2 B;  1WMN A;  4I4K A;  1QJG A;  1W6G A;  3KSE D;  2XSO B;  3NV0 B;  4HZ9 B;  3FZW A;  3STD A;  3DGL A;  3F14 A;  2RFR A;  2CHC A;  1VQN 3;  1K8A 4;  1LNH A;  4EYC A;  3MKI A;  3CCE 3;  5KP3 A;  1W5Z A;  1JB5 A;  2O3O A;  1JB2 A;  2K54 A;  1A67 A;  2V1L A;  4FCJ A;  1R4C A;  3OV4 A;  2OOV A;  3GZY B;  1NB3 I;  2KCD A;  1MOL A;  2Z6B A;  2CFW A;  3A76 A;  1YJ9 3;  3N9H A;  3GZR A;  2E2U A;  3E99 A;  3EC9 A;  5TGN A;  3S28 A;  3LML A;  2OTJ 3;  3WA2 X;  1N8R 4;  3BNB A;  1JKG A;  1ZX2 A;  2WGQ A;  3GRD A;  1SII A;  3PXM A;  4FR9 A;  4PEJ A;  3FG3 A;  5AIH A;  7STD A;  1AV4 A;  4JF8 A;  4XBX A;  2PNC A;  3EBT A;  3Q1C A;  1YIJ 3;  5AIF A;  3IMA B;  4LGQ A;  1VQ9 3;  1RRL A;  4OUQ A;  5IG3 A;  4HM5 B;  2XFT A;  1M9G A;  2F98 A;  1TU5 A;  1OGZ A;  4R80 A;  2MF7 A;  1STF I;  3MG1 A;  2WGO A;  4R1K A;  1GY5 A;  1Q40 B;  1W00 A;  1OHO A;  2QGU A;  1J2B A;  1A2K A;  4WP5 A;  3CCM 3;  1ROV A;  3N54 B;  4HBR A;  2IUJ A;  3DGM A;  2CC3 A;  2XRX B;  3H3H A;  3Q90 A;  4Q53 A;  3G71 3;  3K0Z A;  1FGO A;  2OOV C;  3CC2 3;  3FCS B;  4NHF A;  3RDE A;  4KFE A;  1ROA A;  4O2H A;  1QAF A;  2Z7A A;  2P05 A;  1ULI B;  5AYR B;  4O8S A;  1N8Q A;  3PS8 A;  2CKF B;  1U8C B;  3NXJ A;  4EC6 A;  1HKX A;  1IV7 A;  3CXC 2;  3F40 A;  1Z1S A;  1IQX A;  1JN5 B;  2OCT A;  4IIA A;  4N6N B;  4MJD A;  3KE7 A;  1EG9 B;  4IPB A;  4CCV A;  3UL6 A;  3TDG A;  3X40 A;  1Q82 4;  1Q42 A;  1W7C A;  1LVN A;  3FGY A;  1AVK A;  1E97 A;  3DXO A;  3IPT A;  4FMA A;  5AII A;  1PFP A;  1VQK 3;  2MC8 A;  1OF5 A;  3CU3 A;  3EB8 A;  2BO9 B;  3EJV A;  4J8T A;  4TX4 A;  3SX1 A;  3VF1 A;  1ZO2 A;  3KFQ C;  3OWU A;  1VQ7 3;  5STD A;  3BB9 A;  3SED A;  1G96 A;  3BND A;  3FSD A;  2CK3 H;  4KFF A;  5IG4 A;  1ASK A;  2INX A;  2Y74 A;  1N9J A;  1PU4 A;  1VQ6 3;  2XFS A;  3G6E 3;  3HIG A;  3M8C A;  3X41 A;  5JPP A;  4LSO A;  1OHS A;  3K9M C;  3MHE A;  1LOX A;  1C7H A;  1AVL A;  1Q7Y 4;  1YHQ 3;  1A2V A;  4WFO A;  2W0Q A;  4HM0 B;  1VQM 3;  2CFG A;  4R9L A;  5LC6 A;  4HJL B;  3NM2 A;  3U1W A;  4HKV B;  4R4K A;  2W2C A;  5D81 A;  1VQP 3;  3LOY A;  4MMZ B;  4BTY A;  5IER A;  2CWT A;  3DUK A;  2K0M A;  1ULJ B;  3JUO A;  2HMN B;  3G16 A;  5AIG A;  1SPU A;  4QWT A;  1VQO 3;  4L7K A;  1TP6 A;  1GD4 A;  2IMJ A;  2GBW B;  5AEU B;  3T8N A;  5IEP A;  2STD A;  3F7X A;  3HII A;  3PZW A;  2Q07 A;  2JDI H;  5IG5 A;  2ML5 A;  1D6Y A;  1CYV A;  3LT8 A;  1CYU A;  1DVD A;  3LT9 A;  2Z77 A;  3K63 A;  3QK9 A;  1ISK A;  3RGR A;  1MNL A;  4N6M A;  5FGO A;  4OVM A;  3KKG A;  1OH0 A;  1US1 A;  4LMI A;  1W02 A;  4H61 A;  2HMO B;  4N6L A;  1QAL A;  3O8Y A;  2JQ5 A;  3S67 A;  1YGE A;  2XH9 A;  3GAX A;  1GY6 A;  5DRE A;  1WMO A;  2PZV A;  2W56 A;  5EEO A;  3AMO A;  2CW9 A;  4MMX B;  2RGQ A;  1DMM A;  1JKG B;  1OGX A;  2OWP A;  3SVA A;  2CFL A;  3F8X A;  2UX0 A;  1EQK A;  3I56 3;  1KWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...