7STDA

Scytalone dehydratase plus inhibitor 4
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scytalone dehydratase
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
total genus 49
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 7stdA00
3EN1B 4K1VA 4XB5A 3ECFA 3CNXA 3NV0A 1JN5B 3MKIA 5KP4A 2R4IA 3MG2A 3B8LA 5CK6A 4HM0B 1Q42A 4XDWA 4PEJA 1K41A 1EG9B 2W2CA 4FCMA 3MHEA 3KKGA 1OH0A 4LGQA 2HMKB 4L8OA 1NU3A 3NUVA 3FH1A 4LMIA 5IENA 3EC9A 1Z1SA 3KE7A 3B7CA 1DMNA 3WMDA 3OWUA 1TUHA 1GS3A 2XR8B 3D9RA 3FSDA 5AI1A 1ULIB 4LEHA 4WYKA 2RCDA 3OWYA 3OXAA 1JN5A 1GY7A 3RGAA 3F40A 1O7MB 1Q40B 3NV0B 3OX9A 2INXA 2XSOB 1OUNA 3EF8A 1S5AA 2B24B 4HJLB 5AEWB 5KP3A 3GZYB 1OHOA 1ZO2A 3DMCA 3DZLA 3JUMA 5IF6A 3SOAA 5IG0A 3UJMA 3G8ZA 3ROBA 3BB9A 3BLZA 3EHCA 3OWSA 4R9KA 2STDA 2HMNB 3FKAA 3JUPA 5AIHA 1EA2A 3EX9A 1DMQA 3CNMA 3KZTA 4X2HA 2IMJA 3M8CA 3A76A 4WP5A 4WYKB 4HM3B 3FF2A 1C7HA 4U13A 5D82A 1Q40A 1OCVA 1QJGA 2F86B 3F9SA 2HMJB 3KSPA 5IEPA 7STDA 4HM1B 3FZWA 2GEXA 3STDA 3VGNA 3I0YA 6STDA 2I9WA 3G0KA 3EBYA 1OHPA 3B4PA 5IG4A 1UUVB 3LZAA 4X2OA 1W02A 1TP6A 4XBXA 3DM8A 5DRVA 1OGZA 3DXOA 5TGNA 3MG3A 4HM4B 3SOYA 4J8TA 4H3UA 2CKFB 5KP1A 5D83A 3H51A 5G2GA 3NBRA 2OWPA 5JPUA 3JUQA 1E97A 2A15A 1IDPA 1BUQA 2XSHB 1E3RA 4ORLA 1JKGA 1SJWA 5AIFA 1W6YA 4HM6B 2QGUA 4KVHA 5IERA 5JPPA 3IPTA 2K54A 2GXFA 4R1KA 4STDA 1OGXA 4I4KA 4HZBB 3G16A 3GZXB 2CHCA 3GZRA 3DUKA 3ER7A 4Q53A 2Z76A 1A2KA 5DREA 1W01A 4HM7B 4FCJA 2BMQB 1JB4A 4N3VA 1CQSA 5IG3A 4XBYA 3K0ZA 4XDVA 1O7PB 4OUQA 4L7KA 3F8XA 1O7WB 4GB5A 2Z77A 1JB5A 1DMMA 2HMLB 3RGRA 2JQ5A 5IEOA 1JKGB 3CPOA 3HZPA 3GRDA 4XBTA 3MYTA 5CXOA 2YFIB 4CDLA 5FW5A 2F98A 3MG1A 1AR0A 4MJDA 1WQLB 2BMOB 1NDOB 2UX0A 2HMMB 4RZMA 1VZZA 3FGYA 1E3VA 4K1UA 2GBWB 1O7GB 3MSOA 3F7XA 5AEUB 5EVHA 2PZVA 2GEYA 3OV4A 1OPYA 3NHXA 5AIGA 1GY5A 3JUOA 1ZX2A 3FF0A 5CF1A 5STDA 2HMOB 2Z7AA 4R9LA 2YFJB 3T8NA 5CF2A 2QIYA 4OVMA 3CU3A 3F14A 4HKVB 1OF5B 3FLJA 1QMAA 3LYGA 4HM2B 3B4OA 3HX8A 1STDA 3UNLA 3F7SA 3T8UA 4HZ9B 4L8PA 8CHOA 4HVNA 2RFRA 3H3HA 5AIIA 3GWRA 2F99A 1U5OA 1HKXA 2BNGA 1O7HB 2YFLB 1GY6A 1NWWA 3EBTA 5HGRA 1JB2A 3Q90A 3GZBA 3EJVA 2XRXB 5BVBA 1ISKA 1OHSA 3VSYA 3JUNA 3EQQB 5D81A 1ULJB 1GYBA 1O7NB 2B1XB 5CLKA 4WWUC 1W00A 4J9AA 3S5CA 1OF5A 4IIAA 2GBXB 3EN8A 3HK4A 4HM8B 3E99A 3SEDA 3F8HA 2BMRB 1UUWB 4HM5B 3K7CA 1ASKA 3NM2A 2RGQA 3NXJA 5BXQA 4XM4A 5IG5A
chains in the Genus database with same CATH superfamily
2W03A 1HYFA 3EN1B 4N6UA 3NBJA 4K1VA 1SPUA 4XB5A 1FA3A 3CCU3 1DETA 2WGOA 3ECFA 1EKMA 1I3FA 3CNXA 1BNJA 3NV0A 1I2EA 1JN5B 3MKIA 4HOHA 5KP4A 1IT8A 1T2IA 2R4IA 4G1MB 3MG2A 4IT7A 3D5GA 3DGNA 1ISKA 1MGRA 1QAKA 3B8LA 3G713 5CK6A 2KF3A 4HM0B 3NQZA 1Q42A 4XDWA 4PEJA 5AYRB 2CFDA 1FGQA 1K41A 2IYJA 1AQZA 1EG9B 1RN1A 1BAOA 3V98A 1VQ43 2W2CA 1UI7A 1N9JA 2O3OA 1YGWA 5HOHA 5AYSC 1M1XB 1Q864 2BHMA 1WNHA 4FCMA 3SVAA 2CG0A 3MHEA 3KKGA 1OH0A 1N9EA 4LGQA 9RNTA 1B21A 4FMAA 3WA2X 2HMKB 3T0UA 1IVUA 1CYUA 2KRTA 4L8OA 2ZHXB 1OACA 4EV2A 1NU3A 1RGLA 2WOFA 3FH1A 3NUVA 3PYJA 3Q1CA 1Q7HA 4LMIA 3ALAA 5IENA 2BO9B 3EC9A 5LC6A 1Z1SA 1STFI 3B7CA 1DMNA 3KE7A 1CH0A 3D3LA 3WMDA 3CCM3 3LMLA 1T5YA 4FMBA 3OWUA 1BRJA 3IJEB 1TUHA 1L5GB 1GS3A 1RMSA 3AGOA 1LQGC 2XR8B 3D9RA 2W56A 3DH2A 3K9MC 3L0RA 1Q7Y4 2LYXA 3FSDA 4RNZA 5AI1A 4O02B 1FUWA 3BNCA 2Z6BA 1B2ZA 1ULIB 3O8YA 1SIIA 1BU4A 4LEHA 1MGWA 2RSXA 1RGKA 2W6JH 1CEWI 2Y73A 1VQO3 4GSPA 1IVXA 4WYKA 5BU4A 3WA3A 1NB3I 1FUTA 1ZGXA 1US1A 2RCDA 1PFPA 3OXAA 3OWYA 1EUIC 4N6OB 2OTJ3 2CFKA 2M7OA 1JN5A 1GY7A 1ROVA 2SARA 3RGAA 1B20A 3F40A 2P38A 3WODG 1BSCA 1O7MB 3LOYA 2IUKA 1Q40B 3NV0B 3OX9A 4EW5A 2IA7A 2AAEA 2ZL8A 1SQWA 2INXA 2XSOB 1UDII 1WMNA 1OUNA 2Y74A 1KC84 3EF8A 1S5AA 2B24B 4OK0A 2CFGA 4HJLB 5AEWB 1IQ8A 1I2FA 3GZYB 1OHOA 5KP3A 3I553 1ZO2A 3WOFB 1EEJA 3QK9A 3N54B 2QA43 1M904 3D4AA 3DMCA 4LZIA 3DZLA 3JUMA 3ZFZA 5IF6A 4H61A 1WTHA 1JRQA 1HU9A 3SOAA 1YI23 5IG0A 3UJMA 2SBLA 4I5QA 3G8ZA 4GL6A 3U97A 1B3SA 1BNGA 4NREA 1FW7A 3BB9A 3ROBA 1FGOA 3BLZA 3EHCA 3S27A 2C10A 3OWSA 4MEIA 4R9KA 1DE3A 2STDA 2HMNB 3RNTA 5I97A 1Q9EA 4N6TA 3RDEA 5LC7A 4JRFA 1LNIA 3FKAA 3JUPA 1VQN3 4KT3B 1BNEA 5AIHA 1EA2A 1RTUA 4QWTA 1W7CA 2W56B 3EX9A 1RGCA 3KN4A 2XEPA 1I0XA 1DMQA 3CNMA 1FGRA 3KZTA 1RCLA 4RNYA 1MWTA 4X2HA 3UL5A 2IMJA 3LTCA 3M8CA 2OCTA 1JBTA 1ROAA 2XGNA 1FGTA 4NHFA 1N8R4 2XF3A 3DGOA 1S723 1FUSA 1V57A 3A76A 4N6MA 4AKYA 3LTAA 4WP5A 4WYKB 1A67A 2C4BA 4HM3B 3FF2A 1C7HA 3CCJ3 4U13A 3EE1A 1LRAA 1TFOA 3G6E3 4CJNA 3BNBA 5D82A 1Q40A 8RNTA 1OCVA 4BIRA 2KF5A 1LOYA 3NM7A 3ZG5A 1QJGA 1UW1A 3MWZA 1BNIA 2F86B 1I8VA 1JZDA 2HMJB 1AY7A 3F9SA 3KSPA 4KFDA 2P05A 4WFOA 3X41A 3ZG0A 5IEPA 1RRLA 1Y4KA 5G1KA 7STDA 1JJ22 1VQ93 1IV7A 2CG1A 2FNQA 5EEOA 2CX0A 2KF6A 3AHSA 1A2VA 4GHOA 4HM1B 3FZWA 1IQYA 2GEXA 1RHLA 2W04A 3STDA 3VGNA 1YIT3 3WDGB 3IMAB 3I0YA 1BSDA 2PNCA 2ZA4A 6STDA 3FG1A 3Q3FA 1UI8A 1AVKA 2UUGC 2I9WA 2CIUA 3G0KA 3EBYA 1OHPA 1K8A4 1IV9A 3B4PA 5IG4A 1UUVB 3LZAA 1IT7A 4FCZA 4X2OA 1W02A 3BNEA 1TP6A 4XBXA 1UUGB 3DM8A 3BIRA 2RBIA 3A5EA 1UCIA 3PZWA 3HIIA 4NPBA 5DRVA 1OGZA 3DXOA 5M19A 3CCE3 5TGNA 1NO3A 3MG3A 4HM4B 3SOYA 4MMZB 1VQ73 1GMQA 4J8TA 2W9QA 1FGMA 3PCRA 2XFSA 1YJN3 4H3UA 2CKFB 4IPBA 5KP1A 2CC3A 2P09A 5D83A 2GU3A 3H51A 2WO0A 3HI7A 2CWUA 3NBRA 4KZ1A 5G2GA 3CXC2 1EQKA 1VQ63 1B27A 1PU4A 1BRSA 2OWPA 1G02A 3HOHA 1T2HA 5JPUA 3CC73 2FXTA 3JUQA 3LH4A 1E97A 2A15A 3SX1A 7GSPA 1IDPA 2CH9A 1BUQA 4EYCA 2KCDA 1YGEA 1NJI4 1BSBA 2XSHB 1E3RA 4ORLA 1JKGA 1BNRA 2GSPA 1BRNL 1SJWA 1BRGA 4KFFA 1SIHA 5AIFA 2CK3H 1NB5I 2XGLA 1LOVA 2F56A 3X3ZA 1YIJ3 3NX0A 1FZUA 3X3YA 1W6YA 4HM6B 2QGUA 4DKIA 1KD14 3S29A 4JF8A 4KVHA 2V1LA 4N6V0 5IERA 1I0VA 2CX1A 5JPPA 4AEQA 1VQ83 3JVCA 1I3IA 3IPTA 4BU4A 1I2GA 1DYUA 2K54A 3AHWA 1D6ZA 2GXFA 3URPA 1UCJA 4R1KA 4AKZA 1BNSA 2ML6A 3X42A 4CPKA 1Q814 1K9M4 1GOVA 4STDA 1OGXA 2CW9A 2AADA 1B2UA 4HZBB 4I4KA 3G16A 3GZXB 2CHCA 1BANA 1VQQA 1BRKA 3DUKA 3DGMA 3GZRA 1UGIA 3ER7A 1GOUA 6RNTA 1IK3A 4Q53A 2Q07A 3CPW2 2Z76A 1A2KA 1RKYA 5DREA 1W01A 4R80A 2D1WA 2H0HA 1W5ZA 2KXGA 1QALA 4HM7B 2L1SA 4FCJA 1VQ53 1W2ZA 2BMQB 3D79A 1T3BA 1FYSA 1JB4A 1WMOA 3TDGA 4BL2A 1LXEA 4N3VA 5ELUA 1CQSA 3K63A 1X1UA 4N6NB 1YVBI 4EV5A 4FMCA 5IG3A 1B2XA 1N5PA 4MMYB 1VQM3 4XBYA 3KCHA 3K0ZA 3FG3A 4KFEA 1RLSA 1D6YA 4XDVA 3SYUA 3Q2PA 1VQP3 2IUJA 1O7PB 2CWTA 1RGFA 1YVSA 1DVCA 4MMXB 1SARA 3FG4A 4OUQA 5GSPA 3CC43 4J5GA 4L7KA 4BTXA 2OOVC 3F8XA 1O7WB 4FR9A 4GB5A 2Z77A 3G4S3 1JB5A 1GMPA 1IQXA 2F4YA 1YJW3 1DMMA 1TTOA 4LSOA 2HMLB 4BTYA 4O2HA 2P0XA 3K5TA 1NNVA 3RGRA 2JQ5A 3NBBA 1BNFA 2BT3A 4R4KA 1IYYA 2XH9A 1M9GA 1RGAA 3FCSB 5IEOA 6GSPA 4RBNA 1JKGB 3BNDA 3CPOA 2OQEA 5IW9A 1BRHA 1B2MA 3HZPA 2W0QA 1BIRA 3GRDA 4O8SA 1BOXA 4XBTA 2H0GA 3MYTA 1Q824 4EBGA 3J7Yd 5CXOA 2YFIB 3NQYA 4HYZA 4CDLA 4BL3A 1R4CA 2GU1A 3AGNA 5FW5A 2F98A 1I70A 1U8CB 3KFQC 1V74A 1RN4A 3MG1A 3CCQ3 1J2BA 1AR0A 3CME3 3V92A 2OQEC 1X1WA 3CCL3 4MJDA 1WQLB 2BMOB 1NDOB 2UGIA 2H0IA 1MWUA 2UX0A 3LTDA 3PCSA 3X3XA 3CMA3 2HMMB 4RZMA 1K28A 4HBRA 3I563 1VZZA 2FGTA 3FGYA 1WMPA 1E3VA 4K1UA 3DGYA 2GBWB 4EC6A 3KIIA 1O7GB 4WHAA 3UB1A 3MSOA 1JNQA 3F7XA 5AEUB 5EVHA 1W4NA 2PZVA 1G0TA 1BSEA 1D6UA 2GEYA 2YX9A 3OV4A 1OPYA 1G96A 3NHXA 1MNLA 2WGQA 1CYVA 1RNTA 1A2PA 2WOHA 5AIGA 1GY5A 5G1LA 3JUOA 2K3DA 5JBSA 1RDSA 1ZX2A 3AMOA 3FF0A 3CC23 5CF1A 5STDA 4FMDA 2HMOB 4LYLB 1UGHI 1N5HA 2Z7AA 3HIGA 2RNTA 1JZOA 4R9LA 2E2VA 2YFJB 1RGEA 1RN7A 2E2TA 3T8NA 1BVIA 1RSNA 1C54A 2ZDJA 3WHOA 5CF2A 2QIYA 3CD63 1BGSA 1IVVA 1TRPA 3EB8A 4OVMA 1TU5A 1TIJA 1KSIA 1IU7A 3CU3A 3DY5A 4EXRA 3F14A 3LXUX 1BRIA 1X1XA 4HKVB 1GOYA 1YJ93 4ILFA 2BU4A 1MOLA 2K0MA 3PGBA 1OF5B 3CCS3 1HZ1A 1LOWA 4RNTA 2W9PA 5A0OB 7RNTA 2IY2A 1LQMB 3FLJA 1QMAA 3LYGA 4HM2B 2XFTA 3B4OA 5FGOA 5M1AA 2D42A 3HX8A 3PXMA 1STDA 5RNTA 1RJOA 4HAAA 1MWSA 1RRHA 3UNLA 3V99A 1JV2B 3F7SA 2F5WA 3T8UA 1LNHA 4HZ9B 4L8PA 2OTL3 8CHOA 1TRQA 4HVNA 3CCV3 1RCKA 2RFRA 3D5IA 1UCLA 1F8NA 1ZS7A 3H3HA 1W2B2 1RNBA 3WR2A 4TX4A 5AIIA 3GWRA 2F99A 2KAAA 1BSAA 4O3VA 1DVDA 2CWVA 2R41A 1TJDA 3WOEB 1U5OA 1AVLA 1HKXA 1JBSA 1IVWA 2JDIH 2BNGA 1O7HB 2F5MA 1PYLA 2CFLA 1RGHA 2YFLB 3PS8A 1GD4A 1N8QA 4CCVA 1QVG2 3DGLA 2ML5A 3KSED 1GY6A 1NWWA 2C11A 3EBTA 1BUJA 5HGRA 1TFKA 3OW22 1MWRA 1JB2A 2CFWA 3GZBA 3Q90A 3S28A 2J8XB 2L4VA 4J5KA 3SXXA 3EJVA 5BIRA 1K734 2XRXB 2OOVA 5BVBA 1KWIA 3LT8A 1GD3A 2P0MA 1OHSA 1W6GA 3VSYA 3X40A 3VF1A 5M18A 3JUNA 1YNVX 3AMOB 3UL6A 3EQQB 1A90A 1R4YA 2BIRA 2LQVA 4BTWA 3GAXA 5D81A 1QAFA 3MPHA 4ZM8A 1ULJB 4N6LA 1QVF2 1GYBA 1O7NB 2MC8A 2B1XB 5CLKA 1VQK3 1M1K4 3LTBA 1W00A 4WWUC 4J9AA 3N8BA 1VQL3 3CCR3 3S5CA 1JBRA 1OF5A 4IIAA 2GBXB 2HOHA 2E2UA 1B2SA 1W6CA 3EN8A 3HK4A 3E99A 3QRDA 4HM8B 3SEDA 3LT9A 3S67A 1PY3A 3N9HA 4K90B 1GSPA 3F8HA 3SLUA 1GMRA 2MF7A 4K61A 1V58A 1UCKA 1X1YA 2KF4A 2BMRB 5ELJA 3U1WA 1UUWB 4HM5B 3K7CA 1KQS2 1ASKA 3NM2A 3GSPA 1LOXA 1RGGA 2O9UX 2RGQA 1LVNA 3NXJA 5BXQA 1YHQ3 1AV4A 4XM4A 3BU4A 5EQLA 2QEX3 5IG5A
chains in the Genus database with same CATH topology
2W03A 3EN1B 4N6UA 3NBJA 4K1VA 1SPUA 4XB5A 1FA3A 3CCU3 2WGOA 3ECFA 1EKMA 3CNXA 3NV0A 1JN5B 3MKIA 5KP4A 1IT8A 4G1MB 2R4IA 3MG2A 4IT7A 3DGNA 1ISKA 1QAKA 3B8LA 3G713 5CK6A 4HM0B 3NQZA 1Q42A 4XDWA 4PEJA 5AYRB 2CFDA 1FGQA 1K41A 1EG9B 3V98A 1VQ43 2W2CA 1UI7A 1N9JA 2O3OA 1Q864 5AYSC 1M1XB 2BHMA 1WNHA 4FCMA 3SVAA 2CG0A 3MHEA 3KKGA 1OH0A 1N9EA 4LGQA 4FMAA 3WA2X 2HMKB 3T0UA 1IVUA 1CYUA 2KRTA 4L8OA 1OACA 4EV2A 1NU3A 3NUVA 2WOFA 3FH1A 3PYJA 3Q1CA 4LMIA 3ALAA 5IENA 2BO9B 3EC9A 5LC6A 1Z1SA 1STFI 3B7CA 1DMNA 3KE7A 3WMDA 3D3LA 3CCM3 3LMLA 1T5YA 4FMBA 3OWUA 3IJEB 1TUHA 1L5GB 1GS3A 2XR8B 3D9RA 2W56A 3K9MC 3L0RA 1Q7Y4 2LYXA 3FSDA 4RNZA 5AI1A 4O02B 1FUWA 3BNCA 2Z6BA 1ULIB 3O8YA 1SIIA 4LEHA 2RSXA 2W6JH 2Y73A 1CEWI 1VQO3 1IVXA 4WYKA 3WA3A 1NB3I 4N6OB 2RCDA 1US1A 3OWYA 1PFPA 3OXAA 2OTJ3 2CFKA 2M7OA 1JN5A 1GY7A 1ROVA 3RGAA 3F40A 2P38A 3WODG 1O7MB 3LOYA 2IUKA 1Q40B 3NV0B 3OX9A 2IA7A 2ZL8A 1SQWA 2INXA 2XSOB 1WMNA 1OUNA 2Y74A 1KC84 3EF8A 1S5AA 2B24B 4OK0A 2CFGA 4HJLB 5AEWB 1IQ8A 3GZYB 5KP3A 1OHOA 3I553 1ZO2A 3WOFB 3QK9A 3N54B 2QA43 1M904 3DMCA 4LZIA 3DZLA 3JUMA 5IF6A 4H61A 1WTHA 1JRQA 1HU9A 3SOAA 1YI23 5IG0A 3UJMA 2SBLA 3G8ZA 4GL6A 3U97A 4NREA 3BB9A 3ROBA 1FGOA 3BLZA 3EHCA 3S27A 2C10A 3OWSA 4MEIA 4R9KA 2STDA 2HMNB 5I97A 4N6TA 3RDEA 5LC7A 4JRFA 3FKAA 3JUPA 1VQN3 5AIHA 1EA2A 4QWTA 1W7CA 2W56B 3EX9A 3KN4A 2XEPA 1DMQA 3CNMA 1FGRA 3KZTA 4RNYA 3UL5A 4X2HA 2IMJA 3LTCA 3M8CA 2OCTA 1ROAA 2XGNA 1FGTA 4NHFA 1N8R4 2XF3A 3DGOA 1S723 3A76A 4N6MA 4AKYA 3LTAA 4WP5A 4WYKB 1A67A 4HM3B 3FF2A 1C7HA 3CCJ3 4U13A 3EE1A 1TFOA 3G6E3 3BNBA 5D82A 1Q40A 1OCVA 3NM7A 1QJGA 1UW1A 3MWZA 2F86B 3F9SA 2HMJB 3KSPA 4KFDA 4WFOA 2P05A 3X41A 5IEPA 1RRLA 1Y4KA 7STDA 1VQ93 1JJ22 1IV7A 2CG1A 2FNQA 5EEOA 1A2VA 4HM1B 3FZWA 1IQYA 2GEXA 2W04A 3STDA 3VGNA 1YIT3 3WDGB 3IMAB 3I0YA 2PNCA 6STDA 3FG1A 1UI8A 1AVKA 2I9WA 2CIUA 3G0KA 3EBYA 1OHPA 1K8A4 1IV9A 3B4PA 5IG4A 1UUVB 3LZAA 1IT7A 4FCZA 4X2OA 1W02A 3BNEA 1TP6A 4XBXA 3DM8A 3PZWA 3HIIA 5DRVA 1OGZA 3DXOA 3CCE3 5TGNA 1NO3A 3MG3A 4HM4B 3SOYA 4MMZB 1VQ73 4J8TA 2W9QA 1FGMA 3PCRA 2XFSA 1YJN3 4H3UA 2CKFB 4IPBA 5KP1A 2CC3A 2P09A 5D83A 2GU3A 3H51A 2WO0A 3HI7A 2CWUA 3NBRA 4KZ1A 5G2GA 3CXC2 1EQKA 1VQ63 1PU4A 2OWPA 3CC73 5JPUA 2FXTA 3JUQA 3LH4A 1E97A 2A15A 3SX1A 1IDPA 2CH9A 1BUQA 4EYCA 2KCDA 1YGEA 1NJI4 2XSHB 1E3RA 4ORLA 1JKGA 1SJWA 5AIFA 4KFFA 1SIHA 2CK3H 1NB5I 2XGLA 3X3ZA 1YIJ3 3NX0A 3X3YA 1W6YA 4HM6B 2QGUA 1KD14 3S29A 4JF8A 4KVHA 2V1LA 4N6V0 5IERA 1VQ83 5JPPA 4AEQA 3JVCA 3IPTA 1DYUA 2K54A 4AKZA 1D6ZA 2GXFA 4R1KA 1Q814 2ML6A 3X42A 1K9M4 4STDA 1OGXA 2CW9A 4I4KA 4HZBB 3G16A 3GZXB 2CHCA 3GZRA 3DUKA 3DGMA 1IK3A 3ER7A 4Q53A 2Q07A 3CPW2 2Z76A 1A2KA 1RKYA 5DREA 1W01A 4R80A 2D1WA 1W5ZA 2KXGA 1QALA 4HM7B 4FCJA 1VQ53 1W2ZA 2BMQB 1JB4A 1WMOA 3TDGA 1LXEA 4N3VA 5ELUA 1CQSA 3K63A 4N6NB 4EV5A 1YVBI 4FMCA 5IG3A 1VQM3 1N5PA 4MMYB 4XBYA 3K0ZA 3FG3A 4KFEA 1D6YA 4XDVA 3Q2PA 1VQP3 2IUJA 1O7PB 2CWTA 1DVCA 4MMXB 4OUQA 3FG4A 3CC43 4L7KA 4BTXA 2OOVC 3F8XA 1O7WB 4FR9A 4GB5A 2Z77A 3G4S3 1JB5A 1IQXA 1YJW3 1DMMA 4LSOA 2HMLB 4BTYA 4O2HA 2P0XA 3K5TA 3RGRA 2JQ5A 3NBBA 4R4KA 2BT3A 2XH9A 1M9GA 3FCSB 5IEOA 4RBNA 1JKGB 3BNDA 3CPOA 2OQEA 5IW9A 3HZPA 2W0QA 3GRDA 4O8SA 4XBTA 3MYTA 1Q824 4EBGA 3J7Yd 5CXOA 2YFIB 3NQYA 4HYZA 4CDLA 1R4CA 2GU1A 5FW5A 2F98A 1U8CB 3KFQC 1V74A 3MG1A 3CCQ3 1J2BA 1AR0A 3CME3 3V92A 2OQEC 3CCL3 4MJDA 1WQLB 2BMOB 1NDOB 2UX0A 3LTDA 3PCSA 3X3XA 3CMA3 2HMMB 4RZMA 1K28A 4HBRA 3I563 1VZZA 2FGTA 3FGYA 1WMPA 1E3VA 4K1UA 2GBWB 4EC6A 3KIIA 1O7GB 4WHAA 3UB1A 3MSOA 1JNQA 3F7XA 5AEUB 5EVHA 1W4NA 2PZVA 2GEYA 1D6UA 2YX9A 3OV4A 1OPYA 1G96A 3NHXA 1MNLA 2WGQA 1CYVA 2WOHA 5AIGA 1GY5A 3JUOA 5JBSA 1ZX2A 3AMOA 3FF0A 3CC23 5CF1A 5STDA 4FMDA 2HMOB 1N5HA 2Z7AA 3HIGA 4R9LA 2E2VA 2YFJB 2E2TA 1RN7A 3T8NA 2ZDJA 5CF2A 2QIYA 3CD63 1IVVA 4OVMA 3EB8A 1TU5A 1TIJA 1KSIA 1IU7A 3CU3A 3DY5A 4EXRA 3F14A 3LXUX 4HKVB 1YJ93 1MOLA 2K0MA 3PGBA 1OF5B 3CCS3 2W9PA 5A0OB 3FLJA 1QMAA 3LYGA 4HM2B 2XFTA 3B4OA 5FGOA 2D42A 3HX8A 3PXMA 1STDA 1RJOA 1RRHA 3UNLA 3V99A 1JV2B 3F7SA 3T8UA 1LNHA 4HZ9B 4L8PA 2OTL3 8CHOA 4HVNA 3CCV3 2RFRA 1F8NA 3H3HA 1W2B2 4TX4A 5AIIA 3GWRA 2F99A 4O3VA 1DVDA 2CWVA 3WOEB 1U5OA 1AVLA 1HKXA 1IVWA 2JDIH 2BNGA 1O7HB 2CFLA 4CCVA 2YFLB 3PS8A 1GD4A 1N8QA 1QVG2 3DGLA 2ML5A 3KSED 1GY6A 1NWWA 2C11A 3EBTA 5HGRA 1TFKA 3OW22 1JB2A 2CFWA 3GZBA 3Q90A 3S28A 2L4VA 3SXXA 3EJVA 1K734 2XRXB 2OOVA 5BVBA 1KWIA 3LT8A 1GD3A 2P0MA 1OHSA 1W6GA 3VSYA 3X40A 3VF1A 3JUNA 3AMOB 3UL6A 3EQQB 1A90A 2LQVA 4BTWA 3GAXA 5D81A 1QAFA 3MPHA 4ZM8A 1ULJB 4N6LA 1QVF2 1GYBA 1O7NB 2MC8A 2B1XB 5CLKA 1VQK3 1M1K4 3LTBA 1W00A 4WWUC 4J9AA 3N8BA 1VQL3 3CCR3 3S5CA 1OF5A 4IIAA 2GBXB 2E2UA 3EN8A 1W6CA 3HK4A 3QRDA 3E99A 4HM8B 3SEDA 3LT9A 3S67A 3N9HA 4K90B 3F8HA 3SLUA 2MF7A 4K61A 1KQS2 5ELJA 2BMRB 3U1WA 1UUWB 4HM5B 3K7CA 1ASKA 3NM2A 1LOXA 2RGQA 2O9UX 3NXJA 1LVNA 5BXQA 1YHQ3 1AV4A 4XM4A 5EQLA 2QEX3 5IG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EN1 B;  4K1V A;  4XB5 A;  3ECF A;  3CNX A;  3NV0 A;  1JN5 B;  3MKI A;  5KP4 A;  2R4I A;  3MG2 A;  3B8L A;  5CK6 A;  4HM0 B;  1Q42 A;  4XDW A;  4PEJ A;  1K41 A;  1EG9 B;  2W2C A;  4FCM A;  3MHE A;  3KKG A;  1OH0 A;  4LGQ A;  2HMK B;  4L8O A;  1NU3 A;  3NUV A;  3FH1 A;  4LMI A;  5IEN A;  3EC9 A;  1Z1S A;  3KE7 A;  3B7C A;  1DMN A;  3WMD A;  3OWU A;  1TUH A;  1GS3 A;  2XR8 B;  3D9R A;  3FSD A;  5AI1 A;  1ULI B;  4LEH A;  4WYK A;  2RCD A;  3OWY A;  3OXA A;  1JN5 A;  1GY7 A;  3RGA A;  3F40 A;  1O7M B;  1Q40 B;  3NV0 B;  3OX9 A;  2INX A;  2XSO B;  1OUN A;  3EF8 A;  1S5A A;  2B24 B;  4HJL B;  5AEW B;  5KP3 A;  3GZY B;  1OHO A;  1ZO2 A;  3DMC A;  3DZL A;  3JUM A;  5IF6 A;  3SOA A;  5IG0 A;  3UJM A;  3G8Z A;  3ROB A;  3BB9 A;  3BLZ A;  3EHC A;  3OWS A;  4R9K A;  2STD A;  2HMN B;  3FKA A;  3JUP A;  5AIH A;  1EA2 A;  3EX9 A;  1DMQ A;  3CNM A;  3KZT A;  4X2H A;  2IMJ A;  3M8C A;  3A76 A;  4WP5 A;  4WYK B;  4HM3 B;  3FF2 A;  1C7H A;  4U13 A;  5D82 A;  1Q40 A;  1OCV A;  1QJG A;  2F86 B;  3F9S A;  2HMJ B;  3KSP A;  5IEP A;  7STD A;  4HM1 B;  3FZW A;  2GEX A;  3STD A;  3VGN A;  3I0Y A;  6STD A;  2I9W A;  3G0K A;  3EBY A;  1OHP A;  3B4P A;  5IG4 A;  1UUV B;  3LZA A;  4X2O A;  1W02 A;  1TP6 A;  4XBX A;  3DM8 A;  5DRV A;  1OGZ A;  3DXO A;  5TGN A;  3MG3 A;  4HM4 B;  3SOY A;  4J8T A;  4H3U A;  2CKF B;  5KP1 A;  5D83 A;  3H51 A;  5G2G A;  3NBR A;  2OWP A;  5JPU A;  3JUQ A;  1E97 A;  2A15 A;  1IDP A;  1BUQ A;  2XSH B;  1E3R A;  4ORL A;  1JKG A;  1SJW A;  5AIF A;  1W6Y A;  4HM6 B;  2QGU A;  4KVH A;  5IER A;  5JPP A;  3IPT A;  2K54 A;  2GXF A;  4R1K A;  4STD A;  1OGX A;  4I4K A;  4HZB B;  3G16 A;  3GZX B;  2CHC A;  3GZR A;  3DUK A;  3ER7 A;  4Q53 A;  2Z76 A;  1A2K A;  5DRE A;  1W01 A;  4HM7 B;  4FCJ A;  2BMQ B;  1JB4 A;  4N3V A;  1CQS A;  5IG3 A;  4XBY A;  3K0Z A;  4XDV A;  1O7P B;  4OUQ A;  4L7K A;  3F8X A;  1O7W B;  4GB5 A;  2Z77 A;  1JB5 A;  1DMM A;  2HML B;  3RGR A;  2JQ5 A;  5IEO A;  1JKG B;  3CPO A;  3HZP A;  3GRD A;  4XBT A;  3MYT A;  5CXO A;  2YFI B;  4CDL A;  5FW5 A;  2F98 A;  3MG1 A;  1AR0 A;  4MJD A;  1WQL B;  2BMO B;  1NDO B;  2UX0 A;  2HMM B;  4RZM A;  1VZZ A;  3FGY A;  1E3V A;  4K1U A;  2GBW B;  1O7G B;  3MSO A;  3F7X A;  5AEU B;  5EVH A;  2PZV A;  2GEY A;  3OV4 A;  1OPY A;  3NHX A;  5AIG A;  1GY5 A;  3JUO A;  1ZX2 A;  3FF0 A;  5CF1 A;  5STD A;  2HMO B;  2Z7A A;  4R9L A;  2YFJ B;  3T8N A;  5CF2 A;  2QIY A;  4OVM A;  3CU3 A;  3F14 A;  4HKV B;  1OF5 B;  3FLJ A;  1QMA A;  3LYG A;  4HM2 B;  3B4O A;  3HX8 A;  1STD A;  3UNL A;  3F7S A;  3T8U A;  4HZ9 B;  4L8P A;  8CHO A;  4HVN A;  2RFR A;  3H3H A;  5AII A;  3GWR A;  2F99 A;  1U5O A;  1HKX A;  2BNG A;  1O7H B;  2YFL B;  1GY6 A;  1NWW A;  3EBT A;  5HGR A;  1JB2 A;  3Q90 A;  3GZB A;  3EJV A;  2XRX B;  5BVB A;  1ISK A;  1OHS A;  3VSY A;  3JUN A;  3EQQ B;  5D81 A;  1ULJ B;  1GYB A;  1O7N B;  2B1X B;  5CLK A;  4WWU C;  1W00 A;  4J9A A;  3S5C A;  1OF5 A;  4IIA A;  2GBX B;  3EN8 A;  3HK4 A;  4HM8 B;  3E99 A;  3SED A;  3F8H A;  2BMR B;  1UUW B;  4HM5 B;  3K7C A;  1ASK A;  3NM2 A;  2RGQ A;  3NXJ A;  5BXQ A;  4XM4 A;  5IG5 A; 
#chains in the Genus database with same CATH topology
 2W03 A;  1HYF A;  3EN1 B;  4N6U A;  3NBJ A;  4K1V A;  1SPU A;  4XB5 A;  1FA3 A;  3CCU 3;  1DET A;  2WGO A;  3ECF A;  1EKM A;  1I3F A;  3CNX A;  1BNJ A;  3NV0 A;  1I2E A;  1JN5 B;  3MKI A;  4HOH A;  5KP4 A;  1IT8 A;  1T2I A;  2R4I A;  4G1M B;  3MG2 A;  4IT7 A;  3D5G A;  3DGN A;  1ISK A;  1MGR A;  1QAK A;  3B8L A;  3G71 3;  5CK6 A;  2KF3 A;  4HM0 B;  3NQZ A;  1Q42 A;  4XDW A;  4PEJ A;  5AYR B;  2CFD A;  1FGQ A;  1K41 A;  2IYJ A;  1AQZ A;  1EG9 B;  1RN1 A;  1BAO A;  3V98 A;  1VQ4 3;  2W2C A;  1UI7 A;  1N9J A;  2O3O A;  1YGW A;  5HOH A;  5AYS C;  1M1X B;  1Q86 4;  2BHM A;  1WNH A;  4FCM A;  3SVA A;  2CG0 A;  3MHE A;  3KKG A;  1OH0 A;  1N9E A;  4LGQ A;  9RNT A;  1B21 A;  4FMA A;  3WA2 X;  2HMK B;  3T0U A;  1IVU A;  1CYU A;  2KRT A;  4L8O A;  2ZHX B;  1OAC A;  4EV2 A;  1NU3 A;  1RGL A;  2WOF A;  3FH1 A;  3NUV A;  3PYJ A;  3Q1C A;  1Q7H A;  4LMI A;  3ALA A;  5IEN A;  2BO9 B;  3EC9 A;  5LC6 A;  1Z1S A;  1STF I;  3B7C A;  1DMN A;  3KE7 A;  1CH0 A;  3D3L A;  3WMD A;  3CCM 3;  3LML A;  1T5Y A;  4FMB A;  3OWU A;  1BRJ A;  3IJE B;  1TUH A;  1L5G B;  1GS3 A;  1RMS A;  3AGO A;  1LQG C;  2XR8 B;  3D9R A;  2W56 A;  3DH2 A;  3K9M C;  3L0R A;  1Q7Y 4;  2LYX A;  3FSD A;  4RNZ A;  5AI1 A;  4O02 B;  1FUW A;  3BNC A;  2Z6B A;  1B2Z A;  1ULI B;  3O8Y A;  1SII A;  1BU4 A;  4LEH A;  1MGW A;  2RSX A;  1RGK A;  2W6J H;  1CEW I;  2Y73 A;  1VQO 3;  4GSP A;  1IVX A;  4WYK A;  5BU4 A;  3WA3 A;  1NB3 I;  1FUT A;  1ZGX A;  1US1 A;  2RCD A;  1PFP A;  3OXA A;  3OWY A;  1EUI C;  4N6O B;  2OTJ 3;  2CFK A;  2M7O A;  1JN5 A;  1GY7 A;  1ROV A;  2SAR A;  3RGA A;  1B20 A;  3F40 A;  2P38 A;  3WOD G;  1BSC A;  1O7M B;  3LOY A;  2IUK A;  1Q40 B;  3NV0 B;  3OX9 A;  4EW5 A;  2IA7 A;  2AAE A;  2ZL8 A;  1SQW A;  2INX A;  2XSO B;  1UDI I;  1WMN A;  1OUN A;  2Y74 A;  1KC8 4;  3EF8 A;  1S5A A;  2B24 B;  4OK0 A;  2CFG A;  4HJL B;  5AEW B;  1IQ8 A;  1I2F A;  3GZY B;  1OHO A;  5KP3 A;  3I55 3;  1ZO2 A;  3WOF B;  1EEJ A;  3QK9 A;  3N54 B;  2QA4 3;  1M90 4;  3D4A A;  3DMC A;  4LZI A;  3DZL A;  3JUM A;  3ZFZ A;  5IF6 A;  4H61 A;  1WTH A;  1JRQ A;  1HU9 A;  3SOA A;  1YI2 3;  5IG0 A;  3UJM A;  2SBL A;  4I5Q A;  3G8Z A;  4GL6 A;  3U97 A;  1B3S A;  1BNG A;  4NRE A;  1FW7 A;  3BB9 A;  3ROB A;  1FGO A;  3BLZ A;  3EHC A;  3S27 A;  2C10 A;  3OWS A;  4MEI A;  4R9K A;  1DE3 A;  2STD A;  2HMN B;  3RNT A;  5I97 A;  1Q9E A;  4N6T A;  3RDE A;  5LC7 A;  4JRF A;  1LNI A;  3FKA A;  3JUP A;  1VQN 3;  4KT3 B;  1BNE A;  5AIH A;  1EA2 A;  1RTU A;  4QWT A;  1W7C A;  2W56 B;  3EX9 A;  1RGC A;  3KN4 A;  2XEP A;  1I0X A;  1DMQ A;  3CNM A;  1FGR A;  3KZT A;  1RCL A;  4RNY A;  1MWT A;  4X2H A;  3UL5 A;  2IMJ A;  3LTC A;  3M8C A;  2OCT A;  1JBT A;  1ROA A;  2XGN A;  1FGT A;  4NHF A;  1N8R 4;  2XF3 A;  3DGO A;  1S72 3;  1FUS A;  1V57 A;  3A76 A;  4N6M A;  4AKY A;  3LTA A;  4WP5 A;  4WYK B;  1A67 A;  2C4B A;  4HM3 B;  3FF2 A;  1C7H A;  3CCJ 3;  4U13 A;  3EE1 A;  1LRA A;  1TFO A;  3G6E 3;  4CJN A;  3BNB A;  5D82 A;  1Q40 A;  8RNT A;  1OCV A;  4BIR A;  2KF5 A;  1LOY A;  3NM7 A;  3ZG5 A;  1QJG A;  1UW1 A;  3MWZ A;  1BNI A;  2F86 B;  1I8V A;  1JZD A;  2HMJ B;  1AY7 A;  3F9S A;  3KSP A;  4KFD A;  2P05 A;  4WFO A;  3X41 A;  3ZG0 A;  5IEP A;  1RRL A;  1Y4K A;  5G1K A;  7STD A;  1JJ2 2;  1VQ9 3;  1IV7 A;  2CG1 A;  2FNQ A;  5EEO A;  2CX0 A;  2KF6 A;  3AHS A;  1A2V A;  4GHO A;  4HM1 B;  3FZW A;  1IQY A;  2GEX A;  1RHL A;  2W04 A;  3STD A;  3VGN A;  1YIT 3;  3WDG B;  3IMA B;  3I0Y A;  1BSD A;  2PNC A;  2ZA4 A;  6STD A;  3FG1 A;  3Q3F A;  1UI8 A;  1AVK A;  2UUG C;  2I9W A;  2CIU A;  3G0K A;  3EBY A;  1OHP A;  1K8A 4;  1IV9 A;  3B4P A;  5IG4 A;  1UUV B;  3LZA A;  1IT7 A;  4FCZ A;  4X2O A;  1W02 A;  3BNE A;  1TP6 A;  4XBX A;  1UUG B;  3DM8 A;  3BIR A;  2RBI A;  3A5E A;  1UCI A;  3PZW A;  3HII A;  4NPB A;  5DRV A;  1OGZ A;  3DXO A;  5M19 A;  3CCE 3;  5TGN A;  1NO3 A;  3MG3 A;  4HM4 B;  3SOY A;  4MMZ B;  1VQ7 3;  1GMQ A;  4J8T A;  2W9Q A;  1FGM A;  3PCR A;  2XFS A;  1YJN 3;  4H3U A;  2CKF B;  4IPB A;  5KP1 A;  2CC3 A;  2P09 A;  5D83 A;  2GU3 A;  3H51 A;  2WO0 A;  3HI7 A;  2CWU A;  3NBR A;  4KZ1 A;  5G2G A;  3CXC 2;  1EQK A;  1VQ6 3;  1B27 A;  1PU4 A;  1BRS A;  2OWP A;  1G02 A;  3HOH A;  1T2H A;  5JPU A;  3CC7 3;  2FXT A;  3JUQ A;  3LH4 A;  1E97 A;  2A15 A;  3SX1 A;  7GSP A;  1IDP A;  2CH9 A;  1BUQ A;  4EYC A;  2KCD A;  1YGE A;  1NJI 4;  1BSB A;  2XSH B;  1E3R A;  4ORL A;  1JKG A;  1BNR A;  2GSP A;  1BRN L;  1SJW A;  1BRG A;  4KFF A;  1SIH A;  5AIF A;  2CK3 H;  1NB5 I;  2XGL A;  1LOV A;  2F56 A;  3X3Z A;  1YIJ 3;  3NX0 A;  1FZU A;  3X3Y A;  1W6Y A;  4HM6 B;  2QGU A;  4DKI A;  1KD1 4;  3S29 A;  4JF8 A;  4KVH A;  2V1L A;  4N6V 0;  5IER A;  1I0V A;  2CX1 A;  5JPP A;  4AEQ A;  1VQ8 3;  3JVC A;  1I3I A;  3IPT A;  4BU4 A;  1I2G A;  1DYU A;  2K54 A;  3AHW A;  1D6Z A;  2GXF A;  3URP A;  1UCJ A;  4R1K A;  4AKZ A;  1BNS A;  2ML6 A;  3X42 A;  4CPK A;  1Q81 4;  1K9M 4;  1GOV A;  4STD A;  1OGX A;  2CW9 A;  2AAD A;  1B2U A;  4HZB B;  4I4K A;  3G16 A;  3GZX B;  2CHC A;  1BAN A;  1VQQ A;  1BRK A;  3DUK A;  3DGM A;  3GZR A;  1UGI A;  3ER7 A;  1GOU A;  6RNT A;  1IK3 A;  4Q53 A;  2Q07 A;  3CPW 2;  2Z76 A;  1A2K A;  1RKY A;  5DRE A;  1W01 A;  4R80 A;  2D1W A;  2H0H A;  1W5Z A;  2KXG A;  1QAL A;  4HM7 B;  2L1S A;  4FCJ A;  1VQ5 3;  1W2Z A;  2BMQ B;  3D79 A;  1T3B A;  1FYS A;  1JB4 A;  1WMO A;  3TDG A;  4BL2 A;  1LXE A;  4N3V A;  5ELU A;  1CQS A;  3K63 A;  1X1U A;  4N6N B;  1YVB I;  4EV5 A;  4FMC A;  5IG3 A;  1B2X A;  1N5P A;  4MMY B;  1VQM 3;  4XBY A;  3KCH A;  3K0Z A;  3FG3 A;  4KFE A;  1RLS A;  1D6Y A;  4XDV A;  3SYU A;  3Q2P A;  1VQP 3;  2IUJ A;  1O7P B;  2CWT A;  1RGF A;  1YVS A;  1DVC A;  4MMX B;  1SAR A;  3FG4 A;  4OUQ A;  5GSP A;  3CC4 3;  4J5G A;  4L7K A;  4BTX A;  2OOV C;  3F8X A;  1O7W B;  4FR9 A;  4GB5 A;  2Z77 A;  3G4S 3;  1JB5 A;  1GMP A;  1IQX A;  2F4Y A;  1YJW 3;  1DMM A;  1TTO A;  4LSO A;  2HML B;  4BTY A;  4O2H A;  2P0X A;  3K5T A;  1NNV A;  3RGR A;  2JQ5 A;  3NBB A;  1BNF A;  2BT3 A;  4R4K A;  1IYY A;  2XH9 A;  1M9G A;  1RGA A;  3FCS B;  5IEO A;  6GSP A;  4RBN A;  1JKG B;  3BND A;  3CPO A;  2OQE A;  5IW9 A;  1BRH A;  1B2M A;  3HZP A;  2W0Q A;  1BIR A;  3GRD A;  4O8S A;  1BOX A;  4XBT A;  2H0G A;  3MYT A;  1Q82 4;  4EBG A;  3J7Y d;  5CXO A;  2YFI B;  3NQY A;  4HYZ A;  4CDL A;  4BL3 A;  1R4C A;  2GU1 A;  3AGN A;  5FW5 A;  2F98 A;  1I70 A;  1U8C B;  3KFQ C;  1V74 A;  1RN4 A;  3MG1 A;  3CCQ 3;  1J2B A;  1AR0 A;  3CME 3;  3V92 A;  2OQE C;  1X1W A;  3CCL 3;  4MJD A;  1WQL B;  2BMO B;  1NDO B;  2UGI A;  2H0I A;  1MWU A;  2UX0 A;  3LTD A;  3PCS A;  3X3X A;  3CMA 3;  2HMM B;  4RZM A;  1K28 A;  4HBR A;  3I56 3;  1VZZ A;  2FGT A;  3FGY A;  1WMP A;  1E3V A;  4K1U A;  3DGY A;  2GBW B;  4EC6 A;  3KII A;  1O7G B;  4WHA A;  3UB1 A;  3MSO A;  1JNQ A;  3F7X A;  5AEU B;  5EVH A;  1W4N A;  2PZV A;  1G0T A;  1BSE A;  1D6U A;  2GEY A;  2YX9 A;  3OV4 A;  1OPY A;  1G96 A;  3NHX A;  1MNL A;  2WGQ A;  1CYV A;  1RNT A;  1A2P A;  2WOH A;  5AIG A;  1GY5 A;  5G1L A;  3JUO A;  2K3D A;  5JBS A;  1RDS A;  1ZX2 A;  3AMO A;  3FF0 A;  3CC2 3;  5CF1 A;  5STD A;  4FMD A;  2HMO B;  4LYL B;  1UGH I;  1N5H A;  2Z7A A;  3HIG A;  2RNT A;  1JZO A;  4R9L A;  2E2V A;  2YFJ B;  1RGE A;  1RN7 A;  2E2T A;  3T8N A;  1BVI A;  1RSN A;  1C54 A;  2ZDJ A;  3WHO A;  5CF2 A;  2QIY A;  3CD6 3;  1BGS A;  1IVV A;  1TRP A;  3EB8 A;  4OVM A;  1TU5 A;  1TIJ A;  1KSI A;  1IU7 A;  3CU3 A;  3DY5 A;  4EXR A;  3F14 A;  3LXU X;  1BRI A;  1X1X A;  4HKV B;  1GOY A;  1YJ9 3;  4ILF A;  2BU4 A;  1MOL A;  2K0M A;  3PGB A;  1OF5 B;  3CCS 3;  1HZ1 A;  1LOW A;  4RNT A;  2W9P A;  5A0O B;  7RNT A;  2IY2 A;  1LQM B;  3FLJ A;  1QMA A;  3LYG A;  4HM2 B;  2XFT A;  3B4O A;  5FGO A;  5M1A A;  2D42 A;  3HX8 A;  3PXM A;  1STD A;  5RNT A;  1RJO A;  4HAA A;  1MWS A;  1RRH A;  3UNL A;  3V99 A;  1JV2 B;  3F7S A;  2F5W A;  3T8U A;  1LNH A;  4HZ9 B;  4L8P A;  2OTL 3;  8CHO A;  1TRQ A;  4HVN A;  3CCV 3;  1RCK A;  2RFR A;  3D5I A;  1UCL A;  1F8N A;  1ZS7 A;  3H3H A;  1W2B 2;  1RNB A;  3WR2 A;  4TX4 A;  5AII A;  3GWR A;  2F99 A;  2KAA A;  1BSA A;  4O3V A;  1DVD A;  2CWV A;  2R41 A;  1TJD A;  3WOE B;  1U5O A;  1AVL A;  1HKX A;  1JBS A;  1IVW A;  2JDI H;  2BNG A;  1O7H B;  2F5M A;  1PYL A;  2CFL A;  1RGH A;  2YFL B;  3PS8 A;  1GD4 A;  1N8Q A;  4CCV A;  1QVG 2;  3DGL A;  2ML5 A;  3KSE D;  1GY6 A;  1NWW A;  2C11 A;  3EBT A;  1BUJ A;  5HGR A;  1TFK A;  3OW2 2;  1MWR A;  1JB2 A;  2CFW A;  3GZB A;  3Q90 A;  3S28 A;  2J8X B;  2L4V A;  4J5K A;  3SXX A;  3EJV A;  5BIR A;  1K73 4;  2XRX B;  2OOV A;  5BVB A;  1KWI A;  3LT8 A;  1GD3 A;  2P0M A;  1OHS A;  1W6G A;  3VSY A;  3X40 A;  3VF1 A;  5M18 A;  3JUN A;  1YNV X;  3AMO B;  3UL6 A;  3EQQ B;  1A90 A;  1R4Y A;  2BIR A;  2LQV A;  4BTW A;  3GAX A;  5D81 A;  1QAF A;  3MPH A;  4ZM8 A;  1ULJ B;  4N6L A;  1QVF 2;  1GYB A;  1O7N B;  2MC8 A;  2B1X B;  5CLK A;  1VQK 3;  1M1K 4;  3LTB A;  1W00 A;  4WWU C;  4J9A A;  3N8B A;  1VQL 3;  3CCR 3;  3S5C A;  1JBR A;  1OF5 A;  4IIA A;  2GBX B;  2HOH A;  2E2U A;  1B2S A;  1W6C A;  3EN8 A;  3HK4 A;  3E99 A;  3QRD A;  4HM8 B;  3SED A;  3LT9 A;  3S67 A;  1PY3 A;  3N9H A;  4K90 B;  1GSP A;  3F8H A;  3SLU A;  1GMR A;  2MF7 A;  4K61 A;  1V58 A;  1UCK A;  1X1Y A;  2KF4 A;  2BMR B;  5ELJ A;  3U1W A;  1UUW B;  4HM5 B;  3K7C A;  1KQS 2;  1ASK A;  3NM2 A;  3GSP A;  1LOX A;  1RGG A;  2O9U X;  2RGQ A;  1LVN A;  3NXJ A;  5BXQ A;  1YHQ 3;  1AV4 A;  4XM4 A;  3BU4 A;  5EQL A;  2QEX 3;  5IG5 A; 
#chains in the Genus database with same CATH homology
 2W03 A;  3EN1 B;  4N6U A;  3NBJ A;  4K1V A;  1SPU A;  4XB5 A;  1FA3 A;  3CCU 3;  2WGO A;  3ECF A;  1EKM A;  3CNX A;  3NV0 A;  1JN5 B;  3MKI A;  5KP4 A;  1IT8 A;  4G1M B;  2R4I A;  3MG2 A;  4IT7 A;  3DGN A;  1ISK A;  1QAK A;  3B8L A;  3G71 3;  5CK6 A;  4HM0 B;  3NQZ A;  1Q42 A;  4XDW A;  4PEJ A;  5AYR B;  2CFD A;  1FGQ A;  1K41 A;  1EG9 B;  3V98 A;  1VQ4 3;  2W2C A;  1UI7 A;  1N9J A;  2O3O A;  1Q86 4;  5AYS C;  1M1X B;  2BHM A;  1WNH A;  4FCM A;  3SVA A;  2CG0 A;  3MHE A;  3KKG A;  1OH0 A;  1N9E A;  4LGQ A;  4FMA A;  3WA2 X;  2HMK B;  3T0U A;  1IVU A;  1CYU A;  2KRT A;  4L8O A;  1OAC A;  4EV2 A;  1NU3 A;  3NUV A;  2WOF A;  3FH1 A;  3PYJ A;  3Q1C A;  4LMI A;  3ALA A;  5IEN A;  2BO9 B;  3EC9 A;  5LC6 A;  1Z1S A;  1STF I;  3B7C A;  1DMN A;  3KE7 A;  3WMD A;  3D3L A;  3CCM 3;  3LML A;  1T5Y A;  4FMB A;  3OWU A;  3IJE B;  1TUH A;  1L5G B;  1GS3 A;  2XR8 B;  3D9R A;  2W56 A;  3K9M C;  3L0R A;  1Q7Y 4;  2LYX A;  3FSD A;  4RNZ A;  5AI1 A;  4O02 B;  1FUW A;  3BNC A;  2Z6B A;  1ULI B;  3O8Y A;  1SII A;  4LEH A;  2RSX A;  2W6J H;  2Y73 A;  1CEW I;  1VQO 3;  1IVX A;  4WYK A;  3WA3 A;  1NB3 I;  4N6O B;  2RCD A;  1US1 A;  3OWY A;  1PFP A;  3OXA A;  2OTJ 3;  2CFK A;  2M7O A;  1JN5 A;  1GY7 A;  1ROV A;  3RGA A;  3F40 A;  2P38 A;  3WOD G;  1O7M B;  3LOY A;  2IUK A;  1Q40 B;  3NV0 B;  3OX9 A;  2IA7 A;  2ZL8 A;  1SQW A;  2INX A;  2XSO B;  1WMN A;  1OUN A;  2Y74 A;  1KC8 4;  3EF8 A;  1S5A A;  2B24 B;  4OK0 A;  2CFG A;  4HJL B;  5AEW B;  1IQ8 A;  3GZY B;  5KP3 A;  1OHO A;  3I55 3;  1ZO2 A;  3WOF B;  3QK9 A;  3N54 B;  2QA4 3;  1M90 4;  3DMC A;  4LZI A;  3DZL A;  3JUM A;  5IF6 A;  4H61 A;  1WTH A;  1JRQ A;  1HU9 A;  3SOA A;  1YI2 3;  5IG0 A;  3UJM A;  2SBL A;  3G8Z A;  4GL6 A;  3U97 A;  4NRE A;  3BB9 A;  3ROB A;  1FGO A;  3BLZ A;  3EHC A;  3S27 A;  2C10 A;  3OWS A;  4MEI A;  4R9K A;  2STD A;  2HMN B;  5I97 A;  4N6T A;  3RDE A;  5LC7 A;  4JRF A;  3FKA A;  3JUP A;  1VQN 3;  5AIH A;  1EA2 A;  4QWT A;  1W7C A;  2W56 B;  3EX9 A;  3KN4 A;  2XEP A;  1DMQ A;  3CNM A;  1FGR A;  3KZT A;  4RNY A;  3UL5 A;  4X2H A;  2IMJ A;  3LTC A;  3M8C A;  2OCT A;  1ROA A;  2XGN A;  1FGT A;  4NHF A;  1N8R 4;  2XF3 A;  3DGO A;  1S72 3;  3A76 A;  4N6M A;  4AKY A;  3LTA A;  4WP5 A;  4WYK B;  1A67 A;  4HM3 B;  3FF2 A;  1C7H A;  3CCJ 3;  4U13 A;  3EE1 A;  1TFO A;  3G6E 3;  3BNB A;  5D82 A;  1Q40 A;  1OCV A;  3NM7 A;  1QJG A;  1UW1 A;  3MWZ A;  2F86 B;  3F9S A;  2HMJ B;  3KSP A;  4KFD A;  4WFO A;  2P05 A;  3X41 A;  5IEP A;  1RRL A;  1Y4K A;  7STD A;  1VQ9 3;  1JJ2 2;  1IV7 A;  2CG1 A;  2FNQ A;  5EEO A;  1A2V A;  4HM1 B;  3FZW A;  1IQY A;  2GEX A;  2W04 A;  3STD A;  3VGN A;  1YIT 3;  3WDG B;  3IMA B;  3I0Y A;  2PNC A;  6STD A;  3FG1 A;  1UI8 A;  1AVK A;  2I9W A;  2CIU A;  3G0K A;  3EBY A;  1OHP A;  1K8A 4;  1IV9 A;  3B4P A;  5IG4 A;  1UUV B;  3LZA A;  1IT7 A;  4FCZ A;  4X2O A;  1W02 A;  3BNE A;  1TP6 A;  4XBX A;  3DM8 A;  3PZW A;  3HII A;  5DRV A;  1OGZ A;  3DXO A;  3CCE 3;  5TGN A;  1NO3 A;  3MG3 A;  4HM4 B;  3SOY A;  4MMZ B;  1VQ7 3;  4J8T A;  2W9Q A;  1FGM A;  3PCR A;  2XFS A;  1YJN 3;  4H3U A;  2CKF B;  4IPB A;  5KP1 A;  2CC3 A;  2P09 A;  5D83 A;  2GU3 A;  3H51 A;  2WO0 A;  3HI7 A;  2CWU A;  3NBR A;  4KZ1 A;  5G2G A;  3CXC 2;  1EQK A;  1VQ6 3;  1PU4 A;  2OWP A;  3CC7 3;  5JPU A;  2FXT A;  3JUQ A;  3LH4 A;  1E97 A;  2A15 A;  3SX1 A;  1IDP A;  2CH9 A;  1BUQ A;  4EYC A;  2KCD A;  1YGE A;  1NJI 4;  2XSH B;  1E3R A;  4ORL A;  1JKG A;  1SJW A;  5AIF A;  4KFF A;  1SIH A;  2CK3 H;  1NB5 I;  2XGL A;  3X3Z A;  1YIJ 3;  3NX0 A;  3X3Y A;  1W6Y A;  4HM6 B;  2QGU A;  1KD1 4;  3S29 A;  4JF8 A;  4KVH A;  2V1L A;  4N6V 0;  5IER A;  1VQ8 3;  5JPP A;  4AEQ A;  3JVC A;  3IPT A;  1DYU A;  2K54 A;  4AKZ A;  1D6Z A;  2GXF A;  4R1K A;  1Q81 4;  2ML6 A;  3X42 A;  1K9M 4;  4STD A;  1OGX A;  2CW9 A;  4I4K A;  4HZB B;  3G16 A;  3GZX B;  2CHC A;  3GZR A;  3DUK A;  3DGM A;  1IK3 A;  3ER7 A;  4Q53 A;  2Q07 A;  3CPW 2;  2Z76 A;  1A2K A;  1RKY A;  5DRE A;  1W01 A;  4R80 A;  2D1W A;  1W5Z A;  2KXG A;  1QAL A;  4HM7 B;  4FCJ A;  1VQ5 3;  1W2Z A;  2BMQ B;  1JB4 A;  1WMO A;  3TDG A;  1LXE A;  4N3V A;  5ELU A;  1CQS A;  3K63 A;  4N6N B;  4EV5 A;  1YVB I;  4FMC A;  5IG3 A;  1VQM 3;  1N5P A;  4MMY B;  4XBY A;  3K0Z A;  3FG3 A;  4KFE A;  1D6Y A;  4XDV A;  3Q2P A;  1VQP 3;  2IUJ A;  1O7P B;  2CWT A;  1DVC A;  4MMX B;  4OUQ A;  3FG4 A;  3CC4 3;  4L7K A;  4BTX A;  2OOV C;  3F8X A;  1O7W B;  4FR9 A;  4GB5 A;  2Z77 A;  3G4S 3;  1JB5 A;  1IQX A;  1YJW 3;  1DMM A;  4LSO A;  2HML B;  4BTY A;  4O2H A;  2P0X A;  3K5T A;  3RGR A;  2JQ5 A;  3NBB A;  4R4K A;  2BT3 A;  2XH9 A;  1M9G A;  3FCS B;  5IEO A;  4RBN A;  1JKG B;  3BND A;  3CPO A;  2OQE A;  5IW9 A;  3HZP A;  2W0Q A;  3GRD A;  4O8S A;  4XBT A;  3MYT A;  1Q82 4;  4EBG A;  3J7Y d;  5CXO A;  2YFI B;  3NQY A;  4HYZ A;  4CDL A;  1R4C A;  2GU1 A;  5FW5 A;  2F98 A;  1U8C B;  3KFQ C;  1V74 A;  3MG1 A;  3CCQ 3;  1J2B A;  1AR0 A;  3CME 3;  3V92 A;  2OQE C;  3CCL 3;  4MJD A;  1WQL B;  2BMO B;  1NDO B;  2UX0 A;  3LTD A;  3PCS A;  3X3X A;  3CMA 3;  2HMM B;  4RZM A;  1K28 A;  4HBR A;  3I56 3;  1VZZ A;  2FGT A;  3FGY A;  1WMP A;  1E3V A;  4K1U A;  2GBW B;  4EC6 A;  3KII A;  1O7G B;  4WHA A;  3UB1 A;  3MSO A;  1JNQ A;  3F7X A;  5AEU B;  5EVH A;  1W4N A;  2PZV A;  2GEY A;  1D6U A;  2YX9 A;  3OV4 A;  1OPY A;  1G96 A;  3NHX A;  1MNL A;  2WGQ A;  1CYV A;  2WOH A;  5AIG A;  1GY5 A;  3JUO A;  5JBS A;  1ZX2 A;  3AMO A;  3FF0 A;  3CC2 3;  5CF1 A;  5STD A;  4FMD A;  2HMO B;  1N5H A;  2Z7A A;  3HIG A;  4R9L A;  2E2V A;  2YFJ B;  2E2T A;  1RN7 A;  3T8N A;  2ZDJ A;  5CF2 A;  2QIY A;  3CD6 3;  1IVV A;  4OVM A;  3EB8 A;  1TU5 A;  1TIJ A;  1KSI A;  1IU7 A;  3CU3 A;  3DY5 A;  4EXR A;  3F14 A;  3LXU X;  4HKV B;  1YJ9 3;  1MOL A;  2K0M A;  3PGB A;  1OF5 B;  3CCS 3;  2W9P A;  5A0O B;  3FLJ A;  1QMA A;  3LYG A;  4HM2 B;  2XFT A;  3B4O A;  5FGO A;  2D42 A;  3HX8 A;  3PXM A;  1STD A;  1RJO A;  1RRH A;  3UNL A;  3V99 A;  1JV2 B;  3F7S A;  3T8U A;  1LNH A;  4HZ9 B;  4L8P A;  2OTL 3;  8CHO A;  4HVN A;  3CCV 3;  2RFR A;  1F8N A;  3H3H A;  1W2B 2;  4TX4 A;  5AII A;  3GWR A;  2F99 A;  4O3V A;  1DVD A;  2CWV A;  3WOE B;  1U5O A;  1AVL A;  1HKX A;  1IVW A;  2JDI H;  2BNG A;  1O7H B;  2CFL A;  4CCV A;  2YFL B;  3PS8 A;  1GD4 A;  1N8Q A;  1QVG 2;  3DGL A;  2ML5 A;  3KSE D;  1GY6 A;  1NWW A;  2C11 A;  3EBT A;  5HGR A;  1TFK A;  3OW2 2;  1JB2 A;  2CFW A;  3GZB A;  3Q90 A;  3S28 A;  2L4V A;  3SXX A;  3EJV A;  1K73 4;  2XRX B;  2OOV A;  5BVB A;  1KWI A;  3LT8 A;  1GD3 A;  2P0M A;  1OHS A;  1W6G A;  3VSY A;  3X40 A;  3VF1 A;  3JUN A;  3AMO B;  3UL6 A;  3EQQ B;  1A90 A;  2LQV A;  4BTW A;  3GAX A;  5D81 A;  1QAF A;  3MPH A;  4ZM8 A;  1ULJ B;  4N6L A;  1QVF 2;  1GYB A;  1O7N B;  2MC8 A;  2B1X B;  5CLK A;  1VQK 3;  1M1K 4;  3LTB A;  1W00 A;  4WWU C;  4J9A A;  3N8B A;  1VQL 3;  3CCR 3;  3S5C A;  1OF5 A;  4IIA A;  2GBX B;  2E2U A;  3EN8 A;  1W6C A;  3HK4 A;  3QRD A;  3E99 A;  4HM8 B;  3SED A;  3LT9 A;  3S67 A;  3N9H A;  4K90 B;  3F8H A;  3SLU A;  2MF7 A;  4K61 A;  1KQS 2;  5ELJ A;  2BMR B;  3U1W A;  1UUW B;  4HM5 B;  3K7C A;  1ASK A;  3NM2 A;  1LOX A;  2RGQ A;  2O9U X;  3NXJ A;  1LVN A;  5BXQ A;  1YHQ 3;  1AV4 A;  4XM4 A;  5EQL A;  2QEX 3;  5IG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...