2C4BA

Inhibitor cystine knot protein mcoeeti fused to the catalytically inactive barnase mutant h102a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIRSSSMGVCPKILKKCRRDSDCLAGCVCGPNGFCGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Barnase Fusion as a Tool to Determine the Crystal Structure of the Small Disulfide-Rich Protein Mcoeeti.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Fusion protein
molecule keywords BARNASE MCOEETI FUSION
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2005-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2c4bA00
1RCLA 1C54A 1YVSA 2F4YA 1I2GA 2HOHA 2RNTA 3URPA 1GMQA 1FYSA 5BIRA 1MGWA 1RGCA 1BAOA 3DGYA 4GSPA 1B21A 1I70A 1SARA 7RNTA 3SYUA 4BU4A 1HZ1A 1B2ZA 1UCLA 4HOHA 1BRJA 4GHOA 2C4BA 3AHWA 1AQZA 3AHSA 1PY3A 1CH0A 1LOWA 1RMSA 1I2EA 2BU4A 1GMRA 1TRQA 1YGWA 1RGGA 1BVIA 1RGLA 2ZA4A 1MGRA 1G02A 9RNTA 2KAAA 1YNVX 5RNTA 1UCJA 5HOHA 3GSPA 1B3SA 1I0VA 1LOYA 1AY7A 1RGHA 2F5MA 1X1WA 1BSEA 1I3FA 1BGSA 2KF5A 7GSPA 1FW7A 2GSPA 2BIRA 1BRNL 1LNIA 2KF3A 1RLSA 1BUJA 1PYLA 4HAAA 1X1XA 1BRIA 1RGFA 1DETA 1BNGA 1B20A 3D5IA 1BOXA 1B2MA 3BU4A 1B27A 1RGKA 2F5WA 3A5EA 1BANA 1Q9EA 1BIRA 3Q3FA 3BIRA 1GSPA 2AAEA 1LRAA 1I3IA 1RNTA 1I8VA 2KF6A 6RNTA 1RNBA 1GMPA 1RTUA 1RGEA 3KCHA 1BRGA 1BNIA 1B2UA 1RGAA 1GOUA 1BNSA 3AGOA 2RBIA 5BU4A 1GOVA 3WR2A 1TTOA 1RCKA 1BNRA 1BNJA 1GOYA 1RHLA 1T2IA 1B2XA 4RNTA 4J5KA 3DH2A 1BSBA 1X1YA 1TRPA 2F56A 2AADA 1BRHA 4BIRA 1BNEA 1JBRA 1R4YA 1RSNA 1BNFA 3D4AA 1UCIA 1FUTA 1X1UA 1JBSA 1IYYA 4J5GA 1B2SA 1BU4A 1RN4A 1RDSA 1BRSA 1FZUA 1T2HA 1I0XA 2KF4A 2SARA 3AGNA 1RN1A 3HOHA 3RNTA 8RNTA 1BSCA 1A2PA 1I2FA 6GSPA 1JBTA 1DE3A 1LOVA 1UCKA 1FUSA 3D5GA 1BSAA 1HYFA 5GSPA 1ZGXA 1BSDA 1BRKA 3WHOA
chains in the Genus database with same CATH superfamily
2H0HA 3PXMA 3Q1CA 2F4YA 2HOHA 1I2GA 1UGHI 1OACA 1AVLA 1ROVA 2BO9B 3DM8A 4N6NB 1GMQA 3PYJA 5BIRA 5TGNA 4X2HA 2P0MA 3UL5A 4GSPA 3G6E3 7RNTA 3EN1B 3S27A 1TUHA 2K3DA 1T5YA 3JUMA 4NPBA 4ZM8A 2A15A 5HGRA 4K1UA 5IW9A 3PS8A 1M1K4 5G1KA 4XBTA 2KCDA 1AQZA 3AHSA 5IG5A 2F98A 1PY3A 1VQ73 1CH0A 1I2EA 1UUWB 4N6TA 3CXC2 1GYBA 1ULJB 2R41A 2L4VA 1BVIA 1W01A 3G0KA 3NBBA 1YIJ3 2HMKB 2Z76A 2M7OA 1VQ83 1D6UA 1SQWA 3BNDA 3CCQ3 1YNVX 1UCJA 3BNBA 3OX9A 1QJGA 2CFLA 2Z77A 1US1A 5HOHA 3WODG 4KVHA 3GSPA 1STDA 1WMOA 4XBXA 3JUNA 3PCRA 1X1WA 1E97A 1BSEA 1I3FA 3DGMA 2GU3A 2O9UX 2KF5A 3DGLA 4R1KA 7GSPA 5IG3A 3EF8A 1F8NA 1RJOA 3HX8A 2BIRA 3E99A 2WOHA 5STDA 1QVF2 1IV9A 1BRNL 4GB5A 3LXUX 5CF1A 2ZDJA 1UDII 3BB9A 3FH1A 3WMDA 1RLSA 1VZZA 1N5HA 2YFJB 4HAAA 4O2HA 1BRIA 4BTWA 1DETA 3CNXA 5EVHA 1WTHA 2YFLB 3CCU3 4HKVB 1NB5I 4N6OB 1B27A 1RGKA 4L8PA 2ZL8A 3ZG5A 3A5EA 1VQ63 1DMNA 3O8YA 1Q9EA 3NM2A 4R9LA 3BIRA 3K63A 4X2OA 2KF6A 1V58A 2W9PA 1GMPA 1OCVA 1RGEA 3V98A 2ML5A 2XH9A 5D82A 4NHFA 2W6JH 1BNIA 3DXOA 1NWWA 3MKIA 1GD4A 3G8ZA 3HI7A 2CC3A 1BNSA 2W56A 3CU3A 5I97A 2BNGA 3DY5A 4H3UA 3D9RA 2UX0A 3X3YA 3SVAA 3TDGA 4J8TA 2ZHXB 4FMDA 2MC8A 4J5KA 3DH2A 3QK9A 1KD14 1TU5A 3EQQB 3V99A 1BSBA 1ZX2A 4GL6A 1X1YA 2CG1A 1FGRA 2F56A 3LTAA 3MG3A 1W6CA 3F40A 1VQN3 4RNYA 1A67A 1OH0A 3QRDA 1JBRA 1SJWA 1Q40A 4H61A 3RDEA 3B7CA 1D6ZA 5FW5A 3N9HA 3HK4A 1FUTA 4L8OA 4FR9A 1WNHA 1X1UA 5G1LA 1B2SA 2LQVA 4LGQA 1RDSA 4LSOA 8RNTA 1I0XA 3AGNA 4MMYB 1RN1A 3WOEB 3CC43 2WGOA 3MWZA 1A2PA 5M1AA 3KFQC 4U13A 1OF5B 1DE3A 1JN5B 2P0XA 1ASKA 1FUSA 1UCKA 1NDOB 4HM3B 3KN4A 1BSDA 4LEHA 1WQLB 1N5PA 4JRFA 2R4IA 2O3OA 3BNCA 3G16A 4DKIA 1IT7A 2CG0A 1K734 5IG0A 1VQO3 1YVSA 3URPA 4HZ9B 2QEX3 1M1XB 1NO3A 1FYSA 4HM2B 3EBYA 3CC73 2OWPA 3SYUA 1IQ8A 5IENA 1UCLA 1DVCA 4HOHA 1MWTA 1O7NB 3SOYA 4R4KA 3J7Yd 4J9AA 2Z7AA 1O7MB 3GAXA 4GHOA 4MMZB 2C4BA 3N54B 3I553 3L0RA 3NHXA 2CFWA 5BVBA 5G2GA 5DREA 1GMRA 1RGGA 2FXTA 3STDA 5M19A 2RSXA 1FA3A 2ZA4A 3RGAA 1MGRA 4I4KA 1S5AA 2I9WA 3S5CA 2QIYA 2XSHB 2BHMA 4FMBA 1K8A4 1SIIA 5M18A 1G02A 1SIHA 4N6UA 3FF2A 3H51A 4KFEA 5CK6A 9RNTA 1PU4A 3EBTA 5RNTA 2XRXB 3CCV3 4OUQA 1LQMB 3WOFB 1B3SA 2PZVA 1RGHA 1Q7Y4 3UNLA 1W5ZA 2XGLA 4AKYA 1IV7A 1K41A 1WMPA 1PFPA 2CKFB 1ISKA 3EJVA 2GSPA 3CCE3 1A90A 3S67A 1GD3A 1OF5A 6STDA 1LNIA 1IU7A 3DGNA 4RNZA 1JRQA 5EEOA 4BL3A 1JNQA 1YHQ3 1X1XA 2B1XB 4XDVA 3D5IA 1R4CA 2H0GA 1HKXA 2OOVC 1MOLA 3SEDA 3BU4A 3MYTA 3EN8A 2GBWB 1Q7HA 1E3VA 1EUIC 1OHSA 1VQ53 4FMCA 1MWRA 1BANA 1BIRA 1O7HB 4HM0B 3Q3FA 3V92A 2AAEA 1LRAA 1RNTA 3EX9A 3PCSA 4HM1B 1OPYA 2IA7A 2ML6A 1TP6A 2HMJB 3FKAA 1RNBA 4MEIA 3ER7A 3NXJA 2OTL3 1JB5A 3N8BA 3VSYA 3CPW2 1RGAA 3A76A 3OV4A 2INXA 4IPBA 3WDGB 1M904 3MPHA 1Z1SA 3F7SA 4LYLB 2KXGA 1RKYA 2RGQA 1Q814 3NBRA 4CJNA 4WWUC 1E3RA 1QMAA 2CWTA 1YJ93 1CYUA 4FCJA 4EC6A 2GXFA 4WHAA 1TIJA 4L7KA 1O7PB 2XEPA 1TRPA 3D79A 3X40A 1LNHA 1UI8A 2BMOB 3Q2PA 2P05A 2C11A 3F9SA 3PZWA 1C7HA 4HM5B 1OGXA 2HMOB 1ROAA 3SLUA 2WGQA 1RSNA 2Y73A 3DMCA 1UCIA 2STDA 2GEXA 1QALA 3ECFA 1U8CB 3JUOA 1UGIA 5BXQA 2KF4A 3X3XA 5DRVA 3WA2X 2SARA 1JZDA 3RNTA 2FNQA 3FGYA 1I2FA 2W56B 3I563 3IMAB 5AIIA 1JBTA 4WFOA 4HM6B 4XDWA 3IPTA 1YJW3 1IQYA 1HU9A 1OUNA 3EHCA 3Q90A 2XGNA 1ZGXA 1IVUA 3JUQA 1N8R4 4FCMA 3X3ZA 2L1SA 1W02A 2KRTA 1VQK3 3LOYA 4HM7B 1RCLA 1BUQA 1C54A 2QGUA 2F99A 4TX4A 1TFKA 3NBJA 3SXXA 2RNTA 1M9GA 5LC7A 1V74A 3NQYA 1MGWA 3KSPA 4R80A 1BAOA 7STDA 5FGOA 1MNLA 3EC9A 3PGBA 4HZBB 4BU4A 1HZ1A 1Y4KA 2Z6BA 1VQL3 1DMQA 3CCM3 4EXRA 2WO0A 3LTCA 3KE7A 2XF3A 3AHWA 4BL2A 1LOXA 2CX1A 5D83A 4HJLB 3RGRA 2BU4A 1U5OA 3AMOA 1VQ43 1YI23 3MHEA 1AR0A 1NNVA 4WYKB 1L5GB 1DYUA 2IUJA 1FGTA 4O8SA 1QAKA 3FG4A 1W6GA 2RCDA 3U1WA 1WMNA 3FG1A 3UJMA 2KAAA 3K7CA 1DVDA 1RRLA 1GY5A 3G4S3 1UUVB 4K61A 1I0VA 1LOYA 1Q824 1AY7A 2W9QA 3G713 2F5MA 2CHCA 1OGZA 4EV2A 1GY6A 3KZTA 1ZO2A 3HZPA 3ZG0A 3NX0A 2QA43 3KIIA 2MF7A 1YVBI 1W7CA 5ELUA 4KFDA 3JVCA 3KKGA 4EW5A 5AEWB 4HYZA 5JPPA 4FMAA 1BNGA 4Q53A 1GY7A 1JZOA 2CFDA 4OVMA 3ALAA 1RRHA 1UW1A 3H3HA 4HM4B 4O3VA 1YIT3 2F5WA 2SBLA 1J2BA 4CCVA 3CCR3 2BT3A 4XBYA 2D42A 1FGOA 3EE1A 4K90B 3CPOA 3X41A 5ELJA 1YJN3 2J8XB 1I8VA 1RN7A 4EV5A 6RNTA 4FCZA 3NUVA 1VQQA 3B4OA 1A2KA 5AIHA 3NV0A 2XSOB 1VQ93 3KCHA 3UB1A 2YFIB 1AVKA 1QAFA 2XFTA 4N6V0 1B2UA 1D6YA 1O7WB 2HMLB 2K0MA 2JQ5A 3F8XA 3MG2A 4EYCA 2RBIA 5BU4A 3NQZA 4EBGA 1LXEA 3CCJ3 2JDIH 3MSOA 2K54A 1GOYA 3CCS3 2CK3H 3B4PA 1RHLA 1T2IA 3FG3A 2P09A 3LZAA 1MWUA 5KP1A 1K9M4 3F8HA 1N9JA 2BMQB 1EG9B 2PNCA 3LMLA 2AADA 3D3LA 5AYSC 5CF2A 1ZS7A 1KQS2 4BIRA 3GZRA 3SOAA 1V57A 1R4YA 1EEJA 1W4NA 2LYXA 3D4AA 5JPUA 2CW9A 1JBSA 1IYYA 1NJI4 3S29A 3OXAA 1T2HA 1BRSA 5AIFA 1IVWA 3LT8A 4NREA 3HOHA 5CXOA 1BSCA 3CC23 3FSDA 1N8QA 4XB5A 4KZ1A 6GSPA 3FCSB 1JN5A 1BSAA 4LMIA 2Y74A 1NB3I 2UGIA 3OWYA 1JV2B 3DUKA 3UL6A 1KSIA 1FGQA 5D81A 3VGNA 2E2VA 3WHOA 3CMA3 4BTYA 3FLJA 1KC84 4G1MB 1OHPA 3LT9A 4N6MA 2GEYA 3HIIA 1RGCA 2OTJ3 3DGYA 5AYRB 1B21A 1I70A 1SARA 1TFOA 3NM7A 4BTXA 5A0OB 4AEQA 1B2ZA 4JF8A 2CFKA 3T0UA 1DMMA 1BRJA 4ORLA 4XM4A 2CWVA 2FGTA 2OCTA 2Q07A 1W2ZA 4WP5A 3GWRA 3LH4A 4N3VA 3HIGA 1LOWA 1RMSA 3GZBA 5IERA 3U97A 3WA3A 1TRQA 1YGWA 3CME3 1RGLA 5IEPA 2W03A 4HM8B 3K5TA 3F7XA 5KP3A 2GU1A 4MJDA 2IY2A 4STDA 3OWSA 3IJEB 4HBRA 3DZLA 3ROBA 3B8LA 2B24B 1JB4A 2D1WA 1QVG2 4K1VA 4ILFA 1G96A 3CD63 2IUKA 2RFRA 4KT3B 2UUGC 1IQXA 2XFSA 3S28A 3NV0B 1BGSA 1FW7A 3EB8A 3LTBA 2IYJA 1S723 1G0TA 1CYVA 3MG1A 1UUGB 1W2B2 2KF3A 1JKGA 1LVNA 1O7GB 1BUJA 3BNEA 1JKGB 2OQEC 1NU3A 1KWIA 1PYLA 2CIUA 1RGFA 1B20A 3AMOB 4WYKA 3SX1A 1Q864 5LC6A 2XR8B 1BOXA 3LTDA 1B2MA 3ZFZA 3K0ZA 5AI1A 4KFFA 5CLKA 1IVXA 1SPUA 1GSPA 1ULIB 1STFI 1I3IA 2GBXB 1IT8A 4LZIA 4N6LA 4OK0A 1CEWI 5AIGA 1CQSA 1TJDA 1Q40B 3CCL3 1IVVA 3GZXB 5EQLA 1RTUA 3BLZA 2W04A 2E2UA 2W2CA 1BRGA 3JUPA 2YX9A 1GOUA 1T3BA 1IK3A 3AGOA 4PEJA 5JBSA 1Q42A 3M8CA 4I5QA 5IEOA 2OQEA 1GOVA 1IDPA 4IT7A 1TTOA 3WR2A 4O02B 4R9KA 1RCKA 2WOFA 1JB2A 3OW22 1BNRA 3GRDA 1VQM3 2F86B 1BNJA 3LYGA 1LQGC 2CWUA 1B2XA 4RNTA 3X42A 5IF6A 1UI7A 3OWUA 4RBNA 1FGMA 3I0YA 3KSED 1K28A 1BRHA 2E2TA 3T8UA 1FUWA 4MMXB 1BNEA 1OHOA 2BMRB 3T8NA 1EKMA 3CNMA 5AEUB 3VF1A 2HMNB 1BNFA 1N9EA 4IIAA 4AKZA 5KP4A 1VQP3 2IMJA 4J5GA 4CDLA 2CX0A 1BU4A 1RN4A 1A2VA 1FZUA 2HMMB 3K9MC 4HVNA 1YGEA 2H0IA 3GZYB 4RZMA 1W00A 2W0QA 1EQKA 1LOVA 8CHOA 3D5GA 2C10A 2P38A 2OOVA 2V1LA 1MWSA 1HYFA 2CH9A 3FZWA 5IG4A 5GSPA 1GS3A 2CFGA 3F14A 1W6YA 1BRKA 3DGOA 4QWTA 1AV4A 3FF0A 1EA2A 4CPKA 1JJ22
chains in the Genus database with same CATH topology
1RCLA 1C54A 1YVSA 2F4YA 1I2GA 2HOHA 2RNTA 3URPA 1GMQA 1FYSA 5BIRA 1MGWA 1RGCA 1BAOA 3DGYA 4GSPA 1B21A 1I70A 1SARA 7RNTA 3SYUA 4BU4A 1HZ1A 1B2ZA 1UCLA 4HOHA 1BRJA 4GHOA 2C4BA 3AHWA 1AQZA 3AHSA 1PY3A 1CH0A 1LOWA 1RMSA 1I2EA 2BU4A 1GMRA 1TRQA 1YGWA 1RGGA 1BVIA 1RGLA 2ZA4A 1MGRA 1G02A 9RNTA 2KAAA 1YNVX 5RNTA 1UCJA 5HOHA 3GSPA 1B3SA 1I0VA 1LOYA 1AY7A 1RGHA 2F5MA 1X1WA 1BSEA 1I3FA 1BGSA 2KF5A 7GSPA 1FW7A 2GSPA 2BIRA 1BRNL 1LNIA 2KF3A 1RLSA 1BUJA 1PYLA 4HAAA 1X1XA 1BRIA 1RGFA 1DETA 1BNGA 1B20A 3D5IA 1BOXA 1B2MA 3BU4A 1B27A 1RGKA 2F5WA 3A5EA 1BANA 1Q9EA 1BIRA 3Q3FA 3BIRA 1GSPA 2AAEA 1LRAA 1I3IA 1RNTA 1I8VA 2KF6A 6RNTA 1RNBA 1GMPA 1RTUA 1RGEA 3KCHA 1BRGA 1BNIA 1B2UA 1RGAA 1GOUA 1BNSA 3AGOA 2RBIA 5BU4A 1GOVA 3WR2A 1TTOA 1RCKA 1BNRA 1BNJA 1GOYA 1RHLA 1T2IA 1B2XA 4RNTA 4J5KA 3DH2A 1BSBA 1X1YA 1TRPA 2F56A 2AADA 1BRHA 4BIRA 1BNEA 1JBRA 1R4YA 1RSNA 1BNFA 3D4AA 1UCIA 1FUTA 1X1UA 1JBSA 1IYYA 4J5GA 1B2SA 1BU4A 1RN4A 1RDSA 1BRSA 1FZUA 1T2HA 1I0XA 2KF4A 2SARA 3AGNA 1RN1A 3HOHA 3RNTA 8RNTA 1BSCA 1A2PA 1I2FA 6GSPA 1JBTA 1DE3A 1LOVA 1UCKA 1FUSA 3D5GA 1BSAA 1HYFA 5GSPA 1ZGXA 1BSDA 1BRKA 3WHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCL A;  1C54 A;  1YVS A;  2F4Y A;  1I2G A;  2HOH A;  2RNT A;  3URP A;  1GMQ A;  1FYS A;  5BIR A;  1MGW A;  1RGC A;  1BAO A;  3DGY A;  4GSP A;  1B21 A;  1I70 A;  1SAR A;  7RNT A;  3SYU A;  4BU4 A;  1HZ1 A;  1B2Z A;  1UCL A;  4HOH A;  1BRJ A;  4GHO A;  2C4B A;  3AHW A;  1AQZ A;  3AHS A;  1PY3 A;  1CH0 A;  1LOW A;  1RMS A;  1I2E A;  2BU4 A;  1GMR A;  1TRQ A;  1YGW A;  1RGG A;  1BVI A;  1RGL A;  2ZA4 A;  1MGR A;  1G02 A;  9RNT A;  2KAA A;  1YNV X;  5RNT A;  1UCJ A;  5HOH A;  3GSP A;  1B3S A;  1I0V A;  1LOY A;  1AY7 A;  1RGH A;  2F5M A;  1X1W A;  1BSE A;  1I3F A;  1BGS A;  2KF5 A;  7GSP A;  1FW7 A;  2GSP A;  2BIR A;  1BRN L;  1LNI A;  2KF3 A;  1RLS A;  1BUJ A;  1PYL A;  4HAA A;  1X1X A;  1BRI A;  1RGF A;  1DET A;  1BNG A;  1B20 A;  3D5I A;  1BOX A;  1B2M A;  3BU4 A;  1B27 A;  1RGK A;  2F5W A;  3A5E A;  1BAN A;  1Q9E A;  1BIR A;  3Q3F A;  3BIR A;  1GSP A;  2AAE A;  1LRA A;  1I3I A;  1RNT A;  1I8V A;  2KF6 A;  6RNT A;  1RNB A;  1GMP A;  1RTU A;  1RGE A;  3KCH A;  1BRG A;  1BNI A;  1B2U A;  1RGA A;  1GOU A;  1BNS A;  3AGO A;  2RBI A;  5BU4 A;  1GOV A;  3WR2 A;  1TTO A;  1RCK A;  1BNR A;  1BNJ A;  1GOY A;  1RHL A;  1T2I A;  1B2X A;  4RNT A;  4J5K A;  3DH2 A;  1BSB A;  1X1Y A;  1TRP A;  2F56 A;  2AAD A;  1BRH A;  4BIR A;  1BNE A;  1JBR A;  1R4Y A;  1RSN A;  1BNF A;  3D4A A;  1UCI A;  1FUT A;  1X1U A;  1JBS A;  1IYY A;  4J5G A;  1B2S A;  1BU4 A;  1RN4 A;  1RDS A;  1BRS A;  1FZU A;  1T2H A;  1I0X A;  2KF4 A;  2SAR A;  3AGN A;  1RN1 A;  3HOH A;  3RNT A;  8RNT A;  1BSC A;  1A2P A;  1I2F A;  6GSP A;  1JBT A;  1DE3 A;  1LOV A;  1UCK A;  1FUS A;  3D5G A;  1BSA A;  1HYF A;  5GSP A;  1ZGX A;  1BSD A;  1BRK A;  3WHO A; 
#chains in the Genus database with same CATH topology
 2H0H A;  3PXM A;  3Q1C A;  2F4Y A;  2HOH A;  1I2G A;  1UGH I;  1OAC A;  1AVL A;  1ROV A;  2BO9 B;  3DM8 A;  4N6N B;  1GMQ A;  3PYJ A;  5BIR A;  5TGN A;  4X2H A;  2P0M A;  3UL5 A;  4GSP A;  3G6E 3;  7RNT A;  3EN1 B;  3S27 A;  1TUH A;  2K3D A;  1T5Y A;  3JUM A;  4NPB A;  4ZM8 A;  2A15 A;  5HGR A;  4K1U A;  5IW9 A;  3PS8 A;  1M1K 4;  5G1K A;  4XBT A;  2KCD A;  1AQZ A;  3AHS A;  5IG5 A;  2F98 A;  1PY3 A;  1VQ7 3;  1CH0 A;  1I2E A;  1UUW B;  4N6T A;  3CXC 2;  1GYB A;  1ULJ B;  2R41 A;  2L4V A;  1BVI A;  1W01 A;  3G0K A;  3NBB A;  1YIJ 3;  2HMK B;  2Z76 A;  2M7O A;  1VQ8 3;  1D6U A;  1SQW A;  3BND A;  3CCQ 3;  1YNV X;  1UCJ A;  3BNB A;  3OX9 A;  1QJG A;  2CFL A;  2Z77 A;  1US1 A;  5HOH A;  3WOD G;  4KVH A;  3GSP A;  1STD A;  1WMO A;  4XBX A;  3JUN A;  3PCR A;  1X1W A;  1E97 A;  1BSE A;  1I3F A;  3DGM A;  2GU3 A;  2O9U X;  2KF5 A;  3DGL A;  4R1K A;  7GSP A;  5IG3 A;  3EF8 A;  1F8N A;  1RJO A;  3HX8 A;  2BIR A;  3E99 A;  2WOH A;  5STD A;  1QVF 2;  1IV9 A;  1BRN L;  4GB5 A;  3LXU X;  5CF1 A;  2ZDJ A;  1UDI I;  3BB9 A;  3FH1 A;  3WMD A;  1RLS A;  1VZZ A;  1N5H A;  2YFJ B;  4HAA A;  4O2H A;  1BRI A;  4BTW A;  1DET A;  3CNX A;  5EVH A;  1WTH A;  2YFL B;  3CCU 3;  4HKV B;  1NB5 I;  4N6O B;  1B27 A;  1RGK A;  4L8P A;  2ZL8 A;  3ZG5 A;  3A5E A;  1VQ6 3;  1DMN A;  3O8Y A;  1Q9E A;  3NM2 A;  4R9L A;  3BIR A;  3K63 A;  4X2O A;  2KF6 A;  1V58 A;  2W9P A;  1GMP A;  1OCV A;  1RGE A;  3V98 A;  2ML5 A;  2XH9 A;  5D82 A;  4NHF A;  2W6J H;  1BNI A;  3DXO A;  1NWW A;  3MKI A;  1GD4 A;  3G8Z A;  3HI7 A;  2CC3 A;  1BNS A;  2W56 A;  3CU3 A;  5I97 A;  2BNG A;  3DY5 A;  4H3U A;  3D9R A;  2UX0 A;  3X3Y A;  3SVA A;  3TDG A;  4J8T A;  2ZHX B;  4FMD A;  2MC8 A;  4J5K A;  3DH2 A;  3QK9 A;  1KD1 4;  1TU5 A;  3EQQ B;  3V99 A;  1BSB A;  1ZX2 A;  4GL6 A;  1X1Y A;  2CG1 A;  1FGR A;  2F56 A;  3LTA A;  3MG3 A;  1W6C A;  3F40 A;  1VQN 3;  4RNY A;  1A67 A;  1OH0 A;  3QRD A;  1JBR A;  1SJW A;  1Q40 A;  4H61 A;  3RDE A;  3B7C A;  1D6Z A;  5FW5 A;  3N9H A;  3HK4 A;  1FUT A;  4L8O A;  4FR9 A;  1WNH A;  1X1U A;  5G1L A;  1B2S A;  2LQV A;  4LGQ A;  1RDS A;  4LSO A;  8RNT A;  1I0X A;  3AGN A;  4MMY B;  1RN1 A;  3WOE B;  3CC4 3;  2WGO A;  3MWZ A;  1A2P A;  5M1A A;  3KFQ C;  4U13 A;  1OF5 B;  1DE3 A;  1JN5 B;  2P0X A;  1ASK A;  1FUS A;  1UCK A;  1NDO B;  4HM3 B;  3KN4 A;  1BSD A;  4LEH A;  1WQL B;  1N5P A;  4JRF A;  2R4I A;  2O3O A;  3BNC A;  3G16 A;  4DKI A;  1IT7 A;  2CG0 A;  1K73 4;  5IG0 A;  1VQO 3;  1YVS A;  3URP A;  4HZ9 B;  2QEX 3;  1M1X B;  1NO3 A;  1FYS A;  4HM2 B;  3EBY A;  3CC7 3;  2OWP A;  3SYU A;  1IQ8 A;  5IEN A;  1UCL A;  1DVC A;  4HOH A;  1MWT A;  1O7N B;  3SOY A;  4R4K A;  3J7Y d;  4J9A A;  2Z7A A;  1O7M B;  3GAX A;  4GHO A;  4MMZ B;  2C4B A;  3N54 B;  3I55 3;  3L0R A;  3NHX A;  2CFW A;  5BVB A;  5G2G A;  5DRE A;  1GMR A;  1RGG A;  2FXT A;  3STD A;  5M19 A;  2RSX A;  1FA3 A;  2ZA4 A;  3RGA A;  1MGR A;  4I4K A;  1S5A A;  2I9W A;  3S5C A;  2QIY A;  2XSH B;  2BHM A;  4FMB A;  1K8A 4;  1SII A;  5M18 A;  1G02 A;  1SIH A;  4N6U A;  3FF2 A;  3H51 A;  4KFE A;  5CK6 A;  9RNT A;  1PU4 A;  3EBT A;  5RNT A;  2XRX B;  3CCV 3;  4OUQ A;  1LQM B;  3WOF B;  1B3S A;  2PZV A;  1RGH A;  1Q7Y 4;  3UNL A;  1W5Z A;  2XGL A;  4AKY A;  1IV7 A;  1K41 A;  1WMP A;  1PFP A;  2CKF B;  1ISK A;  3EJV A;  2GSP A;  3CCE 3;  1A90 A;  3S67 A;  1GD3 A;  1OF5 A;  6STD A;  1LNI A;  1IU7 A;  3DGN A;  4RNZ A;  1JRQ A;  5EEO A;  4BL3 A;  1JNQ A;  1YHQ 3;  1X1X A;  2B1X B;  4XDV A;  3D5I A;  1R4C A;  2H0G A;  1HKX A;  2OOV C;  1MOL A;  3SED A;  3BU4 A;  3MYT A;  3EN8 A;  2GBW B;  1Q7H A;  1E3V A;  1EUI C;  1OHS A;  1VQ5 3;  4FMC A;  1MWR A;  1BAN A;  1BIR A;  1O7H B;  4HM0 B;  3Q3F A;  3V92 A;  2AAE A;  1LRA A;  1RNT A;  3EX9 A;  3PCS A;  4HM1 B;  1OPY A;  2IA7 A;  2ML6 A;  1TP6 A;  2HMJ B;  3FKA A;  1RNB A;  4MEI A;  3ER7 A;  3NXJ A;  2OTL 3;  1JB5 A;  3N8B A;  3VSY A;  3CPW 2;  1RGA A;  3A76 A;  3OV4 A;  2INX A;  4IPB A;  3WDG B;  1M90 4;  3MPH A;  1Z1S A;  3F7S A;  4LYL B;  2KXG A;  1RKY A;  2RGQ A;  1Q81 4;  3NBR A;  4CJN A;  4WWU C;  1E3R A;  1QMA A;  2CWT A;  1YJ9 3;  1CYU A;  4FCJ A;  4EC6 A;  2GXF A;  4WHA A;  1TIJ A;  4L7K A;  1O7P B;  2XEP A;  1TRP A;  3D79 A;  3X40 A;  1LNH A;  1UI8 A;  2BMO B;  3Q2P A;  2P05 A;  2C11 A;  3F9S A;  3PZW A;  1C7H A;  4HM5 B;  1OGX A;  2HMO B;  1ROA A;  3SLU A;  2WGQ A;  1RSN A;  2Y73 A;  3DMC A;  1UCI A;  2STD A;  2GEX A;  1QAL A;  3ECF A;  1U8C B;  3JUO A;  1UGI A;  5BXQ A;  2KF4 A;  3X3X A;  5DRV A;  3WA2 X;  2SAR A;  1JZD A;  3RNT A;  2FNQ A;  3FGY A;  1I2F A;  2W56 B;  3I56 3;  3IMA B;  5AII A;  1JBT A;  4WFO A;  4HM6 B;  4XDW A;  3IPT A;  1YJW 3;  1IQY A;  1HU9 A;  1OUN A;  3EHC A;  3Q90 A;  2XGN A;  1ZGX A;  1IVU A;  3JUQ A;  1N8R 4;  4FCM A;  3X3Z A;  2L1S A;  1W02 A;  2KRT A;  1VQK 3;  3LOY A;  4HM7 B;  1RCL A;  1BUQ A;  1C54 A;  2QGU A;  2F99 A;  4TX4 A;  1TFK A;  3NBJ A;  3SXX A;  2RNT A;  1M9G A;  5LC7 A;  1V74 A;  3NQY A;  1MGW A;  3KSP A;  4R80 A;  1BAO A;  7STD A;  5FGO A;  1MNL A;  3EC9 A;  3PGB A;  4HZB B;  4BU4 A;  1HZ1 A;  1Y4K A;  2Z6B A;  1VQL 3;  1DMQ A;  3CCM 3;  4EXR A;  2WO0 A;  3LTC A;  3KE7 A;  2XF3 A;  3AHW A;  4BL2 A;  1LOX A;  2CX1 A;  5D83 A;  4HJL B;  3RGR A;  2BU4 A;  1U5O A;  3AMO A;  1VQ4 3;  1YI2 3;  3MHE A;  1AR0 A;  1NNV A;  4WYK B;  1L5G B;  1DYU A;  2IUJ A;  1FGT A;  4O8S A;  1QAK A;  3FG4 A;  1W6G A;  2RCD A;  3U1W A;  1WMN A;  3FG1 A;  3UJM A;  2KAA A;  3K7C A;  1DVD A;  1RRL A;  1GY5 A;  3G4S 3;  1UUV B;  4K61 A;  1I0V A;  1LOY A;  1Q82 4;  1AY7 A;  2W9Q A;  3G71 3;  2F5M A;  2CHC A;  1OGZ A;  4EV2 A;  1GY6 A;  3KZT A;  1ZO2 A;  3HZP A;  3ZG0 A;  3NX0 A;  2QA4 3;  3KII A;  2MF7 A;  1YVB I;  1W7C A;  5ELU A;  4KFD A;  3JVC A;  3KKG A;  4EW5 A;  5AEW B;  4HYZ A;  5JPP A;  4FMA A;  1BNG A;  4Q53 A;  1GY7 A;  1JZO A;  2CFD A;  4OVM A;  3ALA A;  1RRH A;  1UW1 A;  3H3H A;  4HM4 B;  4O3V A;  1YIT 3;  2F5W A;  2SBL A;  1J2B A;  4CCV A;  3CCR 3;  2BT3 A;  4XBY A;  2D42 A;  1FGO A;  3EE1 A;  4K90 B;  3CPO A;  3X41 A;  5ELJ A;  1YJN 3;  2J8X B;  1I8V A;  1RN7 A;  4EV5 A;  6RNT A;  4FCZ A;  3NUV A;  1VQQ A;  3B4O A;  1A2K A;  5AIH A;  3NV0 A;  2XSO B;  1VQ9 3;  3KCH A;  3UB1 A;  2YFI B;  1AVK A;  1QAF A;  2XFT A;  4N6V 0;  1B2U A;  1D6Y A;  1O7W B;  2HML B;  2K0M A;  2JQ5 A;  3F8X A;  3MG2 A;  4EYC A;  2RBI A;  5BU4 A;  3NQZ A;  4EBG A;  1LXE A;  3CCJ 3;  2JDI H;  3MSO A;  2K54 A;  1GOY A;  3CCS 3;  2CK3 H;  3B4P A;  1RHL A;  1T2I A;  3FG3 A;  2P09 A;  3LZA A;  1MWU A;  5KP1 A;  1K9M 4;  3F8H A;  1N9J A;  2BMQ B;  1EG9 B;  2PNC A;  3LML A;  2AAD A;  3D3L A;  5AYS C;  5CF2 A;  1ZS7 A;  1KQS 2;  4BIR A;  3GZR A;  3SOA A;  1V57 A;  1R4Y A;  1EEJ A;  1W4N A;  2LYX A;  3D4A A;  5JPU A;  2CW9 A;  1JBS A;  1IYY A;  1NJI 4;  3S29 A;  3OXA A;  1T2H A;  1BRS A;  5AIF A;  1IVW A;  3LT8 A;  4NRE A;  3HOH A;  5CXO A;  1BSC A;  3CC2 3;  3FSD A;  1N8Q A;  4XB5 A;  4KZ1 A;  6GSP A;  3FCS B;  1JN5 A;  1BSA A;  4LMI A;  2Y74 A;  1NB3 I;  2UGI A;  3OWY A;  1JV2 B;  3DUK A;  3UL6 A;  1KSI A;  1FGQ A;  5D81 A;  3VGN A;  2E2V A;  3WHO A;  3CMA 3;  4BTY A;  3FLJ A;  1KC8 4;  4G1M B;  1OHP A;  3LT9 A;  4N6M A;  2GEY A;  3HII A;  1RGC A;  2OTJ 3;  3DGY A;  5AYR B;  1B21 A;  1I70 A;  1SAR A;  1TFO A;  3NM7 A;  4BTX A;  5A0O B;  4AEQ A;  1B2Z A;  4JF8 A;  2CFK A;  3T0U A;  1DMM A;  1BRJ A;  4ORL A;  4XM4 A;  2CWV A;  2FGT A;  2OCT A;  2Q07 A;  1W2Z A;  4WP5 A;  3GWR A;  3LH4 A;  4N3V A;  3HIG A;  1LOW A;  1RMS A;  3GZB A;  5IER A;  3U97 A;  3WA3 A;  1TRQ A;  1YGW A;  3CME 3;  1RGL A;  5IEP A;  2W03 A;  4HM8 B;  3K5T A;  3F7X A;  5KP3 A;  2GU1 A;  4MJD A;  2IY2 A;  4STD A;  3OWS A;  3IJE B;  4HBR A;  3DZL A;  3ROB A;  3B8L A;  2B24 B;  1JB4 A;  2D1W A;  1QVG 2;  4K1V A;  4ILF A;  1G96 A;  3CD6 3;  2IUK A;  2RFR A;  4KT3 B;  2UUG C;  1IQX A;  2XFS A;  3S28 A;  3NV0 B;  1BGS A;  1FW7 A;  3EB8 A;  3LTB A;  2IYJ A;  1S72 3;  1G0T A;  1CYV A;  3MG1 A;  1UUG B;  1W2B 2;  2KF3 A;  1JKG A;  1LVN A;  1O7G B;  1BUJ A;  3BNE A;  1JKG B;  2OQE C;  1NU3 A;  1KWI A;  1PYL A;  2CIU A;  1RGF A;  1B20 A;  3AMO B;  4WYK A;  3SX1 A;  1Q86 4;  5LC6 A;  2XR8 B;  1BOX A;  3LTD A;  1B2M A;  3ZFZ A;  3K0Z A;  5AI1 A;  4KFF A;  5CLK A;  1IVX A;  1SPU A;  1GSP A;  1ULI B;  1STF I;  1I3I A;  2GBX B;  1IT8 A;  4LZI A;  4N6L A;  4OK0 A;  1CEW I;  5AIG A;  1CQS A;  1TJD A;  1Q40 B;  3CCL 3;  1IVV A;  3GZX B;  5EQL A;  1RTU A;  3BLZ A;  2W04 A;  2E2U A;  2W2C A;  1BRG A;  3JUP A;  2YX9 A;  1GOU A;  1T3B A;  1IK3 A;  3AGO A;  4PEJ A;  5JBS A;  1Q42 A;  3M8C A;  4I5Q A;  5IEO A;  2OQE A;  1GOV A;  1IDP A;  4IT7 A;  1TTO A;  3WR2 A;  4O02 B;  4R9K A;  1RCK A;  2WOF A;  1JB2 A;  3OW2 2;  1BNR A;  3GRD A;  1VQM 3;  2F86 B;  1BNJ A;  3LYG A;  1LQG C;  2CWU A;  1B2X A;  4RNT A;  3X42 A;  5IF6 A;  1UI7 A;  3OWU A;  4RBN A;  1FGM A;  3I0Y A;  3KSE D;  1K28 A;  1BRH A;  2E2T A;  3T8U A;  1FUW A;  4MMX B;  1BNE A;  1OHO A;  2BMR B;  3T8N A;  1EKM A;  3CNM A;  5AEU B;  3VF1 A;  2HMN B;  1BNF A;  1N9E A;  4IIA A;  4AKZ A;  5KP4 A;  1VQP 3;  2IMJ A;  4J5G A;  4CDL A;  2CX0 A;  1BU4 A;  1RN4 A;  1A2V A;  1FZU A;  2HMM B;  3K9M C;  4HVN A;  1YGE A;  2H0I A;  3GZY B;  4RZM A;  1W00 A;  2W0Q A;  1EQK A;  1LOV A;  8CHO A;  3D5G A;  2C10 A;  2P38 A;  2OOV A;  2V1L A;  1MWS A;  1HYF A;  2CH9 A;  3FZW A;  5IG4 A;  5GSP A;  1GS3 A;  2CFG A;  3F14 A;  1W6Y A;  1BRK A;  3DGO A;  4QWT A;  1AV4 A;  3FF0 A;  1EA2 A;  4CPK A;  1JJ2 2; 
#chains in the Genus database with same CATH homology
 1RCL A;  1C54 A;  1YVS A;  2F4Y A;  1I2G A;  2HOH A;  2RNT A;  3URP A;  1GMQ A;  1FYS A;  5BIR A;  1MGW A;  1RGC A;  1BAO A;  3DGY A;  4GSP A;  1B21 A;  1I70 A;  1SAR A;  7RNT A;  3SYU A;  4BU4 A;  1HZ1 A;  1B2Z A;  1UCL A;  4HOH A;  1BRJ A;  4GHO A;  2C4B A;  3AHW A;  1AQZ A;  3AHS A;  1PY3 A;  1CH0 A;  1LOW A;  1RMS A;  1I2E A;  2BU4 A;  1GMR A;  1TRQ A;  1YGW A;  1RGG A;  1BVI A;  1RGL A;  2ZA4 A;  1MGR A;  1G02 A;  9RNT A;  2KAA A;  1YNV X;  5RNT A;  1UCJ A;  5HOH A;  3GSP A;  1B3S A;  1I0V A;  1LOY A;  1AY7 A;  1RGH A;  2F5M A;  1X1W A;  1BSE A;  1I3F A;  1BGS A;  2KF5 A;  7GSP A;  1FW7 A;  2GSP A;  2BIR A;  1BRN L;  1LNI A;  2KF3 A;  1RLS A;  1BUJ A;  1PYL A;  4HAA A;  1X1X A;  1BRI A;  1RGF A;  1DET A;  1BNG A;  1B20 A;  3D5I A;  1BOX A;  1B2M A;  3BU4 A;  1B27 A;  1RGK A;  2F5W A;  3A5E A;  1BAN A;  1Q9E A;  1BIR A;  3Q3F A;  3BIR A;  1GSP A;  2AAE A;  1LRA A;  1I3I A;  1RNT A;  1I8V A;  2KF6 A;  6RNT A;  1RNB A;  1GMP A;  1RTU A;  1RGE A;  3KCH A;  1BRG A;  1BNI A;  1B2U A;  1RGA A;  1GOU A;  1BNS A;  3AGO A;  2RBI A;  5BU4 A;  1GOV A;  3WR2 A;  1TTO A;  1RCK A;  1BNR A;  1BNJ A;  1GOY A;  1RHL A;  1T2I A;  1B2X A;  4RNT A;  4J5K A;  3DH2 A;  1BSB A;  1X1Y A;  1TRP A;  2F56 A;  2AAD A;  1BRH A;  4BIR A;  1BNE A;  1JBR A;  1R4Y A;  1RSN A;  1BNF A;  3D4A A;  1UCI A;  1FUT A;  1X1U A;  1JBS A;  1IYY A;  4J5G A;  1B2S A;  1BU4 A;  1RN4 A;  1RDS A;  1BRS A;  1FZU A;  1T2H A;  1I0X A;  2KF4 A;  2SAR A;  3AGN A;  1RN1 A;  3HOH A;  3RNT A;  8RNT A;  1BSC A;  1A2P A;  1I2F A;  6GSP A;  1JBT A;  1DE3 A;  1LOV A;  1UCK A;  1FUS A;  3D5G A;  1BSA A;  1HYF A;  5GSP A;  1ZGX A;  1BSD A;  1BRK A;  3WHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...