2C4BA

Inhibitor cystine knot protein mcoeeti fused to the catalytically inactive barnase mutant h102a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIRSSSMGVCPKILKKCRRDSDCLAGCVCGPNGFCGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Barnase Fusion as a Tool to Determine the Crystal Structure of the Small Disulfide-Rich Protein Mcoeeti.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Fusion protein
molecule keywords BARNASE MCOEETI FUSION
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2005-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2c4bA00
3A5EA 1B2MA 3D5GA 1BUJA 4BU4A 1BSBA 1BRIA 1BSDA 3AHWA 2C4BA 1BSEA 1MGRA 1FZUA 1RHLA 5BIRA 5HOHA 5RNTA 1I70A 1LOWA 1X1XA 1YNVX 3BIRA 1BRSA 1I0XA 3GSPA 4HAAA 1BRNL 6RNTA 3WHOA 1I8VA 1C54A 1BRJA 1GOYA 1B2UA 1BNSA 1ZGXA 2AADA 1HYFA 1RCKA 1RGFA 4RNTA 1X1WA 1RCLA 1I0VA 1B21A 2KAAA 7GSPA 1BGSA 4J5GA 1I2FA 2BIRA 1DETA 1YGWA 1T2HA 1BSAA 1RSNA 1LRAA 1BIRA 1GSPA 4GSPA 2ZA4A 1RDSA 1HZ1A 2KF4A 3AHSA 4J5KA 1BNRA 2KF3A 1FW7A 1RGEA 1UCJA 3DH2A 2KF5A 1RGGA 2F4YA 1BRHA 7RNTA 1FUTA 1BU4A 2AAEA 2BU4A 1RGKA 1I2GA 1BAOA 1BOXA 1AQZA 3D5IA 1RNTA 1I3IA 1RMSA 1LOYA 1BNJA 1MGWA 4GHOA 4BIRA 1X1UA 2F56A 1SARA 3WR2A 1DE3A 2F5WA 1RTUA 2F5MA 2HOHA 1JBSA 1YVSA 1RGLA 3KCHA 1GMQA 1UCIA 1RGHA 3DGYA 1FUSA 1B2ZA 1BNEA 1GMRA 1UCKA 1TRQA 1RLSA 3SYUA 1BNFA 3Q3FA 1X1YA 3BU4A 1RN4A 1A2PA 5GSPA 1BANA 2SARA 9RNTA 1B2SA 1T2IA 2RBIA 1TTOA 1CH0A 1I2EA 1BNIA 1UCLA 1AY7A 2KF6A 1BRKA 1BNGA 5BU4A 1IYYA 1PY3A 1JBRA 1BVIA 1RGCA 2RNTA 1GOVA 6GSPA 1PYLA 1RN1A 1GOUA 8RNTA 1B20A 1B3SA 1B27A 3URPA 1BRGA 3D4AA 1RGAA 1TRPA 3RNTA 1R4YA 1JBTA 1Q9EA 3AGOA 1GMPA 3HOHA 2GSPA 4HOHA 3AGNA 1FYSA 1LOVA 1RNBA 1G02A 1I3FA 1BSCA 1LNIA 1B2XA
chains in the Genus database with same CATH superfamily
1BUJA 4BU4A 1OH0A 1NDOB 1BSDA 4FMBA 3RGAA 1N9JA 1BSEA 1MGRA 1RHLA 2K0MA 5BIRA 1OCVA 1CYVA 5KP3A 1JV2B 2XH9A 5CF2A 3CMA3 3NV0A 2IA7A 4FCZA 4XBXA 1IQXA 1F8NA 2A15A 1Q7HA 2CH9A 3VGNA 2L1SA 3GAXA 3RDEA 4XB5A 3MG2A 3SEDA 2GEYA 3HK4A 1UW1A 1B2UA 4HM0B 3B8LA 6STDA 3OWUA 1RGFA 2O9UX 3MKIA 1JJ22 3G4S3 2XSHB 4QWTA 1VQ83 1O7HB 2XFSA 3FH1A 4R9KA 1D6YA 3K9MC 1I2FA 1DETA 1VQQA 1VQM3 1MNLA 3F14A 1OGZA 4HM2B 1BIRA 2Z6BA 1LNHA 1RN7A 1RDSA 2CFGA 1W6GA 4STDA 1IT8A 2KF4A 4RNZA 1CQSA 3D79A 3T0UA 1IQ8A 2HMMB 3IMAB 1N5HA 2KCDA 4BL3A 3I563 1VQN3 1RGGA 1N5PA 3GZYB 2D1WA 2WGOA 2K3DA 1LQGC 3NQYA 1SQWA 1IDPA 2AAEA 3X3ZA 1RGKA 4HVNA 1GS3A 1UUGB 2H0IA 2OTL3 1RNTA 1SJWA 3LXUX 1I3IA 1UI7A 1OHPA 1ZO2A 3FKAA 5CXOA 2F56A 1DE3A 5CK6A 5IG4A 5IEPA 4XDWA 1RTUA 3S27A 2CG0A 2QIYA 1KD14 2KXGA 2KRTA 1M904 1UCIA 1VQ73 1DMNA 1W4NA 1FUSA 1B2ZA 1K41A 1BNEA 4N6MA 2XRXB 4RBNA 3CNMA 3DGOA 1KQS2 1TRQA 1OACA 1RLSA 2UGIA 1JN5A 1OF5B 2XR8B 3SYUA 3UB1A 1A90A 1W6YA 1AV4A 1NU3A 1X1YA 3GZXB 2IY2A 4K1UA 2YX9A 3OV4A 9RNTA 3HX8A 5I97A 3NBBA 1STFI 2CKFB 3JVCA 3UL5A 3EE1A 4WYKB 1G0TA 1UCLA 4HM7B 1T5YA 5AIHA 1BRKA 4I4KA 1FGRA 1GY5A 5BU4A 4AKZA 3GZRA 1SIIA 1ULIB 3PS8A 2R4IA 1PY3A 3X3XA 1N8R4 2STDA 3F8HA 2FGTA 2RNTA 3G16A 1K9M4 3U97A 1PYLA 3ZFZA 3PZWA 1GOUA 3SVAA 3F40A 1JKGB 2E2TA 4KT3B 5FW5A 1VQO3 3TDGA 3CD63 1YI23 3EF8A 2W04A 5AIIA 3CCL3 5FGOA 1JNQA 1TRPA 4LZIA 4N3VA 1JB4A 2ML5A 4R80A 2JQ5A 1W00A 1JBTA 3AGOA 3LT8A 3FG3A 3N9HA 2C11A 1DYUA 4BTYA 1ROVA 2ML6A 3BNDA 4FMDA 1QAKA 2I9WA 2XEPA 4XBYA 4ZM8A 4HOHA 1IVUA 3EC9A 1UUVB 1RNBA 4BTWA 2SBLA 1B2XA 3EQQB 2R41A 4IPBA 3CME3 1WMOA 1QALA 3VSYA 2RCDA 3T8NA 3F9SA 2XF3A 2CFKA 1UI8A 1DMQA 2F86B 4KFDA 5TGNA 1FZUA 5HOHA 5AEWB 3MG3A 1FUWA 3BIRA 1I0XA 2V1LA 3GSPA 4HAAA 4CJNA 1WQLB 2CX1A 2WO0A 1YVBI 3CCJ3 3WHOA 2IUJA 3MWZA 3WODG 2GBWB 1BRJA 4I5QA 2CG1A 3ROBA 3Q90A 3SXXA 1BNSA 2AADA 4EYCA 2CIUA 1HYFA 2BT3A 1X1WA 2KAAA 4N6OB 2QEX3 3F8XA 4J5GA 1EA2A 4L8PA 3S5CA 1QMAA 2BIRA 1O7WB 1YGWA 1YIJ3 5IEOA 1T2HA 5BVBA 4N6TA 1QAFA 1S723 3BNBA 1E3VA 4GSPA 1A67A 2CC3A 1HZ1A 4EXRA 1OHSA 4J5KA 1FW7A 1UCJA 1ZX2A 2LYXA 2HMNB 4HJLB 1IK3A 1NJI4 2WGQA 3CC23 5G2GA 4MMYB 3B7CA 7RNTA 5AI1A 1WNHA 1UDII 2W56B 4O3VA 1FUTA 4L8OA 3EBTA 3KZTA 3HIIA 1YIT3 1LOXA 5A0OB 2OTJ3 1BAOA 1C7HA 3NUVA 2GEXA 2QA43 3WOFB 4R4KA 4WHAA 1LOYA 3V98A 1FGQA 3Q1CA 1JN5B 3UNLA 3WOEB 3CCV3 3F7SA 1M9GA 3GWRA 2F5WA 1MWRA 4LMIA 1ISKA 3GZBA 4HM6B 2ZL8A 5JBSA 3D9RA 4HM5B 4FMAA 3KCHA 1Z1SA 1GMQA 3FSDA 3OWSA 1RGHA 3DGYA 1FA3A 4J9AA 4XBTA 4ORLA 2OCTA 1MWSA 3ECFA 4X2OA 2RFRA 3DM8A 3KFQC 1KSIA 5ELJA 3PYJA 4KFEA 3BU4A 1PFPA 1RN4A 4NREA 1A2PA 2HMLB 2OQEC 1YHQ3 3G713 1BANA 2SARA 2W9QA 3LZAA 3NQZA 1CH0A 1GY7A 3CPW2 3EN1B 3X42A 1W2ZA 3WA2X 2KF6A 3G0KA 2LQVA 1BNGA 1N8QA 3S29A 3DUKA 5G1LA 3ZG0A 1OPYA 1RGCA 3HZPA 2CX0A 1LVNA 3K7CA 4WP5A 4HZBB 3UJMA 3NXJA 1V58A 4HKVB 1B3SA 1A2VA 1FGOA 3JUNA 3D4AA 3NM2A 2CK3H 2JDIH 3I0YA 1C54A 1AR0A 1GMPA 2Y74A 1K734 3SLUA 1IVXA 2Z77A 1DVCA 3KE7A 4CDLA 4MMXB 3JUMA 2CFDA 1IVWA 3GRDA 4TX4A 3E99A 1EG9B 1LOVA 1G02A 2OOVA 3K0ZA 4AKYA 1Q40A 1BRNL 1NNVA 3A5EA 2L4VA 5LC7A 1B2MA 3DGNA 5AEUB 3K5TA 3OX9A 1QVG2 3OW22 1RJOA 4LYLB 5RNTA 1VQ63 1V74A 2XGLA 4NPBA 1X1XA 2BHMA 3EB8A 1BRSA 3OXAA 2RSXA 1GYBA 3NBRA 3F7XA 1AVKA 1VQ43 4Q53A 6RNTA 2Q07A 1I8VA 1EQKA 4FCJA 3J7Yd 1GOYA 1ZGXA 2IYJA 3FGYA 5M18A 2O3OA 1RCKA 3S67A 5D83A 7GSPA 1I0VA 1B21A 3PXMA 3NM7A 5G1KA 5JPUA 1BGSA 3SOYA 1O7MB 5AYSC 3WMDA 5IG3A 2CWUA 4WYKA 1ROAA 3FG1A 1STDA 1VZZA 4U13A 5D81A 1LRAA 2YFJB 3N8BA 2WOHA 3LTCA 2ZA4A 3X3YA 1VQL3 5EQLA 8CHOA 3SOAA 3AHSA 3KSED 2BO9B 1BNRA 3CCS3 1RGEA 2UX0A 1HU9A 1UGIA 2F4YA 1SPUA 4KVHA 1JKGA 2Z7AA 2P09A 4HYZA 1BRHA 2H0GA 3M8CA 3V92A 4N6V0 5JPPA 4N6LA 3CPOA 1I2GA 3QK9A 1BOXA 2HMJB 3D5IA 3B4OA 4HM1B 3H51A 5AIFA 2ZDJA 4O02B 1OUNA 2P38A 1ASKA 1MGWA 1TIJA 4GHOA 3T8UA 3DZLA 1X1UA 4DKIA 5CF1A 2H0HA 2BMQB 3ZG5A 3MHEA 1K8A4 3MYTA 1MWUA 1A2KA 2HOHA 2ZHXB 1RGLA 1JBSA 2Z76A 5DRVA 1IV9A 1W7CA 2IUKA 2XFTA 3FZWA 1FGMA 1WMPA 1LQMB 2CWTA 2PZVA 3L0RA 5ELUA 1TFKA 2F98A 1KC84 1UCKA 3AMOA 4OK0A 3QRDA 1UUWB 3O8YA 1PU4A 5BXQA 1BNFA 3Q3FA 3X41A 1JB2A 1RRHA 1ULJB 1QVF2 3G6E3 2W9PA 2FNQA 1BUQA 1DMMA 4MJDA 2RBIA 1TTOA 3LTBA 4LGQA 1K28A 4EV5A 3MG1A 4BTXA 4O8SA 4L7KA 2W56A 4CCVA 2CFLA 4KZ1A 3DY5A 4FR9A 3PCRA 3IPTA 4X2HA 4XDVA 1VQ53 1T3BA 1M1XB 1Q42A 1JRQA 4RZMA 1BVIA 2P0MA 2OQEA 1GOVA 1W6CA 3U1WA 6GSPA 1CYUA 1Q40B 4LEHA 3BLZA 8RNTA 3FG4A 3JUQA 1WTHA 1NB5I 2Y73A 4AEQA 3CC43 1B27A 1BRGA 2INXA 3B4PA 1RKYA 2OOVC 1R4YA 2OWPA 1DVDA 1IT7A 3BB9A 2YFIB 4OUQA 5EVHA 4NHFA 3NV0B 2GSPA 4K1VA 1GD4A 1EKMA 3EN8A 2HMKB 5AYRB 1I3FA 3KSPA 2GXFA 4GL6A 4JF8A 2QGUA 2C10A 1FGTA 3D5GA 4R9LA 4FCMA 1BSBA 3FCSB 1BRIA 3DMCA 3KKGA 3PCSA 3AHWA 2CWVA 2C4BA 5CLKA 1E97A 2YFLB 4HM4B 1I70A 1JZDA 1LOWA 1YNVX 3VF1A 4CPKA 1O7GB 4R1KA 1YJW3 1Y4KA 3FLJA 5KP1A 3MPHA 3CCE3 1GY6A 1YGEA 2W03A 3OWYA 1JZOA 4WFOA 2MC8A 1NWWA 5D82A 1R4CA 2UUGC 4EBGA 3K63A 4RNTA 2B1XB 3WA3A 1MWTA 1RCLA 3LTAA 5AIGA 1NB3I 1VQK3 2F99A 2W2CA 2E2VA 4PEJA 3KN4A 1NO3A 4IT7A 1S5AA 5IENA 4MEIA 1G96A 3CCR3 1BSAA 3AMOB 1RSNA 3FF0A 1IVVA 1GSPA 3HIGA 1TJDA 1U8CB 2P05A 3LT9A 3JUPA 4HBRA 1Q814 1E3RA 1IQYA 2KF3A 4K90B 1V57A 3DH2A 2KF5A 2CW9A 3EJVA 3D3LA 4RNYA 3DGMA 1CEWI 2HMOB 3EX9A 4KFFA 3N54B 1BU4A 5IF6A 2GBXB 1D6UA 3G8ZA 2BU4A 5DREA 2J8XB 2CHCA 1EUIC 1U5OA 1AQZA 2P0XA 3LOYA 4O2HA 4MMZB 3SX1A 4OVMA 1OHOA 3Q2PA 3MSOA 1RMSA 1D6ZA 1BNJA 3KIIA 3LYGA 3NHXA 5IG0A 3I553 1TUHA 4N6UA 2K54A 3NBJA 3JUOA 4BIRA 3CCQ3 1TP6A 4EW5A 1SARA 3RGRA 3WR2A 5IG5A 3PGBA 5EEOA 1YJN3 3A76A 3BNCA 2F5MA 4LSOA 1US1A 1WMNA 1TU5A 1YVSA 1O7NB 2XGNA 2E2UA 4H61A 3NX0A 1L5GB 1Q7Y4 3CCU3 3ER7A 1GMRA 4ILFA 4J8TA 1IV7A 1YJ93 2FXTA 3HI7A 3CC73 3EBYA 5LC6A 4XM4A 3STDA 3CCM3 4H3UA 1Q824 1M1K4 1W01A 1QJGA 2M7OA 2IMJA 3DGLA 3LMLA 3CXC2 1W5ZA 2BNGA 5GSPA 1VQP3 2CFWA 1B2SA 1T2IA 1MOLA 1ZS7A 3CU3A 3S28A 4GB5A 5KP4A 1I2EA 2WOFA 5M1AA 1BNIA 5IERA 1AY7A 2XSOB 1TFOA 4WWUC 3CNXA 1HKXA 4G1MB 1IYYA 1AVLA 3H3HA 1JB5A 5M19A 1UGHI 5IW9A 1LXEA 1OF5A 2B24B 2W0QA 4FMCA 3LH4A 5HGRA 4JRFA 3X40A 2RGQA 1JBRA 1RRLA 4BL2A 1IU7A 1RN1A 3FF2A 3DXOA 4K61A 2PNCA 1B20A 1KWIA 3BNEA 2GU1A 7STDA 1J2BA 4HM8B 2BMRB 2MF7A 3URPA 4HM3B 1GD3A 1EEJA 2BMOB 4EV2A 1RGAA 2D42A 3LTDA 4HZ9B 3V99A 2GU3A 3RNTA 1VQ93 1Q9EA 4N6NB 1W2B2 1N9EA 1Q864 3UL6A 1OGXA 2W6JH 3HOHA 1W02A 4EC6A 3WDGB 3ALAA 3AGNA 1FYSA 3IJEB 5STDA 1O7PB 1SIHA 4IIAA 1BSCA 1LNIA 3EHCA
chains in the Genus database with same CATH topology
3A5EA 1B2MA 3D5GA 1BUJA 4BU4A 1BSBA 1BRIA 1BSDA 3AHWA 2C4BA 1BSEA 1MGRA 1FZUA 1RHLA 5BIRA 5HOHA 5RNTA 1I70A 1LOWA 1X1XA 1YNVX 3BIRA 1BRSA 1I0XA 3GSPA 4HAAA 1BRNL 6RNTA 3WHOA 1I8VA 1C54A 1BRJA 1GOYA 1B2UA 1BNSA 1ZGXA 2AADA 1HYFA 1RCKA 1RGFA 4RNTA 1X1WA 1RCLA 1I0VA 1B21A 2KAAA 7GSPA 1BGSA 4J5GA 1I2FA 2BIRA 1DETA 1YGWA 1T2HA 1BSAA 1RSNA 1LRAA 1BIRA 1GSPA 4GSPA 2ZA4A 1RDSA 1HZ1A 2KF4A 3AHSA 4J5KA 1BNRA 2KF3A 1FW7A 1RGEA 1UCJA 3DH2A 2KF5A 1RGGA 2F4YA 1BRHA 7RNTA 1FUTA 1BU4A 2AAEA 2BU4A 1RGKA 1I2GA 1BAOA 1BOXA 1AQZA 3D5IA 1RNTA 1I3IA 1RMSA 1LOYA 1BNJA 1MGWA 4GHOA 4BIRA 1X1UA 2F56A 1SARA 3WR2A 1DE3A 2F5WA 1RTUA 2F5MA 2HOHA 1JBSA 1YVSA 1RGLA 3KCHA 1GMQA 1UCIA 1RGHA 3DGYA 1FUSA 1B2ZA 1BNEA 1GMRA 1UCKA 1TRQA 1RLSA 3SYUA 1BNFA 3Q3FA 1X1YA 3BU4A 1RN4A 1A2PA 5GSPA 1BANA 2SARA 9RNTA 1B2SA 1T2IA 2RBIA 1TTOA 1CH0A 1I2EA 1BNIA 1UCLA 1AY7A 2KF6A 1BRKA 1BNGA 5BU4A 1IYYA 1PY3A 1JBRA 1BVIA 1RGCA 2RNTA 1GOVA 6GSPA 1PYLA 1RN1A 1GOUA 8RNTA 1B20A 1B3SA 1B27A 3URPA 1BRGA 3D4AA 1RGAA 1TRPA 3RNTA 1R4YA 1JBTA 1Q9EA 3AGOA 1GMPA 3HOHA 2GSPA 4HOHA 3AGNA 1FYSA 1LOVA 1RNBA 1G02A 1I3FA 1BSCA 1LNIA 1B2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A5E A;  1B2M A;  3D5G A;  1BUJ A;  4BU4 A;  1BSB A;  1BRI A;  1BSD A;  3AHW A;  2C4B A;  1BSE A;  1MGR A;  1FZU A;  1RHL A;  5BIR A;  5HOH A;  5RNT A;  1I70 A;  1LOW A;  1X1X A;  1YNV X;  3BIR A;  1BRS A;  1I0X A;  3GSP A;  4HAA A;  1BRN L;  6RNT A;  3WHO A;  1I8V A;  1C54 A;  1BRJ A;  1GOY A;  1B2U A;  1BNS A;  1ZGX A;  2AAD A;  1HYF A;  1RCK A;  1RGF A;  4RNT A;  1X1W A;  1RCL A;  1I0V A;  1B21 A;  2KAA A;  7GSP A;  1BGS A;  4J5G A;  1I2F A;  2BIR A;  1DET A;  1YGW A;  1T2H A;  1BSA A;  1RSN A;  1LRA A;  1BIR A;  1GSP A;  4GSP A;  2ZA4 A;  1RDS A;  1HZ1 A;  2KF4 A;  3AHS A;  4J5K A;  1BNR A;  2KF3 A;  1FW7 A;  1RGE A;  1UCJ A;  3DH2 A;  2KF5 A;  1RGG A;  2F4Y A;  1BRH A;  7RNT A;  1FUT A;  1BU4 A;  2AAE A;  2BU4 A;  1RGK A;  1I2G A;  1BAO A;  1BOX A;  1AQZ A;  3D5I A;  1RNT A;  1I3I A;  1RMS A;  1LOY A;  1BNJ A;  1MGW A;  4GHO A;  4BIR A;  1X1U A;  2F56 A;  1SAR A;  3WR2 A;  1DE3 A;  2F5W A;  1RTU A;  2F5M A;  2HOH A;  1JBS A;  1YVS A;  1RGL A;  3KCH A;  1GMQ A;  1UCI A;  1RGH A;  3DGY A;  1FUS A;  1B2Z A;  1BNE A;  1GMR A;  1UCK A;  1TRQ A;  1RLS A;  3SYU A;  1BNF A;  3Q3F A;  1X1Y A;  3BU4 A;  1RN4 A;  1A2P A;  5GSP A;  1BAN A;  2SAR A;  9RNT A;  1B2S A;  1T2I A;  2RBI A;  1TTO A;  1CH0 A;  1I2E A;  1BNI A;  1UCL A;  1AY7 A;  2KF6 A;  1BRK A;  1BNG A;  5BU4 A;  1IYY A;  1PY3 A;  1JBR A;  1BVI A;  1RGC A;  2RNT A;  1GOV A;  6GSP A;  1PYL A;  1RN1 A;  1GOU A;  8RNT A;  1B20 A;  1B3S A;  1B27 A;  3URP A;  1BRG A;  3D4A A;  1RGA A;  1TRP A;  3RNT A;  1R4Y A;  1JBT A;  1Q9E A;  3AGO A;  1GMP A;  3HOH A;  2GSP A;  4HOH A;  3AGN A;  1FYS A;  1LOV A;  1RNB A;  1G02 A;  1I3F A;  1BSC A;  1LNI A;  1B2X A; 
#chains in the Genus database with same CATH topology
 1BUJ A;  4BU4 A;  1OH0 A;  1NDO B;  1BSD A;  4FMB A;  3RGA A;  1N9J A;  1BSE A;  1MGR A;  1RHL A;  2K0M A;  5BIR A;  1OCV A;  1CYV A;  5KP3 A;  1JV2 B;  2XH9 A;  5CF2 A;  3CMA 3;  3NV0 A;  2IA7 A;  4FCZ A;  4XBX A;  1IQX A;  1F8N A;  2A15 A;  1Q7H A;  2CH9 A;  3VGN A;  2L1S A;  3GAX A;  3RDE A;  4XB5 A;  3MG2 A;  3SED A;  2GEY A;  3HK4 A;  1UW1 A;  1B2U A;  4HM0 B;  3B8L A;  6STD A;  3OWU A;  1RGF A;  2O9U X;  3MKI A;  1JJ2 2;  3G4S 3;  2XSH B;  4QWT A;  1VQ8 3;  1O7H B;  2XFS A;  3FH1 A;  4R9K A;  1D6Y A;  3K9M C;  1I2F A;  1DET A;  1VQQ A;  1VQM 3;  1MNL A;  3F14 A;  1OGZ A;  4HM2 B;  1BIR A;  2Z6B A;  1LNH A;  1RN7 A;  1RDS A;  2CFG A;  1W6G A;  4STD A;  1IT8 A;  2KF4 A;  4RNZ A;  1CQS A;  3D79 A;  3T0U A;  1IQ8 A;  2HMM B;  3IMA B;  1N5H A;  2KCD A;  4BL3 A;  3I56 3;  1VQN 3;  1RGG A;  1N5P A;  3GZY B;  2D1W A;  2WGO A;  2K3D A;  1LQG C;  3NQY A;  1SQW A;  1IDP A;  2AAE A;  3X3Z A;  1RGK A;  4HVN A;  1GS3 A;  1UUG B;  2H0I A;  2OTL 3;  1RNT A;  1SJW A;  3LXU X;  1I3I A;  1UI7 A;  1OHP A;  1ZO2 A;  3FKA A;  5CXO A;  2F56 A;  1DE3 A;  5CK6 A;  5IG4 A;  5IEP A;  4XDW A;  1RTU A;  3S27 A;  2CG0 A;  2QIY A;  1KD1 4;  2KXG A;  2KRT A;  1M90 4;  1UCI A;  1VQ7 3;  1DMN A;  1W4N A;  1FUS A;  1B2Z A;  1K41 A;  1BNE A;  4N6M A;  2XRX B;  4RBN A;  3CNM A;  3DGO A;  1KQS 2;  1TRQ A;  1OAC A;  1RLS A;  2UGI A;  1JN5 A;  1OF5 B;  2XR8 B;  3SYU A;  3UB1 A;  1A90 A;  1W6Y A;  1AV4 A;  1NU3 A;  1X1Y A;  3GZX B;  2IY2 A;  4K1U A;  2YX9 A;  3OV4 A;  9RNT A;  3HX8 A;  5I97 A;  3NBB A;  1STF I;  2CKF B;  3JVC A;  3UL5 A;  3EE1 A;  4WYK B;  1G0T A;  1UCL A;  4HM7 B;  1T5Y A;  5AIH A;  1BRK A;  4I4K A;  1FGR A;  1GY5 A;  5BU4 A;  4AKZ A;  3GZR A;  1SII A;  1ULI B;  3PS8 A;  2R4I A;  1PY3 A;  3X3X A;  1N8R 4;  2STD A;  3F8H A;  2FGT A;  2RNT A;  3G16 A;  1K9M 4;  3U97 A;  1PYL A;  3ZFZ A;  3PZW A;  1GOU A;  3SVA A;  3F40 A;  1JKG B;  2E2T A;  4KT3 B;  5FW5 A;  1VQO 3;  3TDG A;  3CD6 3;  1YI2 3;  3EF8 A;  2W04 A;  5AII A;  3CCL 3;  5FGO A;  1JNQ A;  1TRP A;  4LZI A;  4N3V A;  1JB4 A;  2ML5 A;  4R80 A;  2JQ5 A;  1W00 A;  1JBT A;  3AGO A;  3LT8 A;  3FG3 A;  3N9H A;  2C11 A;  1DYU A;  4BTY A;  1ROV A;  2ML6 A;  3BND A;  4FMD A;  1QAK A;  2I9W A;  2XEP A;  4XBY A;  4ZM8 A;  4HOH A;  1IVU A;  3EC9 A;  1UUV B;  1RNB A;  4BTW A;  2SBL A;  1B2X A;  3EQQ B;  2R41 A;  4IPB A;  3CME 3;  1WMO A;  1QAL A;  3VSY A;  2RCD A;  3T8N A;  3F9S A;  2XF3 A;  2CFK A;  1UI8 A;  1DMQ A;  2F86 B;  4KFD A;  5TGN A;  1FZU A;  5HOH A;  5AEW B;  3MG3 A;  1FUW A;  3BIR A;  1I0X A;  2V1L A;  3GSP A;  4HAA A;  4CJN A;  1WQL B;  2CX1 A;  2WO0 A;  1YVB I;  3CCJ 3;  3WHO A;  2IUJ A;  3MWZ A;  3WOD G;  2GBW B;  1BRJ A;  4I5Q A;  2CG1 A;  3ROB A;  3Q90 A;  3SXX A;  1BNS A;  2AAD A;  4EYC A;  2CIU A;  1HYF A;  2BT3 A;  1X1W A;  2KAA A;  4N6O B;  2QEX 3;  3F8X A;  4J5G A;  1EA2 A;  4L8P A;  3S5C A;  1QMA A;  2BIR A;  1O7W B;  1YGW A;  1YIJ 3;  5IEO A;  1T2H A;  5BVB A;  4N6T A;  1QAF A;  1S72 3;  3BNB A;  1E3V A;  4GSP A;  1A67 A;  2CC3 A;  1HZ1 A;  4EXR A;  1OHS A;  4J5K A;  1FW7 A;  1UCJ A;  1ZX2 A;  2LYX A;  2HMN B;  4HJL B;  1IK3 A;  1NJI 4;  2WGQ A;  3CC2 3;  5G2G A;  4MMY B;  3B7C A;  7RNT A;  5AI1 A;  1WNH A;  1UDI I;  2W56 B;  4O3V A;  1FUT A;  4L8O A;  3EBT A;  3KZT A;  3HII A;  1YIT 3;  1LOX A;  5A0O B;  2OTJ 3;  1BAO A;  1C7H A;  3NUV A;  2GEX A;  2QA4 3;  3WOF B;  4R4K A;  4WHA A;  1LOY A;  3V98 A;  1FGQ A;  3Q1C A;  1JN5 B;  3UNL A;  3WOE B;  3CCV 3;  3F7S A;  1M9G A;  3GWR A;  2F5W A;  1MWR A;  4LMI A;  1ISK A;  3GZB A;  4HM6 B;  2ZL8 A;  5JBS A;  3D9R A;  4HM5 B;  4FMA A;  3KCH A;  1Z1S A;  1GMQ A;  3FSD A;  3OWS A;  1RGH A;  3DGY A;  1FA3 A;  4J9A A;  4XBT A;  4ORL A;  2OCT A;  1MWS A;  3ECF A;  4X2O A;  2RFR A;  3DM8 A;  3KFQ C;  1KSI A;  5ELJ A;  3PYJ A;  4KFE A;  3BU4 A;  1PFP A;  1RN4 A;  4NRE A;  1A2P A;  2HML B;  2OQE C;  1YHQ 3;  3G71 3;  1BAN A;  2SAR A;  2W9Q A;  3LZA A;  3NQZ A;  1CH0 A;  1GY7 A;  3CPW 2;  3EN1 B;  3X42 A;  1W2Z A;  3WA2 X;  2KF6 A;  3G0K A;  2LQV A;  1BNG A;  1N8Q A;  3S29 A;  3DUK A;  5G1L A;  3ZG0 A;  1OPY A;  1RGC A;  3HZP A;  2CX0 A;  1LVN A;  3K7C A;  4WP5 A;  4HZB B;  3UJM A;  3NXJ A;  1V58 A;  4HKV B;  1B3S A;  1A2V A;  1FGO A;  3JUN A;  3D4A A;  3NM2 A;  2CK3 H;  2JDI H;  3I0Y A;  1C54 A;  1AR0 A;  1GMP A;  2Y74 A;  1K73 4;  3SLU A;  1IVX A;  2Z77 A;  1DVC A;  3KE7 A;  4CDL A;  4MMX B;  3JUM A;  2CFD A;  1IVW A;  3GRD A;  4TX4 A;  3E99 A;  1EG9 B;  1LOV A;  1G02 A;  2OOV A;  3K0Z A;  4AKY A;  1Q40 A;  1BRN L;  1NNV A;  3A5E A;  2L4V A;  5LC7 A;  1B2M A;  3DGN A;  5AEU B;  3K5T A;  3OX9 A;  1QVG 2;  3OW2 2;  1RJO A;  4LYL B;  5RNT A;  1VQ6 3;  1V74 A;  2XGL A;  4NPB A;  1X1X A;  2BHM A;  3EB8 A;  1BRS A;  3OXA A;  2RSX A;  1GYB A;  3NBR A;  3F7X A;  1AVK A;  1VQ4 3;  4Q53 A;  6RNT A;  2Q07 A;  1I8V A;  1EQK A;  4FCJ A;  3J7Y d;  1GOY A;  1ZGX A;  2IYJ A;  3FGY A;  5M18 A;  2O3O A;  1RCK A;  3S67 A;  5D83 A;  7GSP A;  1I0V A;  1B21 A;  3PXM A;  3NM7 A;  5G1K A;  5JPU A;  1BGS A;  3SOY A;  1O7M B;  5AYS C;  3WMD A;  5IG3 A;  2CWU A;  4WYK A;  1ROA A;  3FG1 A;  1STD A;  1VZZ A;  4U13 A;  5D81 A;  1LRA A;  2YFJ B;  3N8B A;  2WOH A;  3LTC A;  2ZA4 A;  3X3Y A;  1VQL 3;  5EQL A;  8CHO A;  3SOA A;  3AHS A;  3KSE D;  2BO9 B;  1BNR A;  3CCS 3;  1RGE A;  2UX0 A;  1HU9 A;  1UGI A;  2F4Y A;  1SPU A;  4KVH A;  1JKG A;  2Z7A A;  2P09 A;  4HYZ A;  1BRH A;  2H0G A;  3M8C A;  3V92 A;  4N6V 0;  5JPP A;  4N6L A;  3CPO A;  1I2G A;  3QK9 A;  1BOX A;  2HMJ B;  3D5I A;  3B4O A;  4HM1 B;  3H51 A;  5AIF A;  2ZDJ A;  4O02 B;  1OUN A;  2P38 A;  1ASK A;  1MGW A;  1TIJ A;  4GHO A;  3T8U A;  3DZL A;  1X1U A;  4DKI A;  5CF1 A;  2H0H A;  2BMQ B;  3ZG5 A;  3MHE A;  1K8A 4;  3MYT A;  1MWU A;  1A2K A;  2HOH A;  2ZHX B;  1RGL A;  1JBS A;  2Z76 A;  5DRV A;  1IV9 A;  1W7C A;  2IUK A;  2XFT A;  3FZW A;  1FGM A;  1WMP A;  1LQM B;  2CWT A;  2PZV A;  3L0R A;  5ELU A;  1TFK A;  2F98 A;  1KC8 4;  1UCK A;  3AMO A;  4OK0 A;  3QRD A;  1UUW B;  3O8Y A;  1PU4 A;  5BXQ A;  1BNF A;  3Q3F A;  3X41 A;  1JB2 A;  1RRH A;  1ULJ B;  1QVF 2;  3G6E 3;  2W9P A;  2FNQ A;  1BUQ A;  1DMM A;  4MJD A;  2RBI A;  1TTO A;  3LTB A;  4LGQ A;  1K28 A;  4EV5 A;  3MG1 A;  4BTX A;  4O8S A;  4L7K A;  2W56 A;  4CCV A;  2CFL A;  4KZ1 A;  3DY5 A;  4FR9 A;  3PCR A;  3IPT A;  4X2H A;  4XDV A;  1VQ5 3;  1T3B A;  1M1X B;  1Q42 A;  1JRQ A;  4RZM A;  1BVI A;  2P0M A;  2OQE A;  1GOV A;  1W6C A;  3U1W A;  6GSP A;  1CYU A;  1Q40 B;  4LEH A;  3BLZ A;  8RNT A;  3FG4 A;  3JUQ A;  1WTH A;  1NB5 I;  2Y73 A;  4AEQ A;  3CC4 3;  1B27 A;  1BRG A;  2INX A;  3B4P A;  1RKY A;  2OOV C;  1R4Y A;  2OWP A;  1DVD A;  1IT7 A;  3BB9 A;  2YFI B;  4OUQ A;  5EVH A;  4NHF A;  3NV0 B;  2GSP A;  4K1V A;  1GD4 A;  1EKM A;  3EN8 A;  2HMK B;  5AYR B;  1I3F A;  3KSP A;  2GXF A;  4GL6 A;  4JF8 A;  2QGU A;  2C10 A;  1FGT A;  3D5G A;  4R9L A;  4FCM A;  1BSB A;  3FCS B;  1BRI A;  3DMC A;  3KKG A;  3PCS A;  3AHW A;  2CWV A;  2C4B A;  5CLK A;  1E97 A;  2YFL B;  4HM4 B;  1I70 A;  1JZD A;  1LOW A;  1YNV X;  3VF1 A;  4CPK A;  1O7G B;  4R1K A;  1YJW 3;  1Y4K A;  3FLJ A;  5KP1 A;  3MPH A;  3CCE 3;  1GY6 A;  1YGE A;  2W03 A;  3OWY A;  1JZO A;  4WFO A;  2MC8 A;  1NWW A;  5D82 A;  1R4C A;  2UUG C;  4EBG A;  3K63 A;  4RNT A;  2B1X B;  3WA3 A;  1MWT A;  1RCL A;  3LTA A;  5AIG A;  1NB3 I;  1VQK 3;  2F99 A;  2W2C A;  2E2V A;  4PEJ A;  3KN4 A;  1NO3 A;  4IT7 A;  1S5A A;  5IEN A;  4MEI A;  1G96 A;  3CCR 3;  1BSA A;  3AMO B;  1RSN A;  3FF0 A;  1IVV A;  1GSP A;  3HIG A;  1TJD A;  1U8C B;  2P05 A;  3LT9 A;  3JUP A;  4HBR A;  1Q81 4;  1E3R A;  1IQY A;  2KF3 A;  4K90 B;  1V57 A;  3DH2 A;  2KF5 A;  2CW9 A;  3EJV A;  3D3L A;  4RNY A;  3DGM A;  1CEW I;  2HMO B;  3EX9 A;  4KFF A;  3N54 B;  1BU4 A;  5IF6 A;  2GBX B;  1D6U A;  3G8Z A;  2BU4 A;  5DRE A;  2J8X B;  2CHC A;  1EUI C;  1U5O A;  1AQZ A;  2P0X A;  3LOY A;  4O2H A;  4MMZ B;  3SX1 A;  4OVM A;  1OHO A;  3Q2P A;  3MSO A;  1RMS A;  1D6Z A;  1BNJ A;  3KII A;  3LYG A;  3NHX A;  5IG0 A;  3I55 3;  1TUH A;  4N6U A;  2K54 A;  3NBJ A;  3JUO A;  4BIR A;  3CCQ 3;  1TP6 A;  4EW5 A;  1SAR A;  3RGR A;  3WR2 A;  5IG5 A;  3PGB A;  5EEO A;  1YJN 3;  3A76 A;  3BNC A;  2F5M A;  4LSO A;  1US1 A;  1WMN A;  1TU5 A;  1YVS A;  1O7N B;  2XGN A;  2E2U A;  4H61 A;  3NX0 A;  1L5G B;  1Q7Y 4;  3CCU 3;  3ER7 A;  1GMR A;  4ILF A;  4J8T A;  1IV7 A;  1YJ9 3;  2FXT A;  3HI7 A;  3CC7 3;  3EBY A;  5LC6 A;  4XM4 A;  3STD A;  3CCM 3;  4H3U A;  1Q82 4;  1M1K 4;  1W01 A;  1QJG A;  2M7O A;  2IMJ A;  3DGL A;  3LML A;  3CXC 2;  1W5Z A;  2BNG A;  5GSP A;  1VQP 3;  2CFW A;  1B2S A;  1T2I A;  1MOL A;  1ZS7 A;  3CU3 A;  3S28 A;  4GB5 A;  5KP4 A;  1I2E A;  2WOF A;  5M1A A;  1BNI A;  5IER A;  1AY7 A;  2XSO B;  1TFO A;  4WWU C;  3CNX A;  1HKX A;  4G1M B;  1IYY A;  1AVL A;  3H3H A;  1JB5 A;  5M19 A;  1UGH I;  5IW9 A;  1LXE A;  1OF5 A;  2B24 B;  2W0Q A;  4FMC A;  3LH4 A;  5HGR A;  4JRF A;  3X40 A;  2RGQ A;  1JBR A;  1RRL A;  4BL2 A;  1IU7 A;  1RN1 A;  3FF2 A;  3DXO A;  4K61 A;  2PNC A;  1B20 A;  1KWI A;  3BNE A;  2GU1 A;  7STD A;  1J2B A;  4HM8 B;  2BMR B;  2MF7 A;  3URP A;  4HM3 B;  1GD3 A;  1EEJ A;  2BMO B;  4EV2 A;  1RGA A;  2D42 A;  3LTD A;  4HZ9 B;  3V99 A;  2GU3 A;  3RNT A;  1VQ9 3;  1Q9E A;  4N6N B;  1W2B 2;  1N9E A;  1Q86 4;  3UL6 A;  1OGX A;  2W6J H;  3HOH A;  1W02 A;  4EC6 A;  3WDG B;  3ALA A;  3AGN A;  1FYS A;  3IJE B;  5STD A;  1O7P B;  1SIH A;  4IIA A;  1BSC A;  1LNI A;  3EHC A; 
#chains in the Genus database with same CATH homology
 3A5E A;  1B2M A;  3D5G A;  1BUJ A;  4BU4 A;  1BSB A;  1BRI A;  1BSD A;  3AHW A;  2C4B A;  1BSE A;  1MGR A;  1FZU A;  1RHL A;  5BIR A;  5HOH A;  5RNT A;  1I70 A;  1LOW A;  1X1X A;  1YNV X;  3BIR A;  1BRS A;  1I0X A;  3GSP A;  4HAA A;  1BRN L;  6RNT A;  3WHO A;  1I8V A;  1C54 A;  1BRJ A;  1GOY A;  1B2U A;  1BNS A;  1ZGX A;  2AAD A;  1HYF A;  1RCK A;  1RGF A;  4RNT A;  1X1W A;  1RCL A;  1I0V A;  1B21 A;  2KAA A;  7GSP A;  1BGS A;  4J5G A;  1I2F A;  2BIR A;  1DET A;  1YGW A;  1T2H A;  1BSA A;  1RSN A;  1LRA A;  1BIR A;  1GSP A;  4GSP A;  2ZA4 A;  1RDS A;  1HZ1 A;  2KF4 A;  3AHS A;  4J5K A;  1BNR A;  2KF3 A;  1FW7 A;  1RGE A;  1UCJ A;  3DH2 A;  2KF5 A;  1RGG A;  2F4Y A;  1BRH A;  7RNT A;  1FUT A;  1BU4 A;  2AAE A;  2BU4 A;  1RGK A;  1I2G A;  1BAO A;  1BOX A;  1AQZ A;  3D5I A;  1RNT A;  1I3I A;  1RMS A;  1LOY A;  1BNJ A;  1MGW A;  4GHO A;  4BIR A;  1X1U A;  2F56 A;  1SAR A;  3WR2 A;  1DE3 A;  2F5W A;  1RTU A;  2F5M A;  2HOH A;  1JBS A;  1YVS A;  1RGL A;  3KCH A;  1GMQ A;  1UCI A;  1RGH A;  3DGY A;  1FUS A;  1B2Z A;  1BNE A;  1GMR A;  1UCK A;  1TRQ A;  1RLS A;  3SYU A;  1BNF A;  3Q3F A;  1X1Y A;  3BU4 A;  1RN4 A;  1A2P A;  5GSP A;  1BAN A;  2SAR A;  9RNT A;  1B2S A;  1T2I A;  2RBI A;  1TTO A;  1CH0 A;  1I2E A;  1BNI A;  1UCL A;  1AY7 A;  2KF6 A;  1BRK A;  1BNG A;  5BU4 A;  1IYY A;  1PY3 A;  1JBR A;  1BVI A;  1RGC A;  2RNT A;  1GOV A;  6GSP A;  1PYL A;  1RN1 A;  1GOU A;  8RNT A;  1B20 A;  1B3S A;  1B27 A;  3URP A;  1BRG A;  3D4A A;  1RGA A;  1TRP A;  3RNT A;  1R4Y A;  1JBT A;  1Q9E A;  3AGO A;  1GMP A;  3HOH A;  2GSP A;  4HOH A;  3AGN A;  1FYS A;  1LOV A;  1RNB A;  1G02 A;  1I3F A;  1BSC A;  1LNI A;  1B2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...