1DE3A

Solution structure of the cytotoxic ribonuclease alpha-sarcin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
150
structure length
150
Chain Sequence
AVTWTCLNDQKNPKTNKYETKRLLYNQNKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLPKGRTPIKFGKSDCDRPPKHSKDGNGKTDHYLLEFPTFPDGHDYKFDSKKPKENPGPARVIYTYPNKVFCGIIAHTKENQGELKLCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE ALPHA-SARCIN
publication title The highly refined solution structure of the cytotoxic ribonuclease alpha-sarcin reveals the structural requirements for substrate recognition and ribonucleolytic activity.
pubmed doi rcsb
source organism Aspergillus giganteus
total genus 17
structure length 150
sequence length 150
ec nomenclature ec 3.1.27.10: rRNA endonuclease.
pdb deposition date 1999-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1de3A00
3D5IA 1B21A 5BU4A 1BANA 1BGSA 1AY7A 1I3FA 1RN1A 1BSAA 2SARA 2KF5A 1I2FA 2F5MA 3DH2A 2RBIA 3BU4A 1LOYA 1RSNA 1T2IA 1X1UA 1I8VA 1A2PA 3KCHA 1I2GA 2KF3A 1BIRA 1BNEA 1MGWA 5HOHA 4J5GA 1YNVX 1BRGA 1BUJA 4HOHA 1I0XA 3SYUA 4HAAA 1G02A 2F56A 1RN4A 1RNTA 1X1WA 1LRAA 2C4BA 1AQZA 2HOHA 2KF4A 2GSPA 3RNTA 1RTUA 1RNBA 1R4YA 1RDSA 1BNGA 1BSDA 1GOVA 1X1YA 1RHLA 5RNTA 1BRKA 4GHOA 1JBTA 5BIRA 1I0VA 1BNJA 1BRHA 1BU4A 1TRQA 1FZUA 1RMSA 1BSBA 1BRIA 1Q9EA 1BSEA 1IYYA 1BRNL 1BNSA 3URPA 1RGCA 1I70A 1YVSA 1B2MA 9RNTA 1RGKA 1FUSA 3AHWA 3A5EA 2AAEA 1LOVA 2KAAA 1HZ1A 4BU4A 2RNTA 1B2SA 4BIRA 1SARA 2ZA4A 1LNIA 6GSPA 1B3SA 2KF6A 1LOWA 2BIRA 1BNFA 3HOHA 1BRSA 5GSPA 1RGAA 1I3IA 3AGNA 1GOYA 1ZGXA 1UCKA 6RNTA 1FYSA 1B2ZA 4J5KA 1FW7A 1GSPA 1RCKA 1MGRA 1BNIA 1FUTA 1BNRA 1GMRA 1C54A 2BU4A 1GOUA 1UCLA 1UCJA 3BIRA 1BSCA 1T2HA 1BRJA 1B2UA 1HYFA 1DE3A 1RGHA 3D5GA 3D4AA 1JBSA 1UCIA 3DGYA 1BAOA 3GSPA 1TRPA 7GSPA 4RNTA 3WHOA 1RCLA 2AADA 1GMQA 3AGOA 3WR2A 1B27A 7RNTA 1RGLA 1X1XA 1YGWA 1DETA 1BOXA 1RLSA 1RGGA 8RNTA 1PY3A 1B20A 1PYLA 1CH0A 1RGFA 4GSPA 2F5WA 1RGEA 3Q3FA 1I2EA 3AHSA 1BVIA 1TTOA 1B2XA 1JBRA 2F4YA 1GMPA
chains in the Genus database with same CATH superfamily
3D5IA 4NPBA 4N3VA 2JDIH 4WYKB 1EKMA 1GD4A 4ORLA 3LTAA 1E3VA 1BGSA 1AY7A 3JUQA 5EVHA 5G1KA 3LTDA 1GY7A 1N8QA 1Y4KA 1X1UA 3NBJA 1OF5A 1I8VA 3MHEA 5IG0A 3BNBA 1N5HA 3B4PA 2GEXA 1I2GA 2BMQB 1MGWA 1ULIB 4OVMA 2F86B 3EX9A 3DZLA 1TP6A 4HM1B 1OHOA 4N6UA 1IQYA 4BTXA 1SIHA 2WOHA 4XDVA 3CC73 1M1XB 4LZIA 1EUIC 2W6JH 2W56A 3MG2A 4N6TA 5STDA 2D42A 1AQZA 1MWTA 2BHMA 1HKXA 2CX1A 1R4YA 1IV9A 1BNGA 1RDSA 2P05A 3NM2A 1X1YA 4J9AA 2YFJB 1Q864 4GHOA 1JBTA 3FSDA 3MG3A 5BIRA 1YIT3 1M1K4 5KP1A 2W04A 1I0VA 4FCZA 3EB8A 4KFFA 4HBRA 3LT8A 1D6YA 3FG4A 1G0TA 1V74A 1JKGA 2GXFA 2ZHXB 3EN1B 1PU4A 4OK0A 1TU5A 3Q90A 3LTBA 3LXUX 1BRIA 1KWIA 1JNQA 3NBBA 5AIFA 3MYTA 5BXQA 1Q9EA 3X42A 1IQ8A 1VQK3 3GZYB 2P0MA 3URPA 2XGNA 4K1VA 7STDA 3BNCA 1I70A 3KFQC 1YVSA 2LYXA 2OCTA 2J8XB 9RNTA 1OHPA 5IF6A 3NV0B 1NJI4 1J2BA 4N6V0 1FUSA 3FZWA 4R4KA 3FG3A 1IVXA 2XSHB 1FGOA 1OH0A 1Q7HA 1LQGC 1MOLA 3CMA3 1W6YA 3X3YA 2KAAA 1A90A 4BU4A 4HVNA 6STDA 2RNTA 4WP5A 3KIIA 3K0ZA 2GU1A 3UL5A 1SARA 5JPUA 1LNIA 3PYJA 3B8LA 4FMCA 5CXOA 6GSPA 1B3SA 2GU3A 3EF8A 3O8YA 3ZFZA 3OV4A 2KF6A 3HOHA 2CFWA 1IVUA 4N6LA 5GSPA 3S5CA 1RGAA 1EG9B 1FW7A 1ZGXA 8CHOA 3TDGA 3SEDA 1ZS7A 3E99A 1GD3A 2IUJA 3ZG5A 1IK3A 1MGRA 2FGTA 1PFPA 1C54A 1TFOA 2BU4A 4KVHA 2STDA 2CW9A 3AMOA 1BRJA 3BLZA 1B2UA 1EEJA 2CH9A 1JJ22 1JB5A 3FF2A 1W2B2 3STDA 3J7Yd 1BAOA 3GSPA 7GSPA 2BMOB 2IA7A 5AIGA 4RNTA 5M18A 1VQM3 1K734 1ZO2A 3GWRA 4LSOA 3S29A 2CK3H 3F8HA 3QK9A 3CPW2 3IJEB 3CC43 1G96A 3AGOA 3WR2A 2CFKA 2CFDA 4HM7B 4STDA 1RGLA 4XBXA 1RRHA 3I0YA 1DETA 3SX1A 2WGQA 1IVVA 3DGLA 3D79A 3NV0A 1B20A 3N9HA 1CH0A 1RGEA 3MSOA 3Q1CA 3AHSA 4FMAA 4K1UA 2INXA 1JBRA 4HYZA 4HM4B 4PEJA 1RJOA 1AVKA 5CF2A 2H0IA 2YFLB 1N8R4 4HM8B 3U97A 1BANA 1RN1A 1I3FA 5G2GA 3G713 3BNEA 2XGLA 1DMMA 3WOFB 2KF5A 3H3HA 1YJN3 5A0OB 4IIAA 1RSNA 1T2IA 4N6NB 1QAFA 3ER7A 3HX8A 1A2PA 4OUQA 2A15A 4R80A 3H51A 1NDOB 4CDLA 2GBWB 4J8TA 1BNEA 4HM3B 3FG1A 3I553 4K90B 1UUVB 3I563 1UI8A 1I0XA 3SYUA 1EQKA 1OGZA 2GEYA 3B7CA 3G6E3 1X1WA 4EV5A 2QGUA 1LRAA 1Q40A 1JKGB 1MNLA 3LYGA 5IEOA 1RTUA 3K5TA 3N54B 3SOAA 1R4CA 1V58A 1BSDA 3WA2X 3GZXB 1RHLA 5RNTA 4KFDA 3OWUA 2E2VA 3VSYA 4X2OA 1IT8A 4ILFA 2IYJA 3T0UA 3CNXA 2XFSA 1JN5A 3NX0A 3SXXA 4CPKA 1TRQA 2CFLA 1ISKA 4R1KA 4X2HA 2C11A 2K0MA 2FXTA 1BSBA 3FCSB 3UJMA 5CF1A 1CQSA 4L7KA 1DMNA 2W9QA 1E97A 2HMOB 3LH4A 1ASKA 4EYCA 4JRFA 1JRQA 1BRNL 1BNSA 2QIYA 4FR9A 1A67A 2JQ5A 4ZM8A 2PZVA 3EN8A 2Z76A 4Q53A 1FA3A 4XM4A 2ZDJA 2IY2A 1DYUA 2OTL3 2RFRA 2CG0A 2F99A 1LVNA 3CNMA 5CK6A 3G16A 2CG1A 5IERA 1VQN3 5KP3A 1AV4A 1B2SA 5JPPA 2B1XB 3UL6A 4DKIA 2ZA4A 1UDII 3NM7A 3AMOB 2HMJB 4FMDA 5AYSC 3L0RA 1L5GB 2CX0A 3EC9A 1U5OA 3MPHA 1LOWA 2BIRA 1BNFA 3NQYA 1VQ53 2P09A 3M8CA 6RNTA 1UCKA 1F8NA 2F98A 2Z6BA 5EEOA 1SIIA 1BNRA 1TIJA 4HKVB 1BSCA 1VQL3 1US1A 2KCDA 3K7CA 2MF7A 3DXOA 3KZTA 1HYFA 2I9WA 1RGHA 3D5GA 1UCIA 1TRPA 3RGRA 2Q07A 3WHOA 4CCVA 5IG5A 1VQQA 2AADA 1VQ63 1N9JA 3NXJA 3G8ZA 3EHCA 3CCS3 5D82A 3CD63 1UUWB 1LNHA 4RBNA 3X41A 4MMYB 3KN4A 1PY3A 3NQZA 1PYLA 4FMBA 1RGFA 1M904 4GSPA 1FGQA 2F5WA 1YGEA 1UI7A 3F14A 2FNQA 4IPBA 5AIHA 3Q3FA 2W9PA 1JZDA 1I2EA 2D1WA 3DGNA 1TTOA 1B2XA 4MEIA 2BO9B 3ECFA 3KE7A 2XRXB 1QVF2 3GRDA 2M7OA 5EQLA 5JBSA 3CME3 3EBYA 3F40A 5BU4A 3DMCA 3CXC2 4N6MA 1GYBA 2WOFA 1CEWI 1SQWA 2CIUA 1BSAA 2ZL8A 4JF8A 3T8NA 3MWZA 3JUMA 1I2FA 2F5MA 3N8BA 4GL6A 4I5QA 3BU4A 1LOYA 2R4IA 4WWUC 3IPTA 2UUGC 1BUQA 1JZOA 1Q40B 2HMLB 3MKIA 3FF0A 3OXAA 5AEWB 3F8XA 4LEHA 1D6ZA 1UGIA 3KSED 5HOHA 4J5GA 1YNVX 5D81A 3T8UA 4BTWA 2QEX3 3D3LA 1MWRA 4HAAA 1JN5B 1G02A 3B4OA 4K61A 1CYUA 3DUKA 3HZPA 2OWPA 2E2UA 3EBTA 3PCSA 1RKYA 4KT3B 1RNTA 1Q42A 4GB5A 1MWUA 4KFEA 1YVBI 3EJVA 2C4BA 2HOHA 1JB2A 1UGHI 2GBXB 1WNHA 2H0GA 4HZ9B 3RNTA 1RNBA 1V57A 3BNDA 1LOXA 2H0HA 2OQEA 4AKZA 3ALAA 4BL3A 1BRKA 2K54A 3FGYA 1KSIA 1IU7A 3CCL3 2W2CA 3DM8A 1RRLA 2XSOB 3EQQB 4HM6B 1O7NB 2WO0A 3K63A 3HI7A 1W6GA 3RDEA 2WGOA 1QVG2 1LXEA 1RMSA 5IEPA 4AEQA 3OW22 5I97A 4XB5A 1M9GA 2O3OA 2HMMB 1FGRA 1T5YA 1BSEA 1IYYA 2YX9A 3CC23 3JUOA 1DVCA 1EA2A 1OCVA 2W03A 1O7MB 1RGCA 2XEPA 1QMAA 2RCDA 1GY5A 3LT9A 3ZG0A 1MWSA 5ELUA 4HJLB 3SVAA 2SBLA 1VQ43 2RGQA 4TX4A 3A76A 3CCE3 2P0XA 1LOVA 2Z7AA 5FGOA 5M1AA 1NB5I 3QRDA 4G1MB 1LQMB 2Z77A 3PXMA 4RNZA 5DRVA 4BIRA 2KXGA 3CCU3 1DMQA 1YJ93 1ULJB 4IT7A 2HMKB 5DREA 5M19A 3SLUA 4EXRA 1BRSA 3D9RA 1FYSA 1B2ZA 4HZBB 4J5KA 1GSPA 3F7SA 3V98A 4RZMA 2OOVC 3PCRA 1BNIA 1FUTA 1RN7A 2C10A 1GMRA 1N5PA 2XFTA 2R41A 4HM2B 1GOUA 1UCLA 4BL2A 3BIRA 1NNVA 3NUVA 1GY6A 2XH9A 4WFOA 1DE3A 1K8A4 1JBSA 1QAKA 1ROAA 1OACA 2OTJ3 1GMQA 1NWWA 1K9M4 1W6CA 1Z1SA 1B27A 5IG4A 3HK4A 2QA43 4H61A 1A2KA 3ROBA 7RNTA 1VQ93 3GZRA 1X1XA 3KKGA 1YGWA 3PZWA 4EW5A 4QWTA 2CWUA 2UGIA 1K28A 3OX9A 3FLJA 1JV2B 1W2ZA 3GZBA 4XBYA 3OWSA 1E3RA 1C7HA 2PNCA 4L8OA 4R9LA 5HGRA 1W4NA 1BVIA 4H3UA 3EE1A 4FCMA 5CLKA 4AKYA 2CFGA 3WA3A 1W00A 1UW1A 3NBRA 1GMPA 1UUGB 5KP4A 5BVBA 1TUHA 3CCJ3 3G4S3 1B21A 3Q2PA 2K3DA 2P38A 4NHFA 1HU9A 1VZZA 2SARA 1YIJ3 3PS8A 2V1LA 4HM0B 4I4KA 3CCV3 1IQXA 3DH2A 1ROVA 5AEUB 2RBIA 1KD14 4O02B 1O7WB 5AIIA 3SOYA 1GS3A 4NREA 3HIGA 2L4VA 3KCHA 4WYKA 2KF3A 5IG3A 1BIRA 1FUWA 3HIIA 1SPUA 1BRGA 3G0KA 3WOEB 4LGQA 4HOHA 1OUNA 1A2VA 2YFIB 3WDGB 3X3XA 3K9MC 1BUJA 1NO3A 2F56A 2E2TA 1RN4A 1KC84 1Q824 1WMNA 3CCM3 3UNLA 1O7PB 1STFI 1AR0A 2KF4A 2GSPA 1W5ZA 3UB1A 3LOYA 1S5AA 2BNGA 3PGBA 2B24B 4N6OB 2W0QA 1GOVA 4HM5B 4FCJA 1O7GB 3S27A 1Q7Y4 1KQS2 3DY5A 3FH1A 1QALA 2XR8B 4RNYA 3DGMA 4XBTA 2CHCA 5IENA 3JUNA 3LTCA 1BNJA 1BRHA 1BU4A 1FGTA 2ML5A 1N9EA 2LQVA 3JUPA 4LMIA 1YHQ3 1FZUA 2O9UX 5LC6A 4O2HA 1W02A 1JB4A 1NU3A 3CPOA 3DGOA 2BT3A 1STDA 3LMLA 1VQ83 3MG1A 3F7XA 4EC6A 3X40A 4LYLB 1B2MA 1O7HB 1RGKA 1T3BA 3AHWA 2ML6A 3A5EA 1DVDA 1OPYA 2AAEA 3X3ZA 3KSPA 1QJGA 4O3VA 3LZAA 5ELJA 3VGNA 1VQO3 1HZ1A 3IMAB 3CCR3 3VF1A 1ZX2A 1AVLA 2CWVA 2IUKA 1S723 1I3IA 1OGXA 1GOYA 3AGNA 2UX0A 1TFKA 5LC7A 1WMPA 1CYVA 1IDPA 4L8PA 5TGNA 1RCKA 1OF5B 2XF3A 1U8CB 1UCJA 1WTHA 2BMRB 1T2HA 2CWTA 1VQP3 2OQEC 3JVCA 4MMXB 1WMOA 1IV7A 2IMJA 3GAXA 1TJDA 1IVWA 4EBGA 3D4AA 4WHAA 3CCQ3 3V92A 3DGYA 2Y73A 2CKFB 3RGAA 1OHSA 2Y74A 2KRTA 2L1SA 3CU3A 1YI23 1RCLA 1D6UA 4R9KA 4EV2A 5FW5A 2HMNB 2W56B 3WODG 1IT7A 1NB3I 1YJW3 1WQLB 5G1LA 5AI1A 2RSXA 5AYRB 3FKAA 1BOXA 2CC3A 1RLSA 1W7CA 3BB9A 3WMDA 1FGMA 1RGGA 4XDWA 5D83A 3NHXA 4U13A 3S67A 3S28A 8RNTA 5IW9A 4CJNA 4O8SA 4MMZB 1SJWA 1Q814 3U1WA 4MJDA 3V99A 3F9SA 4KZ1A 4BTYA 1K41A 2OOVA 2F4YA 2MC8A 1W01A 1VQ73 3OWYA
chains in the Genus database with same CATH topology
3D5IA 1B21A 5BU4A 1BANA 1BGSA 1AY7A 1I3FA 1RN1A 1BSAA 2SARA 2KF5A 1I2FA 2F5MA 3DH2A 2RBIA 3BU4A 1LOYA 1RSNA 1T2IA 1X1UA 1I8VA 1A2PA 3KCHA 1I2GA 2KF3A 1BIRA 1BNEA 1MGWA 5HOHA 4J5GA 1YNVX 1BRGA 1BUJA 4HOHA 1I0XA 3SYUA 4HAAA 1G02A 2F56A 1RN4A 1RNTA 1X1WA 1LRAA 2C4BA 1AQZA 2HOHA 2KF4A 2GSPA 3RNTA 1RTUA 1RNBA 1R4YA 1RDSA 1BNGA 1BSDA 1GOVA 1X1YA 1RHLA 5RNTA 1BRKA 4GHOA 1JBTA 5BIRA 1I0VA 1BNJA 1BRHA 1BU4A 1TRQA 1FZUA 1RMSA 1BSBA 1BRIA 1Q9EA 1BSEA 1IYYA 1BRNL 1BNSA 3URPA 1RGCA 1I70A 1YVSA 1B2MA 9RNTA 1RGKA 1FUSA 3AHWA 3A5EA 2AAEA 1LOVA 2KAAA 1HZ1A 4BU4A 2RNTA 1B2SA 4BIRA 1SARA 2ZA4A 1LNIA 6GSPA 1B3SA 2KF6A 1LOWA 2BIRA 1BNFA 3HOHA 1BRSA 5GSPA 1RGAA 1I3IA 3AGNA 1GOYA 1ZGXA 1UCKA 6RNTA 1FYSA 1B2ZA 4J5KA 1FW7A 1GSPA 1RCKA 1MGRA 1BNIA 1FUTA 1BNRA 1GMRA 1C54A 2BU4A 1GOUA 1UCLA 1UCJA 3BIRA 1BSCA 1T2HA 1BRJA 1B2UA 1HYFA 1DE3A 1RGHA 3D5GA 3D4AA 1JBSA 1UCIA 3DGYA 1BAOA 3GSPA 1TRPA 7GSPA 4RNTA 3WHOA 1RCLA 2AADA 1GMQA 3AGOA 3WR2A 1B27A 7RNTA 1RGLA 1X1XA 1YGWA 1DETA 1BOXA 1RLSA 1RGGA 8RNTA 1PY3A 1B20A 1PYLA 1CH0A 1RGFA 4GSPA 2F5WA 1RGEA 3Q3FA 1I2EA 3AHSA 1BVIA 1TTOA 1B2XA 1JBRA 2F4YA 1GMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5I A;  1B21 A;  5BU4 A;  1BAN A;  1BGS A;  1AY7 A;  1I3F A;  1RN1 A;  1BSA A;  2SAR A;  2KF5 A;  1I2F A;  2F5M A;  3DH2 A;  2RBI A;  3BU4 A;  1LOY A;  1RSN A;  1T2I A;  1X1U A;  1I8V A;  1A2P A;  3KCH A;  1I2G A;  2KF3 A;  1BIR A;  1BNE A;  1MGW A;  5HOH A;  4J5G A;  1YNV X;  1BRG A;  1BUJ A;  4HOH A;  1I0X A;  3SYU A;  4HAA A;  1G02 A;  2F56 A;  1RN4 A;  1RNT A;  1X1W A;  1LRA A;  2C4B A;  1AQZ A;  2HOH A;  2KF4 A;  2GSP A;  3RNT A;  1RTU A;  1RNB A;  1R4Y A;  1RDS A;  1BNG A;  1BSD A;  1GOV A;  1X1Y A;  1RHL A;  5RNT A;  1BRK A;  4GHO A;  1JBT A;  5BIR A;  1I0V A;  1BNJ A;  1BRH A;  1BU4 A;  1TRQ A;  1FZU A;  1RMS A;  1BSB A;  1BRI A;  1Q9E A;  1BSE A;  1IYY A;  1BRN L;  1BNS A;  3URP A;  1RGC A;  1I70 A;  1YVS A;  1B2M A;  9RNT A;  1RGK A;  1FUS A;  3AHW A;  3A5E A;  2AAE A;  1LOV A;  2KAA A;  1HZ1 A;  4BU4 A;  2RNT A;  1B2S A;  4BIR A;  1SAR A;  2ZA4 A;  1LNI A;  6GSP A;  1B3S A;  2KF6 A;  1LOW A;  2BIR A;  1BNF A;  3HOH A;  1BRS A;  5GSP A;  1RGA A;  1I3I A;  3AGN A;  1GOY A;  1ZGX A;  1UCK A;  6RNT A;  1FYS A;  1B2Z A;  4J5K A;  1FW7 A;  1GSP A;  1RCK A;  1MGR A;  1BNI A;  1FUT A;  1BNR A;  1GMR A;  1C54 A;  2BU4 A;  1GOU A;  1UCL A;  1UCJ A;  3BIR A;  1BSC A;  1T2H A;  1BRJ A;  1B2U A;  1HYF A;  1DE3 A;  1RGH A;  3D5G A;  3D4A A;  1JBS A;  1UCI A;  3DGY A;  1BAO A;  3GSP A;  1TRP A;  7GSP A;  4RNT A;  3WHO A;  1RCL A;  2AAD A;  1GMQ A;  3AGO A;  3WR2 A;  1B27 A;  7RNT A;  1RGL A;  1X1X A;  1YGW A;  1DET A;  1BOX A;  1RLS A;  1RGG A;  8RNT A;  1PY3 A;  1B20 A;  1PYL A;  1CH0 A;  1RGF A;  4GSP A;  2F5W A;  1RGE A;  3Q3F A;  1I2E A;  3AHS A;  1BVI A;  1TTO A;  1B2X A;  1JBR A;  2F4Y A;  1GMP A; 
#chains in the Genus database with same CATH topology
 3D5I A;  4NPB A;  4N3V A;  2JDI H;  4WYK B;  1EKM A;  1GD4 A;  4ORL A;  3LTA A;  1E3V A;  1BGS A;  1AY7 A;  3JUQ A;  5EVH A;  5G1K A;  3LTD A;  1GY7 A;  1N8Q A;  1Y4K A;  1X1U A;  3NBJ A;  1OF5 A;  1I8V A;  3MHE A;  5IG0 A;  3BNB A;  1N5H A;  3B4P A;  2GEX A;  1I2G A;  2BMQ B;  1MGW A;  1ULI B;  4OVM A;  2F86 B;  3EX9 A;  3DZL A;  1TP6 A;  4HM1 B;  1OHO A;  4N6U A;  1IQY A;  4BTX A;  1SIH A;  2WOH A;  4XDV A;  3CC7 3;  1M1X B;  4LZI A;  1EUI C;  2W6J H;  2W56 A;  3MG2 A;  4N6T A;  5STD A;  2D42 A;  1AQZ A;  1MWT A;  2BHM A;  1HKX A;  2CX1 A;  1R4Y A;  1IV9 A;  1BNG A;  1RDS A;  2P05 A;  3NM2 A;  1X1Y A;  4J9A A;  2YFJ B;  1Q86 4;  4GHO A;  1JBT A;  3FSD A;  3MG3 A;  5BIR A;  1YIT 3;  1M1K 4;  5KP1 A;  2W04 A;  1I0V A;  4FCZ A;  3EB8 A;  4KFF A;  4HBR A;  3LT8 A;  1D6Y A;  3FG4 A;  1G0T A;  1V74 A;  1JKG A;  2GXF A;  2ZHX B;  3EN1 B;  1PU4 A;  4OK0 A;  1TU5 A;  3Q90 A;  3LTB A;  3LXU X;  1BRI A;  1KWI A;  1JNQ A;  3NBB A;  5AIF A;  3MYT A;  5BXQ A;  1Q9E A;  3X42 A;  1IQ8 A;  1VQK 3;  3GZY B;  2P0M A;  3URP A;  2XGN A;  4K1V A;  7STD A;  3BNC A;  1I70 A;  3KFQ C;  1YVS A;  2LYX A;  2OCT A;  2J8X B;  9RNT A;  1OHP A;  5IF6 A;  3NV0 B;  1NJI 4;  1J2B A;  4N6V 0;  1FUS A;  3FZW A;  4R4K A;  3FG3 A;  1IVX A;  2XSH B;  1FGO A;  1OH0 A;  1Q7H A;  1LQG C;  1MOL A;  3CMA 3;  1W6Y A;  3X3Y A;  2KAA A;  1A90 A;  4BU4 A;  4HVN A;  6STD A;  2RNT A;  4WP5 A;  3KII A;  3K0Z A;  2GU1 A;  3UL5 A;  1SAR A;  5JPU A;  1LNI A;  3PYJ A;  3B8L A;  4FMC A;  5CXO A;  6GSP A;  1B3S A;  2GU3 A;  3EF8 A;  3O8Y A;  3ZFZ A;  3OV4 A;  2KF6 A;  3HOH A;  2CFW A;  1IVU A;  4N6L A;  5GSP A;  3S5C A;  1RGA A;  1EG9 B;  1FW7 A;  1ZGX A;  8CHO A;  3TDG A;  3SED A;  1ZS7 A;  3E99 A;  1GD3 A;  2IUJ A;  3ZG5 A;  1IK3 A;  1MGR A;  2FGT A;  1PFP A;  1C54 A;  1TFO A;  2BU4 A;  4KVH A;  2STD A;  2CW9 A;  3AMO A;  1BRJ A;  3BLZ A;  1B2U A;  1EEJ A;  2CH9 A;  1JJ2 2;  1JB5 A;  3FF2 A;  1W2B 2;  3STD A;  3J7Y d;  1BAO A;  3GSP A;  7GSP A;  2BMO B;  2IA7 A;  5AIG A;  4RNT A;  5M18 A;  1VQM 3;  1K73 4;  1ZO2 A;  3GWR A;  4LSO A;  3S29 A;  2CK3 H;  3F8H A;  3QK9 A;  3CPW 2;  3IJE B;  3CC4 3;  1G96 A;  3AGO A;  3WR2 A;  2CFK A;  2CFD A;  4HM7 B;  4STD A;  1RGL A;  4XBX A;  1RRH A;  3I0Y A;  1DET A;  3SX1 A;  2WGQ A;  1IVV A;  3DGL A;  3D79 A;  3NV0 A;  1B20 A;  3N9H A;  1CH0 A;  1RGE A;  3MSO A;  3Q1C A;  3AHS A;  4FMA A;  4K1U A;  2INX A;  1JBR A;  4HYZ A;  4HM4 B;  4PEJ A;  1RJO A;  1AVK A;  5CF2 A;  2H0I A;  2YFL B;  1N8R 4;  4HM8 B;  3U97 A;  1BAN A;  1RN1 A;  1I3F A;  5G2G A;  3G71 3;  3BNE A;  2XGL A;  1DMM A;  3WOF B;  2KF5 A;  3H3H A;  1YJN 3;  5A0O B;  4IIA A;  1RSN A;  1T2I A;  4N6N B;  1QAF A;  3ER7 A;  3HX8 A;  1A2P A;  4OUQ A;  2A15 A;  4R80 A;  3H51 A;  1NDO B;  4CDL A;  2GBW B;  4J8T A;  1BNE A;  4HM3 B;  3FG1 A;  3I55 3;  4K90 B;  1UUV B;  3I56 3;  1UI8 A;  1I0X A;  3SYU A;  1EQK A;  1OGZ A;  2GEY A;  3B7C A;  3G6E 3;  1X1W A;  4EV5 A;  2QGU A;  1LRA A;  1Q40 A;  1JKG B;  1MNL A;  3LYG A;  5IEO A;  1RTU A;  3K5T A;  3N54 B;  3SOA A;  1R4C A;  1V58 A;  1BSD A;  3WA2 X;  3GZX B;  1RHL A;  5RNT A;  4KFD A;  3OWU A;  2E2V A;  3VSY A;  4X2O A;  1IT8 A;  4ILF A;  2IYJ A;  3T0U A;  3CNX A;  2XFS A;  1JN5 A;  3NX0 A;  3SXX A;  4CPK A;  1TRQ A;  2CFL A;  1ISK A;  4R1K A;  4X2H A;  2C11 A;  2K0M A;  2FXT A;  1BSB A;  3FCS B;  3UJM A;  5CF1 A;  1CQS A;  4L7K A;  1DMN A;  2W9Q A;  1E97 A;  2HMO B;  3LH4 A;  1ASK A;  4EYC A;  4JRF A;  1JRQ A;  1BRN L;  1BNS A;  2QIY A;  4FR9 A;  1A67 A;  2JQ5 A;  4ZM8 A;  2PZV A;  3EN8 A;  2Z76 A;  4Q53 A;  1FA3 A;  4XM4 A;  2ZDJ A;  2IY2 A;  1DYU A;  2OTL 3;  2RFR A;  2CG0 A;  2F99 A;  1LVN A;  3CNM A;  5CK6 A;  3G16 A;  2CG1 A;  5IER A;  1VQN 3;  5KP3 A;  1AV4 A;  1B2S A;  5JPP A;  2B1X B;  3UL6 A;  4DKI A;  2ZA4 A;  1UDI I;  3NM7 A;  3AMO B;  2HMJ B;  4FMD A;  5AYS C;  3L0R A;  1L5G B;  2CX0 A;  3EC9 A;  1U5O A;  3MPH A;  1LOW A;  2BIR A;  1BNF A;  3NQY A;  1VQ5 3;  2P09 A;  3M8C A;  6RNT A;  1UCK A;  1F8N A;  2F98 A;  2Z6B A;  5EEO A;  1SII A;  1BNR A;  1TIJ A;  4HKV B;  1BSC A;  1VQL 3;  1US1 A;  2KCD A;  3K7C A;  2MF7 A;  3DXO A;  3KZT A;  1HYF A;  2I9W A;  1RGH A;  3D5G A;  1UCI A;  1TRP A;  3RGR A;  2Q07 A;  3WHO A;  4CCV A;  5IG5 A;  1VQQ A;  2AAD A;  1VQ6 3;  1N9J A;  3NXJ A;  3G8Z A;  3EHC A;  3CCS 3;  5D82 A;  3CD6 3;  1UUW B;  1LNH A;  4RBN A;  3X41 A;  4MMY B;  3KN4 A;  1PY3 A;  3NQZ A;  1PYL A;  4FMB A;  1RGF A;  1M90 4;  4GSP A;  1FGQ A;  2F5W A;  1YGE A;  1UI7 A;  3F14 A;  2FNQ A;  4IPB A;  5AIH A;  3Q3F A;  2W9P A;  1JZD A;  1I2E A;  2D1W A;  3DGN A;  1TTO A;  1B2X A;  4MEI A;  2BO9 B;  3ECF A;  3KE7 A;  2XRX B;  1QVF 2;  3GRD A;  2M7O A;  5EQL A;  5JBS A;  3CME 3;  3EBY A;  3F40 A;  5BU4 A;  3DMC A;  3CXC 2;  4N6M A;  1GYB A;  2WOF A;  1CEW I;  1SQW A;  2CIU A;  1BSA A;  2ZL8 A;  4JF8 A;  3T8N A;  3MWZ A;  3JUM A;  1I2F A;  2F5M A;  3N8B A;  4GL6 A;  4I5Q A;  3BU4 A;  1LOY A;  2R4I A;  4WWU C;  3IPT A;  2UUG C;  1BUQ A;  1JZO A;  1Q40 B;  2HML B;  3MKI A;  3FF0 A;  3OXA A;  5AEW B;  3F8X A;  4LEH A;  1D6Z A;  1UGI A;  3KSE D;  5HOH A;  4J5G A;  1YNV X;  5D81 A;  3T8U A;  4BTW A;  2QEX 3;  3D3L A;  1MWR A;  4HAA A;  1JN5 B;  1G02 A;  3B4O A;  4K61 A;  1CYU A;  3DUK A;  3HZP A;  2OWP A;  2E2U A;  3EBT A;  3PCS A;  1RKY A;  4KT3 B;  1RNT A;  1Q42 A;  4GB5 A;  1MWU A;  4KFE A;  1YVB I;  3EJV A;  2C4B A;  2HOH A;  1JB2 A;  1UGH I;  2GBX B;  1WNH A;  2H0G A;  4HZ9 B;  3RNT A;  1RNB A;  1V57 A;  3BND A;  1LOX A;  2H0H A;  2OQE A;  4AKZ A;  3ALA A;  4BL3 A;  1BRK A;  2K54 A;  3FGY A;  1KSI A;  1IU7 A;  3CCL 3;  2W2C A;  3DM8 A;  1RRL A;  2XSO B;  3EQQ B;  4HM6 B;  1O7N B;  2WO0 A;  3K63 A;  3HI7 A;  1W6G A;  3RDE A;  2WGO A;  1QVG 2;  1LXE A;  1RMS A;  5IEP A;  4AEQ A;  3OW2 2;  5I97 A;  4XB5 A;  1M9G A;  2O3O A;  2HMM B;  1FGR A;  1T5Y A;  1BSE A;  1IYY A;  2YX9 A;  3CC2 3;  3JUO A;  1DVC A;  1EA2 A;  1OCV A;  2W03 A;  1O7M B;  1RGC A;  2XEP A;  1QMA A;  2RCD A;  1GY5 A;  3LT9 A;  3ZG0 A;  1MWS A;  5ELU A;  4HJL B;  3SVA A;  2SBL A;  1VQ4 3;  2RGQ A;  4TX4 A;  3A76 A;  3CCE 3;  2P0X A;  1LOV A;  2Z7A A;  5FGO A;  5M1A A;  1NB5 I;  3QRD A;  4G1M B;  1LQM B;  2Z77 A;  3PXM A;  4RNZ A;  5DRV A;  4BIR A;  2KXG A;  3CCU 3;  1DMQ A;  1YJ9 3;  1ULJ B;  4IT7 A;  2HMK B;  5DRE A;  5M19 A;  3SLU A;  4EXR A;  1BRS A;  3D9R A;  1FYS A;  1B2Z A;  4HZB B;  4J5K A;  1GSP A;  3F7S A;  3V98 A;  4RZM A;  2OOV C;  3PCR A;  1BNI A;  1FUT A;  1RN7 A;  2C10 A;  1GMR A;  1N5P A;  2XFT A;  2R41 A;  4HM2 B;  1GOU A;  1UCL A;  4BL2 A;  3BIR A;  1NNV A;  3NUV A;  1GY6 A;  2XH9 A;  4WFO A;  1DE3 A;  1K8A 4;  1JBS A;  1QAK A;  1ROA A;  1OAC A;  2OTJ 3;  1GMQ A;  1NWW A;  1K9M 4;  1W6C A;  1Z1S A;  1B27 A;  5IG4 A;  3HK4 A;  2QA4 3;  4H61 A;  1A2K A;  3ROB A;  7RNT A;  1VQ9 3;  3GZR A;  1X1X A;  3KKG A;  1YGW A;  3PZW A;  4EW5 A;  4QWT A;  2CWU A;  2UGI A;  1K28 A;  3OX9 A;  3FLJ A;  1JV2 B;  1W2Z A;  3GZB A;  4XBY A;  3OWS A;  1E3R A;  1C7H A;  2PNC A;  4L8O A;  4R9L A;  5HGR A;  1W4N A;  1BVI A;  4H3U A;  3EE1 A;  4FCM A;  5CLK A;  4AKY A;  2CFG A;  3WA3 A;  1W00 A;  1UW1 A;  3NBR A;  1GMP A;  1UUG B;  5KP4 A;  5BVB A;  1TUH A;  3CCJ 3;  3G4S 3;  1B21 A;  3Q2P A;  2K3D A;  2P38 A;  4NHF A;  1HU9 A;  1VZZ A;  2SAR A;  1YIJ 3;  3PS8 A;  2V1L A;  4HM0 B;  4I4K A;  3CCV 3;  1IQX A;  3DH2 A;  1ROV A;  5AEU B;  2RBI A;  1KD1 4;  4O02 B;  1O7W B;  5AII A;  3SOY A;  1GS3 A;  4NRE A;  3HIG A;  2L4V A;  3KCH A;  4WYK A;  2KF3 A;  5IG3 A;  1BIR A;  1FUW A;  3HII A;  1SPU A;  1BRG A;  3G0K A;  3WOE B;  4LGQ A;  4HOH A;  1OUN A;  1A2V A;  2YFI B;  3WDG B;  3X3X A;  3K9M C;  1BUJ A;  1NO3 A;  2F56 A;  2E2T A;  1RN4 A;  1KC8 4;  1Q82 4;  1WMN A;  3CCM 3;  3UNL A;  1O7P B;  1STF I;  1AR0 A;  2KF4 A;  2GSP A;  1W5Z A;  3UB1 A;  3LOY A;  1S5A A;  2BNG A;  3PGB A;  2B24 B;  4N6O B;  2W0Q A;  1GOV A;  4HM5 B;  4FCJ A;  1O7G B;  3S27 A;  1Q7Y 4;  1KQS 2;  3DY5 A;  3FH1 A;  1QAL A;  2XR8 B;  4RNY A;  3DGM A;  4XBT A;  2CHC A;  5IEN A;  3JUN A;  3LTC A;  1BNJ A;  1BRH A;  1BU4 A;  1FGT A;  2ML5 A;  1N9E A;  2LQV A;  3JUP A;  4LMI A;  1YHQ 3;  1FZU A;  2O9U X;  5LC6 A;  4O2H A;  1W02 A;  1JB4 A;  1NU3 A;  3CPO A;  3DGO A;  2BT3 A;  1STD A;  3LML A;  1VQ8 3;  3MG1 A;  3F7X A;  4EC6 A;  3X40 A;  4LYL B;  1B2M A;  1O7H B;  1RGK A;  1T3B A;  3AHW A;  2ML6 A;  3A5E A;  1DVD A;  1OPY A;  2AAE A;  3X3Z A;  3KSP A;  1QJG A;  4O3V A;  3LZA A;  5ELJ A;  3VGN A;  1VQO 3;  1HZ1 A;  3IMA B;  3CCR 3;  3VF1 A;  1ZX2 A;  1AVL A;  2CWV A;  2IUK A;  1S72 3;  1I3I A;  1OGX A;  1GOY A;  3AGN A;  2UX0 A;  1TFK A;  5LC7 A;  1WMP A;  1CYV A;  1IDP A;  4L8P A;  5TGN A;  1RCK A;  1OF5 B;  2XF3 A;  1U8C B;  1UCJ A;  1WTH A;  2BMR B;  1T2H A;  2CWT A;  1VQP 3;  2OQE C;  3JVC A;  4MMX B;  1WMO A;  1IV7 A;  2IMJ A;  3GAX A;  1TJD A;  1IVW A;  4EBG A;  3D4A A;  4WHA A;  3CCQ 3;  3V92 A;  3DGY A;  2Y73 A;  2CKF B;  3RGA A;  1OHS A;  2Y74 A;  2KRT A;  2L1S A;  3CU3 A;  1YI2 3;  1RCL A;  1D6U A;  4R9K A;  4EV2 A;  5FW5 A;  2HMN B;  2W56 B;  3WOD G;  1IT7 A;  1NB3 I;  1YJW 3;  1WQL B;  5G1L A;  5AI1 A;  2RSX A;  5AYR B;  3FKA A;  1BOX A;  2CC3 A;  1RLS A;  1W7C A;  3BB9 A;  3WMD A;  1FGM A;  1RGG A;  4XDW A;  5D83 A;  3NHX A;  4U13 A;  3S67 A;  3S28 A;  8RNT A;  5IW9 A;  4CJN A;  4O8S A;  4MMZ B;  1SJW A;  1Q81 4;  3U1W A;  4MJD A;  3V99 A;  3F9S A;  4KZ1 A;  4BTY A;  1K41 A;  2OOV A;  2F4Y A;  2MC8 A;  1W01 A;  1VQ7 3;  3OWY A; 
#chains in the Genus database with same CATH homology
 3D5I A;  1B21 A;  5BU4 A;  1BAN A;  1BGS A;  1AY7 A;  1I3F A;  1RN1 A;  1BSA A;  2SAR A;  2KF5 A;  1I2F A;  2F5M A;  3DH2 A;  2RBI A;  3BU4 A;  1LOY A;  1RSN A;  1T2I A;  1X1U A;  1I8V A;  1A2P A;  3KCH A;  1I2G A;  2KF3 A;  1BIR A;  1BNE A;  1MGW A;  5HOH A;  4J5G A;  1YNV X;  1BRG A;  1BUJ A;  4HOH A;  1I0X A;  3SYU A;  4HAA A;  1G02 A;  2F56 A;  1RN4 A;  1RNT A;  1X1W A;  1LRA A;  2C4B A;  1AQZ A;  2HOH A;  2KF4 A;  2GSP A;  3RNT A;  1RTU A;  1RNB A;  1R4Y A;  1RDS A;  1BNG A;  1BSD A;  1GOV A;  1X1Y A;  1RHL A;  5RNT A;  1BRK A;  4GHO A;  1JBT A;  5BIR A;  1I0V A;  1BNJ A;  1BRH A;  1BU4 A;  1TRQ A;  1FZU A;  1RMS A;  1BSB A;  1BRI A;  1Q9E A;  1BSE A;  1IYY A;  1BRN L;  1BNS A;  3URP A;  1RGC A;  1I70 A;  1YVS A;  1B2M A;  9RNT A;  1RGK A;  1FUS A;  3AHW A;  3A5E A;  2AAE A;  1LOV A;  2KAA A;  1HZ1 A;  4BU4 A;  2RNT A;  1B2S A;  4BIR A;  1SAR A;  2ZA4 A;  1LNI A;  6GSP A;  1B3S A;  2KF6 A;  1LOW A;  2BIR A;  1BNF A;  3HOH A;  1BRS A;  5GSP A;  1RGA A;  1I3I A;  3AGN A;  1GOY A;  1ZGX A;  1UCK A;  6RNT A;  1FYS A;  1B2Z A;  4J5K A;  1FW7 A;  1GSP A;  1RCK A;  1MGR A;  1BNI A;  1FUT A;  1BNR A;  1GMR A;  1C54 A;  2BU4 A;  1GOU A;  1UCL A;  1UCJ A;  3BIR A;  1BSC A;  1T2H A;  1BRJ A;  1B2U A;  1HYF A;  1DE3 A;  1RGH A;  3D5G A;  3D4A A;  1JBS A;  1UCI A;  3DGY A;  1BAO A;  3GSP A;  1TRP A;  7GSP A;  4RNT A;  3WHO A;  1RCL A;  2AAD A;  1GMQ A;  3AGO A;  3WR2 A;  1B27 A;  7RNT A;  1RGL A;  1X1X A;  1YGW A;  1DET A;  1BOX A;  1RLS A;  1RGG A;  8RNT A;  1PY3 A;  1B20 A;  1PYL A;  1CH0 A;  1RGF A;  4GSP A;  2F5W A;  1RGE A;  3Q3F A;  1I2E A;  3AHS A;  1BVI A;  1TTO A;  1B2X A;  1JBR A;  2F4Y A;  1GMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...