1DE3A

Solution structure of the cytotoxic ribonuclease alpha-sarcin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
150
structure length
150
Chain Sequence
AVTWTCLNDQKNPKTNKYETKRLLYNQNKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLPKGRTPIKFGKSDCDRPPKHSKDGNGKTDHYLLEFPTFPDGHDYKFDSKKPKENPGPARVIYTYPNKVFCGIIAHTKENQGELKLCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE ALPHA-SARCIN
publication title The highly refined solution structure of the cytotoxic ribonuclease alpha-sarcin reveals the structural requirements for substrate recognition and ribonucleolytic activity.
pubmed doi rcsb
source organism Aspergillus giganteus
molecule tags Hydrolase
total genus 17
structure length 150
sequence length 150
ec nomenclature ec 3.1.27.10: rRNA endonuclease.
pdb deposition date 1999-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1de3A00
4BIRA 2GSPA 1DE3A 1FUSA 1BNRA 1BRHA 2F56A 1LRAA 7GSPA 1FUTA 2SARA 2RNTA 1GMPA 1PYLA 1RMSA 5BU4A 1UCIA 1G02A 3GSPA 1X1XA 2C4BA 6GSPA 1CH0A 1RGFA 4BU4A 2HOHA 2ZA4A 1I0XA 3D4AA 3WHOA 3KCHA 1BNJA 3D5GA 1I3IA 9RNTA 1GOVA 5RNTA 1RGGA 3BIRA 1JBTA 2KF4A 1GMRA 5BIRA 1B2MA 1RNTA 1BU4A 1GSPA 2KAAA 1RGCA 1YGWA 1LNIA 2RBIA 7RNTA 3BU4A 1BUJA 4J5GA 6RNTA 1I8VA 3AGNA 1B21A 2KF6A 1C54A 1LOWA 3DGYA 1DETA 1BAOA 1RSNA 4HAAA 1HYFA 1X1UA 2KF5A 1MGRA 1T2IA 1RGHA 1GOUA 1B2XA 3RNTA 3WR2A 1RGKA 1BOXA 1HZ1A 1GOYA 3D5IA 1RDSA 1RNBA 1BNIA 1BRGA 4RNTA 5HOHA 1BRKA 3A5EA 1B2SA 1ZGXA 1JBRA 1BSEA 1LOYA 2BU4A 1IYYA 1RTUA 1I0VA 1YVSA 1I2EA 3URPA 3SYUA 1TRQA 1UCKA 1UCJA 1B2UA 1RCLA 2AAEA 1RGLA 1FYSA 1B3SA 1I2FA 1PY3A 1RLSA 1JBSA 1BRIA 1A2PA 1RHLA 1SARA 1RCKA 1BRNL 3DH2A 1FW7A 2F5WA 1TRPA 1B20A 1X1YA 1YNVX 3AGOA 1FZUA 1BNGA 1I3FA 8RNTA 1BSCA 2KF3A 1B2ZA 1BSDA 1BVIA 1BSAA 1BNSA 4J5KA 1RGAA 4GHOA 4GSPA 4HOHA 1Q9EA 1BNFA 1RN4A 1T2HA 3Q3FA 1I2GA 5GSPA 2F5MA 1AY7A 1BRJA 2AADA 1I70A 1TTOA 1X1WA 1R4YA 2F4YA 3HOHA 1MGWA 1UCLA 1BNEA 1AQZA 1BGSA 3AHSA 1BIRA 1B27A 1RN1A 3AHWA 2BIRA 1BANA 1GMQA 1LOVA 1BSBA 1BRSA 1RGEA
chains in the Genus database with same CATH superfamily
5EEOA 2GSPA 2P38A 4BIRA 5AIIA 1IU7A 2ML5A 1TU5A 1BRHA 4H61A 2F56A 3K0ZA 1IDPA 7GSPA 3PYJA 3JUPA 1IT8A 1YJ93 3DUKA 4CJNA 2CFGA 4O8SA 2F99A 1UCIA 3HIGA 2C10A 3GSPA 2R4IA 4OVMA 2J8XB 1ZX2A 2KRTA 1IQYA 3DY5A 3LT8A 4KFDA 3I553 4WHAA 2WOFA 3G4S3 1GD4A 3HI7A 3D4AA 1YHQ3 1I0XA 1OF5A 2C11A 1NJI4 3CC43 4TX4A 1I3IA 3MWZA 5BXQA 3F14A 1RKYA 3LOYA 4NREA 1Q824 1GOVA 1UW1A 4X2HA 1VQ83 1W01A 3FH1A 4HYZA 2BNGA 2CG1A 1ULIB 2F98A 1WNHA 1ULJB 3CCR3 1GMRA 1IV9A 4HM1B 1O7HB 4N6TA 3K7CA 3KKGA 2CWVA 2HMOB 5CXOA 3CCU3 2CFDA 2RBIA 4WYKB 1IVUA 3NQYA 1FGTA 5CF1A 4MEIA 6RNTA 1I8VA 1WMOA 4KVHA 5I97A 3KN4A 3X3YA 1C54A 1LOWA 1KC84 3MHEA 2GU3A 1HYFA 3B4PA 3EB8A 3CCM3 1MGRA 2YFJB 3GRDA 3RNTA 1RGKA 3NM7A 1IVXA 2BT3A 2RFRA 1SIHA 1IK3A 3GAXA 5EVHA 3N8BA 3D5IA 1RNBA 3CD63 2SBLA 1OHOA 5LC7A 3A76A 1GY5A 1UGHI 3DGNA 3G8ZA 1K9M4 1W6YA 1ZGXA 1KSIA 2B1XB 4KFFA 1BSEA 2XF3A 2BU4A 2K3DA 3JVCA 1RTUA 1I0VA 4EW5A 2MF7A 4I5QA 5G1KA 1VQ63 1TRQA 2PNCA 3LTAA 2E2TA 4O2HA 1RCLA 2AAEA 5G1LA 1FYSA 1B3SA 3JUOA 3F7SA 4AKZA 1PY3A 4RBNA 1OPYA 3IPTA 3ER7A 1CQSA 1RHLA 3EHCA 1YGEA 2W03A 4MJDA 3WDGB 4XBYA 3PXMA 2RGQA 3DH2A 1EA2A 3GWRA 3LZAA 5M19A 1B20A 1X1YA 2HMNB 2LQVA 1V58A 3WOFB 5AYSC 2LYXA 2R41A 3FZWA 1SPUA 3LTBA 4OUQA 5HGRA 2KF3A 1QALA 3NBBA 1BVIA 3GZYB 3X3ZA 3PCSA 1LVNA 4J5KA 1JV2B 4OK0A 2HMKB 1BNFA 1T2HA 3SOYA 5GSPA 2JQ5A 3KZTA 3S27A 1QAFA 3J7Yd 1JB2A 1VQN3 4O3VA 4R4KA 2CFLA 3SLUA 1O7PB 3Q2PA 3B4OA 1R4YA 2CW9A 2GBWB 2L1SA 3LTDA 5LC6A 3T8UA 3S28A 4K90B 3VSYA 4L7KA 2XFTA 2GXFA 2L4VA 4EYCA 1U5OA 2OTL3 2KCDA 3AHWA 2CH9A 2BIRA 3MPHA 3OXAA 1DMMA 1BRSA 3HZPA 4KT3B 3CCL3 1M9GA 1DE3A 1VQQA 1S723 4JF8A 1A67A 2F86B 1LOXA 2Q07A 5BVBA 3ZG0A 4MMYB 1ROVA 2XR8B 3S29A 3SVAA 2WO0A 2CK3H 3NXJA 1GMPA 1PYLA 5BU4A 5DREA 2XEPA 3STDA 1YJN3 3F8XA 4R1KA 3G16A 4IPBA 1X1XA 2BHMA 2BO9B 2MC8A 1KWIA 3SX1A 6GSPA 1O7WB 1RGFA 3CCS3 3WA2X 3F40A 5D82A 4BU4A 1YI23 3MYTA 1IVVA 2QGUA 1HU9A 3KCHA 3PZWA 2HMMB 4LZIA 1JJ22 4O02B 3B8LA 3CCQ3 3EN1B 1T5YA 1MNLA 2FGTA 3N54B 1NNVA 1O7GB 2QA43 3BIRA 5JPPA 4MMXB 1JB5A 1VQ93 1JBTA 1UI7A 3EJVA 4K1VA 3WODG 1M1XB 4HM5B 3U97A 1MWRA 1B2MA 1BU4A 1GS3A 2KAAA 4J9AA 4FR9A 3EC9A 1LNIA 3IMAB 4LGQA 3CCJ3 2IY2A 4WWUC 1BUJA 3O8YA 1JN5A 4HM6B 2BMOB 3AGNA 1B21A 1STFI 3KSPA 2ZDJA 7STDA 1V74A 1DETA 3I563 1E3RA 5IENA 2K54A 2CHCA 2KF5A 1UGIA 3V99A 3N9HA 2HMJB 2W56A 3WR2A 1DMQA 2GBXB 1CYUA 3DGOA 1GOYA 3E99A 3LXUX 1BRGA 4RNTA 2CX1A 1BRKA 2STDA 3BLZA 4G1MB 3UB1A 1W2B2 1B2SA 3GZXB 2O3OA 2UX0A 1LOYA 1QVF2 4FMBA 4HM4B 1MWTA 4N6OB 1IVWA 4KZ1A 3BNDA 5IG0A 3HK4A 1I2EA 1TIJA 2P05A 3URPA 5IG4A 3SYUA 4ILFA 2QEX3 3F8HA 1UCKA 3KSED 1DYUA 1K28A 1B2UA 1FGQA 1JZOA 4GL6A 5AI1A 4NHFA 1YIJ3 2Z6BA 1I2FA 4NPBA 1K8A4 1JBSA 1BRIA 1G0TA 4U13A 3EN8A 1RCKA 4LYLB 1LQGC 3SEDA 5KP4A 3WA3A 1BRNL 1FW7A 1JNQA 3DMCA 2O9UX 3ROBA 5D81A 1BNGA 3OX9A 8RNTA 3CCE3 2H0HA 3EQQB 1JZDA 1G96A 2CX0A 5AIGA 2H0GA 2D42A 2QIYA 1MWUA 2P0XA 1RGAA 4HVNA 3I0YA 3Q3FA 3D3LA 5DRVA 5G2GA 1I2GA 1OGZA 2OOVC 1MOLA 1HKXA 4N6V0 2W6JH 1WMPA 2F5MA 5A0OB 1AY7A 1BRJA 1AV4A 2AADA 1LQMB 3MG1A 4L8OA 2E2VA 2XGLA 4RZMA 2YFLB 1VQ53 3HOHA 3Q90A 3HIIA 1D6ZA 5FGOA 1A2VA 1BGSA 1JN5B 2BMQB 2V1LA 4HJLB 4IIAA 1BANA 1TFKA 1SQWA 2E2UA 3MSOA 3D9RA 1LOVA 1BSBA 4N6UA 1KQS2 2INXA 1RGEA 3OWSA 1RJOA 1NB5I 3JUQA 4STDA 4AEQA 2W56B 1TP6A 3T0UA 1VZZA 3EX9A 3FKAA 3OWUA 4RNYA 1LRAA 1ASKA 3UJMA 1FUTA 2SARA 1UUWB 3NBRA 4I4KA 3RGRA 3ZG5A 4EC6A 5IW9A 3F9SA 4HM0B 4HM8B 2OOVA 4R80A 2CWTA 1G02A 1TUHA 1US1A 2XSOB 3D79A 3OW22 1LXEA 4HM7B 4ZM8A 2ZA4A 3EBTA 5TGNA 1D6YA 4H3UA 1BNJA 2A15A 3K63A 4EXRA 1EKMA 1SJWA 3RGAA 9RNTA 3NHXA 2CWUA 4HM3B 1OH0A 3NUVA 3PS8A 1CYVA 1AR0A 3CME3 3B7CA 1Q7Y4 3AMOA 1RN7A 2FXTA 2GU1A 2IMJA 3QRDA 4BL2A 1SIIA 1JB4A 5BIRA 4XM4A 1GSPA 3WMDA 1GYBA 3BNEA 4CDLA 1YGWA 4R9LA 3BU4A 4Q53A 1NU3A 2OWPA 3BB9A 1K734 1L5GB 5EQLA 1VQO3 1O7MB 1PU4A 3X40A 4DKIA 1BAOA 4LSOA 4HAAA 1ZS7A 5AEWB 1X1UA 5IERA 5STDA 3BNCA 1OGXA 1MWSA 1RGHA 2W9QA 1WMNA 1Q814 1JRQA 1QVG2 1HZ1A 1W6GA 1EG9B 2UGIA 2WGQA 1NWWA 4HBRA 2XFSA 4FCZA 3OWYA 2XRXB 3CC23 1YJW3 4N6NB 3VGNA 3NV0A 4N6LA 5JBSA 1JBRA 4HZ9B 1IT7A 4PEJA 1UUGB 1T3BA 2YFIB 3EE1A 4BTYA 6STDA 2CIUA 1OHSA 2Z7AA 5M1AA 1UCJA 3ZFZA 3EBYA 5KP3A 3LT9A 5CLKA 1EEJA 1RGLA 3CPOA 2ML6A 1NB3I 2IYJA 1A2PA 2OQEC 2H0IA 1SARA 1N8R4 1AVLA 1Q7HA 4BTWA 3KFQC 3FSDA 2XGNA 1TRPA 1YNVX 1K41A 1E97A 3L0RA 1ISKA 4N3VA 2CFKA 1N5HA 1Z1SA 1GY6A 3X41A 1FA3A 5CF2A 3M8CA 2M7OA 1A2KA 1B2ZA 1BSDA 3H51A 4HKVB 5IF6A 3DGLA 4LMIA 4K61A 3FCSB 1BNSA 1Y4KA 4KFEA 3ECFA 3RDEA 1OACA 1RRHA 1W00A 4GHOA 4HOHA 1RN4A 5D83A 4FMAA 2RSXA 1OUNA 1QAKA 2IA7A 3AMOB 2I9WA 5AIHA 1X1WA 2OQEA 2B24B 4RNZA 3FG1A 1FGMA 3CNMA 5CK6A 1MGWA 1UI8A 1BNEA 3JUNA 1CEWI 4ORLA 4HZBB 3PGBA 1E3VA 5IEPA 1B27A 1RN1A 1DVCA 1GMQA 1M904 3DXOA 1JKGA 1GY7A 1GD3A 3FF0A 1N9JA 4HM2B 1W7CA 1FUSA 3PCRA 4CPKA 3G713 1BNRA 3HX8A 3LYGA 2GEYA 1N8QA 4XDVA 1F8NA 3H3HA 1TFOA 3NBJA 2RNTA 1AVKA 1WQLB 3CNXA 1DMNA 4FMCA 1IQ8A 1YVBI 1RMSA 3NV0B 5AYRB 4BL3A 3NM2A 5IG3A 3UNLA 1W2ZA 2ZL8A 3G0KA 2C4BA 3KE7A 4FMDA 1KD14 1CH0A 3JUMA 3DZLA 2HOHA 4XDWA 3NQZA 3WHOA 4EBGA 4JRFA 3D5GA 1FGOA 2P09A 1Q42A 2WOHA 4K1UA 5RNTA 1RGGA 1STDA 3FGYA 4FCMA 3VF1A 4WP5A 5ELJA 3U1WA 2KF4A 1VQP3 2XH9A 2JDIH 1RNTA 3FF2A 2KXGA 1RGCA 1W5ZA 3LMLA 2Z77A 5IEOA 3K9MC 7RNTA 5IG5A 4R9KA 3UL6A 2CG0A 3EF8A 4J5GA 2P0MA 3CU3A 3CPW2 1Q40A 3CCV3 4XBXA 4WFOA 2KF6A 3KIIA 5ELUA 1YIT3 3DGYA 2CKFB 2W04A 4J8TA 1RSNA 1BUQA 1A90A 3SXXA 1EQKA 1VQM3 1FUWA 4LEHA 1T2IA 1GOUA 1B2XA 1Q864 1FGRA 1BOXA 3Q1CA 1VQ43 3S5CA 1RDSA 3DM8A 4MMZB 1BNIA 1UUVB 1U8CB 5HOHA 3UL5A 1W02A 1D6UA 2BMRB 4EV2A 1OF5B 2OTJ3 2Z76A 4L8PA 1TJDA 2W2CA 3A5EA 4N6MA 3CMA3 1IV7A 1S5AA 1W4NA 4EV5A 1IYYA 1YVSA 1UDII 1JKGB 2FNQA 1N9EA 1R4CA 3F7XA 3FG4A 2ZHXB 4AKYA 2HMLB 2K0MA 3FLJA 3LH4A 3LTCA 3OV4A 4GB5A 3X3XA 1RLSA 5M18A 2OCTA 2W0QA 2W9PA 5JPUA 1J2BA 1RRLA 1OHPA 2IUJA 3T8NA 5KP1A 3DGMA 3CXC2 1N5PA 1W6CA 2IUKA 3V92A 4FCJA 2F5WA 2Y74A 5FW5A 2CC3A 3AGOA 2Y73A 3TDGA 1QJGA 2UUGC 1VQK3 1WTHA 3ALAA 1FZUA 1I3FA 4WYKA 1OCVA 3GZRA 2WGOA 4QWTA 1BSCA 4BTXA 3V98A 3MKIA 2XSHB 3GZBA 3QK9A 1BSAA 3CC73 2RCDA 1M1K4 1DVDA 4GSPA 1Q9EA 3S67A 1QMAA 1PFPA 3MG3A 1C7HA 1EUIC 1NO3A 4XB5A 3X42A 4X2OA 2D1WA 3G6E3 1LNHA 2GEXA 3IJEB 4XBTA 2YX9A 1ROAA 3SOAA 4CCVA 5AEUB 1I70A 1TTOA 2F4YA 3MG2A 2PZVA 1NDOB 3K5TA 8CHOA 1IQXA 1UCLA 4IT7A 1AQZA 1O7NB 3WOEB 3AHSA 1BIRA 1VQ73 1VQL3 2CFWA 1Q40B 1ZO2A 3NX0A 1V57A 3FG3A 5AIFA 3BNBA
chains in the Genus database with same CATH topology
4BIRA 2GSPA 1DE3A 1FUSA 1BNRA 1BRHA 2F56A 1LRAA 7GSPA 1FUTA 2SARA 2RNTA 1GMPA 1PYLA 1RMSA 5BU4A 1UCIA 1G02A 3GSPA 1X1XA 2C4BA 6GSPA 1CH0A 1RGFA 4BU4A 2HOHA 2ZA4A 1I0XA 3D4AA 3WHOA 3KCHA 1BNJA 3D5GA 1I3IA 9RNTA 1GOVA 5RNTA 1RGGA 3BIRA 1JBTA 2KF4A 1GMRA 5BIRA 1B2MA 1RNTA 1BU4A 1GSPA 2KAAA 1RGCA 1YGWA 1LNIA 2RBIA 7RNTA 3BU4A 1BUJA 4J5GA 6RNTA 1I8VA 3AGNA 1B21A 2KF6A 1C54A 1LOWA 3DGYA 1DETA 1BAOA 1RSNA 4HAAA 1HYFA 1X1UA 2KF5A 1MGRA 1T2IA 1RGHA 1GOUA 1B2XA 3RNTA 3WR2A 1RGKA 1BOXA 1HZ1A 1GOYA 3D5IA 1RDSA 1RNBA 1BNIA 1BRGA 4RNTA 5HOHA 1BRKA 3A5EA 1B2SA 1ZGXA 1JBRA 1BSEA 1LOYA 2BU4A 1IYYA 1RTUA 1I0VA 1YVSA 1I2EA 3URPA 3SYUA 1TRQA 1UCKA 1UCJA 1B2UA 1RCLA 2AAEA 1RGLA 1FYSA 1B3SA 1I2FA 1PY3A 1RLSA 1JBSA 1BRIA 1A2PA 1RHLA 1SARA 1RCKA 1BRNL 3DH2A 1FW7A 2F5WA 1TRPA 1B20A 1X1YA 1YNVX 3AGOA 1FZUA 1BNGA 1I3FA 8RNTA 1BSCA 2KF3A 1B2ZA 1BSDA 1BVIA 1BSAA 1BNSA 4J5KA 1RGAA 4GHOA 4GSPA 4HOHA 1Q9EA 1BNFA 1RN4A 1T2HA 3Q3FA 1I2GA 5GSPA 2F5MA 1AY7A 1BRJA 2AADA 1I70A 1TTOA 1X1WA 1R4YA 2F4YA 3HOHA 1MGWA 1UCLA 1BNEA 1AQZA 1BGSA 3AHSA 1BIRA 1B27A 1RN1A 3AHWA 2BIRA 1BANA 1GMQA 1LOVA 1BSBA 1BRSA 1RGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BIR A;  2GSP A;  1DE3 A;  1FUS A;  1BNR A;  1BRH A;  2F56 A;  1LRA A;  7GSP A;  1FUT A;  2SAR A;  2RNT A;  1GMP A;  1PYL A;  1RMS A;  5BU4 A;  1UCI A;  1G02 A;  3GSP A;  1X1X A;  2C4B A;  6GSP A;  1CH0 A;  1RGF A;  4BU4 A;  2HOH A;  2ZA4 A;  1I0X A;  3D4A A;  3WHO A;  3KCH A;  1BNJ A;  3D5G A;  1I3I A;  9RNT A;  1GOV A;  5RNT A;  1RGG A;  3BIR A;  1JBT A;  2KF4 A;  1GMR A;  5BIR A;  1B2M A;  1RNT A;  1BU4 A;  1GSP A;  2KAA A;  1RGC A;  1YGW A;  1LNI A;  2RBI A;  7RNT A;  3BU4 A;  1BUJ A;  4J5G A;  6RNT A;  1I8V A;  3AGN A;  1B21 A;  2KF6 A;  1C54 A;  1LOW A;  3DGY A;  1DET A;  1BAO A;  1RSN A;  4HAA A;  1HYF A;  1X1U A;  2KF5 A;  1MGR A;  1T2I A;  1RGH A;  1GOU A;  1B2X A;  3RNT A;  3WR2 A;  1RGK A;  1BOX A;  1HZ1 A;  1GOY A;  3D5I A;  1RDS A;  1RNB A;  1BNI A;  1BRG A;  4RNT A;  5HOH A;  1BRK A;  3A5E A;  1B2S A;  1ZGX A;  1JBR A;  1BSE A;  1LOY A;  2BU4 A;  1IYY A;  1RTU A;  1I0V A;  1YVS A;  1I2E A;  3URP A;  3SYU A;  1TRQ A;  1UCK A;  1UCJ A;  1B2U A;  1RCL A;  2AAE A;  1RGL A;  1FYS A;  1B3S A;  1I2F A;  1PY3 A;  1RLS A;  1JBS A;  1BRI A;  1A2P A;  1RHL A;  1SAR A;  1RCK A;  1BRN L;  3DH2 A;  1FW7 A;  2F5W A;  1TRP A;  1B20 A;  1X1Y A;  1YNV X;  3AGO A;  1FZU A;  1BNG A;  1I3F A;  8RNT A;  1BSC A;  2KF3 A;  1B2Z A;  1BSD A;  1BVI A;  1BSA A;  1BNS A;  4J5K A;  1RGA A;  4GHO A;  4GSP A;  4HOH A;  1Q9E A;  1BNF A;  1RN4 A;  1T2H A;  3Q3F A;  1I2G A;  5GSP A;  2F5M A;  1AY7 A;  1BRJ A;  2AAD A;  1I70 A;  1TTO A;  1X1W A;  1R4Y A;  2F4Y A;  3HOH A;  1MGW A;  1UCL A;  1BNE A;  1AQZ A;  1BGS A;  3AHS A;  1BIR A;  1B27 A;  1RN1 A;  3AHW A;  2BIR A;  1BAN A;  1GMQ A;  1LOV A;  1BSB A;  1BRS A;  1RGE A; 
#chains in the Genus database with same CATH topology
 5EEO A;  2GSP A;  2P38 A;  4BIR A;  5AII A;  1IU7 A;  2ML5 A;  1TU5 A;  1BRH A;  4H61 A;  2F56 A;  3K0Z A;  1IDP A;  7GSP A;  3PYJ A;  3JUP A;  1IT8 A;  1YJ9 3;  3DUK A;  4CJN A;  2CFG A;  4O8S A;  2F99 A;  1UCI A;  3HIG A;  2C10 A;  3GSP A;  2R4I A;  4OVM A;  2J8X B;  1ZX2 A;  2KRT A;  1IQY A;  3DY5 A;  3LT8 A;  4KFD A;  3I55 3;  4WHA A;  2WOF A;  3G4S 3;  1GD4 A;  3HI7 A;  3D4A A;  1YHQ 3;  1I0X A;  1OF5 A;  2C11 A;  1NJI 4;  3CC4 3;  4TX4 A;  1I3I A;  3MWZ A;  5BXQ A;  3F14 A;  1RKY A;  3LOY A;  4NRE A;  1Q82 4;  1GOV A;  1UW1 A;  4X2H A;  1VQ8 3;  1W01 A;  3FH1 A;  4HYZ A;  2BNG A;  2CG1 A;  1ULI B;  2F98 A;  1WNH A;  1ULJ B;  3CCR 3;  1GMR A;  1IV9 A;  4HM1 B;  1O7H B;  4N6T A;  3K7C A;  3KKG A;  2CWV A;  2HMO B;  5CXO A;  3CCU 3;  2CFD A;  2RBI A;  4WYK B;  1IVU A;  3NQY A;  1FGT A;  5CF1 A;  4MEI A;  6RNT A;  1I8V A;  1WMO A;  4KVH A;  5I97 A;  3KN4 A;  3X3Y A;  1C54 A;  1LOW A;  1KC8 4;  3MHE A;  2GU3 A;  1HYF A;  3B4P A;  3EB8 A;  3CCM 3;  1MGR A;  2YFJ B;  3GRD A;  3RNT A;  1RGK A;  3NM7 A;  1IVX A;  2BT3 A;  2RFR A;  1SIH A;  1IK3 A;  3GAX A;  5EVH A;  3N8B A;  3D5I A;  1RNB A;  3CD6 3;  2SBL A;  1OHO A;  5LC7 A;  3A76 A;  1GY5 A;  1UGH I;  3DGN A;  3G8Z A;  1K9M 4;  1W6Y A;  1ZGX A;  1KSI A;  2B1X B;  4KFF A;  1BSE A;  2XF3 A;  2BU4 A;  2K3D A;  3JVC A;  1RTU A;  1I0V A;  4EW5 A;  2MF7 A;  4I5Q A;  5G1K A;  1VQ6 3;  1TRQ A;  2PNC A;  3LTA A;  2E2T A;  4O2H A;  1RCL A;  2AAE A;  5G1L A;  1FYS A;  1B3S A;  3JUO A;  3F7S A;  4AKZ A;  1PY3 A;  4RBN A;  1OPY A;  3IPT A;  3ER7 A;  1CQS A;  1RHL A;  3EHC A;  1YGE A;  2W03 A;  4MJD A;  3WDG B;  4XBY A;  3PXM A;  2RGQ A;  3DH2 A;  1EA2 A;  3GWR A;  3LZA A;  5M19 A;  1B20 A;  1X1Y A;  2HMN B;  2LQV A;  1V58 A;  3WOF B;  5AYS C;  2LYX A;  2R41 A;  3FZW A;  1SPU A;  3LTB A;  4OUQ A;  5HGR A;  2KF3 A;  1QAL A;  3NBB A;  1BVI A;  3GZY B;  3X3Z A;  3PCS A;  1LVN A;  4J5K A;  1JV2 B;  4OK0 A;  2HMK B;  1BNF A;  1T2H A;  3SOY A;  5GSP A;  2JQ5 A;  3KZT A;  3S27 A;  1QAF A;  3J7Y d;  1JB2 A;  1VQN 3;  4O3V A;  4R4K A;  2CFL A;  3SLU A;  1O7P B;  3Q2P A;  3B4O A;  1R4Y A;  2CW9 A;  2GBW B;  2L1S A;  3LTD A;  5LC6 A;  3T8U A;  3S28 A;  4K90 B;  3VSY A;  4L7K A;  2XFT A;  2GXF A;  2L4V A;  4EYC A;  1U5O A;  2OTL 3;  2KCD A;  3AHW A;  2CH9 A;  2BIR A;  3MPH A;  3OXA A;  1DMM A;  1BRS A;  3HZP A;  4KT3 B;  3CCL 3;  1M9G A;  1DE3 A;  1VQQ A;  1S72 3;  4JF8 A;  1A67 A;  2F86 B;  1LOX A;  2Q07 A;  5BVB A;  3ZG0 A;  4MMY B;  1ROV A;  2XR8 B;  3S29 A;  3SVA A;  2WO0 A;  2CK3 H;  3NXJ A;  1GMP A;  1PYL A;  5BU4 A;  5DRE A;  2XEP A;  3STD A;  1YJN 3;  3F8X A;  4R1K A;  3G16 A;  4IPB A;  1X1X A;  2BHM A;  2BO9 B;  2MC8 A;  1KWI A;  3SX1 A;  6GSP A;  1O7W B;  1RGF A;  3CCS 3;  3WA2 X;  3F40 A;  5D82 A;  4BU4 A;  1YI2 3;  3MYT A;  1IVV A;  2QGU A;  1HU9 A;  3KCH A;  3PZW A;  2HMM B;  4LZI A;  1JJ2 2;  4O02 B;  3B8L A;  3CCQ 3;  3EN1 B;  1T5Y A;  1MNL A;  2FGT A;  3N54 B;  1NNV A;  1O7G B;  2QA4 3;  3BIR A;  5JPP A;  4MMX B;  1JB5 A;  1VQ9 3;  1JBT A;  1UI7 A;  3EJV A;  4K1V A;  3WOD G;  1M1X B;  4HM5 B;  3U97 A;  1MWR A;  1B2M A;  1BU4 A;  1GS3 A;  2KAA A;  4J9A A;  4FR9 A;  3EC9 A;  1LNI A;  3IMA B;  4LGQ A;  3CCJ 3;  2IY2 A;  4WWU C;  1BUJ A;  3O8Y A;  1JN5 A;  4HM6 B;  2BMO B;  3AGN A;  1B21 A;  1STF I;  3KSP A;  2ZDJ A;  7STD A;  1V74 A;  1DET A;  3I56 3;  1E3R A;  5IEN A;  2K54 A;  2CHC A;  2KF5 A;  1UGI A;  3V99 A;  3N9H A;  2HMJ B;  2W56 A;  3WR2 A;  1DMQ A;  2GBX B;  1CYU A;  3DGO A;  1GOY A;  3E99 A;  3LXU X;  1BRG A;  4RNT A;  2CX1 A;  1BRK A;  2STD A;  3BLZ A;  4G1M B;  3UB1 A;  1W2B 2;  1B2S A;  3GZX B;  2O3O A;  2UX0 A;  1LOY A;  1QVF 2;  4FMB A;  4HM4 B;  1MWT A;  4N6O B;  1IVW A;  4KZ1 A;  3BND A;  5IG0 A;  3HK4 A;  1I2E A;  1TIJ A;  2P05 A;  3URP A;  5IG4 A;  3SYU A;  4ILF A;  2QEX 3;  3F8H A;  1UCK A;  3KSE D;  1DYU A;  1K28 A;  1B2U A;  1FGQ A;  1JZO A;  4GL6 A;  5AI1 A;  4NHF A;  1YIJ 3;  2Z6B A;  1I2F A;  4NPB A;  1K8A 4;  1JBS A;  1BRI A;  1G0T A;  4U13 A;  3EN8 A;  1RCK A;  4LYL B;  1LQG C;  3SED A;  5KP4 A;  3WA3 A;  1BRN L;  1FW7 A;  1JNQ A;  3DMC A;  2O9U X;  3ROB A;  5D81 A;  1BNG A;  3OX9 A;  8RNT A;  3CCE 3;  2H0H A;  3EQQ B;  1JZD A;  1G96 A;  2CX0 A;  5AIG A;  2H0G A;  2D42 A;  2QIY A;  1MWU A;  2P0X A;  1RGA A;  4HVN A;  3I0Y A;  3Q3F A;  3D3L A;  5DRV A;  5G2G A;  1I2G A;  1OGZ A;  2OOV C;  1MOL A;  1HKX A;  4N6V 0;  2W6J H;  1WMP A;  2F5M A;  5A0O B;  1AY7 A;  1BRJ A;  1AV4 A;  2AAD A;  1LQM B;  3MG1 A;  4L8O A;  2E2V A;  2XGL A;  4RZM A;  2YFL B;  1VQ5 3;  3HOH A;  3Q90 A;  3HII A;  1D6Z A;  5FGO A;  1A2V A;  1BGS A;  1JN5 B;  2BMQ B;  2V1L A;  4HJL B;  4IIA A;  1BAN A;  1TFK A;  1SQW A;  2E2U A;  3MSO A;  3D9R A;  1LOV A;  1BSB A;  4N6U A;  1KQS 2;  2INX A;  1RGE A;  3OWS A;  1RJO A;  1NB5 I;  3JUQ A;  4STD A;  4AEQ A;  2W56 B;  1TP6 A;  3T0U A;  1VZZ A;  3EX9 A;  3FKA A;  3OWU A;  4RNY A;  1LRA A;  1ASK A;  3UJM A;  1FUT A;  2SAR A;  1UUW B;  3NBR A;  4I4K A;  3RGR A;  3ZG5 A;  4EC6 A;  5IW9 A;  3F9S A;  4HM0 B;  4HM8 B;  2OOV A;  4R80 A;  2CWT A;  1G02 A;  1TUH A;  1US1 A;  2XSO B;  3D79 A;  3OW2 2;  1LXE A;  4HM7 B;  4ZM8 A;  2ZA4 A;  3EBT A;  5TGN A;  1D6Y A;  4H3U A;  1BNJ A;  2A15 A;  3K63 A;  4EXR A;  1EKM A;  1SJW A;  3RGA A;  9RNT A;  3NHX A;  2CWU A;  4HM3 B;  1OH0 A;  3NUV A;  3PS8 A;  1CYV A;  1AR0 A;  3CME 3;  3B7C A;  1Q7Y 4;  3AMO A;  1RN7 A;  2FXT A;  2GU1 A;  2IMJ A;  3QRD A;  4BL2 A;  1SII A;  1JB4 A;  5BIR A;  4XM4 A;  1GSP A;  3WMD A;  1GYB A;  3BNE A;  4CDL A;  1YGW A;  4R9L A;  3BU4 A;  4Q53 A;  1NU3 A;  2OWP A;  3BB9 A;  1K73 4;  1L5G B;  5EQL A;  1VQO 3;  1O7M B;  1PU4 A;  3X40 A;  4DKI A;  1BAO A;  4LSO A;  4HAA A;  1ZS7 A;  5AEW B;  1X1U A;  5IER A;  5STD A;  3BNC A;  1OGX A;  1MWS A;  1RGH A;  2W9Q A;  1WMN A;  1Q81 4;  1JRQ A;  1QVG 2;  1HZ1 A;  1W6G A;  1EG9 B;  2UGI A;  2WGQ A;  1NWW A;  4HBR A;  2XFS A;  4FCZ A;  3OWY A;  2XRX B;  3CC2 3;  1YJW 3;  4N6N B;  3VGN A;  3NV0 A;  4N6L A;  5JBS A;  1JBR A;  4HZ9 B;  1IT7 A;  4PEJ A;  1UUG B;  1T3B A;  2YFI B;  3EE1 A;  4BTY A;  6STD A;  2CIU A;  1OHS A;  2Z7A A;  5M1A A;  1UCJ A;  3ZFZ A;  3EBY A;  5KP3 A;  3LT9 A;  5CLK A;  1EEJ A;  1RGL A;  3CPO A;  2ML6 A;  1NB3 I;  2IYJ A;  1A2P A;  2OQE C;  2H0I A;  1SAR A;  1N8R 4;  1AVL A;  1Q7H A;  4BTW A;  3KFQ C;  3FSD A;  2XGN A;  1TRP A;  1YNV X;  1K41 A;  1E97 A;  3L0R A;  1ISK A;  4N3V A;  2CFK A;  1N5H A;  1Z1S A;  1GY6 A;  3X41 A;  1FA3 A;  5CF2 A;  3M8C A;  2M7O A;  1A2K A;  1B2Z A;  1BSD A;  3H51 A;  4HKV B;  5IF6 A;  3DGL A;  4LMI A;  4K61 A;  3FCS B;  1BNS A;  1Y4K A;  4KFE A;  3ECF A;  3RDE A;  1OAC A;  1RRH A;  1W00 A;  4GHO A;  4HOH A;  1RN4 A;  5D83 A;  4FMA A;  2RSX A;  1OUN A;  1QAK A;  2IA7 A;  3AMO B;  2I9W A;  5AIH A;  1X1W A;  2OQE A;  2B24 B;  4RNZ A;  3FG1 A;  1FGM A;  3CNM A;  5CK6 A;  1MGW A;  1UI8 A;  1BNE A;  3JUN A;  1CEW I;  4ORL A;  4HZB B;  3PGB A;  1E3V A;  5IEP A;  1B27 A;  1RN1 A;  1DVC A;  1GMQ A;  1M90 4;  3DXO A;  1JKG A;  1GY7 A;  1GD3 A;  3FF0 A;  1N9J A;  4HM2 B;  1W7C A;  1FUS A;  3PCR A;  4CPK A;  3G71 3;  1BNR A;  3HX8 A;  3LYG A;  2GEY A;  1N8Q A;  4XDV A;  1F8N A;  3H3H A;  1TFO A;  3NBJ A;  2RNT A;  1AVK A;  1WQL B;  3CNX A;  1DMN A;  4FMC A;  1IQ8 A;  1YVB I;  1RMS A;  3NV0 B;  5AYR B;  4BL3 A;  3NM2 A;  5IG3 A;  3UNL A;  1W2Z A;  2ZL8 A;  3G0K A;  2C4B A;  3KE7 A;  4FMD A;  1KD1 4;  1CH0 A;  3JUM A;  3DZL A;  2HOH A;  4XDW A;  3NQZ A;  3WHO A;  4EBG A;  4JRF A;  3D5G A;  1FGO A;  2P09 A;  1Q42 A;  2WOH A;  4K1U A;  5RNT A;  1RGG A;  1STD A;  3FGY A;  4FCM A;  3VF1 A;  4WP5 A;  5ELJ A;  3U1W A;  2KF4 A;  1VQP 3;  2XH9 A;  2JDI H;  1RNT A;  3FF2 A;  2KXG A;  1RGC A;  1W5Z A;  3LML A;  2Z77 A;  5IEO A;  3K9M C;  7RNT A;  5IG5 A;  4R9K A;  3UL6 A;  2CG0 A;  3EF8 A;  4J5G A;  2P0M A;  3CU3 A;  3CPW 2;  1Q40 A;  3CCV 3;  4XBX A;  4WFO A;  2KF6 A;  3KII A;  5ELU A;  1YIT 3;  3DGY A;  2CKF B;  2W04 A;  4J8T A;  1RSN A;  1BUQ A;  1A90 A;  3SXX A;  1EQK A;  1VQM 3;  1FUW A;  4LEH A;  1T2I A;  1GOU A;  1B2X A;  1Q86 4;  1FGR A;  1BOX A;  3Q1C A;  1VQ4 3;  3S5C A;  1RDS A;  3DM8 A;  4MMZ B;  1BNI A;  1UUV B;  1U8C B;  5HOH A;  3UL5 A;  1W02 A;  1D6U A;  2BMR B;  4EV2 A;  1OF5 B;  2OTJ 3;  2Z76 A;  4L8P A;  1TJD A;  2W2C A;  3A5E A;  4N6M A;  3CMA 3;  1IV7 A;  1S5A A;  1W4N A;  4EV5 A;  1IYY A;  1YVS A;  1UDI I;  1JKG B;  2FNQ A;  1N9E A;  1R4C A;  3F7X A;  3FG4 A;  2ZHX B;  4AKY A;  2HML B;  2K0M A;  3FLJ A;  3LH4 A;  3LTC A;  3OV4 A;  4GB5 A;  3X3X A;  1RLS A;  5M18 A;  2OCT A;  2W0Q A;  2W9P A;  5JPU A;  1J2B A;  1RRL A;  1OHP A;  2IUJ A;  3T8N A;  5KP1 A;  3DGM A;  3CXC 2;  1N5P A;  1W6C A;  2IUK A;  3V92 A;  4FCJ A;  2F5W A;  2Y74 A;  5FW5 A;  2CC3 A;  3AGO A;  2Y73 A;  3TDG A;  1QJG A;  2UUG C;  1VQK 3;  1WTH A;  3ALA A;  1FZU A;  1I3F A;  4WYK A;  1OCV A;  3GZR A;  2WGO A;  4QWT A;  1BSC A;  4BTX A;  3V98 A;  3MKI A;  2XSH B;  3GZB A;  3QK9 A;  1BSA A;  3CC7 3;  2RCD A;  1M1K 4;  1DVD A;  4GSP A;  1Q9E A;  3S67 A;  1QMA A;  1PFP A;  3MG3 A;  1C7H A;  1EUI C;  1NO3 A;  4XB5 A;  3X42 A;  4X2O A;  2D1W A;  3G6E 3;  1LNH A;  2GEX A;  3IJE B;  4XBT A;  2YX9 A;  1ROA A;  3SOA A;  4CCV A;  5AEU B;  1I70 A;  1TTO A;  2F4Y A;  3MG2 A;  2PZV A;  1NDO B;  3K5T A;  8CHO A;  1IQX A;  1UCL A;  4IT7 A;  1AQZ A;  1O7N B;  3WOE B;  3AHS A;  1BIR A;  1VQ7 3;  1VQL 3;  2CFW A;  1Q40 B;  1ZO2 A;  3NX0 A;  1V57 A;  3FG3 A;  5AIF A;  3BNB A; 
#chains in the Genus database with same CATH homology
 4BIR A;  2GSP A;  1DE3 A;  1FUS A;  1BNR A;  1BRH A;  2F56 A;  1LRA A;  7GSP A;  1FUT A;  2SAR A;  2RNT A;  1GMP A;  1PYL A;  1RMS A;  5BU4 A;  1UCI A;  1G02 A;  3GSP A;  1X1X A;  2C4B A;  6GSP A;  1CH0 A;  1RGF A;  4BU4 A;  2HOH A;  2ZA4 A;  1I0X A;  3D4A A;  3WHO A;  3KCH A;  1BNJ A;  3D5G A;  1I3I A;  9RNT A;  1GOV A;  5RNT A;  1RGG A;  3BIR A;  1JBT A;  2KF4 A;  1GMR A;  5BIR A;  1B2M A;  1RNT A;  1BU4 A;  1GSP A;  2KAA A;  1RGC A;  1YGW A;  1LNI A;  2RBI A;  7RNT A;  3BU4 A;  1BUJ A;  4J5G A;  6RNT A;  1I8V A;  3AGN A;  1B21 A;  2KF6 A;  1C54 A;  1LOW A;  3DGY A;  1DET A;  1BAO A;  1RSN A;  4HAA A;  1HYF A;  1X1U A;  2KF5 A;  1MGR A;  1T2I A;  1RGH A;  1GOU A;  1B2X A;  3RNT A;  3WR2 A;  1RGK A;  1BOX A;  1HZ1 A;  1GOY A;  3D5I A;  1RDS A;  1RNB A;  1BNI A;  1BRG A;  4RNT A;  5HOH A;  1BRK A;  3A5E A;  1B2S A;  1ZGX A;  1JBR A;  1BSE A;  1LOY A;  2BU4 A;  1IYY A;  1RTU A;  1I0V A;  1YVS A;  1I2E A;  3URP A;  3SYU A;  1TRQ A;  1UCK A;  1UCJ A;  1B2U A;  1RCL A;  2AAE A;  1RGL A;  1FYS A;  1B3S A;  1I2F A;  1PY3 A;  1RLS A;  1JBS A;  1BRI A;  1A2P A;  1RHL A;  1SAR A;  1RCK A;  1BRN L;  3DH2 A;  1FW7 A;  2F5W A;  1TRP A;  1B20 A;  1X1Y A;  1YNV X;  3AGO A;  1FZU A;  1BNG A;  1I3F A;  8RNT A;  1BSC A;  2KF3 A;  1B2Z A;  1BSD A;  1BVI A;  1BSA A;  1BNS A;  4J5K A;  1RGA A;  4GHO A;  4GSP A;  4HOH A;  1Q9E A;  1BNF A;  1RN4 A;  1T2H A;  3Q3F A;  1I2G A;  5GSP A;  2F5M A;  1AY7 A;  1BRJ A;  2AAD A;  1I70 A;  1TTO A;  1X1W A;  1R4Y A;  2F4Y A;  3HOH A;  1MGW A;  1UCL A;  1BNE A;  1AQZ A;  1BGS A;  3AHS A;  1BIR A;  1B27 A;  1RN1 A;  3AHW A;  2BIR A;  1BAN A;  1GMQ A;  1LOV A;  1BSB A;  1BRS A;  1RGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...