1Q40A

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
165
Chain Sequence
QDPTQQLEPFLKRFLASLDLLYTQSQPFPNVESYATQLGSNLKRSSAIIVNGQPIIPSPQEDCKLQFQKKWLQTPLSSHQLTSYDGHLIPGTGTFVVHFSAKVRFDQSGRNRLGESADLFQENNQRPIWGSWFGVDVNLVVDENVMQDGEIINSMDYRFTYVPND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
total genus 43
structure length 165
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40A00
4H3UA 2F99A 3EJVA 3GWRA 3KKGA 1VZZA 3NUVA 4N3VA 4STDA 3K7CA 1BUQA 1QJGA 1OGXA 2HMOB 4XB5A 1SJWA 1OGZA 2JQ5A 2Z7AA 4HM2B 3ER7A 2B24B 4XBYA 5D81A 5HGRA 2CKFB 2GBXB 3JUNA 2BNGA 3M8CA 3MG2A 3MHEA 4K1UA 3EF8A 4KVHA 2YFJB 2YFLB 3G0KA 4WYKA 1GS3A 3DM8A 3MSOA 2HMKB 4Q53A 5IERA 5KP3A 3DZLA 3RGAA 5AEWB 4L8OA 5CF1A 1QMAA 4R9KA 5AEUB 6STDA 3OWSA 1E97A 3CNMA 4WP5A 3T8NA 1JB5A 1OF5A 4HZ9B 5JPPA 2BMRB 2OWPA 3GZBA 2BMOB 1JN5B 3HX8A 1DMNA 5CLKA 4OUQA 4OVMA 2XSHB 3LZAA 5EVHA 3B4PA 1U5OA 2RFRA 3IPTA 1E3RA 1HKXA 2XR8B 4HM3B 3RGRA 5TGNA 1C7HA 4R1KA 2F86B 5IG0A 3D9RA 3VGNA 4J8TA 5STDA 1JN5A 3EX9A 5FW5A 1O7NB 2HMLB 3NHXA 4XDVA 4XDWA 1O7GB 1ULJB 1NWWA 4PEJA 4J9AA 3NBRA 2PZVA 5DRVA 4HM0B 4LMIA 3NXJA 4CDLA 5BVBA 3OV4A 4I4KA 4WYKB 1NDOB 5AIHA 3F7SA 5JPUA 3OX9A 5CXOA 1UUVB 3FZWA 1WQLB 3MYTA 3OWYA 3MG3A 3FF2A 1ZX2A 4FCMA 5DREA 4IIAA 1DMMA 3F14A 8CHOA 2RGQA 3NV0A 4XBTA 2XSOB 1OCVA 5D83A 5IG5A 2R4IA 3K0ZA 1OUNA 3BB9A 3EN1B 1TP6A 5AIFA 5IG3A 1ISKA 4X2HA 3EBYA 3ECFA 1GY6A 2A15A 2STDA 4L8PA 5CK6A 2XRXB 1STDA 4HM4B 5KP4A 4U13A 3JUMA 2K54A 3KE7A 2BMQB 3FH1A 1UUWB 2B1XB 1NU3A 1EA2A 3SOAA 1OHSA 3EQQB 3SOYA 5AI1A 5IEPA 3H51A 4MJDA 3LYGA 3NV0B 3VSYA 3A76A 1Q40A 2YFIB 1W02A 3KZTA 4HJLB 1OPYA 2CHCA 2Z76A 3B8LA 4HM5B 1OF5B 2QIYA 4XBXA 3CNXA 4HM1B 5IF6A 3OWUA 3F9SA 2IMJA 3GZXB 1AR0A 4HM6B 1O7HB 2HMJB 4GB5A 5G2GA 3FSDA 1JB2A 2QGUA 1GY7A 1JB4A 3EHCA 3F7XA 4LGQA 5IG4A 3STDA 1GYBA 2Z77A 3F8XA 1GY5A 5BXQA 3Q90A 3EN8A 2W2CA 3GRDA 3I0YA 5IENA 4X2OA 2HMNB 4LEHA 4HZBB 3DUKA 2GBWB 2HMMB 3GZRA 3MG1A 3G16A 3KSPA 4HKVB 4R9LA 7STDA 3GZYB 1OHOA 3F40A 1Q42A 1ULIB 3EC9A 3MKIA 4FCJA 2INXA 5IEOA 5AIIA 3T8UA 3H3HA 4XM4A 3FGYA 3ROBA 1DMQA 4ORLA 1O7WB 3S5CA 3FLJA 4RZMA 3CU3A 1E3VA 2UX0A 3HZPA 3SEDA 1A2KA 4L7KA 1K41A 4HM7B 1TUHA 3CPOA 3JUPA 5AIGA 3F8HA 4HM8B 4HVNA 5D82A 2F98A 1W6YA 1JKGA 3UJMA 2GEXA 3OXAA 1W00A 3WMDA 1O7MB 2GEYA 1ZO2A 2RCDA 1EG9B 1Z1SA 3B7CA 3FKAA 1W01A 5KP1A 4WWUC 3B4OA 1O7PB 1Q40B 1ASKA 3BLZA 1OH0A 2GXFA 2I9WA 3FF0A 3JUOA 3NM2A 1IDPA 1OHPA 1JKGB 1CQSA 3EBTA 3HK4A 3UNLA 3DXOA 3E99A 5CF2A 1S5AA 3G8ZA 4K1VA 3DMCA 3JUQA
chains in the Genus database with same CATH superfamily
2F99A 3EJVA 2P38A 1VQO3 2OTL3 2F4YA 1EUIC 1DETA 3MWZA 5RNTA 1G02A 1OGXA 1YHQ3 4XB5A 1SJWA 1M1XB 3MPHA 5D81A 3WDGB 2GBXB 3M8CA 1RGLA 2C4BA 4QWTA 2L1SA 4MMYB 2CW9A 1IQ8A 2XGNA 3MSOA 5IERA 2LYXA 2RBIA 1BRKA 4L8OA 3LT9A 2CG1A 1ROAA 4IPBA 1GD4A 1MWRA 2FGTA 3QK9A 3UB1A 1QAKA 4ILFA 1FGQA 4HZ9B 3DGOA 1W5ZA 2BMOB 3HX8A 1KWIA 3BNDA 3KFQC 4N6OB 4OVMA 5EEOA 2F5MA 2FNQA 3X40A 2O9UX 4HBRA 2KF4A 3RGRA 4JF8A 2F86B 1YIT3 1A2VA 5FW5A 1O7NB 6RNTA 1CYVA 1NWWA 2E2VA 1RRHA 4MMZB 1BNGA 4CDLA 5BVBA 3NXJA 1VQ53 1BSDA 4WYKB 1I8VA 1UGIA 4N6UA 5AYSC 3WOEB 1Q9EA 3OX9A 2KRTA 4DKIA 3NM7A 4FCMA 6STDA 5JBSA 1FA3A 1FUWA 4N6TA 3F14A 3D5GA 2C11A 1D6UA 3LTDA 2XSOB 4FCZA 4XBTA 1BANA 1FUTA 1IK3A 5AIFA 1JRQA 1K734 3PYJA 2Z6BA 3LXUX 2XRXB 4EBGA 4O8SA 4MMXB 4U13A 1UCJA 1M1K4 3X41A 3SOAA 1DVDA 1B20A 3SOYA 5IEPA 4MJDA 2OQEC 3NV0B 1JBTA 3VSYA 1Q40A 2K3DA 2YFIB 3WOFB 1W02A 2KF6A 4HJLB 2PNCA 1OPYA 2KXGA 1UCIA 3B8LA 3WODG 1Q7Y4 1JNQA 1RCLA 1OF5B 2RSXA 3KSED 3CC73 1J2BA 5IF6A 3OWUA 1RKYA 3F9SA 1I70A 1TFOA 2HMJB 1T2HA 5G2GA 3SYUA 1JB2A 1SIIA 3F7XA 1EQKA 2XF3A 4LGQA 1CH0A 3F8XA 3X3YA 1DVCA 4EV2A 1CYUA 3EN8A 2W2CA 1BSAA 1BNIA 1QVG2 2HMNB 3DUKA 3CC43 2ML5A 5M18A 3MKIA 1ULIB 5M1AA 1RN1A 3CPW2 3SXXA 2SARA 1FUSA 3UL6A 3FGYA 4CPKA 2CX0A 1DE3A 1UI8A 1LQGC 5BU4A 3LTBA 4KFEA 3QRDA 3RDEA 4MEIA 2W04A 3CPOA 3JUPA 1W7CA 1UDII 3F8HA 4HVNA 1BUJA 2F98A 2C10A 1O7MB 2GEYA 1ZO2A 2RCDA 1QAFA 1ZS7A 3B7CA 2XH9A 3Q1CA 8RNTA 3OXAA 3BLZA 4J8TA 7GSPA 3I553 3PZWA 1CQSA 1U8CB 1YJN3 4AKYA 1BNSA 4H3UA 3KKGA 3DGNA 4FMAA 3NBJA 3PXMA 1MGWA 3K7CA 1IV7A 1WNHA 2JQ5A 2Z7AA 2B24B 3FG4A 5GSPA 1B2XA 1RJOA 5AYRB 2BNGA 1HYFA 1IYYA 2YFJB 1K9M4 2YFLB 2XFTA 2MC8A 5KP3A 5AEWB 2CC3A 3NQYA 1S723 3CD63 3WA3A 1KSIA 3OWSA 3ZG5A 4LYLB 1E97A 3CNMA 1RGHA 3DGMA 1WTHA 1JB5A 2BT3A 5BIRA 2BMRB 3GZBA 3AHWA 3HIGA 3UL5A 1QALA 4K90B 1NB3I 1B2SA 5EVHA 1VQM3 4NREA 1B21A 3LMLA 1U5OA 1Q864 1A90A 2XR8B 3PS8A 1IV9A 3GSPA 4R80A 9RNTA 2XFSA 3CCR3 2D42A 5HOHA 2QEX3 3VGNA 1JN5A 5IW9A 2HMLB 3J7Yd 4XDVA 1T5YA 1ULJB 1GOYA 3NBRA 5DRVA 4LMIA 4BTWA 1D6ZA 1N9JA 1B2MA 1BVIA 3F7SA 5CXOA 1AV4A 1LNHA 3FCSB 1RMSA 1RTUA 3OWYA 1YJ93 4CCVA 3BNCA 4IIAA 2F56A 2W6JH 8CHOA 1YIJ3 1SQWA 2CK3H 2H0HA 1LNIA 1LOWA 1DYUA 1PYLA 1UI7A 3K9MC 2R4IA 4N6MA 4ZM8A 5IG5A 1PU4A 1TP6A 2CWUA 3AHSA 3DH2A 3S28A 1Q7HA 3EBYA 4GL6A 1GY6A 2UGIA 4L8PA 4TX4A 1F8NA 4HM4B 1STDA 1K28A 2K54A 3KE7A 1RN4A 2CIUA 2BMQB 2LQVA 4RNTA 3URPA 1I2FA 4FR9A 2P0MA 3CCS3 3VF1A 3S67A 1OHSA 4NPBA 1IQXA 3EQQB 2Y74A 1UCLA 4OK0A 2IY2A 2E2TA 3KZTA 2Z76A 1I2EA 1UW1A 2QIYA 3CNXA 4HM1B 1MGRA 3LTCA 1A2PA 1MNLA 3GZXB 3CCJ3 1AR0A 4HM6B 1VQP3 1SPUA 1VQ73 2P0XA 5IG4A 1JB4A 1EEJA 4WHAA 3D5IA 1LXEA 1GY5A 1MWTA 3O8YA 3WHOA 1V57A 2OQEA 1ZGXA 5IENA 3LT8A 2WGOA 4X2OA 1JV2B 1W2B2 1VQQA 1BNJA 4HZBB 1GOVA 3GZRA 1N9EA 3SX1A 1BRJA 4EV5A 1WMOA 2H0IA 1YVSA 2W9PA 3HI7A 3Q3FA 2CH9A 7RNTA 1YGWA 1DMQA 4ORLA 1JBSA 5G1KA 4EXRA 3S5CA 4RZMA 3CU3A 3HZPA 2UX0A 2YX9A 1NNVA 1A2KA 3X3XA 2W03A 1V58A 4NHFA 1MWSA 1W00A 1TJDA 3LH4A 1EG9B 1Z1SA 2CFDA 3FKAA 1W01A 5KP1A 2H0GA 1CEWI 3B4OA 1B2UA 1NO3A 2P09A 3V99A 3AGNA 1TFKA 1RGAA 5LC7A 3EBTA 1BNFA 1JKGB 1BSEA 3UNLA 4EW5A 2JDIH 3DXOA 1BU4A 1A67A 1W6GA 1S5AA 1LOXA 2KF5A 4J5GA 2IA7A 3DMCA 4WYKA 3GWRA 1VZZA 1BRNL 5FGOA 4STDA 1QJGA 2UUGC 3PGBA 4HAAA 4HM2B 4RNYA 4XBYA 1YJW3 2F5WA 1GSPA 3N54B 3CCE3 4KFDA 3JUNA 3MG2A 4KVHA 1GMRA 5A0OB 1RSNA 3PCSA 1VQL3 1KD14 3DM8A 1STFI 5EQLA 2SBLA 4K61A 3X42A 1M904 3DZLA 1Q814 4IT7A 3A5EA 5CF1A 5AEUB 3G713 1RGGA 1TRQA 2O3OA 3T8NA 1JZDA 1OF5A 2OWPA 1JN5B 1RGEA 1RHLA 1LOVA 4OUQA 4BIRA 4N6V0 2WO0A 1TTOA 3ZG0A 2RFRA 4N6LA 4RNZA 3CXC2 1E3RA 1HKXA 1N5HA 1KC84 1OACA 1SARA 1C7HA 2CX1A 3LOYA 5TGNA 3S29A 3NHXA 2OTJ3 1O7GB 4PEJA 4J9AA 2KCDA 2PZVA 1B27A 2CFKA 4HM0B 1GMQA 2GSPA 3EB8A 5JPUA 1K8A4 2GU1A 1BOXA 1I3IA 3NQZA 1D6YA 3FF2A 1I2GA 4WFOA 1JBRA 3LTAA 2WOHA 3K0ZA 1OUNA 3EN1B 1BNRA 4FMCA 4X2HA 4CJNA 4BL2A 3CME3 1BAOA 2STDA 4GHOA 3I563 1EKMA 3JUMA 1Y4KA 3FH1A 2B1XB 4I5QA 1IVUA 2CG0A 1YGEA 1AQZA 2IYJA 1R4CA 3G6E3 1SIHA 5AI1A 3LYGA 3S27A 4JRFA 1IT7A 2D1WA 3JVCA 3V98A 3G4S3 3GAXA 3DY5A 1LVNA 3NBBA 1BIRA 1I3FA 1FZUA 1O7HB 1BSCA 4N6NB 1GD3A 3FSDA 2QGUA 1RGKA 1IVWA 4LZIA 3STDA 2Z77A 3BNEA 5BXQA 3Q90A 3GRDA 4RBNA 3I0YA 2W56A 1AY7A 1TRPA 2RNTA 2KAAA 1VQ63 1VQ43 4LEHA 3MG1A 3CC23 5I97A 3G16A 3KSPA 1FW7A 2R41A 4H61A 6GSPA 1OHOA 3F40A 4FMBA 4O2HA 3EC9A 2INXA 1N5PA 3L0RA 3HOHA 1T3BA 2J8XB 3KN4A 3PCRA 3NX0A 3TDGA 1W6CA 1O7WB 4LSOA 3U1WA 3T0UA 3D79A 1L5GB 1Q824 3FLJA 1E3VA 3SEDA 4L7KA 2KF3A 2OCTA 1X1WA 2W9QA 1BRIA 4HM7B 2Q07A 5AIGA 5D82A 4HM8B 1JKGA 2XGLA 2GEXA 2ZL8A 3WMDA 1T2IA 2BHMA 1C54A 2ML6A 2Y73A 1ISKA 5ELJA 3HIIA 1Q40B 1ASKA 1ROVA 1OH0A 4HKVB 3NM2A 3WR2A 3IJEB 1BGSA 1RNBA 1IQYA 1YI23 3G8ZA 1IU7A 1IT8A 1GMPA 1N8R4 1YVBI 1AVKA 3NUVA 4N3VA 1R4YA 4HOHA 1FYSA 2OOVA 1BUQA 2HMOB 4BL3A 1X1UA 1VQ83 3BIRA 1OGZA 1HU9A 3ER7A 2K0MA 3CCQ3 5HGRA 1YNVX 3AMOB 1VQ93 2CKFB 3MHEA 1BRGA 4K1UA 2W0QA 3EF8A 1VQK3 4EC6A 1I0VA 3G0KA 1GS3A 2HMKB 4Q53A 3SLUA 1LRAA 3RGAA 3K5TA 1QMAA 4R9KA 2ZHXB 3N9HA 3BNBA 4WP5A 2CFWA 2E2UA 4AEQA 5LC6A 5JPPA 1AVLA 1DMNA 5CLKA 2XSHB 3LZAA 2FXTA 1RDSA 3B4PA 3BU4A 1IVXA 3IPTA 1TU5A 3K63A 4HM3B 1FGOA 3FG1A 4HYZA 4R1KA 3CMA3 5IG0A 2L4VA 3D9RA 5STDA 3EX9A 3D4AA 1GOUA 1FGMA 4XDWA 1HZ1A 2AADA 3RNTA 2MF7A 4R4KA 2V1LA 1V74A 2BIRA 3KIIA 3OV4A 4I4KA 1NDOB 5AIHA 1LQMB 1UUVB 3FZWA 1WQLB 3MYTA 5DREA 3MG3A 3X3ZA 1ZX2A 2WGQA 3CCL3 1PFPA 1DMMA 2RGQA 3FG3A 3CCM3 1OCVA 3AMOA 3IMAB 5D83A 3U97A 1VQN3 2AAEA 3BB9A 1RGCA 5IG3A 2IUJA 3ECFA 2A15A 1UGHI 5CK6A 1B2ZA 1RNTA 1MOLA 1UUWB 1NU3A 4J5KA 1BRHA 3Q2PA 1EA2A 1FGTA 1KQS2 2ZA4A 1WMPA 3H51A 2BO9B 4BU4A 4O3VA 1RLSA 3A76A 2HOHA 1BNEA 3V92A 1FGRA 1PY3A 2IUKA 1IVVA 2CHCA 1I0XA 1US1A 2M7OA 2XEPA 4HM5B 1MWUA 1W4NA 4XBXA 1G96A 2QA43 2GU3A 1UCKA 3SVAA 1NB5I 2IMJA 1QVF2 2W56B 1BSBA 4GB5A 4KT3B 4BTXA 3EHCA 1GY7A 1TIJA 4AKZA 1JJ22 1GYBA 3DGYA 3ZFZA 2CFGA 2CWTA 1UUGB 3CCU3 2BU4A 2OOVC 5G1LA 4G1MB 3OW22 1BRSA 3CCV3 2CFLA 4FMDA 1RRLA 1RN7A 4BTYA 1B3SA 2GBWB 2HMMB 1M9GA 1X1XA 3ALAA 4R9LA 4EYCA 7STDA 4KZ1A 1RGFA 3GZYB 4FCJA 1Q42A 4GSPA 5IEOA 5AIIA 3T8UA 3H3HA 4XM4A 1JZOA 2P05A 3ROBA 3AGOA 5M19A 2CWVA 3WA2X 1K41A 1TUHA 1W2ZA 3N8BA 3D3LA 1W6YA 3UJMA 1RCKA 3KCHA 4WWUC 1G0TA 3EE1A 4KFFA 3DGLA 5ELUA 1O7PB 3JUOA 3FF0A 2GXFA 3NV0A 2I9WA 4O02B 5KP4A 1IDPA 1OHPA 1X1YA 2WOFA 2ZDJA 3HK4A 5CF2A 3E99A 1NJI4 1WMNA 1LOYA 4K1VA 1N8QA 3JUQA
chains in the Genus database with same CATH topology
2F99A 3EJVA 2P38A 1VQO3 2OTL3 3MWZA 1OGXA 1YHQ3 4XB5A 1SJWA 1M1XB 3MPHA 5D81A 3WDGB 2GBXB 3M8CA 4QWTA 4MMYB 2CW9A 1IQ8A 2XGNA 3MSOA 5IERA 2LYXA 4L8OA 3LT9A 2CG1A 1ROAA 4IPBA 1GD4A 2FGTA 3QK9A 3UB1A 1QAKA 1FGQA 4HZ9B 3DGOA 1W5ZA 2BMOB 3HX8A 1KWIA 3BNDA 3KFQC 4N6OB 4OVMA 5EEOA 2FNQA 3X40A 2O9UX 4HBRA 3RGRA 4JF8A 2F86B 1YIT3 1A2VA 5FW5A 1O7NB 1CYVA 1NWWA 2E2VA 1RRHA 4MMZB 4CDLA 5BVBA 3NXJA 1VQ53 4WYKB 4N6UA 3WOEB 5AYSC 5JBSA 3OX9A 2KRTA 3NM7A 4FCMA 6STDA 1FA3A 1FUWA 4N6TA 3F14A 3LTDA 2C11A 1D6UA 4FCZA 2XSOB 4XBTA 1IK3A 5AIFA 1JRQA 1K734 3PYJA 2Z6BA 3LXUX 2XRXB 4EBGA 4O8SA 4MMXB 4U13A 1M1K4 3X41A 3SOAA 1DVDA 3SOYA 5IEPA 4MJDA 2OQEC 3NV0B 3VSYA 1Q40A 2YFIB 3WOFB 1W02A 4HJLB 2PNCA 1OPYA 2KXGA 3B8LA 3WODG 1Q7Y4 1J2BA 1JNQA 1OF5B 2RSXA 3KSED 3CC73 5IF6A 3OWUA 1RKYA 3F9SA 1TFOA 2HMJB 5G2GA 1JB2A 1SIIA 3F7XA 1EQKA 2XF3A 4LGQA 3F8XA 3X3YA 1DVCA 4EV2A 1CYUA 3EN8A 2W2CA 1QVG2 2HMNB 3DUKA 3CC43 2ML5A 3MKIA 1ULIB 3CPW2 3SXXA 3UL6A 3FGYA 1UI8A 3LTBA 4KFEA 3QRDA 3RDEA 4MEIA 2W04A 3CPOA 3JUPA 1W7CA 3F8HA 4HVNA 2F98A 2C10A 1O7MB 2GEYA 1ZO2A 2RCDA 1QAFA 3B7CA 2XH9A 3Q1CA 3OXAA 3BLZA 4J8TA 3I553 3PZWA 1CQSA 1U8CB 1YJN3 4AKYA 4H3UA 3KKGA 3DGNA 4FMAA 3NBJA 3PXMA 3K7CA 1IV7A 1WNHA 2JQ5A 2Z7AA 2B24B 3FG4A 5AYRB 1RJOA 2BNGA 2YFJB 1K9M4 2YFLB 2XFTA 2MC8A 5KP3A 5AEWB 2CC3A 3NQYA 1S723 3CD63 3WA3A 1KSIA 3OWSA 3DGMA 1E97A 3CNMA 1WTHA 1JB5A 2BT3A 2BMRB 3GZBA 3HIGA 3UL5A 1QALA 4K90B 1NB3I 5EVHA 1VQM3 4NREA 3LMLA 1U5OA 1Q864 1A90A 2XR8B 3PS8A 1IV9A 4R80A 3CCR3 2XFSA 2D42A 2QEX3 3VGNA 1JN5A 5IW9A 2HMLB 3J7Yd 4XDVA 1T5YA 1ULJB 3NBRA 5DRVA 4LMIA 4BTWA 1D6ZA 1N9JA 3F7SA 5CXOA 1AV4A 1LNHA 3FCSB 3OWYA 1YJ93 4CCVA 3BNCA 4IIAA 2W6JH 8CHOA 1YIJ3 1SQWA 2CK3H 4ZM8A 1UI7A 1DYUA 4N6MA 3K9MC 5IG5A 2R4IA 1PU4A 1TP6A 2CWUA 1ISKA 3S28A 3EBYA 4GL6A 4TX4A 1GY6A 4L8PA 1F8NA 4HM4B 1STDA 1K28A 2K54A 3KE7A 2BMQB 2CIUA 2LQVA 4FR9A 2P0MA 3CCS3 3VF1A 3S67A 1OHSA 1IQXA 3EQQB 2Y74A 4OK0A 2E2TA 3KZTA 2Z76A 1UW1A 2QIYA 3CNXA 4HM1B 3LTCA 3GZXB 1MNLA 3CCJ3 1AR0A 4HM6B 1VQP3 1SPUA 1VQ73 2P0XA 5IG4A 1JB4A 4WHAA 1LXEA 1GY5A 3O8YA 2OQEA 5IENA 3LT8A 2WGOA 4X2OA 1JV2B 1W2B2 4HZBB 3GZRA 1N9EA 3SX1A 4EV5A 1WMOA 3HI7A 2W9PA 2CH9A 1DMQA 4ORLA 4EXRA 3S5CA 4RZMA 3CU3A 3HZPA 2UX0A 2YX9A 1A2KA 3X3XA 2W03A 4NHFA 1W00A 3LH4A 1EG9B 1Z1SA 2CFDA 3FKAA 1W01A 5KP1A 1CEWI 3B4OA 1NO3A 2P09A 3V99A 1TFKA 5LC7A 3EBTA 3UNLA 1JKGB 2JDIH 3DXOA 1A67A 1W6GA 1S5AA 1LOXA 4WYKA 3DMCA 2IA7A 3GWRA 1VZZA 5FGOA 4STDA 1QJGA 3PGBA 4HM2B 4RNYA 4XBYA 1YJW3 3N54B 3CCE3 4KFDA 3JUNA 3MG2A 4KVHA 5A0OB 3PCSA 1VQL3 1KD14 3DM8A 1STFI 5EQLA 2SBLA 4K61A 3X42A 1M904 3DZLA 1Q814 4IT7A 5CF1A 5AEUB 3G713 2O3OA 3T8NA 1OF5A 2OWPA 1JN5B 4OUQA 4N6V0 2WO0A 2RFRA 4N6LA 4RNZA 3CXC2 1E3RA 1HKXA 1N5HA 1KC84 1OACA 3LOYA 1C7HA 5TGNA 3S29A 3NHXA 2OTJ3 1O7GB 4PEJA 4J9AA 2KCDA 2PZVA 4HM0B 2CFKA 3EB8A 5JPUA 1K8A4 2GU1A 3NQZA 1D6YA 3FF2A 4WFOA 3LTAA 2WOHA 3K0ZA 1OUNA 3EN1B 4FMCA 4X2HA 3CME3 2STDA 3I563 1EKMA 3JUMA 1Y4KA 3FH1A 2B1XB 1IVUA 2CG0A 1YGEA 1R4CA 3G6E3 1SIHA 5AI1A 3LYGA 3S27A 4JRFA 1IT7A 2D1WA 3JVCA 3V98A 3GAXA 3DY5A 1LVNA 3NBBA 1O7HB 4N6NB 1GD3A 3FSDA 2QGUA 1IVWA 4LZIA 3STDA 2Z77A 3BNEA 5BXQA 3Q90A 3GRDA 4RBNA 3I0YA 2W56A 1VQ63 1VQ43 4LEHA 3MG1A 3CC23 5I97A 3G16A 3KSPA 4H61A 1OHOA 3F40A 4FMBA 4O2HA 3EC9A 2INXA 1N5PA 3L0RA 3KN4A 3PCRA 3NX0A 3TDGA 1W6CA 1O7WB 4LSOA 3U1WA 3T0UA 1L5GB 1Q824 3FLJA 1E3VA 3SEDA 4L7KA 2OCTA 2W9QA 4HM7B 2Q07A 5AIGA 5D82A 4HM8B 1JKGA 2XGLA 2GEXA 2ZL8A 3WMDA 2BHMA 2ML6A 2Y73A 5ELJA 3HIIA 1Q40B 1ASKA 1ROVA 1OH0A 4HKVB 3NM2A 3IJEB 1IQYA 1YI23 3G8ZA 1IU7A 1IT8A 1N8R4 1YVBI 1AVKA 3NUVA 4N3VA 2OOVA 1BUQA 2HMOB 1VQ83 1OGZA 1HU9A 3ER7A 2K0MA 3CCQ3 5HGRA 3AMOB 1VQ93 2CKFB 3MHEA 4K1UA 2W0QA 3EF8A 1VQK3 4EC6A 3G0KA 1GS3A 2HMKB 4Q53A 3SLUA 3RGAA 3K5TA 1QMAA 4R9KA 3N9HA 3BNBA 4WP5A 2CFWA 2E2UA 4AEQA 5LC6A 5JPPA 1AVLA 1DMNA 5CLKA 2XSHB 3LZAA 2FXTA 3B4PA 1IVXA 3IPTA 1TU5A 3K63A 4HM3B 1FGOA 3FG1A 4HYZA 4R1KA 3CMA3 5IG0A 2L4VA 3D9RA 5STDA 3EX9A 1FGMA 4XDWA 2MF7A 4R4KA 2V1LA 1V74A 3KIIA 3OV4A 4I4KA 1NDOB 5AIHA 1UUVB 3FZWA 1WQLB 3MYTA 5DREA 3MG3A 3X3ZA 1ZX2A 2WGQA 3CCL3 1PFPA 1DMMA 2RGQA 3FG3A 3CCM3 1OCVA 3AMOA 3IMAB 5D83A 3U97A 1VQN3 3BB9A 5IG3A 2IUJA 3ECFA 2A15A 5CK6A 1MOLA 1UUWB 1NU3A 3Q2PA 1EA2A 1FGTA 1KQS2 1WMPA 3H51A 2BO9B 4O3VA 3A76A 3V92A 1FGRA 2M7OA 2IUKA 1IVVA 2CHCA 1US1A 2XEPA 4HM5B 1W4NA 4XBXA 1G96A 2QA43 2GU3A 3SVAA 1NB5I 1QVF2 2IMJA 2W56B 4GB5A 4BTXA 3EHCA 1GY7A 1TIJA 4AKZA 1JJ22 1GYBA 2CFGA 2CWTA 3CCU3 2OOVC 4G1MB 3OW22 3CCV3 2CFLA 4FMDA 1RRLA 1RN7A 4BTYA 2GBWB 2HMMB 1M9GA 3ALAA 4R9LA 4EYCA 7STDA 4KZ1A 3GZYB 4FCJA 5IEOA 1Q42A 5AIIA 3T8UA 3H3HA 4XM4A 2P05A 3ROBA 2CWVA 3WA2X 1K41A 1TUHA 1W2ZA 3N8BA 3D3LA 1W6YA 3UJMA 4WWUC 3EE1A 4KFFA 3DGLA 5ELUA 1O7PB 3JUOA 3FF0A 2GXFA 3NV0A 2I9WA 4O02B 5KP4A 1IDPA 1OHPA 2WOFA 3HK4A 2ZDJA 5CF2A 3E99A 1NJI4 1WMNA 3G4S3 4K1VA 1N8QA 3JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H3U A;  2F99 A;  3EJV A;  3GWR A;  3KKG A;  1VZZ A;  3NUV A;  4N3V A;  4STD A;  3K7C A;  1BUQ A;  1QJG A;  1OGX A;  2HMO B;  4XB5 A;  1SJW A;  1OGZ A;  2JQ5 A;  2Z7A A;  4HM2 B;  3ER7 A;  2B24 B;  4XBY A;  5D81 A;  5HGR A;  2CKF B;  2GBX B;  3JUN A;  2BNG A;  3M8C A;  3MG2 A;  3MHE A;  4K1U A;  3EF8 A;  4KVH A;  2YFJ B;  2YFL B;  3G0K A;  4WYK A;  1GS3 A;  3DM8 A;  3MSO A;  2HMK B;  4Q53 A;  5IER A;  5KP3 A;  3DZL A;  3RGA A;  5AEW B;  4L8O A;  5CF1 A;  1QMA A;  4R9K A;  5AEU B;  6STD A;  3OWS A;  1E97 A;  3CNM A;  4WP5 A;  3T8N A;  1JB5 A;  1OF5 A;  4HZ9 B;  5JPP A;  2BMR B;  2OWP A;  3GZB A;  2BMO B;  1JN5 B;  3HX8 A;  1DMN A;  5CLK A;  4OUQ A;  4OVM A;  2XSH B;  3LZA A;  5EVH A;  3B4P A;  1U5O A;  2RFR A;  3IPT A;  1E3R A;  1HKX A;  2XR8 B;  4HM3 B;  3RGR A;  5TGN A;  1C7H A;  4R1K A;  2F86 B;  5IG0 A;  3D9R A;  3VGN A;  4J8T A;  5STD A;  1JN5 A;  3EX9 A;  5FW5 A;  1O7N B;  2HML B;  3NHX A;  4XDV A;  4XDW A;  1O7G B;  1ULJ B;  1NWW A;  4PEJ A;  4J9A A;  3NBR A;  2PZV A;  5DRV A;  4HM0 B;  4LMI A;  3NXJ A;  4CDL A;  5BVB A;  3OV4 A;  4I4K A;  4WYK B;  1NDO B;  5AIH A;  3F7S A;  5JPU A;  3OX9 A;  5CXO A;  1UUV B;  3FZW A;  1WQL B;  3MYT A;  3OWY A;  3MG3 A;  3FF2 A;  1ZX2 A;  4FCM A;  5DRE A;  4IIA A;  1DMM A;  3F14 A;  8CHO A;  2RGQ A;  3NV0 A;  4XBT A;  2XSO B;  1OCV A;  5D83 A;  5IG5 A;  2R4I A;  3K0Z A;  1OUN A;  3BB9 A;  3EN1 B;  1TP6 A;  5AIF A;  5IG3 A;  1ISK A;  4X2H A;  3EBY A;  3ECF A;  1GY6 A;  2A15 A;  2STD A;  4L8P A;  5CK6 A;  2XRX B;  1STD A;  4HM4 B;  5KP4 A;  4U13 A;  3JUM A;  2K54 A;  3KE7 A;  2BMQ B;  3FH1 A;  1UUW B;  2B1X B;  1NU3 A;  1EA2 A;  3SOA A;  1OHS A;  3EQQ B;  3SOY A;  5AI1 A;  5IEP A;  3H51 A;  4MJD A;  3LYG A;  3NV0 B;  3VSY A;  3A76 A;  1Q40 A;  2YFI B;  1W02 A;  3KZT A;  4HJL B;  1OPY A;  2CHC A;  2Z76 A;  3B8L A;  4HM5 B;  1OF5 B;  2QIY A;  4XBX A;  3CNX A;  4HM1 B;  5IF6 A;  3OWU A;  3F9S A;  2IMJ A;  3GZX B;  1AR0 A;  4HM6 B;  1O7H B;  2HMJ B;  4GB5 A;  5G2G A;  3FSD A;  1JB2 A;  2QGU A;  1GY7 A;  1JB4 A;  3EHC A;  3F7X A;  4LGQ A;  5IG4 A;  3STD A;  1GYB A;  2Z77 A;  3F8X A;  1GY5 A;  5BXQ A;  3Q90 A;  3EN8 A;  2W2C A;  3GRD A;  3I0Y A;  5IEN A;  4X2O A;  2HMN B;  4LEH A;  4HZB B;  3DUK A;  2GBW B;  2HMM B;  3GZR A;  3MG1 A;  3G16 A;  3KSP A;  4HKV B;  4R9L A;  7STD A;  3GZY B;  1OHO A;  3F40 A;  1Q42 A;  1ULI B;  3EC9 A;  3MKI A;  4FCJ A;  2INX A;  5IEO A;  5AII A;  3T8U A;  3H3H A;  4XM4 A;  3FGY A;  3ROB A;  1DMQ A;  4ORL A;  1O7W B;  3S5C A;  3FLJ A;  4RZM A;  3CU3 A;  1E3V A;  2UX0 A;  3HZP A;  3SED A;  1A2K A;  4L7K A;  1K41 A;  4HM7 B;  1TUH A;  3CPO A;  3JUP A;  5AIG A;  3F8H A;  4HM8 B;  4HVN A;  5D82 A;  2F98 A;  1W6Y A;  1JKG A;  3UJM A;  2GEX A;  3OXA A;  1W00 A;  3WMD A;  1O7M B;  2GEY A;  1ZO2 A;  2RCD A;  1EG9 B;  1Z1S A;  3B7C A;  3FKA A;  1W01 A;  5KP1 A;  4WWU C;  3B4O A;  1O7P B;  1Q40 B;  1ASK A;  3BLZ A;  1OH0 A;  2GXF A;  2I9W A;  3FF0 A;  3JUO A;  3NM2 A;  1IDP A;  1OHP A;  1JKG B;  1CQS A;  3EBT A;  3HK4 A;  3UNL A;  3DXO A;  3E99 A;  5CF2 A;  1S5A A;  3G8Z A;  4K1V A;  3DMC A;  3JUQ A; 
#chains in the Genus database with same CATH topology
 2F99 A;  3EJV A;  2P38 A;  1VQO 3;  2OTL 3;  2F4Y A;  1EUI C;  1DET A;  3MWZ A;  5RNT A;  1G02 A;  1OGX A;  1YHQ 3;  4XB5 A;  1SJW A;  1M1X B;  3MPH A;  5D81 A;  3WDG B;  2GBX B;  3M8C A;  1RGL A;  2C4B A;  4QWT A;  2L1S A;  4MMY B;  2CW9 A;  1IQ8 A;  2XGN A;  3MSO A;  5IER A;  2LYX A;  2RBI A;  1BRK A;  4L8O A;  3LT9 A;  2CG1 A;  1ROA A;  4IPB A;  1GD4 A;  1MWR A;  2FGT A;  3QK9 A;  3UB1 A;  1QAK A;  4ILF A;  1FGQ A;  4HZ9 B;  3DGO A;  1W5Z A;  2BMO B;  3HX8 A;  1KWI A;  3BND A;  3KFQ C;  4N6O B;  4OVM A;  5EEO A;  2F5M A;  2FNQ A;  3X40 A;  2O9U X;  4HBR A;  2KF4 A;  3RGR A;  4JF8 A;  2F86 B;  1YIT 3;  1A2V A;  5FW5 A;  1O7N B;  6RNT A;  1CYV A;  1NWW A;  2E2V A;  1RRH A;  4MMZ B;  1BNG A;  4CDL A;  5BVB A;  3NXJ A;  1VQ5 3;  1BSD A;  4WYK B;  1I8V A;  1UGI A;  4N6U A;  5AYS C;  3WOE B;  1Q9E A;  3OX9 A;  2KRT A;  4DKI A;  3NM7 A;  4FCM A;  6STD A;  5JBS A;  1FA3 A;  1FUW A;  4N6T A;  3F14 A;  3D5G A;  2C11 A;  1D6U A;  3LTD A;  2XSO B;  4FCZ A;  4XBT A;  1BAN A;  1FUT A;  1IK3 A;  5AIF A;  1JRQ A;  1K73 4;  3PYJ A;  2Z6B A;  3LXU X;  2XRX B;  4EBG A;  4O8S A;  4MMX B;  4U13 A;  1UCJ A;  1M1K 4;  3X41 A;  3SOA A;  1DVD A;  1B20 A;  3SOY A;  5IEP A;  4MJD A;  2OQE C;  3NV0 B;  1JBT A;  3VSY A;  1Q40 A;  2K3D A;  2YFI B;  3WOF B;  1W02 A;  2KF6 A;  4HJL B;  2PNC A;  1OPY A;  2KXG A;  1UCI A;  3B8L A;  3WOD G;  1Q7Y 4;  1JNQ A;  1RCL A;  1OF5 B;  2RSX A;  3KSE D;  3CC7 3;  1J2B A;  5IF6 A;  3OWU A;  1RKY A;  3F9S A;  1I70 A;  1TFO A;  2HMJ B;  1T2H A;  5G2G A;  3SYU A;  1JB2 A;  1SII A;  3F7X A;  1EQK A;  2XF3 A;  4LGQ A;  1CH0 A;  3F8X A;  3X3Y A;  1DVC A;  4EV2 A;  1CYU A;  3EN8 A;  2W2C A;  1BSA A;  1BNI A;  1QVG 2;  2HMN B;  3DUK A;  3CC4 3;  2ML5 A;  5M18 A;  3MKI A;  1ULI B;  5M1A A;  1RN1 A;  3CPW 2;  3SXX A;  2SAR A;  1FUS A;  3UL6 A;  3FGY A;  4CPK A;  2CX0 A;  1DE3 A;  1UI8 A;  1LQG C;  5BU4 A;  3LTB A;  4KFE A;  3QRD A;  3RDE A;  4MEI A;  2W04 A;  3CPO A;  3JUP A;  1W7C A;  1UDI I;  3F8H A;  4HVN A;  1BUJ A;  2F98 A;  2C10 A;  1O7M B;  2GEY A;  1ZO2 A;  2RCD A;  1QAF A;  1ZS7 A;  3B7C A;  2XH9 A;  3Q1C A;  8RNT A;  3OXA A;  3BLZ A;  4J8T A;  7GSP A;  3I55 3;  3PZW A;  1CQS A;  1U8C B;  1YJN 3;  4AKY A;  1BNS A;  4H3U A;  3KKG A;  3DGN A;  4FMA A;  3NBJ A;  3PXM A;  1MGW A;  3K7C A;  1IV7 A;  1WNH A;  2JQ5 A;  2Z7A A;  2B24 B;  3FG4 A;  5GSP A;  1B2X A;  1RJO A;  5AYR B;  2BNG A;  1HYF A;  1IYY A;  2YFJ B;  1K9M 4;  2YFL B;  2XFT A;  2MC8 A;  5KP3 A;  5AEW B;  2CC3 A;  3NQY A;  1S72 3;  3CD6 3;  3WA3 A;  1KSI A;  3OWS A;  3ZG5 A;  4LYL B;  1E97 A;  3CNM A;  1RGH A;  3DGM A;  1WTH A;  1JB5 A;  2BT3 A;  5BIR A;  2BMR B;  3GZB A;  3AHW A;  3HIG A;  3UL5 A;  1QAL A;  4K90 B;  1NB3 I;  1B2S A;  5EVH A;  1VQM 3;  4NRE A;  1B21 A;  3LML A;  1U5O A;  1Q86 4;  1A90 A;  2XR8 B;  3PS8 A;  1IV9 A;  3GSP A;  4R80 A;  9RNT A;  2XFS A;  3CCR 3;  2D42 A;  5HOH A;  2QEX 3;  3VGN A;  1JN5 A;  5IW9 A;  2HML B;  3J7Y d;  4XDV A;  1T5Y A;  1ULJ B;  1GOY A;  3NBR A;  5DRV A;  4LMI A;  4BTW A;  1D6Z A;  1N9J A;  1B2M A;  1BVI A;  3F7S A;  5CXO A;  1AV4 A;  1LNH A;  3FCS B;  1RMS A;  1RTU A;  3OWY A;  1YJ9 3;  4CCV A;  3BNC A;  4IIA A;  2F56 A;  2W6J H;  8CHO A;  1YIJ 3;  1SQW A;  2CK3 H;  2H0H A;  1LNI A;  1LOW A;  1DYU A;  1PYL A;  1UI7 A;  3K9M C;  2R4I A;  4N6M A;  4ZM8 A;  5IG5 A;  1PU4 A;  1TP6 A;  2CWU A;  3AHS A;  3DH2 A;  3S28 A;  1Q7H A;  3EBY A;  4GL6 A;  1GY6 A;  2UGI A;  4L8P A;  4TX4 A;  1F8N A;  4HM4 B;  1STD A;  1K28 A;  2K54 A;  3KE7 A;  1RN4 A;  2CIU A;  2BMQ B;  2LQV A;  4RNT A;  3URP A;  1I2F A;  4FR9 A;  2P0M A;  3CCS 3;  3VF1 A;  3S67 A;  1OHS A;  4NPB A;  1IQX A;  3EQQ B;  2Y74 A;  1UCL A;  4OK0 A;  2IY2 A;  2E2T A;  3KZT A;  2Z76 A;  1I2E A;  1UW1 A;  2QIY A;  3CNX A;  4HM1 B;  1MGR A;  3LTC A;  1A2P A;  1MNL A;  3GZX B;  3CCJ 3;  1AR0 A;  4HM6 B;  1VQP 3;  1SPU A;  1VQ7 3;  2P0X A;  5IG4 A;  1JB4 A;  1EEJ A;  4WHA A;  3D5I A;  1LXE A;  1GY5 A;  1MWT A;  3O8Y A;  3WHO A;  1V57 A;  2OQE A;  1ZGX A;  5IEN A;  3LT8 A;  2WGO A;  4X2O A;  1JV2 B;  1W2B 2;  1VQQ A;  1BNJ A;  4HZB B;  1GOV A;  3GZR A;  1N9E A;  3SX1 A;  1BRJ A;  4EV5 A;  1WMO A;  2H0I A;  1YVS A;  2W9P A;  3HI7 A;  3Q3F A;  2CH9 A;  7RNT A;  1YGW A;  1DMQ A;  4ORL A;  1JBS A;  5G1K A;  4EXR A;  3S5C A;  4RZM A;  3CU3 A;  3HZP A;  2UX0 A;  2YX9 A;  1NNV A;  1A2K A;  3X3X A;  2W03 A;  1V58 A;  4NHF A;  1MWS A;  1W00 A;  1TJD A;  3LH4 A;  1EG9 B;  1Z1S A;  2CFD A;  3FKA A;  1W01 A;  5KP1 A;  2H0G A;  1CEW I;  3B4O A;  1B2U A;  1NO3 A;  2P09 A;  3V99 A;  3AGN A;  1TFK A;  1RGA A;  5LC7 A;  3EBT A;  1BNF A;  1JKG B;  1BSE A;  3UNL A;  4EW5 A;  2JDI H;  3DXO A;  1BU4 A;  1A67 A;  1W6G A;  1S5A A;  1LOX A;  2KF5 A;  4J5G A;  2IA7 A;  3DMC A;  4WYK A;  3GWR A;  1VZZ A;  1BRN L;  5FGO A;  4STD A;  1QJG A;  2UUG C;  3PGB A;  4HAA A;  4HM2 B;  4RNY A;  4XBY A;  1YJW 3;  2F5W A;  1GSP A;  3N54 B;  3CCE 3;  4KFD A;  3JUN A;  3MG2 A;  4KVH A;  1GMR A;  5A0O B;  1RSN A;  3PCS A;  1VQL 3;  1KD1 4;  3DM8 A;  1STF I;  5EQL A;  2SBL A;  4K61 A;  3X42 A;  1M90 4;  3DZL A;  1Q81 4;  4IT7 A;  3A5E A;  5CF1 A;  5AEU B;  3G71 3;  1RGG A;  1TRQ A;  2O3O A;  3T8N A;  1JZD A;  1OF5 A;  2OWP A;  1JN5 B;  1RGE A;  1RHL A;  1LOV A;  4OUQ A;  4BIR A;  4N6V 0;  2WO0 A;  1TTO A;  3ZG0 A;  2RFR A;  4N6L A;  4RNZ A;  3CXC 2;  1E3R A;  1HKX A;  1N5H A;  1KC8 4;  1OAC A;  1SAR A;  1C7H A;  2CX1 A;  3LOY A;  5TGN A;  3S29 A;  3NHX A;  2OTJ 3;  1O7G B;  4PEJ A;  4J9A A;  2KCD A;  2PZV A;  1B27 A;  2CFK A;  4HM0 B;  1GMQ A;  2GSP A;  3EB8 A;  5JPU A;  1K8A 4;  2GU1 A;  1BOX A;  1I3I A;  3NQZ A;  1D6Y A;  3FF2 A;  1I2G A;  4WFO A;  1JBR A;  3LTA A;  2WOH A;  3K0Z A;  1OUN A;  3EN1 B;  1BNR A;  4FMC A;  4X2H A;  4CJN A;  4BL2 A;  3CME 3;  1BAO A;  2STD A;  4GHO A;  3I56 3;  1EKM A;  3JUM A;  1Y4K A;  3FH1 A;  2B1X B;  4I5Q A;  1IVU A;  2CG0 A;  1YGE A;  1AQZ A;  2IYJ A;  1R4C A;  3G6E 3;  1SIH A;  5AI1 A;  3LYG A;  3S27 A;  4JRF A;  1IT7 A;  2D1W A;  3JVC A;  3V98 A;  3G4S 3;  3GAX A;  3DY5 A;  1LVN A;  3NBB A;  1BIR A;  1I3F A;  1FZU A;  1O7H B;  1BSC A;  4N6N B;  1GD3 A;  3FSD A;  2QGU A;  1RGK A;  1IVW A;  4LZI A;  3STD A;  2Z77 A;  3BNE A;  5BXQ A;  3Q90 A;  3GRD A;  4RBN A;  3I0Y A;  2W56 A;  1AY7 A;  1TRP A;  2RNT A;  2KAA A;  1VQ6 3;  1VQ4 3;  4LEH A;  3MG1 A;  3CC2 3;  5I97 A;  3G16 A;  3KSP A;  1FW7 A;  2R41 A;  4H61 A;  6GSP A;  1OHO A;  3F40 A;  4FMB A;  4O2H A;  3EC9 A;  2INX A;  1N5P A;  3L0R A;  3HOH A;  1T3B A;  2J8X B;  3KN4 A;  3PCR A;  3NX0 A;  3TDG A;  1W6C A;  1O7W B;  4LSO A;  3U1W A;  3T0U A;  3D79 A;  1L5G B;  1Q82 4;  3FLJ A;  1E3V A;  3SED A;  4L7K A;  2KF3 A;  2OCT A;  1X1W A;  2W9Q A;  1BRI A;  4HM7 B;  2Q07 A;  5AIG A;  5D82 A;  4HM8 B;  1JKG A;  2XGL A;  2GEX A;  2ZL8 A;  3WMD A;  1T2I A;  2BHM A;  1C54 A;  2ML6 A;  2Y73 A;  1ISK A;  5ELJ A;  3HII A;  1Q40 B;  1ASK A;  1ROV A;  1OH0 A;  4HKV B;  3NM2 A;  3WR2 A;  3IJE B;  1BGS A;  1RNB A;  1IQY A;  1YI2 3;  3G8Z A;  1IU7 A;  1IT8 A;  1GMP A;  1N8R 4;  1YVB I;  1AVK A;  3NUV A;  4N3V A;  1R4Y A;  4HOH A;  1FYS A;  2OOV A;  1BUQ A;  2HMO B;  4BL3 A;  1X1U A;  1VQ8 3;  3BIR A;  1OGZ A;  1HU9 A;  3ER7 A;  2K0M A;  3CCQ 3;  5HGR A;  1YNV X;  3AMO B;  1VQ9 3;  2CKF B;  3MHE A;  1BRG A;  4K1U A;  2W0Q A;  3EF8 A;  1VQK 3;  4EC6 A;  1I0V A;  3G0K A;  1GS3 A;  2HMK B;  4Q53 A;  3SLU A;  1LRA A;  3RGA A;  3K5T A;  1QMA A;  4R9K A;  2ZHX B;  3N9H A;  3BNB A;  4WP5 A;  2CFW A;  2E2U A;  4AEQ A;  5LC6 A;  5JPP A;  1AVL A;  1DMN A;  5CLK A;  2XSH B;  3LZA A;  2FXT A;  1RDS A;  3B4P A;  3BU4 A;  1IVX A;  3IPT A;  1TU5 A;  3K63 A;  4HM3 B;  1FGO A;  3FG1 A;  4HYZ A;  4R1K A;  3CMA 3;  5IG0 A;  2L4V A;  3D9R A;  5STD A;  3EX9 A;  3D4A A;  1GOU A;  1FGM A;  4XDW A;  1HZ1 A;  2AAD A;  3RNT A;  2MF7 A;  4R4K A;  2V1L A;  1V74 A;  2BIR A;  3KII A;  3OV4 A;  4I4K A;  1NDO B;  5AIH A;  1LQM B;  1UUV B;  3FZW A;  1WQL B;  3MYT A;  5DRE A;  3MG3 A;  3X3Z A;  1ZX2 A;  2WGQ A;  3CCL 3;  1PFP A;  1DMM A;  2RGQ A;  3FG3 A;  3CCM 3;  1OCV A;  3AMO A;  3IMA B;  5D83 A;  3U97 A;  1VQN 3;  2AAE A;  3BB9 A;  1RGC A;  5IG3 A;  2IUJ A;  3ECF A;  2A15 A;  1UGH I;  5CK6 A;  1B2Z A;  1RNT A;  1MOL A;  1UUW B;  1NU3 A;  4J5K A;  1BRH A;  3Q2P A;  1EA2 A;  1FGT A;  1KQS 2;  2ZA4 A;  1WMP A;  3H51 A;  2BO9 B;  4BU4 A;  4O3V A;  1RLS A;  3A76 A;  2HOH A;  1BNE A;  3V92 A;  1FGR A;  1PY3 A;  2IUK A;  1IVV A;  2CHC A;  1I0X A;  1US1 A;  2M7O A;  2XEP A;  4HM5 B;  1MWU A;  1W4N A;  4XBX A;  1G96 A;  2QA4 3;  2GU3 A;  1UCK A;  3SVA A;  1NB5 I;  2IMJ A;  1QVF 2;  2W56 B;  1BSB A;  4GB5 A;  4KT3 B;  4BTX A;  3EHC A;  1GY7 A;  1TIJ A;  4AKZ A;  1JJ2 2;  1GYB A;  3DGY A;  3ZFZ A;  2CFG A;  2CWT A;  1UUG B;  3CCU 3;  2BU4 A;  2OOV C;  5G1L A;  4G1M B;  3OW2 2;  1BRS A;  3CCV 3;  2CFL A;  4FMD A;  1RRL A;  1RN7 A;  4BTY A;  1B3S A;  2GBW B;  2HMM B;  1M9G A;  1X1X A;  3ALA A;  4R9L A;  4EYC A;  7STD A;  4KZ1 A;  1RGF A;  3GZY B;  4FCJ A;  1Q42 A;  4GSP A;  5IEO A;  5AII A;  3T8U A;  3H3H A;  4XM4 A;  1JZO A;  2P05 A;  3ROB A;  3AGO A;  5M19 A;  2CWV A;  3WA2 X;  1K41 A;  1TUH A;  1W2Z A;  3N8B A;  3D3L A;  1W6Y A;  3UJM A;  1RCK A;  3KCH A;  4WWU C;  1G0T A;  3EE1 A;  4KFF A;  3DGL A;  5ELU A;  1O7P B;  3JUO A;  3FF0 A;  2GXF A;  3NV0 A;  2I9W A;  4O02 B;  5KP4 A;  1IDP A;  1OHP A;  1X1Y A;  2WOF A;  2ZDJ A;  3HK4 A;  5CF2 A;  3E99 A;  1NJI 4;  1WMN A;  1LOY A;  4K1V A;  1N8Q A;  3JUQ A; 
#chains in the Genus database with same CATH homology
 2F99 A;  3EJV A;  2P38 A;  1VQO 3;  2OTL 3;  3MWZ A;  1OGX A;  1YHQ 3;  4XB5 A;  1SJW A;  1M1X B;  3MPH A;  5D81 A;  3WDG B;  2GBX B;  3M8C A;  4QWT A;  4MMY B;  2CW9 A;  1IQ8 A;  2XGN A;  3MSO A;  5IER A;  2LYX A;  4L8O A;  3LT9 A;  2CG1 A;  1ROA A;  4IPB A;  1GD4 A;  2FGT A;  3QK9 A;  3UB1 A;  1QAK A;  1FGQ A;  4HZ9 B;  3DGO A;  1W5Z A;  2BMO B;  3HX8 A;  1KWI A;  3BND A;  3KFQ C;  4N6O B;  4OVM A;  5EEO A;  2FNQ A;  3X40 A;  2O9U X;  4HBR A;  3RGR A;  4JF8 A;  2F86 B;  1YIT 3;  1A2V A;  5FW5 A;  1O7N B;  1CYV A;  1NWW A;  2E2V A;  1RRH A;  4MMZ B;  4CDL A;  5BVB A;  3NXJ A;  1VQ5 3;  4WYK B;  4N6U A;  3WOE B;  5AYS C;  5JBS A;  3OX9 A;  2KRT A;  3NM7 A;  4FCM A;  6STD A;  1FA3 A;  1FUW A;  4N6T A;  3F14 A;  3LTD A;  2C11 A;  1D6U A;  4FCZ A;  2XSO B;  4XBT A;  1IK3 A;  5AIF A;  1JRQ A;  1K73 4;  3PYJ A;  2Z6B A;  3LXU X;  2XRX B;  4EBG A;  4O8S A;  4MMX B;  4U13 A;  1M1K 4;  3X41 A;  3SOA A;  1DVD A;  3SOY A;  5IEP A;  4MJD A;  2OQE C;  3NV0 B;  3VSY A;  1Q40 A;  2YFI B;  3WOF B;  1W02 A;  4HJL B;  2PNC A;  1OPY A;  2KXG A;  3B8L A;  3WOD G;  1Q7Y 4;  1J2B A;  1JNQ A;  1OF5 B;  2RSX A;  3KSE D;  3CC7 3;  5IF6 A;  3OWU A;  1RKY A;  3F9S A;  1TFO A;  2HMJ B;  5G2G A;  1JB2 A;  1SII A;  3F7X A;  1EQK A;  2XF3 A;  4LGQ A;  3F8X A;  3X3Y A;  1DVC A;  4EV2 A;  1CYU A;  3EN8 A;  2W2C A;  1QVG 2;  2HMN B;  3DUK A;  3CC4 3;  2ML5 A;  3MKI A;  1ULI B;  3CPW 2;  3SXX A;  3UL6 A;  3FGY A;  1UI8 A;  3LTB A;  4KFE A;  3QRD A;  3RDE A;  4MEI A;  2W04 A;  3CPO A;  3JUP A;  1W7C A;  3F8H A;  4HVN A;  2F98 A;  2C10 A;  1O7M B;  2GEY A;  1ZO2 A;  2RCD A;  1QAF A;  3B7C A;  2XH9 A;  3Q1C A;  3OXA A;  3BLZ A;  4J8T A;  3I55 3;  3PZW A;  1CQS A;  1U8C B;  1YJN 3;  4AKY A;  4H3U A;  3KKG A;  3DGN A;  4FMA A;  3NBJ A;  3PXM A;  3K7C A;  1IV7 A;  1WNH A;  2JQ5 A;  2Z7A A;  2B24 B;  3FG4 A;  5AYR B;  1RJO A;  2BNG A;  2YFJ B;  1K9M 4;  2YFL B;  2XFT A;  2MC8 A;  5KP3 A;  5AEW B;  2CC3 A;  3NQY A;  1S72 3;  3CD6 3;  3WA3 A;  1KSI A;  3OWS A;  3DGM A;  1E97 A;  3CNM A;  1WTH A;  1JB5 A;  2BT3 A;  2BMR B;  3GZB A;  3HIG A;  3UL5 A;  1QAL A;  4K90 B;  1NB3 I;  5EVH A;  1VQM 3;  4NRE A;  3LML A;  1U5O A;  1Q86 4;  1A90 A;  2XR8 B;  3PS8 A;  1IV9 A;  4R80 A;  3CCR 3;  2XFS A;  2D42 A;  2QEX 3;  3VGN A;  1JN5 A;  5IW9 A;  2HML B;  3J7Y d;  4XDV A;  1T5Y A;  1ULJ B;  3NBR A;  5DRV A;  4LMI A;  4BTW A;  1D6Z A;  1N9J A;  3F7S A;  5CXO A;  1AV4 A;  1LNH A;  3FCS B;  3OWY A;  1YJ9 3;  4CCV A;  3BNC A;  4IIA A;  2W6J H;  8CHO A;  1YIJ 3;  1SQW A;  2CK3 H;  4ZM8 A;  1UI7 A;  1DYU A;  4N6M A;  3K9M C;  5IG5 A;  2R4I A;  1PU4 A;  1TP6 A;  2CWU A;  1ISK A;  3S28 A;  3EBY A;  4GL6 A;  4TX4 A;  1GY6 A;  4L8P A;  1F8N A;  4HM4 B;  1STD A;  1K28 A;  2K54 A;  3KE7 A;  2BMQ B;  2CIU A;  2LQV A;  4FR9 A;  2P0M A;  3CCS 3;  3VF1 A;  3S67 A;  1OHS A;  1IQX A;  3EQQ B;  2Y74 A;  4OK0 A;  2E2T A;  3KZT A;  2Z76 A;  1UW1 A;  2QIY A;  3CNX A;  4HM1 B;  3LTC A;  3GZX B;  1MNL A;  3CCJ 3;  1AR0 A;  4HM6 B;  1VQP 3;  1SPU A;  1VQ7 3;  2P0X A;  5IG4 A;  1JB4 A;  4WHA A;  1LXE A;  1GY5 A;  3O8Y A;  2OQE A;  5IEN A;  3LT8 A;  2WGO A;  4X2O A;  1JV2 B;  1W2B 2;  4HZB B;  3GZR A;  1N9E A;  3SX1 A;  4EV5 A;  1WMO A;  3HI7 A;  2W9P A;  2CH9 A;  1DMQ A;  4ORL A;  4EXR A;  3S5C A;  4RZM A;  3CU3 A;  3HZP A;  2UX0 A;  2YX9 A;  1A2K A;  3X3X A;  2W03 A;  4NHF A;  1W00 A;  3LH4 A;  1EG9 B;  1Z1S A;  2CFD A;  3FKA A;  1W01 A;  5KP1 A;  1CEW I;  3B4O A;  1NO3 A;  2P09 A;  3V99 A;  1TFK A;  5LC7 A;  3EBT A;  3UNL A;  1JKG B;  2JDI H;  3DXO A;  1A67 A;  1W6G A;  1S5A A;  1LOX A;  4WYK A;  3DMC A;  2IA7 A;  3GWR A;  1VZZ A;  5FGO A;  4STD A;  1QJG A;  3PGB A;  4HM2 B;  4RNY A;  4XBY A;  1YJW 3;  3N54 B;  3CCE 3;  4KFD A;  3JUN A;  3MG2 A;  4KVH A;  5A0O B;  3PCS A;  1VQL 3;  1KD1 4;  3DM8 A;  1STF I;  5EQL A;  2SBL A;  4K61 A;  3X42 A;  1M90 4;  3DZL A;  1Q81 4;  4IT7 A;  5CF1 A;  5AEU B;  3G71 3;  2O3O A;  3T8N A;  1OF5 A;  2OWP A;  1JN5 B;  4OUQ A;  4N6V 0;  2WO0 A;  2RFR A;  4N6L A;  4RNZ A;  3CXC 2;  1E3R A;  1HKX A;  1N5H A;  1KC8 4;  1OAC A;  3LOY A;  1C7H A;  5TGN A;  3S29 A;  3NHX A;  2OTJ 3;  1O7G B;  4PEJ A;  4J9A A;  2KCD A;  2PZV A;  4HM0 B;  2CFK A;  3EB8 A;  5JPU A;  1K8A 4;  2GU1 A;  3NQZ A;  1D6Y A;  3FF2 A;  4WFO A;  3LTA A;  2WOH A;  3K0Z A;  1OUN A;  3EN1 B;  4FMC A;  4X2H A;  3CME 3;  2STD A;  3I56 3;  1EKM A;  3JUM A;  1Y4K A;  3FH1 A;  2B1X B;  1IVU A;  2CG0 A;  1YGE A;  1R4C A;  3G6E 3;  1SIH A;  5AI1 A;  3LYG A;  3S27 A;  4JRF A;  1IT7 A;  2D1W A;  3JVC A;  3V98 A;  3GAX A;  3DY5 A;  1LVN A;  3NBB A;  1O7H B;  4N6N B;  1GD3 A;  3FSD A;  2QGU A;  1IVW A;  4LZI A;  3STD A;  2Z77 A;  3BNE A;  5BXQ A;  3Q90 A;  3GRD A;  4RBN A;  3I0Y A;  2W56 A;  1VQ6 3;  1VQ4 3;  4LEH A;  3MG1 A;  3CC2 3;  5I97 A;  3G16 A;  3KSP A;  4H61 A;  1OHO A;  3F40 A;  4FMB A;  4O2H A;  3EC9 A;  2INX A;  1N5P A;  3L0R A;  3KN4 A;  3PCR A;  3NX0 A;  3TDG A;  1W6C A;  1O7W B;  4LSO A;  3U1W A;  3T0U A;  1L5G B;  1Q82 4;  3FLJ A;  1E3V A;  3SED A;  4L7K A;  2OCT A;  2W9Q A;  4HM7 B;  2Q07 A;  5AIG A;  5D82 A;  4HM8 B;  1JKG A;  2XGL A;  2GEX A;  2ZL8 A;  3WMD A;  2BHM A;  2ML6 A;  2Y73 A;  5ELJ A;  3HII A;  1Q40 B;  1ASK A;  1ROV A;  1OH0 A;  4HKV B;  3NM2 A;  3IJE B;  1IQY A;  1YI2 3;  3G8Z A;  1IU7 A;  1IT8 A;  1N8R 4;  1YVB I;  1AVK A;  3NUV A;  4N3V A;  2OOV A;  1BUQ A;  2HMO B;  1VQ8 3;  1OGZ A;  1HU9 A;  3ER7 A;  2K0M A;  3CCQ 3;  5HGR A;  3AMO B;  1VQ9 3;  2CKF B;  3MHE A;  4K1U A;  2W0Q A;  3EF8 A;  1VQK 3;  4EC6 A;  3G0K A;  1GS3 A;  2HMK B;  4Q53 A;  3SLU A;  3RGA A;  3K5T A;  1QMA A;  4R9K A;  3N9H A;  3BNB A;  4WP5 A;  2CFW A;  2E2U A;  4AEQ A;  5LC6 A;  5JPP A;  1AVL A;  1DMN A;  5CLK A;  2XSH B;  3LZA A;  2FXT A;  3B4P A;  1IVX A;  3IPT A;  1TU5 A;  3K63 A;  4HM3 B;  1FGO A;  3FG1 A;  4HYZ A;  4R1K A;  3CMA 3;  5IG0 A;  2L4V A;  3D9R A;  5STD A;  3EX9 A;  1FGM A;  4XDW A;  2MF7 A;  4R4K A;  2V1L A;  1V74 A;  3KII A;  3OV4 A;  4I4K A;  1NDO B;  5AIH A;  1UUV B;  3FZW A;  1WQL B;  3MYT A;  5DRE A;  3MG3 A;  3X3Z A;  1ZX2 A;  2WGQ A;  3CCL 3;  1PFP A;  1DMM A;  2RGQ A;  3FG3 A;  3CCM 3;  1OCV A;  3AMO A;  3IMA B;  5D83 A;  3U97 A;  1VQN 3;  3BB9 A;  5IG3 A;  2IUJ A;  3ECF A;  2A15 A;  5CK6 A;  1MOL A;  1UUW B;  1NU3 A;  3Q2P A;  1EA2 A;  1FGT A;  1KQS 2;  1WMP A;  3H51 A;  2BO9 B;  4O3V A;  3A76 A;  3V92 A;  1FGR A;  2M7O A;  2IUK A;  1IVV A;  2CHC A;  1US1 A;  2XEP A;  4HM5 B;  1W4N A;  4XBX A;  1G96 A;  2QA4 3;  2GU3 A;  3SVA A;  1NB5 I;  1QVF 2;  2IMJ A;  2W56 B;  4GB5 A;  4BTX A;  3EHC A;  1GY7 A;  1TIJ A;  4AKZ A;  1JJ2 2;  1GYB A;  2CFG A;  2CWT A;  3CCU 3;  2OOV C;  4G1M B;  3OW2 2;  3CCV 3;  2CFL A;  4FMD A;  1RRL A;  1RN7 A;  4BTY A;  2GBW B;  2HMM B;  1M9G A;  3ALA A;  4R9L A;  4EYC A;  7STD A;  4KZ1 A;  3GZY B;  4FCJ A;  5IEO A;  1Q42 A;  5AII A;  3T8U A;  3H3H A;  4XM4 A;  2P05 A;  3ROB A;  2CWV A;  3WA2 X;  1K41 A;  1TUH A;  1W2Z A;  3N8B A;  3D3L A;  1W6Y A;  3UJM A;  4WWU C;  3EE1 A;  4KFF A;  3DGL A;  5ELU A;  1O7P B;  3JUO A;  3FF0 A;  2GXF A;  3NV0 A;  2I9W A;  4O02 B;  5KP4 A;  1IDP A;  1OHP A;  2WOF A;  3HK4 A;  2ZDJ A;  5CF2 A;  3E99 A;  1NJI 4;  1WMN A;  3G4S 3;  4K1V A;  1N8Q A;  3JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...