1Q40A

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
165
Chain Sequence
QDPTQQLEPFLKRFLASLDLLYTQSQPFPNVESYATQLGSNLKRSSAIIVNGQPIIPSPQEDCKLQFQKKWLQTPLSSHQLTSYDGHLIPGTGTFVVHFSAKVRFDQSGRNRLGESADLFQENNQRPIWGSWFGVDVNLVVDENVMQDGEIINSMDYRFTYVPND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
total genus 43
structure length 165
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40A00
3OWYA 3DZLA 1O7GB 3B8LA 2HMKB 1U5OA 3MYTA 1OPYA 1NWWA 4RZMA 3EBTA 5CF1A 3DUKA 3FKAA 3G0KA 5IERA 1Q40B 3FH1A 5IEPA 1QMAA 4HM8B 3FGYA 3NXJA 1S5AA 2BMQB 1OGXA 3OXAA 5CK6A 3FF2A 3RGRA 2A15A 4CDLA 2XR8B 2HMOB 4R1KA 2Z76A 3BB9A 5DRVA 4H3UA 8CHOA 1JB4A 5KP4A 3F40A 1O7HB 5JPUA 1EA2A 3ROBA 3OX9A 1ULIB 3SEDA 2BMRB 2I9WA 3WMDA 3MKIA 5IG4A 4ORLA 1ISKA 3HK4A 3EJVA 2XRXB 3EN8A 2F98A 3T8NA 2XSHB 3F7XA 3DM8A 5AIFA 1W00A 5AIIA 4K1VA 3OWSA 3CNXA 5BXQA 2HMNB 3NV0B 4LMIA 1AR0A 4OVMA 1EG9B 3OV4A 3HZPA 5AEWB 5AIGA 2GEYA 5KP1A 5IG5A 3CU3A 2W2CA 4HM3B 4R9LA 4PEJA 5G2GA 3H51A 4HM4B 3D9RA 3JUMA 4KVHA 1Z1SA 3F14A 3F9SA 4I4KA 4L8PA 3KE7A 5CLKA 4J8TA 4X2OA 1OGZA 2GBWB 4K1UA 2HMLB 3VGNA 5TGNA 3A76A 3MSOA 1Q42A 4LEHA 7STDA 1UUWB 5AEUB 1JB5A 3Q90A 3B7CA 3GZRA 1SJWA 3SOYA 4LGQA 1NU3A 1OHPA 2RCDA 2GEXA 1ULJB 4HM0B 1WQLB 4HJLB 2BMOB 3CNMA 4GB5A 3KKGA 1C7HA 1TUHA 3B4PA 1OUNA 2YFIB 3F8XA 1O7NB 3NV0A 1O7MB 5EVHA 3DXOA 1OHOA 3DMCA 4HM5B 2CKFB 3FSDA 4XM4A 3EN1B 2CHCA 1JN5B 1OHSA 4STDA 2RGQA 2STDA 4WP5A 1CQSA 3LZAA 1O7WB 3I0YA 1DMMA 4N3VA 3B4OA 3F8HA 3S5CA 3M8CA 3NUVA 2PZVA 3STDA 1W01A 5STDA 2INXA 2JQ5A 2HMJB 1TP6A 3NHXA 2B24B 3G8ZA 3MG3A 5CXOA 3K0ZA 3EX9A 4XDWA 4XB5A 3NBRA 3OWUA 4HZBB 4Q53A 2RFRA 1E97A 1E3RA 3LYGA 2UX0A 3VSYA 3GZYB 1ZX2A 3F7SA 3JUPA 2R4IA 4X2HA 1STDA 2IMJA 1NDOB 2OWPA 1GYBA 5IF6A 2K54A 4XBYA 5D83A 3JUNA 4XBTA 5AI1A 1ASKA 3CPOA 5IG0A 3EQQB 1JN5A 3GZXB 5IENA 3FF0A 1GY5A 4HKVB 5IEOA 5D81A 3JUQA 4J9AA 3EBYA 1DMQA 4HVNA 3SOAA 1OF5B 2Z77A 1A2KA 1IDPA 1QJGA 4HM7B 2B1XB 4WYKA 3H3HA 2F86B 2Z7AA 2GXFA 3E99A 4OUQA 4L8OA 2QIYA 1O7PB 3MG1A 4XDVA 1GY7A 2F99A 5FW5A 1JKGA 1JB2A 1GS3A 3KSPA 2BNGA 4L7KA 3K7CA 3ER7A 4U13A 1W6YA 3G16A 1UUVB 1BUQA 4FCJA 3UNLA 5D82A 3BLZA 5CF2A 5KP3A 4WYKB 4XBXA 4HZ9B 4WWUC 1ZO2A 3MG2A 3IPTA 1K41A 4HM2B 3RGAA 1OCVA 1W02A 6STDA 1VZZA 3MHEA 4IIAA 2YFJB 3JUOA 3EHCA 5HGRA 2HMMB 1JKGB 3HX8A 4FCMA 5IG3A 3EF8A 4HM6B 3FLJA 1GY6A 3T8UA 4MJDA 1E3VA 1HKXA 2GBXB 3NM2A 5AIHA 3GZBA 3UJMA 4HM1B 1Q40A 3EC9A 2YFLB 3FZWA 1OF5A 3GWRA 3ECFA 1DMNA 5DREA 5BVBA 3GRDA 2XSOB 2QGUA 1OH0A 5JPPA 3KZTA 4R9KA
chains in the Genus database with same CATH superfamily
3OWYA 2QEX3 1DETA 3DZLA 1O7GB 5FGOA 3B8LA 2F56A 4MMXB 1UGIA 1PY3A 1CEWI 1VQ43 1N9EA 2HMKB 1IQYA 2ML6A 3LTCA 3X3XA 1YJW3 3WODG 2R41A 2Y74A 1U5OA 1NJI4 3MYTA 1OPYA 1FYSA 1NWWA 3AGNA 3QK9A 2E2UA 4FMCA 1T2HA 3EBTA 2W03A 4RZMA 3DUKA 3TDGA 2CX0A 5CF1A 1V57A 1RRLA 4BL2A 2Y73A 4H61A 1VQL3 3FKAA 3G0KA 5IERA 1Q40B 1MNLA 1RGGA 3FH1A 5IEPA 1QMAA 3AMOB 3N54B 4HM8B 3FGYA 2MF7A 3FCSB 2BIRA 3NXJA 1S5AA 2BMQB 1IU7A 3CME3 1OGXA 3OXAA 1RGEA 1X1UA 2IY2A 1QVF2 5CK6A 1QAKA 2W9QA 3FF2A 3RGRA 3EE1A 2A15A 5AYSC 3SX1A 2UUGC 3U97A 3X3ZA 4CDLA 1NB5I 1B2MA 3CCV3 4QWTA 1JBSA 3DGLA 2XR8B 2D42A 2HMOB 4R80A 4R1KA 1GOVA 2Z76A 3WA2X 1YJ93 3BB9A 1W6GA 5DRVA 3OW22 1RNBA 4H3UA 1J2BA 3MPHA 8CHOA 3NQYA 1JB4A 1JZOA 1M1XB 5KP4A 3F40A 1K8A4 3CC23 2BU4A 4GL6A 1O7HB 3D5IA 5JPUA 1EA2A 1B2SA 3K9MC 4N6OB 1AVLA 4RNTA 5GSPA 3ROBA 3JVCA 1RGAA 1TRQA 1ULIB 3OX9A 3SEDA 1I2EA 1EKMA 4KFEA 4G1MB 3CCJ3 2BMRB 4BL3A 2I9WA 2CWVA 3WMDA 3MKIA 1Q864 4AKYA 1VQM3 2KF4A 5IG4A 2OTL3 4ORLA 1RHLA 1JNQA 3LT8A 5EEOA 4EV5A 9RNTA 1VQN3 1ISKA 3BNEA 1W5ZA 3HOHA 4NREA 3HK4A 3EJVA 3WR2A 2XRXB 3EN8A 2F98A 1BOXA 2XSHB 1B2UA 3F7XA 3T8NA 3X41A 2IYJA 3DM8A 3KFQC 4GSPA 1JBTA 5AIFA 1W00A 5IW9A 1RLSA 2KF5A 5AIIA 4EBGA 4K1VA 2W04A 4LSOA 1YJN3 3OWSA 3CNXA 5BXQA 1NO3A 2KRTA 2GU3A 1KQS2 1I8VA 2WGOA 2HMNB 3NV0B 4KFDA 4LMIA 1AR0A 4OK0A 4N6TA 4OVMA 1EG9B 3OV4A 4KZ1A 1UUGB 1VQ93 3HZPA 1F8NA 1IVXA 5AEWB 2WGQA 3LXUX 1FGRA 1IVUA 5ELUA 3SXXA 4N6LA 5AIGA 2GEYA 2O9UX 1YHQ3 1FGQA 1LOXA 3T0UA 5KP1A 5IG5A 3CU3A 3HIIA 3G713 2W2CA 3ZG0A 3UB1A 1US1A 3X42A 4HM3B 2F4YA 4R9LA 1B2ZA 2XFTA 1GSPA 1G02A 4PEJA 4BIRA 5G2GA 3H51A 4HM4B 3UL5A 1OACA 1FUWA 3D9RA 3JUMA 2CFKA 3EB8A 3L0RA 3NQZA 1G96A 4KVHA 1K9M4 2CFGA 3KN4A 1QAFA 1R4CA 1Z1SA 3F14A 2IUKA 2CWTA 4J5KA 3F9SA 4TX4A 4I4KA 4L8PA 5HOHA 3KE7A 2H0GA 4ILFA 5CLKA 1RCKA 1CH0A 4J8TA 4X2OA 3WHOA 2OQEA 1SIIA 1OGZA 2GBWB 2H0IA 3X40A 1WMNA 1LOWA 1SARA 4K1UA 5G1KA 2HMLB 4HBRA 1BRIA 3S27A 7RNTA 3CCE3 2CFLA 1UDII 2CIUA 3DY5A 3VGNA 5TGNA 3A76A 3MSOA 2ZHXB 3Q3FA 2OOVA 1PU4A 1VQ83 3X3YA 1FUTA 1Q42A 1HZ1A 3S29A 1M9GA 1Q814 4LEHA 7STDA 1VQO3 4R4KA 1GD3A 4LYLB 2P09A 1UUWB 1JRQA 1UGHI 5AEUB 3FG3A 1PFPA 1JB5A 1HYFA 1X1WA 3Q90A 1NNVA 1I3FA 1I70A 1MOLA 3B7CA 1RN4A 3GZRA 1FGTA 1SJWA 2L1SA 3SOYA 4KFFA 2GSPA 3DGMA 4LGQA 3V98A 4EC6A 1LOYA 4FMAA 1NU3A 1WMOA 3LOYA 1W7CA 1OHPA 3AHSA 2CH9A 3DGYA 4GHOA 4MMZB 2C10A 4WFOA 5M19A 2RCDA 4NPBA 1I2FA 3WOEB 3PGBA 1ROVA 1A2VA 2GEXA 1D6ZA 1ULJB 2ML5A 4HM0B 5JBSA 3CCM3 2ZA4A 1RJOA 1WQLB 4N6MA 3VF1A 4DKIA 3GSPA 1BNGA 1YGEA 3PS8A 4HJLB 2BMOB 1NB3I 3V99A 3CC73 3CCR3 1RSNA 3CNMA 4GB5A 3Q2PA 3KKGA 1C7HA 1BRHA 3FG1A 4O3VA 4N6UA 1TUHA 1DYUA 3B4PA 1OUNA 1L5GB 1Q7HA 2YFIB 3F8XA 1O7NB 1SIHA 4N6NB 2V1LA 1LNHA 3NV0A 2H0HA 1BAOA 1O7MB 1IT8A 1IVVA 2SARA 3DXOA 1OHOA 1T3BA 3DMCA 5EVHA 3I553 2CX1A 2F5WA 4CPKA 1B3SA 4HM5B 2KF3A 1LOVA 4O2HA 1ROAA 4BU4A 2CKFB 2P0XA 4WHAA 3FSDA 2UGIA 1BSBA 3EN1B 4XM4A 1TFOA 2C4BA 3ZG5A 1QVG2 3AHWA 2W6JH 1EQKA 1MWSA 1R4YA 4EYCA 1HU9A 1N5HA 2CHCA 1JBRA 1JN5B 1GMQA 2KF6A 1OHSA 2P05A 4JF8A 3LTBA 4STDA 1T5YA 2RGQA 2CK3H 2STDA 4WP5A 2ZDJA 1CQSA 2IUJA 3LZAA 2W0QA 3ZFZA 1O7WB 3WDGB 2E2TA 3I0YA 1KD14 1DMMA 1YVSA 4N3VA 3B4OA 3F8HA 3S5CA 3M8CA 3NUVA 1KC84 2PZVA 1JV2B 2ZL8A 3STDA 2XGLA 1VQ63 1BGSA 1W01A 1YI23 3D3LA 3BNDA 5STDA 4EV2A 2BHMA 6RNTA 1FW7A 4EXRA 1EUIC 1Y4KA 2L4VA 1FGMA 2INXA 2JQ5A 2OOVC 3NM7A 4HOHA 4LZIA 2CG1A 3KIIA 2P0MA 3U1WA 3BNCA 1V74A 3CPW2 2HMJB 1KWIA 1BNEA 3IJEB 5A0OB 1D6UA 1TP6A 2W9PA 3NHXA 1WTHA 1RKYA 2XH9A 1BNSA 1SPUA 3DH2A 2CWUA 2CFWA 3CCQ3 2B24B 3G8ZA 3MG3A 5CXOA 1CYUA 3MWZA 3K0ZA 3Q1CA 3EX9A 3URPA 1BNFA 1B21A 4O02B 4XDWA 3WA3A 4XB5A 1EEJA 1A67A 1Q9EA 3NBRA 2JDIH 2WO0A 1W2ZA 2D1WA 3OWUA 4HZBB 4Q53A 8RNTA 1IK3A 2RFRA 1E97A 1E3RA 3LYGA 2UX0A 2XEPA 1BRNL 1W2B2 1FUSA 3VSYA 3GZYB 1VQ53 1ZX2A 3G6E3 1DVDA 2AAEA 3F7SA 3JUPA 3CD63 2CFDA 4IT7A 3GAXA 5RNTA 2R4IA 1BRGA 1BU4A 1UI7A 4X2HA 1KSIA 1K28A 1UI8A 1AVKA 1STDA 1LQMB 2IMJA 1NDOB 1ZS7A 2OWPA 1GYBA 3CMA3 2C11A 5IF6A 4CJNA 3LT9A 3A5EA 3D4AA 3D79A 4FR9A 3PCRA 3ALAA 2K54A 3PXMA 3S28A 3LMLA 3CCL3 2OCTA 4XBYA 5D83A 4BTWA 1S723 3JUNA 4XBTA 1DVCA 1RMSA 2SBLA 5AI1A 1JZDA 1D6YA 1ASKA 3KSED 4HYZA 2KXGA 1IT7A 2LYXA 3CPOA 3CCU3 1SQWA 2CC3A 1MWRA 1RGLA 3WOFB 5IG0A 1QALA 1VQK3 4IPBA 1IVWA 1FA3A 1RGKA 3EQQB 3QRDA 4N6V0 1JN5A 5LC7A 3GZXB 1LVNA 2KCDA 1Q7Y4 1UW1A 1T2IA 3V92A 5IENA 4J5GA 3FF0A 1BNJA 1GY5A 1W4NA 4HKVB 3CXC2 3S67A 5IEOA 2XF3A 5D81A 1VQQA 3JUQA 4MEIA 4K61A 2YX9A 1BSEA 4O8SA 4J9AA 5AYRB 3EBYA 1DMQA 1I3IA 4MMYB 1BNIA 2W56B 1RN7A 1DE3A 4HVNA 5EQLA 3SOAA 1RN1A 1RGCA 3KCHA 4FMDA 3SLUA 3DGOA 1AY7A 1OF5B 2Z77A 2BO9B 3AGOA 3CCS3 5I97A 3UL6A 4AKZA 1A2KA 1IDPA 3PCSA 1JJ22 1QJGA 1STFI 4HM7B 5BU4A 1RCLA 2CW9A 2B1XB 4FMBA 2M7OA 2Z6BA 1IV7A 4WYKA 4AEQA 3H3HA 2F86B 3SVAA 2Z7AA 1M1K4 2GXFA 2CG0A 1FGOA 2RSXA 3E99A 4OUQA 2FGTA 4L8OA 2QIYA 1O7PB 2E2VA 2K0MA 2XGNA 1BSCA 1UCLA 1AV4A 3BU4A 3MG1A 2GU1A 4XDVA 1GY7A 1TRPA 1K734 1MWUA 1RGFA 3G4S3 3J7Yd 2F99A 1N5PA 1LQGC 5FW5A 1JKGA 4HAAA 1JB2A 1C54A 1GS3A 3SYUA 1Q824 1A2PA 2BNGA 1GD4A 3KSPA 4L7KA 5M18A 1TJDA 3K7CA 3NBJA 1RGHA 2OQEC 3ER7A 1W6YA 4U13A 5M1AA 1M904 3G16A 1YGWA 3BNBA 2OTJ3 1GMPA 1N8QA 1UUVB 1BUQA 1YNVX 2WOFA 4FCJA 1RDSA 3UNLA 1X1YA 1LXEA 5D82A 3BLZA 2O3OA 3BIRA 5CF2A 3CC43 5KP3A 3RNTA 4BTYA 2FXTA 1W6CA 4WYKB 4XBXA 4RBNA 1IYYA 4HZ9B 4WWUC 1ZO2A 3MG2A 1RTUA 3IPTA 1K41A 1I0XA 2J8XB 2MC8A 2BT3A 2KAAA 1BRSA 5G1LA 6GSPA 1ZGXA 2IA7A 4HM2B 3IMAB 1CYVA 1MWTA 3RGAA 1B2XA 1OCVA 1BANA 3DGNA 1N9JA 3N9HA 3NBBA 1W02A 5LC6A 6STDA 3N8BA 1I2GA 1VZZA 3MHEA 5BIRA 4IIAA 3PYJA 1IV9A 4BTXA 1U8CB 2WOHA 2YFJB 3JUOA 4RNYA 3EHCA 5HGRA 2HMMB 4RNZA 1JKGB 1RNTA 2K3DA 2RNTA 2PNCA 3HX8A 1V58A 4FCMA 4ZM8A 3RDEA 5IG3A 1IQ8A 1I0VA 3EF8A 4HM6B 2LQVA 1BIRA 1MGRA 2F5MA 3FLJA 1GY6A 1TFKA 4KT3B 3T8UA 4MJDA 2Q07A 3K63A 3K5TA 4I5QA 1TU5A 1N8R4 1E3VA 1HKXA 1WNHA 2GBXB 3NM2A 5AIHA 1BRJA 1LNIA 4CCVA 1G0TA 4K90B 3LTDA 4FCZA 1BRKA 1X1XA 1A90A 1IQXA 4EW5A 1UCKA 1YVBI 1BUJA 1PYLA 1UCJA 1WMPA 3LH4A 4JRFA 3GZBA 2W56A 3I563 3UJMA 1BSDA 3NX0A 1B20A 3PZWA 4HM1B 1Q40A 7GSPA 1VQ73 3AMOA 3EC9A 2YFLB 3FZWA 1AQZA 1GMRA 1UCIA 2AADA 2FNQA 3HIGA 1VQP3 1OF5A 1YIJ3 2QA43 3GWRA 3ECFA 1DMNA 1TIJA 5DREA 1BNRA 2XFSA 1B27A 1TTOA 5ELJA 5BVBA 3GRDA 2XSOB 1LRAA 2RBIA 2QGUA 3O8YA 1RRHA 1OH0A 3FG4A 1GOYA 5JPPA 3KZTA 3D5GA 1GOUA 4NHFA 1MGWA 3HI7A 3LTAA 1BSAA 4R9KA 1FZUA 1YIT3 1BVIA 2P38A 2HOHA
chains in the Genus database with same CATH topology
3OWYA 2QEX3 3DZLA 1O7GB 5FGOA 3B8LA 4MMXB 1CEWI 1VQ43 1N9EA 2HMKB 1IQYA 2ML6A 3LTCA 3X3XA 1YJW3 3WODG 1NJI4 2Y74A 1U5OA 3MYTA 1OPYA 1NWWA 3QK9A 4FMCA 2E2UA 4RZMA 3EBTA 3TDGA 2W03A 5CF1A 3DUKA 1RRLA 2Y73A 4H61A 1VQL3 3FKAA 3G0KA 5IERA 1Q40B 1MNLA 3FH1A 5IEPA 1QMAA 3AMOB 3N54B 4HM8B 3FGYA 2MF7A 3FCSB 3NXJA 1S5AA 2BMQB 1IU7A 3CME3 1OGXA 3OXAA 1QVF2 5CK6A 1QAKA 2W9QA 3FF2A 3RGRA 3EE1A 2A15A 5AYSC 3SX1A 3U97A 3X3ZA 4CDLA 1NB5I 3CCV3 4QWTA 3DGLA 2XR8B 2D42A 2HMOB 4R80A 4R1KA 2Z76A 3WA2X 1YJ93 3BB9A 1W6GA 5DRVA 3OW22 4H3UA 1J2BA 3MPHA 8CHOA 3NQYA 1JB4A 1M1XB 5KP4A 3F40A 1K8A4 3CC23 4GL6A 1O7HB 5JPUA 1EA2A 3K9MC 4N6OB 1AVLA 3ROBA 3JVCA 3OX9A 1ULIB 3SEDA 1EKMA 4KFEA 4G1MB 3CCJ3 2BMRB 2I9WA 2CWVA 3WMDA 3MKIA 1Q864 4AKYA 1VQM3 5IG4A 2OTL3 4ORLA 1JNQA 3LT8A 5EEOA 4EV5A 1VQN3 1ISKA 3BNEA 1W5ZA 4NREA 3HK4A 3EJVA 2XRXB 3EN8A 2F98A 3F7XA 2XSHB 3T8NA 3X41A 3DM8A 3KFQC 5AIFA 1W00A 5IW9A 5AIIA 4EBGA 4K1VA 2W04A 4LSOA 1YJN3 3OWSA 3CNXA 5BXQA 1NO3A 2KRTA 2GU3A 1KQS2 2WGOA 2HMNB 3NV0B 4KFDA 4LMIA 1AR0A 4OK0A 4N6TA 4OVMA 1EG9B 3OV4A 4KZ1A 1VQ93 3HZPA 1F8NA 1IVXA 5AEWB 2WGQA 3LXUX 1FGRA 1IVUA 5ELUA 3SXXA 4N6LA 5AIGA 2GEYA 2O9UX 1YHQ3 1FGQA 1LOXA 3T0UA 5KP1A 5IG5A 3CU3A 3HIIA 3G713 2W2CA 3UB1A 1US1A 3X42A 4HM3B 4R9LA 2XFTA 4PEJA 5G2GA 3H51A 4HM4B 3UL5A 1OACA 1FUWA 3D9RA 3JUMA 2CFKA 3EB8A 3L0RA 3NQZA 1G96A 4KVHA 1K9M4 2CFGA 3KN4A 1QAFA 1R4CA 1Z1SA 3F14A 2IUKA 2CWTA 4TX4A 3F9SA 4I4KA 4L8PA 3KE7A 5CLKA 4J8TA 4X2OA 3X40A 2OQEA 1SIIA 1OGZA 2GBWB 1WMNA 4K1UA 2HMLB 4HBRA 3S27A 3CCE3 2CFLA 2CIUA 3DY5A 3VGNA 5TGNA 3A76A 3MSOA 2OOVA 1PU4A 1VQ83 3X3YA 1Q42A 3S29A 1M9GA 1Q814 4LEHA 7STDA 1VQO3 4R4KA 1GD3A 2P09A 1UUWB 1JRQA 5AEUB 3FG3A 1PFPA 1JB5A 3Q90A 1MOLA 3B7CA 3GZRA 1FGTA 1SJWA 3SOYA 4KFFA 3DGMA 4LGQA 3V98A 4EC6A 4FMAA 1NU3A 1WMOA 3LOYA 1W7CA 1OHPA 4MMZB 2CH9A 4WFOA 3CCM3 2C10A 2RCDA 3WOEB 3PGBA 1ROVA 1A2VA 2GEXA 1D6ZA 1ULJB 2ML5A 4HM0B 5JBSA 3VF1A 1RJOA 1WQLB 4N6MA 1YGEA 3PS8A 4HJLB 2BMOB 1NB3I 3V99A 3CC73 3CCR3 3CNMA 4GB5A 3Q2PA 3KKGA 1C7HA 3FG1A 4O3VA 4N6UA 1TUHA 1DYUA 3B4PA 1OUNA 1L5GB 2YFIB 3F8XA 1O7NB 1SIHA 4N6NB 2V1LA 1LNHA 3NV0A 1O7MB 1IT8A 1IVVA 5EVHA 3DXOA 1OHOA 3DMCA 3I553 4HM5B 4O2HA 1ROAA 2CKFB 2P0XA 4WHAA 3FSDA 4XM4A 3EN1B 1TFOA 1QVG2 2W6JH 1EQKA 4EYCA 1HU9A 1N5HA 2CHCA 1JN5B 1OHSA 2P05A 4JF8A 3LTBA 4STDA 1T5YA 2RGQA 2CK3H 2STDA 4WP5A 2ZDJA 1CQSA 2IUJA 3LZAA 2W0QA 1O7WB 3WDGB 2E2TA 3I0YA 1KD14 1DMMA 4N3VA 3B4OA 3F8HA 3S5CA 3M8CA 3NUVA 1KC84 2PZVA 1JV2B 2ZL8A 3STDA 2XGLA 1VQ63 1W01A 1YI23 3D3LA 3BNDA 5STDA 4EV2A 2BHMA 4EXRA 1Y4KA 2L4VA 1FGMA 2INXA 2JQ5A 2OOVC 3NM7A 4LZIA 2CG1A 3KIIA 2P0MA 3U1WA 3BNCA 1V74A 3CPW2 2HMJB 1KWIA 3IJEB 5A0OB 1D6UA 1TP6A 2W9PA 3NHXA 1WTHA 1RKYA 2XH9A 1SPUA 2CWUA 2CFWA 3CCQ3 2B24B 3G8ZA 3MG3A 5CXOA 1CYUA 3MWZA 3K0ZA 3Q1CA 3EX9A 4O02B 4XDWA 3WA3A 4XB5A 1A67A 3NBRA 2JDIH 2WO0A 1W2ZA 2D1WA 3OWUA 4HZBB 4Q53A 1IK3A 2RFRA 1E97A 1E3RA 3LYGA 2UX0A 2XEPA 1W2B2 3VSYA 3GZYB 1VQ53 1ZX2A 3G6E3 1DVDA 3F7SA 3JUPA 3CD63 2CFDA 4IT7A 3GAXA 2R4IA 1UI7A 4X2HA 1KSIA 1K28A 1UI8A 1AVKA 1STDA 2IMJA 1NDOB 2OWPA 3CMA3 1GYBA 2C11A 5IF6A 3LT9A 4FR9A 3PCRA 3ALAA 2K54A 3PXMA 3S28A 3LMLA 3CCL3 2OCTA 4XBYA 5D83A 4BTWA 1S723 3JUNA 4XBTA 1DVCA 2SBLA 5AI1A 1D6YA 1ASKA 3KSED 4HYZA 2KXGA 1IT7A 2LYXA 3CPOA 3CCU3 1SQWA 2CC3A 3WOFB 5IG0A 1QALA 1VQK3 4IPBA 1IVWA 1FA3A 4N6V0 3EQQB 3QRDA 5LC7A 1JN5A 3GZXB 1LVNA 2KCDA 1Q7Y4 1UW1A 3V92A 5IENA 3FF0A 1GY5A 1W4NA 4HKVB 3CXC2 3S67A 5IEOA 2XF3A 5D81A 3JUQA 4MEIA 4K61A 2YX9A 4O8SA 4J9AA 5AYRB 3EBYA 1DMQA 4MMYB 2W56B 1RN7A 4HVNA 5EQLA 3SOAA 4FMDA 3SLUA 3DGOA 1OF5B 2Z77A 2BO9B 3CCS3 5I97A 3UL6A 4AKZA 1A2KA 1IDPA 3PCSA 1JJ22 1QJGA 1STFI 4HM7B 2CW9A 2B1XB 4FMBA 2M7OA 2Z6BA 1IV7A 4WYKA 4AEQA 3H3HA 2F86B 3SVAA 2Z7AA 1M1K4 2GXFA 2CG0A 1FGOA 2RSXA 3E99A 4OUQA 2FGTA 4L8OA 2QIYA 1O7PB 2E2VA 2K0MA 2XGNA 3MG1A 1AV4A 2GU1A 4XDVA 1GY7A 1K734 3G4S3 3J7Yd 2F99A 1N5PA 5FW5A 1JKGA 1JB2A 1GS3A 1Q824 3KSPA 2BNGA 1GD4A 4L7KA 3K7CA 3NBJA 2OQEC 3ER7A 1W6YA 4U13A 1M904 3G16A 3BNBA 2OTJ3 1N8QA 1UUVB 1BUQA 2WOFA 4FCJA 3UNLA 1LXEA 5D82A 3BLZA 2O3OA 5CF2A 3CC43 5KP3A 4BTYA 2FXTA 1W6CA 4WYKB 4XBXA 4RBNA 4HZ9B 4WWUC 1ZO2A 3MG2A 3IPTA 1K41A 2MC8A 2BT3A 2IA7A 4HM2B 3IMAB 1CYVA 3RGAA 1OCVA 3N9HA 3DGNA 1N9JA 3NBBA 5LC6A 1W02A 6STDA 3N8BA 1VZZA 3MHEA 4IIAA 3PYJA 1IV9A 4BTXA 1U8CB 2WOHA 2YFJB 3JUOA 4RNYA 3EHCA 5HGRA 2HMMB 4RNZA 1JKGB 2PNCA 3HX8A 4FCMA 4ZM8A 3RDEA 5IG3A 1IQ8A 3EF8A 4HM6B 2LQVA 3FLJA 1GY6A 1TFKA 3T8UA 4MJDA 2Q07A 3K63A 3K5TA 1TU5A 1N8R4 1E3VA 1HKXA 1WNHA 2GBXB 3NM2A 5AIHA 4CCVA 4K90B 3LTDA 4FCZA 1A90A 1IQXA 1YVBI 1WMPA 3LH4A 4JRFA 3I563 3GZBA 2W56A 3UJMA 3NX0A 3PZWA 4HM1B 1Q40A 1VQ73 3AMOA 3EC9A 2YFLB 3FZWA 2FNQA 1YIJ3 3HIGA 1VQP3 1OF5A 2QA43 3GWRA 3ECFA 1DMNA 1TIJA 5DREA 2XFSA 5ELJA 5BVBA 3GRDA 2XSOB 2QGUA 3O8YA 1RRHA 1OH0A 3FG4A 5JPPA 3KZTA 4NHFA 3HI7A 3LTAA 4R9KA 1YIT3 2P38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWY A;  3DZL A;  1O7G B;  3B8L A;  2HMK B;  1U5O A;  3MYT A;  1OPY A;  1NWW A;  4RZM A;  3EBT A;  5CF1 A;  3DUK A;  3FKA A;  3G0K A;  5IER A;  1Q40 B;  3FH1 A;  5IEP A;  1QMA A;  4HM8 B;  3FGY A;  3NXJ A;  1S5A A;  2BMQ B;  1OGX A;  3OXA A;  5CK6 A;  3FF2 A;  3RGR A;  2A15 A;  4CDL A;  2XR8 B;  2HMO B;  4R1K A;  2Z76 A;  3BB9 A;  5DRV A;  4H3U A;  8CHO A;  1JB4 A;  5KP4 A;  3F40 A;  1O7H B;  5JPU A;  1EA2 A;  3ROB A;  3OX9 A;  1ULI B;  3SED A;  2BMR B;  2I9W A;  3WMD A;  3MKI A;  5IG4 A;  4ORL A;  1ISK A;  3HK4 A;  3EJV A;  2XRX B;  3EN8 A;  2F98 A;  3T8N A;  2XSH B;  3F7X A;  3DM8 A;  5AIF A;  1W00 A;  5AII A;  4K1V A;  3OWS A;  3CNX A;  5BXQ A;  2HMN B;  3NV0 B;  4LMI A;  1AR0 A;  4OVM A;  1EG9 B;  3OV4 A;  3HZP A;  5AEW B;  5AIG A;  2GEY A;  5KP1 A;  5IG5 A;  3CU3 A;  2W2C A;  4HM3 B;  4R9L A;  4PEJ A;  5G2G A;  3H51 A;  4HM4 B;  3D9R A;  3JUM A;  4KVH A;  1Z1S A;  3F14 A;  3F9S A;  4I4K A;  4L8P A;  3KE7 A;  5CLK A;  4J8T A;  4X2O A;  1OGZ A;  2GBW B;  4K1U A;  2HML B;  3VGN A;  5TGN A;  3A76 A;  3MSO A;  1Q42 A;  4LEH A;  7STD A;  1UUW B;  5AEU B;  1JB5 A;  3Q90 A;  3B7C A;  3GZR A;  1SJW A;  3SOY A;  4LGQ A;  1NU3 A;  1OHP A;  2RCD A;  2GEX A;  1ULJ B;  4HM0 B;  1WQL B;  4HJL B;  2BMO B;  3CNM A;  4GB5 A;  3KKG A;  1C7H A;  1TUH A;  3B4P A;  1OUN A;  2YFI B;  3F8X A;  1O7N B;  3NV0 A;  1O7M B;  5EVH A;  3DXO A;  1OHO A;  3DMC A;  4HM5 B;  2CKF B;  3FSD A;  4XM4 A;  3EN1 B;  2CHC A;  1JN5 B;  1OHS A;  4STD A;  2RGQ A;  2STD A;  4WP5 A;  1CQS A;  3LZA A;  1O7W B;  3I0Y A;  1DMM A;  4N3V A;  3B4O A;  3F8H A;  3S5C A;  3M8C A;  3NUV A;  2PZV A;  3STD A;  1W01 A;  5STD A;  2INX A;  2JQ5 A;  2HMJ B;  1TP6 A;  3NHX A;  2B24 B;  3G8Z A;  3MG3 A;  5CXO A;  3K0Z A;  3EX9 A;  4XDW A;  4XB5 A;  3NBR A;  3OWU A;  4HZB B;  4Q53 A;  2RFR A;  1E97 A;  1E3R A;  3LYG A;  2UX0 A;  3VSY A;  3GZY B;  1ZX2 A;  3F7S A;  3JUP A;  2R4I A;  4X2H A;  1STD A;  2IMJ A;  1NDO B;  2OWP A;  1GYB A;  5IF6 A;  2K54 A;  4XBY A;  5D83 A;  3JUN A;  4XBT A;  5AI1 A;  1ASK A;  3CPO A;  5IG0 A;  3EQQ B;  1JN5 A;  3GZX B;  5IEN A;  3FF0 A;  1GY5 A;  4HKV B;  5IEO A;  5D81 A;  3JUQ A;  4J9A A;  3EBY A;  1DMQ A;  4HVN A;  3SOA A;  1OF5 B;  2Z77 A;  1A2K A;  1IDP A;  1QJG A;  4HM7 B;  2B1X B;  4WYK A;  3H3H A;  2F86 B;  2Z7A A;  2GXF A;  3E99 A;  4OUQ A;  4L8O A;  2QIY A;  1O7P B;  3MG1 A;  4XDV A;  1GY7 A;  2F99 A;  5FW5 A;  1JKG A;  1JB2 A;  1GS3 A;  3KSP A;  2BNG A;  4L7K A;  3K7C A;  3ER7 A;  4U13 A;  1W6Y A;  3G16 A;  1UUV B;  1BUQ A;  4FCJ A;  3UNL A;  5D82 A;  3BLZ A;  5CF2 A;  5KP3 A;  4WYK B;  4XBX A;  4HZ9 B;  4WWU C;  1ZO2 A;  3MG2 A;  3IPT A;  1K41 A;  4HM2 B;  3RGA A;  1OCV A;  1W02 A;  6STD A;  1VZZ A;  3MHE A;  4IIA A;  2YFJ B;  3JUO A;  3EHC A;  5HGR A;  2HMM B;  1JKG B;  3HX8 A;  4FCM A;  5IG3 A;  3EF8 A;  4HM6 B;  3FLJ A;  1GY6 A;  3T8U A;  4MJD A;  1E3V A;  1HKX A;  2GBX B;  3NM2 A;  5AIH A;  3GZB A;  3UJM A;  4HM1 B;  1Q40 A;  3EC9 A;  2YFL B;  3FZW A;  1OF5 A;  3GWR A;  3ECF A;  1DMN A;  5DRE A;  5BVB A;  3GRD A;  2XSO B;  2QGU A;  1OH0 A;  5JPP A;  3KZT A;  4R9K A; 
#chains in the Genus database with same CATH topology
 3OWY A;  2QEX 3;  1DET A;  3DZL A;  1O7G B;  5FGO A;  3B8L A;  2F56 A;  4MMX B;  1UGI A;  1PY3 A;  1CEW I;  1VQ4 3;  1N9E A;  2HMK B;  1IQY A;  2ML6 A;  3LTC A;  3X3X A;  1YJW 3;  3WOD G;  2R41 A;  2Y74 A;  1U5O A;  1NJI 4;  3MYT A;  1OPY A;  1FYS A;  1NWW A;  3AGN A;  3QK9 A;  2E2U A;  4FMC A;  1T2H A;  3EBT A;  2W03 A;  4RZM A;  3DUK A;  3TDG A;  2CX0 A;  5CF1 A;  1V57 A;  1RRL A;  4BL2 A;  2Y73 A;  4H61 A;  1VQL 3;  3FKA A;  3G0K A;  5IER A;  1Q40 B;  1MNL A;  1RGG A;  3FH1 A;  5IEP A;  1QMA A;  3AMO B;  3N54 B;  4HM8 B;  3FGY A;  2MF7 A;  3FCS B;  2BIR A;  3NXJ A;  1S5A A;  2BMQ B;  1IU7 A;  3CME 3;  1OGX A;  3OXA A;  1RGE A;  1X1U A;  2IY2 A;  1QVF 2;  5CK6 A;  1QAK A;  2W9Q A;  3FF2 A;  3RGR A;  3EE1 A;  2A15 A;  5AYS C;  3SX1 A;  2UUG C;  3U97 A;  3X3Z A;  4CDL A;  1NB5 I;  1B2M A;  3CCV 3;  4QWT A;  1JBS A;  3DGL A;  2XR8 B;  2D42 A;  2HMO B;  4R80 A;  4R1K A;  1GOV A;  2Z76 A;  3WA2 X;  1YJ9 3;  3BB9 A;  1W6G A;  5DRV A;  3OW2 2;  1RNB A;  4H3U A;  1J2B A;  3MPH A;  8CHO A;  3NQY A;  1JB4 A;  1JZO A;  1M1X B;  5KP4 A;  3F40 A;  1K8A 4;  3CC2 3;  2BU4 A;  4GL6 A;  1O7H B;  3D5I A;  5JPU A;  1EA2 A;  1B2S A;  3K9M C;  4N6O B;  1AVL A;  4RNT A;  5GSP A;  3ROB A;  3JVC A;  1RGA A;  1TRQ A;  1ULI B;  3OX9 A;  3SED A;  1I2E A;  1EKM A;  4KFE A;  4G1M B;  3CCJ 3;  2BMR B;  4BL3 A;  2I9W A;  2CWV A;  3WMD A;  3MKI A;  1Q86 4;  4AKY A;  1VQM 3;  2KF4 A;  5IG4 A;  2OTL 3;  4ORL A;  1RHL A;  1JNQ A;  3LT8 A;  5EEO A;  4EV5 A;  9RNT A;  1VQN 3;  1ISK A;  3BNE A;  1W5Z A;  3HOH A;  4NRE A;  3HK4 A;  3EJV A;  3WR2 A;  2XRX B;  3EN8 A;  2F98 A;  1BOX A;  2XSH B;  1B2U A;  3F7X A;  3T8N A;  3X41 A;  2IYJ A;  3DM8 A;  3KFQ C;  4GSP A;  1JBT A;  5AIF A;  1W00 A;  5IW9 A;  1RLS A;  2KF5 A;  5AII A;  4EBG A;  4K1V A;  2W04 A;  4LSO A;  1YJN 3;  3OWS A;  3CNX A;  5BXQ A;  1NO3 A;  2KRT A;  2GU3 A;  1KQS 2;  1I8V A;  2WGO A;  2HMN B;  3NV0 B;  4KFD A;  4LMI A;  1AR0 A;  4OK0 A;  4N6T A;  4OVM A;  1EG9 B;  3OV4 A;  4KZ1 A;  1UUG B;  1VQ9 3;  3HZP A;  1F8N A;  1IVX A;  5AEW B;  2WGQ A;  3LXU X;  1FGR A;  1IVU A;  5ELU A;  3SXX A;  4N6L A;  5AIG A;  2GEY A;  2O9U X;  1YHQ 3;  1FGQ A;  1LOX A;  3T0U A;  5KP1 A;  5IG5 A;  3CU3 A;  3HII A;  3G71 3;  2W2C A;  3ZG0 A;  3UB1 A;  1US1 A;  3X42 A;  4HM3 B;  2F4Y A;  4R9L A;  1B2Z A;  2XFT A;  1GSP A;  1G02 A;  4PEJ A;  4BIR A;  5G2G A;  3H51 A;  4HM4 B;  3UL5 A;  1OAC A;  1FUW A;  3D9R A;  3JUM A;  2CFK A;  3EB8 A;  3L0R A;  3NQZ A;  1G96 A;  4KVH A;  1K9M 4;  2CFG A;  3KN4 A;  1QAF A;  1R4C A;  1Z1S A;  3F14 A;  2IUK A;  2CWT A;  4J5K A;  3F9S A;  4TX4 A;  4I4K A;  4L8P A;  5HOH A;  3KE7 A;  2H0G A;  4ILF A;  5CLK A;  1RCK A;  1CH0 A;  4J8T A;  4X2O A;  3WHO A;  2OQE A;  1SII A;  1OGZ A;  2GBW B;  2H0I A;  3X40 A;  1WMN A;  1LOW A;  1SAR A;  4K1U A;  5G1K A;  2HML B;  4HBR A;  1BRI A;  3S27 A;  7RNT A;  3CCE 3;  2CFL A;  1UDI I;  2CIU A;  3DY5 A;  3VGN A;  5TGN A;  3A76 A;  3MSO A;  2ZHX B;  3Q3F A;  2OOV A;  1PU4 A;  1VQ8 3;  3X3Y A;  1FUT A;  1Q42 A;  1HZ1 A;  3S29 A;  1M9G A;  1Q81 4;  4LEH A;  7STD A;  1VQO 3;  4R4K A;  1GD3 A;  4LYL B;  2P09 A;  1UUW B;  1JRQ A;  1UGH I;  5AEU B;  3FG3 A;  1PFP A;  1JB5 A;  1HYF A;  1X1W A;  3Q90 A;  1NNV A;  1I3F A;  1I70 A;  1MOL A;  3B7C A;  1RN4 A;  3GZR A;  1FGT A;  1SJW A;  2L1S A;  3SOY A;  4KFF A;  2GSP A;  3DGM A;  4LGQ A;  3V98 A;  4EC6 A;  1LOY A;  4FMA A;  1NU3 A;  1WMO A;  3LOY A;  1W7C A;  1OHP A;  3AHS A;  2CH9 A;  3DGY A;  4GHO A;  4MMZ B;  2C10 A;  4WFO A;  5M19 A;  2RCD A;  4NPB A;  1I2F A;  3WOE B;  3PGB A;  1ROV A;  1A2V A;  2GEX A;  1D6Z A;  1ULJ B;  2ML5 A;  4HM0 B;  5JBS A;  3CCM 3;  2ZA4 A;  1RJO A;  1WQL B;  4N6M A;  3VF1 A;  4DKI A;  3GSP A;  1BNG A;  1YGE A;  3PS8 A;  4HJL B;  2BMO B;  1NB3 I;  3V99 A;  3CC7 3;  3CCR 3;  1RSN A;  3CNM A;  4GB5 A;  3Q2P A;  3KKG A;  1C7H A;  1BRH A;  3FG1 A;  4O3V A;  4N6U A;  1TUH A;  1DYU A;  3B4P A;  1OUN A;  1L5G B;  1Q7H A;  2YFI B;  3F8X A;  1O7N B;  1SIH A;  4N6N B;  2V1L A;  1LNH A;  3NV0 A;  2H0H A;  1BAO A;  1O7M B;  1IT8 A;  1IVV A;  2SAR A;  3DXO A;  1OHO A;  1T3B A;  3DMC A;  5EVH A;  3I55 3;  2CX1 A;  2F5W A;  4CPK A;  1B3S A;  4HM5 B;  2KF3 A;  1LOV A;  4O2H A;  1ROA A;  4BU4 A;  2CKF B;  2P0X A;  4WHA A;  3FSD A;  2UGI A;  1BSB A;  3EN1 B;  4XM4 A;  1TFO A;  2C4B A;  3ZG5 A;  1QVG 2;  3AHW A;  2W6J H;  1EQK A;  1MWS A;  1R4Y A;  4EYC A;  1HU9 A;  1N5H A;  2CHC A;  1JBR A;  1JN5 B;  1GMQ A;  2KF6 A;  1OHS A;  2P05 A;  4JF8 A;  3LTB A;  4STD A;  1T5Y A;  2RGQ A;  2CK3 H;  2STD A;  4WP5 A;  2ZDJ A;  1CQS A;  2IUJ A;  3LZA A;  2W0Q A;  3ZFZ A;  1O7W B;  3WDG B;  2E2T A;  3I0Y A;  1KD1 4;  1DMM A;  1YVS A;  4N3V A;  3B4O A;  3F8H A;  3S5C A;  3M8C A;  3NUV A;  1KC8 4;  2PZV A;  1JV2 B;  2ZL8 A;  3STD A;  2XGL A;  1VQ6 3;  1BGS A;  1W01 A;  1YI2 3;  3D3L A;  3BND A;  5STD A;  4EV2 A;  2BHM A;  6RNT A;  1FW7 A;  4EXR A;  1EUI C;  1Y4K A;  2L4V A;  1FGM A;  2INX A;  2JQ5 A;  2OOV C;  3NM7 A;  4HOH A;  4LZI A;  2CG1 A;  3KII A;  2P0M A;  3U1W A;  3BNC A;  1V74 A;  3CPW 2;  2HMJ B;  1KWI A;  1BNE A;  3IJE B;  5A0O B;  1D6U A;  1TP6 A;  2W9P A;  3NHX A;  1WTH A;  1RKY A;  2XH9 A;  1BNS A;  1SPU A;  3DH2 A;  2CWU A;  2CFW A;  3CCQ 3;  2B24 B;  3G8Z A;  3MG3 A;  5CXO A;  1CYU A;  3MWZ A;  3K0Z A;  3Q1C A;  3EX9 A;  3URP A;  1BNF A;  1B21 A;  4O02 B;  4XDW A;  3WA3 A;  4XB5 A;  1EEJ A;  1A67 A;  1Q9E A;  3NBR A;  2JDI H;  2WO0 A;  1W2Z A;  2D1W A;  3OWU A;  4HZB B;  4Q53 A;  8RNT A;  1IK3 A;  2RFR A;  1E97 A;  1E3R A;  3LYG A;  2UX0 A;  2XEP A;  1BRN L;  1W2B 2;  1FUS A;  3VSY A;  3GZY B;  1VQ5 3;  1ZX2 A;  3G6E 3;  1DVD A;  2AAE A;  3F7S A;  3JUP A;  3CD6 3;  2CFD A;  4IT7 A;  3GAX A;  5RNT A;  2R4I A;  1BRG A;  1BU4 A;  1UI7 A;  4X2H A;  1KSI A;  1K28 A;  1UI8 A;  1AVK A;  1STD A;  1LQM B;  2IMJ A;  1NDO B;  1ZS7 A;  2OWP A;  1GYB A;  3CMA 3;  2C11 A;  5IF6 A;  4CJN A;  3LT9 A;  3A5E A;  3D4A A;  3D79 A;  4FR9 A;  3PCR A;  3ALA A;  2K54 A;  3PXM A;  3S28 A;  3LML A;  3CCL 3;  2OCT A;  4XBY A;  5D83 A;  4BTW A;  1S72 3;  3JUN A;  4XBT A;  1DVC A;  1RMS A;  2SBL A;  5AI1 A;  1JZD A;  1D6Y A;  1ASK A;  3KSE D;  4HYZ A;  2KXG A;  1IT7 A;  2LYX A;  3CPO A;  3CCU 3;  1SQW A;  2CC3 A;  1MWR A;  1RGL A;  3WOF B;  5IG0 A;  1QAL A;  1VQK 3;  4IPB A;  1IVW A;  1FA3 A;  1RGK A;  3EQQ B;  3QRD A;  4N6V 0;  1JN5 A;  5LC7 A;  3GZX B;  1LVN A;  2KCD A;  1Q7Y 4;  1UW1 A;  1T2I A;  3V92 A;  5IEN A;  4J5G A;  3FF0 A;  1BNJ A;  1GY5 A;  1W4N A;  4HKV B;  3CXC 2;  3S67 A;  5IEO A;  2XF3 A;  5D81 A;  1VQQ A;  3JUQ A;  4MEI A;  4K61 A;  2YX9 A;  1BSE A;  4O8S A;  4J9A A;  5AYR B;  3EBY A;  1DMQ A;  1I3I A;  4MMY B;  1BNI A;  2W56 B;  1RN7 A;  1DE3 A;  4HVN A;  5EQL A;  3SOA A;  1RN1 A;  1RGC A;  3KCH A;  4FMD A;  3SLU A;  3DGO A;  1AY7 A;  1OF5 B;  2Z77 A;  2BO9 B;  3AGO A;  3CCS 3;  5I97 A;  3UL6 A;  4AKZ A;  1A2K A;  1IDP A;  3PCS A;  1JJ2 2;  1QJG A;  1STF I;  4HM7 B;  5BU4 A;  1RCL A;  2CW9 A;  2B1X B;  4FMB A;  2M7O A;  2Z6B A;  1IV7 A;  4WYK A;  4AEQ A;  3H3H A;  2F86 B;  3SVA A;  2Z7A A;  1M1K 4;  2GXF A;  2CG0 A;  1FGO A;  2RSX A;  3E99 A;  4OUQ A;  2FGT A;  4L8O A;  2QIY A;  1O7P B;  2E2V A;  2K0M A;  2XGN A;  1BSC A;  1UCL A;  1AV4 A;  3BU4 A;  3MG1 A;  2GU1 A;  4XDV A;  1GY7 A;  1TRP A;  1K73 4;  1MWU A;  1RGF A;  3G4S 3;  3J7Y d;  2F99 A;  1N5P A;  1LQG C;  5FW5 A;  1JKG A;  4HAA A;  1JB2 A;  1C54 A;  1GS3 A;  3SYU A;  1Q82 4;  1A2P A;  2BNG A;  1GD4 A;  3KSP A;  4L7K A;  5M18 A;  1TJD A;  3K7C A;  3NBJ A;  1RGH A;  2OQE C;  3ER7 A;  1W6Y A;  4U13 A;  5M1A A;  1M90 4;  3G16 A;  1YGW A;  3BNB A;  2OTJ 3;  1GMP A;  1N8Q A;  1UUV B;  1BUQ A;  1YNV X;  2WOF A;  4FCJ A;  1RDS A;  3UNL A;  1X1Y A;  1LXE A;  5D82 A;  3BLZ A;  2O3O A;  3BIR A;  5CF2 A;  3CC4 3;  5KP3 A;  3RNT A;  4BTY A;  2FXT A;  1W6C A;  4WYK B;  4XBX A;  4RBN A;  1IYY A;  4HZ9 B;  4WWU C;  1ZO2 A;  3MG2 A;  1RTU A;  3IPT A;  1K41 A;  1I0X A;  2J8X B;  2MC8 A;  2BT3 A;  2KAA A;  1BRS A;  5G1L A;  6GSP A;  1ZGX A;  2IA7 A;  4HM2 B;  3IMA B;  1CYV A;  1MWT A;  3RGA A;  1B2X A;  1OCV A;  1BAN A;  3DGN A;  1N9J A;  3N9H A;  3NBB A;  1W02 A;  5LC6 A;  6STD A;  3N8B A;  1I2G A;  1VZZ A;  3MHE A;  5BIR A;  4IIA A;  3PYJ A;  1IV9 A;  4BTX A;  1U8C B;  2WOH A;  2YFJ B;  3JUO A;  4RNY A;  3EHC A;  5HGR A;  2HMM B;  4RNZ A;  1JKG B;  1RNT A;  2K3D A;  2RNT A;  2PNC A;  3HX8 A;  1V58 A;  4FCM A;  4ZM8 A;  3RDE A;  5IG3 A;  1IQ8 A;  1I0V A;  3EF8 A;  4HM6 B;  2LQV A;  1BIR A;  1MGR A;  2F5M A;  3FLJ A;  1GY6 A;  1TFK A;  4KT3 B;  3T8U A;  4MJD A;  2Q07 A;  3K63 A;  3K5T A;  4I5Q A;  1TU5 A;  1N8R 4;  1E3V A;  1HKX A;  1WNH A;  2GBX B;  3NM2 A;  5AIH A;  1BRJ A;  1LNI A;  4CCV A;  1G0T A;  4K90 B;  3LTD A;  4FCZ A;  1BRK A;  1X1X A;  1A90 A;  1IQX A;  4EW5 A;  1UCK A;  1YVB I;  1BUJ A;  1PYL A;  1UCJ A;  1WMP A;  3LH4 A;  4JRF A;  3GZB A;  2W56 A;  3I56 3;  3UJM A;  1BSD A;  3NX0 A;  1B20 A;  3PZW A;  4HM1 B;  1Q40 A;  7GSP A;  1VQ7 3;  3AMO A;  3EC9 A;  2YFL B;  3FZW A;  1AQZ A;  1GMR A;  1UCI A;  2AAD A;  2FNQ A;  3HIG A;  1VQP 3;  1OF5 A;  1YIJ 3;  2QA4 3;  3GWR A;  3ECF A;  1DMN A;  1TIJ A;  5DRE A;  1BNR A;  2XFS A;  1B27 A;  1TTO A;  5ELJ A;  5BVB A;  3GRD A;  2XSO B;  1LRA A;  2RBI A;  2QGU A;  3O8Y A;  1RRH A;  1OH0 A;  3FG4 A;  1GOY A;  5JPP A;  3KZT A;  3D5G A;  1GOU A;  4NHF A;  1MGW A;  3HI7 A;  3LTA A;  1BSA A;  4R9K A;  1FZU A;  1YIT 3;  1BVI A;  2P38 A;  2HOH A; 
#chains in the Genus database with same CATH homology
 3OWY A;  2QEX 3;  3DZL A;  1O7G B;  5FGO A;  3B8L A;  4MMX B;  1CEW I;  1VQ4 3;  1N9E A;  2HMK B;  1IQY A;  2ML6 A;  3LTC A;  3X3X A;  1YJW 3;  3WOD G;  1NJI 4;  2Y74 A;  1U5O A;  3MYT A;  1OPY A;  1NWW A;  3QK9 A;  4FMC A;  2E2U A;  4RZM A;  3EBT A;  3TDG A;  2W03 A;  5CF1 A;  3DUK A;  1RRL A;  2Y73 A;  4H61 A;  1VQL 3;  3FKA A;  3G0K A;  5IER A;  1Q40 B;  1MNL A;  3FH1 A;  5IEP A;  1QMA A;  3AMO B;  3N54 B;  4HM8 B;  3FGY A;  2MF7 A;  3FCS B;  3NXJ A;  1S5A A;  2BMQ B;  1IU7 A;  3CME 3;  1OGX A;  3OXA A;  1QVF 2;  5CK6 A;  1QAK A;  2W9Q A;  3FF2 A;  3RGR A;  3EE1 A;  2A15 A;  5AYS C;  3SX1 A;  3U97 A;  3X3Z A;  4CDL A;  1NB5 I;  3CCV 3;  4QWT A;  3DGL A;  2XR8 B;  2D42 A;  2HMO B;  4R80 A;  4R1K A;  2Z76 A;  3WA2 X;  1YJ9 3;  3BB9 A;  1W6G A;  5DRV A;  3OW2 2;  4H3U A;  1J2B A;  3MPH A;  8CHO A;  3NQY A;  1JB4 A;  1M1X B;  5KP4 A;  3F40 A;  1K8A 4;  3CC2 3;  4GL6 A;  1O7H B;  5JPU A;  1EA2 A;  3K9M C;  4N6O B;  1AVL A;  3ROB A;  3JVC A;  3OX9 A;  1ULI B;  3SED A;  1EKM A;  4KFE A;  4G1M B;  3CCJ 3;  2BMR B;  2I9W A;  2CWV A;  3WMD A;  3MKI A;  1Q86 4;  4AKY A;  1VQM 3;  5IG4 A;  2OTL 3;  4ORL A;  1JNQ A;  3LT8 A;  5EEO A;  4EV5 A;  1VQN 3;  1ISK A;  3BNE A;  1W5Z A;  4NRE A;  3HK4 A;  3EJV A;  2XRX B;  3EN8 A;  2F98 A;  3F7X A;  2XSH B;  3T8N A;  3X41 A;  3DM8 A;  3KFQ C;  5AIF A;  1W00 A;  5IW9 A;  5AII A;  4EBG A;  4K1V A;  2W04 A;  4LSO A;  1YJN 3;  3OWS A;  3CNX A;  5BXQ A;  1NO3 A;  2KRT A;  2GU3 A;  1KQS 2;  2WGO A;  2HMN B;  3NV0 B;  4KFD A;  4LMI A;  1AR0 A;  4OK0 A;  4N6T A;  4OVM A;  1EG9 B;  3OV4 A;  4KZ1 A;  1VQ9 3;  3HZP A;  1F8N A;  1IVX A;  5AEW B;  2WGQ A;  3LXU X;  1FGR A;  1IVU A;  5ELU A;  3SXX A;  4N6L A;  5AIG A;  2GEY A;  2O9U X;  1YHQ 3;  1FGQ A;  1LOX A;  3T0U A;  5KP1 A;  5IG5 A;  3CU3 A;  3HII A;  3G71 3;  2W2C A;  3UB1 A;  1US1 A;  3X42 A;  4HM3 B;  4R9L A;  2XFT A;  4PEJ A;  5G2G A;  3H51 A;  4HM4 B;  3UL5 A;  1OAC A;  1FUW A;  3D9R A;  3JUM A;  2CFK A;  3EB8 A;  3L0R A;  3NQZ A;  1G96 A;  4KVH A;  1K9M 4;  2CFG A;  3KN4 A;  1QAF A;  1R4C A;  1Z1S A;  3F14 A;  2IUK A;  2CWT A;  4TX4 A;  3F9S A;  4I4K A;  4L8P A;  3KE7 A;  5CLK A;  4J8T A;  4X2O A;  3X40 A;  2OQE A;  1SII A;  1OGZ A;  2GBW B;  1WMN A;  4K1U A;  2HML B;  4HBR A;  3S27 A;  3CCE 3;  2CFL A;  2CIU A;  3DY5 A;  3VGN A;  5TGN A;  3A76 A;  3MSO A;  2OOV A;  1PU4 A;  1VQ8 3;  3X3Y A;  1Q42 A;  3S29 A;  1M9G A;  1Q81 4;  4LEH A;  7STD A;  1VQO 3;  4R4K A;  1GD3 A;  2P09 A;  1UUW B;  1JRQ A;  5AEU B;  3FG3 A;  1PFP A;  1JB5 A;  3Q90 A;  1MOL A;  3B7C A;  3GZR A;  1FGT A;  1SJW A;  3SOY A;  4KFF A;  3DGM A;  4LGQ A;  3V98 A;  4EC6 A;  4FMA A;  1NU3 A;  1WMO A;  3LOY A;  1W7C A;  1OHP A;  4MMZ B;  2CH9 A;  4WFO A;  3CCM 3;  2C10 A;  2RCD A;  3WOE B;  3PGB A;  1ROV A;  1A2V A;  2GEX A;  1D6Z A;  1ULJ B;  2ML5 A;  4HM0 B;  5JBS A;  3VF1 A;  1RJO A;  1WQL B;  4N6M A;  1YGE A;  3PS8 A;  4HJL B;  2BMO B;  1NB3 I;  3V99 A;  3CC7 3;  3CCR 3;  3CNM A;  4GB5 A;  3Q2P A;  3KKG A;  1C7H A;  3FG1 A;  4O3V A;  4N6U A;  1TUH A;  1DYU A;  3B4P A;  1OUN A;  1L5G B;  2YFI B;  3F8X A;  1O7N B;  1SIH A;  4N6N B;  2V1L A;  1LNH A;  3NV0 A;  1O7M B;  1IT8 A;  1IVV A;  5EVH A;  3DXO A;  1OHO A;  3DMC A;  3I55 3;  4HM5 B;  4O2H A;  1ROA A;  2CKF B;  2P0X A;  4WHA A;  3FSD A;  4XM4 A;  3EN1 B;  1TFO A;  1QVG 2;  2W6J H;  1EQK A;  4EYC A;  1HU9 A;  1N5H A;  2CHC A;  1JN5 B;  1OHS A;  2P05 A;  4JF8 A;  3LTB A;  4STD A;  1T5Y A;  2RGQ A;  2CK3 H;  2STD A;  4WP5 A;  2ZDJ A;  1CQS A;  2IUJ A;  3LZA A;  2W0Q A;  1O7W B;  3WDG B;  2E2T A;  3I0Y A;  1KD1 4;  1DMM A;  4N3V A;  3B4O A;  3F8H A;  3S5C A;  3M8C A;  3NUV A;  1KC8 4;  2PZV A;  1JV2 B;  2ZL8 A;  3STD A;  2XGL A;  1VQ6 3;  1W01 A;  1YI2 3;  3D3L A;  3BND A;  5STD A;  4EV2 A;  2BHM A;  4EXR A;  1Y4K A;  2L4V A;  1FGM A;  2INX A;  2JQ5 A;  2OOV C;  3NM7 A;  4LZI A;  2CG1 A;  3KII A;  2P0M A;  3U1W A;  3BNC A;  1V74 A;  3CPW 2;  2HMJ B;  1KWI A;  3IJE B;  5A0O B;  1D6U A;  1TP6 A;  2W9P A;  3NHX A;  1WTH A;  1RKY A;  2XH9 A;  1SPU A;  2CWU A;  2CFW A;  3CCQ 3;  2B24 B;  3G8Z A;  3MG3 A;  5CXO A;  1CYU A;  3MWZ A;  3K0Z A;  3Q1C A;  3EX9 A;  4O02 B;  4XDW A;  3WA3 A;  4XB5 A;  1A67 A;  3NBR A;  2JDI H;  2WO0 A;  1W2Z A;  2D1W A;  3OWU A;  4HZB B;  4Q53 A;  1IK3 A;  2RFR A;  1E97 A;  1E3R A;  3LYG A;  2UX0 A;  2XEP A;  1W2B 2;  3VSY A;  3GZY B;  1VQ5 3;  1ZX2 A;  3G6E 3;  1DVD A;  3F7S A;  3JUP A;  3CD6 3;  2CFD A;  4IT7 A;  3GAX A;  2R4I A;  1UI7 A;  4X2H A;  1KSI A;  1K28 A;  1UI8 A;  1AVK A;  1STD A;  2IMJ A;  1NDO B;  2OWP A;  3CMA 3;  1GYB A;  2C11 A;  5IF6 A;  3LT9 A;  4FR9 A;  3PCR A;  3ALA A;  2K54 A;  3PXM A;  3S28 A;  3LML A;  3CCL 3;  2OCT A;  4XBY A;  5D83 A;  4BTW A;  1S72 3;  3JUN A;  4XBT A;  1DVC A;  2SBL A;  5AI1 A;  1D6Y A;  1ASK A;  3KSE D;  4HYZ A;  2KXG A;  1IT7 A;  2LYX A;  3CPO A;  3CCU 3;  1SQW A;  2CC3 A;  3WOF B;  5IG0 A;  1QAL A;  1VQK 3;  4IPB A;  1IVW A;  1FA3 A;  4N6V 0;  3EQQ B;  3QRD A;  5LC7 A;  1JN5 A;  3GZX B;  1LVN A;  2KCD A;  1Q7Y 4;  1UW1 A;  3V92 A;  5IEN A;  3FF0 A;  1GY5 A;  1W4N A;  4HKV B;  3CXC 2;  3S67 A;  5IEO A;  2XF3 A;  5D81 A;  3JUQ A;  4MEI A;  4K61 A;  2YX9 A;  4O8S A;  4J9A A;  5AYR B;  3EBY A;  1DMQ A;  4MMY B;  2W56 B;  1RN7 A;  4HVN A;  5EQL A;  3SOA A;  4FMD A;  3SLU A;  3DGO A;  1OF5 B;  2Z77 A;  2BO9 B;  3CCS 3;  5I97 A;  3UL6 A;  4AKZ A;  1A2K A;  1IDP A;  3PCS A;  1JJ2 2;  1QJG A;  1STF I;  4HM7 B;  2CW9 A;  2B1X B;  4FMB A;  2M7O A;  2Z6B A;  1IV7 A;  4WYK A;  4AEQ A;  3H3H A;  2F86 B;  3SVA A;  2Z7A A;  1M1K 4;  2GXF A;  2CG0 A;  1FGO A;  2RSX A;  3E99 A;  4OUQ A;  2FGT A;  4L8O A;  2QIY A;  1O7P B;  2E2V A;  2K0M A;  2XGN A;  3MG1 A;  1AV4 A;  2GU1 A;  4XDV A;  1GY7 A;  1K73 4;  3G4S 3;  3J7Y d;  2F99 A;  1N5P A;  5FW5 A;  1JKG A;  1JB2 A;  1GS3 A;  1Q82 4;  3KSP A;  2BNG A;  1GD4 A;  4L7K A;  3K7C A;  3NBJ A;  2OQE C;  3ER7 A;  1W6Y A;  4U13 A;  1M90 4;  3G16 A;  3BNB A;  2OTJ 3;  1N8Q A;  1UUV B;  1BUQ A;  2WOF A;  4FCJ A;  3UNL A;  1LXE A;  5D82 A;  3BLZ A;  2O3O A;  5CF2 A;  3CC4 3;  5KP3 A;  4BTY A;  2FXT A;  1W6C A;  4WYK B;  4XBX A;  4RBN A;  4HZ9 B;  4WWU C;  1ZO2 A;  3MG2 A;  3IPT A;  1K41 A;  2MC8 A;  2BT3 A;  2IA7 A;  4HM2 B;  3IMA B;  1CYV A;  3RGA A;  1OCV A;  3N9H A;  3DGN A;  1N9J A;  3NBB A;  5LC6 A;  1W02 A;  6STD A;  3N8B A;  1VZZ A;  3MHE A;  4IIA A;  3PYJ A;  1IV9 A;  4BTX A;  1U8C B;  2WOH A;  2YFJ B;  3JUO A;  4RNY A;  3EHC A;  5HGR A;  2HMM B;  4RNZ A;  1JKG B;  2PNC A;  3HX8 A;  4FCM A;  4ZM8 A;  3RDE A;  5IG3 A;  1IQ8 A;  3EF8 A;  4HM6 B;  2LQV A;  3FLJ A;  1GY6 A;  1TFK A;  3T8U A;  4MJD A;  2Q07 A;  3K63 A;  3K5T A;  1TU5 A;  1N8R 4;  1E3V A;  1HKX A;  1WNH A;  2GBX B;  3NM2 A;  5AIH A;  4CCV A;  4K90 B;  3LTD A;  4FCZ A;  1A90 A;  1IQX A;  1YVB I;  1WMP A;  3LH4 A;  4JRF A;  3I56 3;  3GZB A;  2W56 A;  3UJM A;  3NX0 A;  3PZW A;  4HM1 B;  1Q40 A;  1VQ7 3;  3AMO A;  3EC9 A;  2YFL B;  3FZW A;  2FNQ A;  1YIJ 3;  3HIG A;  1VQP 3;  1OF5 A;  2QA4 3;  3GWR A;  3ECF A;  1DMN A;  1TIJ A;  5DRE A;  2XFS A;  5ELJ A;  5BVB A;  3GRD A;  2XSO B;  2QGU A;  3O8Y A;  1RRH A;  1OH0 A;  3FG4 A;  5JPP A;  3KZT A;  4NHF A;  3HI7 A;  3LTA A;  4R9K A;  1YIT 3;  2P38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...