1Q40A

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
165
Chain Sequence
QDPTQQLEPFLKRFLASLDLLYTQSQPFPNVESYATQLGSNLKRSSAIIVNGQPIIPSPQEDCKLQFQKKWLQTPLSSHQLTSYDGHLIPGTGTFVVHFSAKVRFDQSGRNRLGESADLFQENNQRPIWGSWFGVDVNLVVDENVMQDGEIINSMDYRFTYVPND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
total genus 43
structure length 165
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40A00
3MG3A 1ULIB 4LMIA 4X2HA 4PEJA 2CHCA 1GY6A 2UX0A 5D81A 1OF5A 1NWWA 1Q40B 4FCJA 1JB2A 3OXAA 2B24B 2YFLB 2QIYA 2Z7AA 4K1VA 4L8PA 3MG2A 1Q42A 3DMCA 5IG4A 4HZBB 3DXOA 3LYGA 1O7WB 1OGZA 3IPTA 2BMQB 4XB5A 4HZ9B 1EA2A 5CF1A 1K41A 3OX9A 1W6YA 3KKGA 3G16A 2W2CA 5FW5A 5KP4A 1O7HB 3NM2A 2B1XB 4LEHA 5AIGA 1WQLB 3UJMA 3HK4A 3HX8A 4XBTA 5DRVA 2Z76A 3B7CA 2GXFA 2I9WA 3EC9A 3KE7A 1NU3A 3EBYA 4HJLB 3VGNA 4L7KA 3F7XA 2GEXA 4HM7B 5IENA 3ER7A 3DM8A 3CPOA 1C7HA 3EQQB 1GS3A 5IG0A 3GZYB 3RGAA 4WYKB 1GYBA 4HVNA 5JPUA 1QMAA 1SJWA 3EF8A 1JB4A 3MSOA 2RCDA 3K0ZA 3NV0A 3FH1A 3GRDA 4H3UA 2STDA 4CDLA 4LGQA 4K1UA 4OUQA 3E99A 5AIHA 3LZAA 2HMKB 5KP1A 3B8LA 3D9RA 1UUVB 1W00A 2XRXB 1DMMA 3GWRA 5CK6A 1O7NB 2XSOB 5IERA 1TP6A 4KVHA 3I0YA 1OHOA 3G8ZA 6STDA 3BB9A 3K7CA 3NXJA 5AIIA 1U5OA 2RGQA 5AEUB 1A2KA 4R9LA 4HM1B 3JUOA 2HMMB 3OWYA 4IIAA 3BLZA 1QJGA 2GBXB 4HM0B 5IG5A 4XM4A 1S5AA 4I4KA 5CXOA 1OCVA 3F8XA 1EG9B 2HMNB 1BUQA 2RFRA 5EVHA 1JKGA 2F86B 3OWUA 3UNLA 5CF2A 1CQSA 1OF5B 3RGRA 4STDA 3EN1B 3FF0A 2HMLB 4OVMA 3DUKA 1JN5A 4Q53A 3NHXA 1ZX2A 2Z77A 1AR0A 4J8TA 4R1KA 2INXA 1O7GB 2QGUA 1ISKA 3SOAA 2HMJB 5CLKA 2BMRB 5D82A 5HGRA 4GB5A 4WP5A 5IF6A 4U13A 5IEPA 3NBRA 3OWSA 1O7MB 4L8OA 2F99A 3A76A 3H3HA 4HM8B 3MHEA 1ULJB 1OHPA 1E3RA 1OGXA 4HKVB 8CHOA 2GBWB 3MYTA 1Q40A 2R4IA 2BMOB 3CU3A 3T8UA 3JUMA 5AI1A 1O7PB 3G0KA 2A15A 3H51A 3SOYA 4HM3B 3FF2A 3M8CA 2CKFB 3NV0B 5BXQA 3CNMA 3KSPA 1NDOB 4MJDA 3MKIA 3DZLA 1ASKA 4XBYA 5G2GA 1DMQA 3S5CA 7STDA 4N3VA 5JPPA 5KP3A 3F7SA 1IDPA 5TGNA 1E3VA 1JB5A 2OWPA 1OPYA 3EBTA 3F40A 1GY7A 1Z1SA 3B4PA 1STDA 3EJVA 3B4OA 1GY5A 3JUNA 3JUQA 2HMOB 4WYKA 3FSDA 3EHCA 5AIFA 3FLJA 2GEYA 2F98A 1W02A 3OV4A 4RZMA 3FZWA 5IEOA 3EX9A 2XSHB 3FGYA 3SEDA 3EN8A 3FKAA 1OHSA 4HM6B 5STDA 1E97A 3KZTA 1JKGB 2YFIB 4WWUC 3Q90A 4HM2B 3F9SA 4X2OA 2K54A 5BVBA 2PZVA 3NUVA 3T8NA 1HKXA 2BNGA 2XR8B 3GZBA 3HZPA 3F14A 4ORLA 3WMDA 3STDA 4XBXA 3JUPA 1JN5B 5D83A 3VSYA 1W01A 1UUWB 3ECFA 3MG1A 5DREA 1DMNA 4J9AA 4HM4B 4XDWA 4R9KA 5IG3A 2YFJB 1ZO2A 2JQ5A 4HM5B 3CNXA 4XDVA 1VZZA 3ROBA 3GZXB 2IMJA 3GZRA 4FCMA 1TUHA 1OH0A 3F8HA 5AEWB 1OUNA
chains in the Genus database with same CATH superfamily
2C4BA 3MG3A 1ULIB 4LMIA 4X2HA 1PYLA 1RHLA 2CC3A 2RSXA 2CHCA 4PEJA 1GY6A 1MWRA 1GD3A 1OACA 1CH0A 4MMZB 2FNQA 2UX0A 5D81A 1OF5A 3X42A 4N6NB 5LC6A 1NWWA 1Q40B 4FCJA 1UCKA 1VQ93 1JB2A 3WR2A 2W04A 4MEIA 3OXAA 1K8A4 1BUJA 2B24B 2YFLB 2QIYA 2Z7AA 4K1VA 4L8PA 3MG2A 1Q42A 1DYUA 5ELUA 1CYUA 1RGGA 3DMCA 2IUKA 3S28A 4HZBB 5IG4A 1IV7A 1BNSA 3DXOA 4J5GA 3LYGA 1O7WB 3NX0A 1OGZA 2CWVA 2IY2A 1B2SA 2KXGA 3IPTA 5IW9A 2BMQB 3LT8A 4XB5A 5FGOA 1B20A 2XGNA 1BNIA 1NJI4 4HZ9B 1EA2A 3CCJ3 2ZHXB 4GL6A 5BIRA 2K0MA 3URPA 3SX1A 3N8BA 5CF1A 1K41A 3ZG0A 1MGRA 1PFPA 3OX9A 1W6YA 3KKGA 3G16A 2W2CA 5FW5A 2ML6A 5KP4A 1O7HB 2C11A 3NM2A 3WDGB 3CXC2 1YJN3 2B1XB 3CCS3 4OK0A 4AKYA 3GSPA 1BNFA 2D1WA 4LEHA 1LQMB 1LNIA 2JDIH 1QALA 5AIGA 1WQLB 2XFSA 1JBSA 3AHWA 3UJMA 1ROAA 1RGAA 2KF5A 7GSPA 3HK4A 3HX8A 3PS8A 2BO9B 4XBTA 5DRVA 1V57A 4AEQA 2OTL3 1N8R4 3LT9A 1LOWA 1BU4A 1A2PA 1BANA 2Z76A 1TRQA 2GXFA 3B7CA 1RCKA 2I9WA 3EC9A 3QK9A 3U1WA 2FXTA 1D6UA 3KE7A 3D3LA 1NU3A 3EBYA 4HJLB 3Q3FA 3VGNA 4N6MA 3ALAA 2IUJA 4L7KA 3F7XA 1G96A 3HOHA 2CWTA 2GEXA 2WOFA 3JVCA 4HM7B 5IENA 1FYSA 3ER7A 3HIIA 3D5IA 3DM8A 1TRPA 1QAKA 2F56A 1V58A 3CPOA 1BRJA 1BNGA 1C7HA 2D42A 2CK3H 1GS3A 3EQQB 1CYVA 5IG0A 3GZYB 4EW5A 3CCU3 3CC43 1RGEA 3RGAA 1BRHA 1RMSA 4WYKB 4WFOA 1GYBA 3PZWA 4HVNA 3UL5A 1X1XA 1LOYA 1YGEA 3I553 4FMBA 3D79A 5JPUA 1W6CA 3WOEB 1QMAA 3MPHA 2H0GA 2Y73A 1LNHA 1SJWA 3EF8A 1JB4A 3MSOA 1QVG2 1FA3A 2RCDA 3CC73 3K0ZA 1JV2B 3CC23 1BSEA 5EQLA 3NV0A 4HYZA 3FH1A 3GRDA 3CD63 2FGTA 2W03A 1VQM3 3DY5A 1Q864 3CPW2 4H3UA 2W9PA 3V99A 1IT7A 1ZS7A 2STDA 4CDLA 1MWUA 3V92A 4LGQA 3EE1A 2LYXA 2P0XA 1DETA 4K1UA 4OUQA 3E99A 4RNZA 5AIHA 1KWIA 1UGHI 2HMKB 3DGNA 3LZAA 3WA3A 1JRQA 5KP1A 1I0VA 3LMLA 3BNEA 3PYJA 1IYYA 2F5WA 2ZDJA 3B8LA 5AYSC 1HU9A 3D9RA 3OW22 1UUVB 2SARA 2O9UX 2QA43 2J8XB 4CJNA 1IQXA 6RNTA 3X3XA 1C54A 3CME3 1HZ1A 1NNVA 3SLUA 1EEJA 1VQQA 1W00A 1T5YA 2XRXB 2CX0A 4LZIA 3AHSA 1FGQA 3ZG5A 1NO3A 1DMMA 1HYFA 3K9MC 1RGHA 1QAFA 3KN4A 3GWRA 1W2B2 1TFOA 1YNVX 3PXMA 5CK6A 1O7NB 2XSOB 5IERA 1TP6A 3NM7A 4MMXB 1BRIA 2CFDA 4KVHA 1I2EA 3PCRA 3I0YA 1I8VA 1GOVA 1OHOA 2Q07A 2R41A 3G8ZA 6STDA 1VQ73 4KT3B 2F4YA 3BB9A 3K7CA 3NXJA 1A2VA 1Q7Y4 3IJEB 3BNCA 2W9QA 3NBBA 5AIIA 1WNHA 2CG1A 5ELJA 2ML5A 1WTHA 3SVAA 2OQEA 1U5OA 2RGQA 1BRKA 1IVWA 4FMDA 3UL6A 4BTWA 3VF1A 1A2KA 1X1UA 4HM1B 3FG3A 3JUOA 4R9LA 5AEUB 1X1WA 2HMMB 1RGFA 3OWYA 1YVBI 2L1SA 4IIAA 2QEX3 1I2FA 1GMQA 4FR9A 2P38A 2RBIA 4HOHA 3N9HA 5M19A 1N5HA 3BLZA 2CFLA 2XF3A 1QJGA 2GBXB 2XEPA 3S67A 1FZUA 1R4YA 4HM0B 1SARA 5IG5A 1KQS2 3LTDA 1SIIA 1MWSA 4XM4A 1S5AA 4I4KA 1SQWA 5CXOA 1B2MA 1GOYA 4KZ1A 4NPBA 1OCVA 1VQL3 4FMCA 3F8XA 2AAEA 3BNDA 1EG9B 4R80A 2HMNB 1VQN3 1BUQA 1RDSA 2RFRA 1BNJA 2PNCA 5EVHA 2WOHA 4MMYB 1JKGA 1G0TA 1VQ83 3I563 2F86B 4JRFA 3OWUA 1BNEA 3UNLA 4R4KA 1UCJA 3FG1A 1M9GA 3KIIA 3RDEA 3EB8A 5CF2A 4N6OB 3FCSB 1UI8A 3SYUA 2W0QA 4K61A 4H61A 4O2HA 1U8CB 1CQSA 1IT8A 2SBLA 2BU4A 5JBSA 1OF5B 4N6LA 3RGRA 4STDA 3EN1B 2AADA 3Q1CA 1EUIC 4EV2A 3PGBA 3FF0A 1X1YA 2HMLB 4OVMA 1S723 1EKMA 3KFQC 2C10A 3J7Yd 5LC7A 2WGQA 1DE3A 1GD4A 3X40A 2YX9A 2OOVC 3DUKA 1JN5A 4RBNA 4DKIA 1JZOA 3KCHA 3AGOA 1K28A 3X3YA 2LQVA 3DGLA 2CFGA 4Q53A 1RKYA 1IVXA 3NHXA 4TX4A 3WOFB 1W5ZA 1BVIA 2CH9A 2MF7A 2P05A 1ZX2A 1GMRA 1VQ43 2Z77A 1I2GA 1AR0A 1BSCA 4KFDA 4J8TA 1BSBA 2INXA 4R1KA 1RNTA 4ZM8A 3CCL3 5GSPA 1O7GB 2QGUA 3ZFZA 1BAOA 1ISKA 4WHAA 3SOAA 2HMJB 1IU7A 1TFKA 5CLKA 2BMRB 3QRDA 5D82A 2OQEC 2W56A 5HGRA 4EC6A 1AVKA 1I3FA 4GB5A 3AMOA 1BGSA 3DGYA 1RRLA 4WP5A 3CCR3 1UI7A 4BIRA 5IF6A 1IQYA 2H0HA 2HOHA 4U13A 5IEPA 1MOLA 3GAXA 8RNTA 3NBRA 5BU4A 4BL3A 3OWSA 1DVDA 1O7MB 4BU4A 4N6V0 4K90B 4L8OA 1GOUA 1IVVA 2F99A 3A76A 3H3HA 1W6GA 4HM8B 1Q814 3MHEA 1RJOA 1TIJA 1ULJB 1RSNA 3LTAA 1FUSA 1KSIA 1E3RA 1OHPA 1OGXA 1FGTA 2XH9A 1LVNA 3A5EA 3IMAB 3NQZA 1D6ZA 4HKVB 3CCM3 1TJDA 3Q2PA 1EQKA 3BIRA 8CHOA 2GBWB 3MYTA 1YIT3 1F8NA 1FW7A 1Q40A 1B27A 4LYLB 2R4IA 2BMOB 3CU3A 2OOVA 3T8UA 4KFEA 3LTCA 1RGKA 3CCE3 3JUMA 1RRHA 1T3BA 5AI1A 1O7PB 2KRTA 2P09A 2A15A 3G0KA 3HIGA 1B2XA 2E2UA 3H51A 1ZGXA 3SOYA 1MNLA 1PU4A 4HM3B 2CIUA 3FF2A 2F5MA 3M8CA 5HOHA 2BIRA 3RNTA 1AV4A 1AVLA 1JBRA 1LQGC 1LOXA 2CKFB 3NV0B 5BXQA 4O3VA 1WMOA 3D4AA 3CNMA 2E2TA 3KSPA 3BU4A 1G02A 1NDOB 4KFFA 3O8YA 4GHOA 5G1KA 4MJDA 3MKIA 1NB5I 2Z6BA 3DZLA 1N5PA 1AY7A 1ASKA 4XBYA 2BHMA 1JBTA 1R4CA 2GU1A 1VQO3 2H0IA 1KC84 4RNYA 5G2GA 1DMQA 1RTUA 1UCLA 1Q9EA 3TDGA 1RGLA 1BRNL 2CW9A 2M7OA 1STFI 1YJW3 1NB3I 3DGMA 3S5CA 4EXRA 3FG4A 7STDA 1IK3A 4N3VA 5JPPA 5KP3A 2ZL8A 3X3ZA 4FCZA 3CMA3 3G4S3 3F7SA 4EYCA 1MGWA 1IDPA 1FUWA 3D5GA 5TGNA 1BNRA 1E3VA 1JB5A 2OWPA 4CCVA 1IV9A 1N8QA 1OPYA 3EBTA 5RNTA 5EEOA 3F40A 3NBJA 4HBRA 1MWTA 1AQZA 1A90A 1ROVA 1GY7A 1Q7HA 1WMPA 1Z1SA 3B4PA 1B2UA 1BRGA 3LH4A 3N54B 1TU5A 3CCV3 1STDA 3EJVA 3CCQ3 2MC8A 2KF6A 1BSDA 1PY3A 1GY5A 1FUTA 3B4OA 3HI7A 1T2HA 1YHQ3 3KSED 3JUNA 2OTJ3 3JUQA 5M18A 2HMOB 4WYKA 2W6JH 2UUGC 3UB1A 3FSDA 2IA7A 1LOVA 3EHCA 4O02B 5AIFA 3FLJA 3BNBA 4LSOA 4NHFA 3WA2X 1UUGB 1LXEA 2GEYA 2F98A 1W4NA 4I5QA 1YVSA 1W02A 2OCTA 4G1MB 1LRAA 3OV4A 4RZMA 2BT3A 1B2ZA 1FGRA 1GSPA 1RN4A 3FZWA 3EX9A 1IQ8A 2XSHB 5IEOA 4AKZA 3FGYA 1RNBA 4J5KA 5G1LA 3SEDA 1RN7A 2L4VA 1RLSA 4QWTA 4CPKA 1T2IA 1K734 3WHOA 4BTXA 2K3DA 4IPBA 3DGOA 3EN8A 3FKAA 1OHSA 4HM6B 5STDA 3LTBA 6GSPA 2WO0A 1FGOA 3L0RA 1E97A 1M1K4 1D6YA 3NQYA 3KZTA 1JKGB 2YFIB 1FGMA 4WWUC 4BTYA 4JF8A 1V74A 2CFWA 4HAAA 4EV5A 3Q90A 2IYJA 4HM2B 5A0OB 2Y74A 2KF3A 2GU3A 1VQP3 4O8SA 3F9SA 3WODG 3X41A 4X2OA 1I3IA 1UCIA 2K54A 5BVBA 2PZVA 1B3SA 1BRSA 3G713 3NUVA 1CEWI 1RCLA 3T8NA 3U97A 1N9EA 1HKXA 2BNGA 2XR8B 1BOXA 3GZBA 3HZPA 3V98A 3F14A 4ORLA 3WMDA 1BSAA 3STDA 4EBGA 4XBXA 3JUPA 3LOYA 1UDII 1VQ63 1M904 1JN5B 1DVCA 1US1A 3MWZA 5D83A 1Y4KA 1W7CA 3VSYA 2GSPA 1RGCA 1W01A 1UUWB 2E2VA 1I70A 1SPUA 3DH2A 1Q824 3ECFA 4N6TA 2XGLA 3MG1A 5DREA 1DMNA 2ZA4A 4J9AA 5AYRB 2CWUA 2RNTA 4HM4B 1J2BA 3K63A 4IT7A 4XDWA 1K9M4 1UW1A 2CX1A 5I97A 4R9KA 1A67A 4N6UA 1VQK3 1N9JA 5IG3A 4GSPA 2XFTA 1YJ93 1TTOA 2YFJB 3AGNA 1ZO2A 1YI23 1BIRA 1UGIA 2JQ5A 4ILFA 1YGWA 2W56B 4FMAA 2KF4A 3LXUX 1SIHA 4HM5B 1M1XB 2KCDA 4RNTA 3G6E3 2CFKA 2CG0A 1JJ22 3T0UA 3CNXA 3PCSA 1VQ53 1GMPA 1IVUA 3AMOB 4XDVA 1VZZA 2KAAA 3ROBA 2WGOA 1JZDA 3GZXB 4NREA 2IMJA 3GZRA 4FCMA 1TUHA 9RNTA 1OH0A 1WMNA 1YIJ3 2P0MA 3F8HA 7RNTA 1L5GB 2V1LA 1B21A 4BL2A 3SXXA 1I0XA 2UGIA 3K5TA 1JNQA 3S29A 5M1AA 1QVF2 1W2ZA 2O3OA 5AEWB 3S27A 1KD14 1OUNA 1RN1A
chains in the Genus database with same CATH topology
3MG3A 1ULIB 4LMIA 4X2HA 2CC3A 2RSXA 4PEJA 2CHCA 1GY6A 1GD3A 1OACA 4MMZB 2FNQA 2UX0A 5D81A 1OF5A 3X42A 4N6NB 5LC6A 1NWWA 1Q40B 4FCJA 1VQ93 1JB2A 2W04A 4MEIA 3OXAA 1K8A4 2B24B 2YFLB 2QIYA 2Z7AA 4K1VA 4L8PA 3MG2A 1Q42A 1DYUA 5ELUA 1CYUA 3DMCA 2IUKA 3S28A 4HZBB 5IG4A 1IV7A 3DXOA 3LYGA 1O7WB 3NX0A 1OGZA 2CWVA 3IPTA 2KXGA 5IW9A 2BMQB 3LT8A 4XB5A 5FGOA 2XGNA 1NJI4 4HZ9B 1EA2A 3CCJ3 4GL6A 2K0MA 3SX1A 3N8BA 5CF1A 1K41A 3OX9A 1PFPA 1W6YA 3KKGA 3G16A 2W2CA 5FW5A 2ML6A 5KP4A 1O7HB 2C11A 3NM2A 3WDGB 3CXC2 1YJN3 2B1XB 3CCS3 4OK0A 4AKYA 2D1WA 4LEHA 2JDIH 1QALA 5AIGA 1WQLB 2XFSA 3UJMA 1ROAA 3HK4A 3HX8A 3PS8A 2BO9B 4XBTA 5DRVA 4AEQA 2OTL3 1N8R4 3LT9A 2Z76A 3B7CA 3U1WA 2GXFA 3QK9A 2I9WA 3EC9A 2FXTA 1D6UA 3KE7A 3D3LA 1NU3A 3EBYA 4HJLB 3VGNA 4N6MA 3ALAA 2IUJA 4L7KA 3F7XA 1G96A 2CWTA 2GEXA 2WOFA 3JVCA 4HM7B 5IENA 3ER7A 3HIIA 3DM8A 1QAKA 3CPOA 1C7HA 2D42A 2CK3H 1GS3A 3EQQB 1CYVA 5IG0A 3GZYB 3CCU3 3CC43 3RGAA 4WYKB 4WFOA 1GYBA 3PZWA 4HVNA 3UL5A 1YGEA 3I553 4FMBA 5JPUA 1W6CA 3WOEB 1QMAA 3MPHA 2Y73A 1LNHA 1SJWA 3EF8A 1JB4A 3MSOA 1QVG2 1FA3A 2RCDA 3CC73 3K0ZA 1JV2B 3CC23 5EQLA 3NV0A 4HYZA 3FH1A 3GRDA 3CD63 2FGTA 2W03A 1VQM3 3DY5A 1Q864 3CPW2 4H3UA 2W9PA 3V99A 1IT7A 2STDA 4CDLA 3V92A 4LGQA 3EE1A 2P0XA 2LYXA 4K1UA 4OUQA 3E99A 4RNZA 5AIHA 1KWIA 2HMKB 3DGNA 3LZAA 3WA3A 1JRQA 5KP1A 3LMLA 3PYJA 3BNEA 2ZDJA 3B8LA 5AYSC 1HU9A 3D9RA 3OW22 1UUVB 2O9UX 1OUNA 2QA43 1IQXA 3X3XA 3CME3 3SLUA 1W00A 1T5YA 2XRXB 4LZIA 1FGQA 1NO3A 1DMMA 3K9MC 1QAFA 3KN4A 3GWRA 1W2B2 1TFOA 3PXMA 5CK6A 1O7NB 2XSOB 5IERA 1TP6A 3NM7A 4MMXB 2CFDA 4KVHA 3PCRA 3I0YA 1OHOA 2Q07A 3G8ZA 6STDA 1VQ73 3BB9A 3K7CA 3NXJA 1A2VA 1Q7Y4 3IJEB 3BNCA 2W9QA 3NBBA 5AIIA 1WNHA 2CG1A 5ELJA 2ML5A 1WTHA 3SVAA 2OQEA 1U5OA 2RGQA 4FMDA 1IVWA 3UL6A 4BTWA 3VF1A 1A2KA 5AEUB 4HM1B 3FG3A 3JUOA 4R9LA 2HMMB 3OWYA 4IIAA 1YVBI 2QEX3 4FR9A 3N9HA 1N5HA 3BLZA 2CFLA 2XF3A 1QJGA 2GBXB 2XEPA 3S67A 4HM0B 5IG5A 1KQS2 3LTDA 1SIIA 4XM4A 1S5AA 4I4KA 1SQWA 5CXOA 1VQL3 4KZ1A 1OCVA 4FMCA 3F8XA 1VQN3 3BNDA 1EG9B 4R80A 2HMNB 1BUQA 2RFRA 2PNCA 5EVHA 2WOHA 4MMYB 1JKGA 1VQ83 3I563 2F86B 4JRFA 3OWUA 3UNLA 4R4KA 3FG1A 1M9GA 3KIIA 3RDEA 3EB8A 5CF2A 4N6OB 3FCSB 1UI8A 2W0QA 4K61A 4H61A 4O2HA 1U8CB 1CQSA 1IT8A 2SBLA 5JBSA 1OF5B 4N6LA 3RGRA 4STDA 3EN1B 3Q1CA 4EV2A 3PGBA 3FF0A 2HMLB 4OVMA 1S723 1EKMA 3KFQC 2C10A 3J7Yd 5LC7A 2WGQA 1GD4A 3X40A 2YX9A 2OOVC 3DUKA 1JN5A 4RBNA 1K28A 3X3YA 2LQVA 3DGLA 2CFGA 4Q53A 1RKYA 1IVXA 3NHXA 4TX4A 3WOFB 1W5ZA 2MF7A 2CH9A 2P05A 1ZX2A 1VQ43 2Z77A 1AR0A 4KFDA 4J8TA 4R1KA 2INXA 3CCL3 4ZM8A 1O7GB 2QGUA 1ISKA 4WHAA 3SOAA 2HMJB 1IU7A 1TFKA 5CLKA 2BMRB 3QRDA 5D82A 2OQEC 2W56A 5HGRA 4EC6A 1AVKA 4GB5A 3AMOA 3CCR3 1RRLA 4WP5A 1UI7A 5IF6A 1IQYA 4U13A 5IEPA 1MOLA 3GAXA 3NBRA 3OWSA 1DVDA 1O7MB 4N6V0 4K90B 4L8OA 1IVVA 2F99A 3A76A 3H3HA 1W6GA 4HM8B 1Q814 3MHEA 1RJOA 1TIJA 1ULJB 3LTAA 1OHPA 1KSIA 1E3RA 2XH9A 1OGXA 1FGTA 3IMAB 1LVNA 3NQZA 1D6ZA 4HKVB 3CCM3 3Q2PA 1EQKA 8CHOA 2GBWB 3MYTA 1YIT3 1F8NA 1Q40A 2R4IA 2BMOB 3CU3A 2OOVA 3T8UA 4KFEA 3LTCA 3CCE3 3JUMA 1RRHA 5AI1A 1O7PB 2KRTA 2P09A 2A15A 3G0KA 3HIGA 2E2UA 3H51A 3SOYA 1MNLA 1PU4A 4HM3B 2CIUA 3FF2A 3M8CA 1AV4A 1AVLA 1LOXA 2CKFB 3NV0B 5BXQA 4O3VA 1WMOA 3CNMA 2E2TA 3KSPA 4KFFA 1NDOB 3O8YA 4MJDA 3MKIA 1NB5I 2Z6BA 3DZLA 1N5PA 1ASKA 4XBYA 2BHMA 1R4CA 2GU1A 1VQO3 1KC84 4RNYA 5G2GA 1DMQA 3TDGA 2CW9A 2M7OA 1STFI 1YJW3 1NB3I 3DGMA 3S5CA 4EXRA 3FG4A 7STDA 1IK3A 4N3VA 5JPPA 5KP3A 2ZL8A 3X3ZA 4FCZA 3CMA3 3G4S3 3F7SA 4EYCA 1IDPA 1FUWA 5TGNA 1E3VA 1JB5A 2OWPA 4CCVA 1IV9A 1N8QA 1OPYA 3EBTA 5EEOA 3F40A 3NBJA 4HBRA 1A90A 1ROVA 1GY7A 1WMPA 1Z1SA 3B4PA 3LH4A 3N54B 1TU5A 3CCV3 1YHQ3 1STDA 3EJVA 3CCQ3 2MC8A 3B4OA 1GY5A 3HI7A 2OTJ3 3KSED 3JUNA 3JUQA 2HMOB 4WYKA 2W6JH 3UB1A 3FSDA 2IA7A 3EHCA 4O02B 5AIFA 3FLJA 3BNBA 4LSOA 4NHFA 3WA2X 1LXEA 2GEYA 2F98A 1W4NA 1W02A 2OCTA 4G1MB 3OV4A 4RZMA 2BT3A 1FGRA 3FZWA 5IEOA 3EX9A 1IQ8A 2XSHB 4AKZA 3FGYA 3SEDA 1RN7A 2L4VA 4QWTA 1K734 4BTXA 4IPBA 3DGOA 3EN8A 3FKAA 1OHSA 4HM6B 5STDA 3LTBA 2WO0A 1FGOA 3L0RA 1E97A 1M1K4 1D6YA 3NQYA 3KZTA 1JKGB 2YFIB 1FGMA 4WWUC 4BTYA 4JF8A 1V74A 2CFWA 4EV5A 3Q90A 4HM2B 5A0OB 2Y74A 2GU3A 1VQP3 4O8SA 3F9SA 3WODG 3X41A 4X2OA 2K54A 5BVBA 2PZVA 3G713 3NUVA 1CEWI 3T8NA 3U97A 1N9EA 1HKXA 2BNGA 2XR8B 3GZBA 3HZPA 3V98A 3F14A 4ORLA 3WMDA 3STDA 4EBGA 4XBXA 3JUPA 3LOYA 1VQ63 1M904 1JN5B 1DVCA 1US1A 3MWZA 5D83A 1Y4KA 1W7CA 3VSYA 1W01A 1UUWB 2E2VA 1SPUA 1Q824 3ECFA 4N6TA 2XGLA 3MG1A 5DREA 1DMNA 4J9AA 5AYRB 2CWUA 4HM4B 1J2BA 3K63A 4IT7A 4XDWA 1K9M4 1UW1A 5I97A 4R9KA 1A67A 4N6UA 1VQK3 1N9JA 5IG3A 1YJ93 2XFTA 2YFJB 1ZO2A 1YI23 2JQ5A 2W56B 4FMAA 3LXUX 4HM5B 1SIHA 1M1XB 2KCDA 3G6E3 2CFKA 2CG0A 1JJ22 3T0UA 3CNXA 3PCSA 1VQ53 4XDVA 1IVUA 3AMOB 1VZZA 3ROBA 2WGOA 3GZXB 4NREA 2IMJA 3GZRA 4FCMA 1TUHA 1OH0A 1WMNA 1YIJ3 2P0MA 3F8HA 1L5GB 2V1LA 3SXXA 3K5TA 1JNQA 3S29A 1QVF2 1W2ZA 2O3OA 5AEWB 3S27A 1KD14 2P38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MG3 A;  1ULI B;  4LMI A;  4X2H A;  4PEJ A;  2CHC A;  1GY6 A;  2UX0 A;  5D81 A;  1OF5 A;  1NWW A;  1Q40 B;  4FCJ A;  1JB2 A;  3OXA A;  2B24 B;  2YFL B;  2QIY A;  2Z7A A;  4K1V A;  4L8P A;  3MG2 A;  1Q42 A;  3DMC A;  5IG4 A;  4HZB B;  3DXO A;  3LYG A;  1O7W B;  1OGZ A;  3IPT A;  2BMQ B;  4XB5 A;  4HZ9 B;  1EA2 A;  5CF1 A;  1K41 A;  3OX9 A;  1W6Y A;  3KKG A;  3G16 A;  2W2C A;  5FW5 A;  5KP4 A;  1O7H B;  3NM2 A;  2B1X B;  4LEH A;  5AIG A;  1WQL B;  3UJM A;  3HK4 A;  3HX8 A;  4XBT A;  5DRV A;  2Z76 A;  3B7C A;  2GXF A;  2I9W A;  3EC9 A;  3KE7 A;  1NU3 A;  3EBY A;  4HJL B;  3VGN A;  4L7K A;  3F7X A;  2GEX A;  4HM7 B;  5IEN A;  3ER7 A;  3DM8 A;  3CPO A;  1C7H A;  3EQQ B;  1GS3 A;  5IG0 A;  3GZY B;  3RGA A;  4WYK B;  1GYB A;  4HVN A;  5JPU A;  1QMA A;  1SJW A;  3EF8 A;  1JB4 A;  3MSO A;  2RCD A;  3K0Z A;  3NV0 A;  3FH1 A;  3GRD A;  4H3U A;  2STD A;  4CDL A;  4LGQ A;  4K1U A;  4OUQ A;  3E99 A;  5AIH A;  3LZA A;  2HMK B;  5KP1 A;  3B8L A;  3D9R A;  1UUV B;  1W00 A;  2XRX B;  1DMM A;  3GWR A;  5CK6 A;  1O7N B;  2XSO B;  5IER A;  1TP6 A;  4KVH A;  3I0Y A;  1OHO A;  3G8Z A;  6STD A;  3BB9 A;  3K7C A;  3NXJ A;  5AII A;  1U5O A;  2RGQ A;  5AEU B;  1A2K A;  4R9L A;  4HM1 B;  3JUO A;  2HMM B;  3OWY A;  4IIA A;  3BLZ A;  1QJG A;  2GBX B;  4HM0 B;  5IG5 A;  4XM4 A;  1S5A A;  4I4K A;  5CXO A;  1OCV A;  3F8X A;  1EG9 B;  2HMN B;  1BUQ A;  2RFR A;  5EVH A;  1JKG A;  2F86 B;  3OWU A;  3UNL A;  5CF2 A;  1CQS A;  1OF5 B;  3RGR A;  4STD A;  3EN1 B;  3FF0 A;  2HML B;  4OVM A;  3DUK A;  1JN5 A;  4Q53 A;  3NHX A;  1ZX2 A;  2Z77 A;  1AR0 A;  4J8T A;  4R1K A;  2INX A;  1O7G B;  2QGU A;  1ISK A;  3SOA A;  2HMJ B;  5CLK A;  2BMR B;  5D82 A;  5HGR A;  4GB5 A;  4WP5 A;  5IF6 A;  4U13 A;  5IEP A;  3NBR A;  3OWS A;  1O7M B;  4L8O A;  2F99 A;  3A76 A;  3H3H A;  4HM8 B;  3MHE A;  1ULJ B;  1OHP A;  1E3R A;  1OGX A;  4HKV B;  8CHO A;  2GBW B;  3MYT A;  1Q40 A;  2R4I A;  2BMO B;  3CU3 A;  3T8U A;  3JUM A;  5AI1 A;  1O7P B;  3G0K A;  2A15 A;  3H51 A;  3SOY A;  4HM3 B;  3FF2 A;  3M8C A;  2CKF B;  3NV0 B;  5BXQ A;  3CNM A;  3KSP A;  1NDO B;  4MJD A;  3MKI A;  3DZL A;  1ASK A;  4XBY A;  5G2G A;  1DMQ A;  3S5C A;  7STD A;  4N3V A;  5JPP A;  5KP3 A;  3F7S A;  1IDP A;  5TGN A;  1E3V A;  1JB5 A;  2OWP A;  1OPY A;  3EBT A;  3F40 A;  1GY7 A;  1Z1S A;  3B4P A;  1STD A;  3EJV A;  3B4O A;  1GY5 A;  3JUN A;  3JUQ A;  2HMO B;  4WYK A;  3FSD A;  3EHC A;  5AIF A;  3FLJ A;  2GEY A;  2F98 A;  1W02 A;  3OV4 A;  4RZM A;  3FZW A;  5IEO A;  3EX9 A;  2XSH B;  3FGY A;  3SED A;  3EN8 A;  3FKA A;  1OHS A;  4HM6 B;  5STD A;  1E97 A;  3KZT A;  1JKG B;  2YFI B;  4WWU C;  3Q90 A;  4HM2 B;  3F9S A;  4X2O A;  2K54 A;  5BVB A;  2PZV A;  3NUV A;  3T8N A;  1HKX A;  2BNG A;  2XR8 B;  3GZB A;  3HZP A;  3F14 A;  4ORL A;  3WMD A;  3STD A;  4XBX A;  3JUP A;  1JN5 B;  5D83 A;  3VSY A;  1W01 A;  1UUW B;  3ECF A;  3MG1 A;  5DRE A;  1DMN A;  4J9A A;  4HM4 B;  4XDW A;  4R9K A;  5IG3 A;  2YFJ B;  1ZO2 A;  2JQ5 A;  4HM5 B;  3CNX A;  4XDV A;  1VZZ A;  3ROB A;  3GZX B;  2IMJ A;  3GZR A;  4FCM A;  1TUH A;  1OH0 A;  3F8H A;  5AEW B;  1OUN A; 
#chains in the Genus database with same CATH topology
 2C4B A;  3MG3 A;  1ULI B;  4LMI A;  4X2H A;  1PYL A;  1RHL A;  2CC3 A;  2RSX A;  2CHC A;  4PEJ A;  1GY6 A;  1MWR A;  1GD3 A;  1OAC A;  1CH0 A;  4MMZ B;  2FNQ A;  2UX0 A;  5D81 A;  1OF5 A;  3X42 A;  4N6N B;  5LC6 A;  1NWW A;  1Q40 B;  4FCJ A;  1UCK A;  1VQ9 3;  1JB2 A;  3WR2 A;  2W04 A;  4MEI A;  3OXA A;  1K8A 4;  1BUJ A;  2B24 B;  2YFL B;  2QIY A;  2Z7A A;  4K1V A;  4L8P A;  3MG2 A;  1Q42 A;  1DYU A;  5ELU A;  1CYU A;  1RGG A;  3DMC A;  2IUK A;  3S28 A;  4HZB B;  5IG4 A;  1IV7 A;  1BNS A;  3DXO A;  4J5G A;  3LYG A;  1O7W B;  3NX0 A;  1OGZ A;  2CWV A;  2IY2 A;  1B2S A;  2KXG A;  3IPT A;  5IW9 A;  2BMQ B;  3LT8 A;  4XB5 A;  5FGO A;  1B20 A;  2XGN A;  1BNI A;  1NJI 4;  4HZ9 B;  1EA2 A;  3CCJ 3;  2ZHX B;  4GL6 A;  5BIR A;  2K0M A;  3URP A;  3SX1 A;  3N8B A;  5CF1 A;  1K41 A;  3ZG0 A;  1MGR A;  1PFP A;  3OX9 A;  1W6Y A;  3KKG A;  3G16 A;  2W2C A;  5FW5 A;  2ML6 A;  5KP4 A;  1O7H B;  2C11 A;  3NM2 A;  3WDG B;  3CXC 2;  1YJN 3;  2B1X B;  3CCS 3;  4OK0 A;  4AKY A;  3GSP A;  1BNF A;  2D1W A;  4LEH A;  1LQM B;  1LNI A;  2JDI H;  1QAL A;  5AIG A;  1WQL B;  2XFS A;  1JBS A;  3AHW A;  3UJM A;  1ROA A;  1RGA A;  2KF5 A;  7GSP A;  3HK4 A;  3HX8 A;  3PS8 A;  2BO9 B;  4XBT A;  5DRV A;  1V57 A;  4AEQ A;  2OTL 3;  1N8R 4;  3LT9 A;  1LOW A;  1BU4 A;  1A2P A;  1BAN A;  2Z76 A;  1TRQ A;  2GXF A;  3B7C A;  1RCK A;  2I9W A;  3EC9 A;  3QK9 A;  3U1W A;  2FXT A;  1D6U A;  3KE7 A;  3D3L A;  1NU3 A;  3EBY A;  4HJL B;  3Q3F A;  3VGN A;  4N6M A;  3ALA A;  2IUJ A;  4L7K A;  3F7X A;  1G96 A;  3HOH A;  2CWT A;  2GEX A;  2WOF A;  3JVC A;  4HM7 B;  5IEN A;  1FYS A;  3ER7 A;  3HII A;  3D5I A;  3DM8 A;  1TRP A;  1QAK A;  2F56 A;  1V58 A;  3CPO A;  1BRJ A;  1BNG A;  1C7H A;  2D42 A;  2CK3 H;  1GS3 A;  3EQQ B;  1CYV A;  5IG0 A;  3GZY B;  4EW5 A;  3CCU 3;  3CC4 3;  1RGE A;  3RGA A;  1BRH A;  1RMS A;  4WYK B;  4WFO A;  1GYB A;  3PZW A;  4HVN A;  3UL5 A;  1X1X A;  1LOY A;  1YGE A;  3I55 3;  4FMB A;  3D79 A;  5JPU A;  1W6C A;  3WOE B;  1QMA A;  3MPH A;  2H0G A;  2Y73 A;  1LNH A;  1SJW A;  3EF8 A;  1JB4 A;  3MSO A;  1QVG 2;  1FA3 A;  2RCD A;  3CC7 3;  3K0Z A;  1JV2 B;  3CC2 3;  1BSE A;  5EQL A;  3NV0 A;  4HYZ A;  3FH1 A;  3GRD A;  3CD6 3;  2FGT A;  2W03 A;  1VQM 3;  3DY5 A;  1Q86 4;  3CPW 2;  4H3U A;  2W9P A;  3V99 A;  1IT7 A;  1ZS7 A;  2STD A;  4CDL A;  1MWU A;  3V92 A;  4LGQ A;  3EE1 A;  2LYX A;  2P0X A;  1DET A;  4K1U A;  4OUQ A;  3E99 A;  4RNZ A;  5AIH A;  1KWI A;  1UGH I;  2HMK B;  3DGN A;  3LZA A;  3WA3 A;  1JRQ A;  5KP1 A;  1I0V A;  3LML A;  3BNE A;  3PYJ A;  1IYY A;  2F5W A;  2ZDJ A;  3B8L A;  5AYS C;  1HU9 A;  3D9R A;  3OW2 2;  1UUV B;  2SAR A;  2O9U X;  2QA4 3;  2J8X B;  4CJN A;  1IQX A;  6RNT A;  3X3X A;  1C54 A;  3CME 3;  1HZ1 A;  1NNV A;  3SLU A;  1EEJ A;  1VQQ A;  1W00 A;  1T5Y A;  2XRX B;  2CX0 A;  4LZI A;  3AHS A;  1FGQ A;  3ZG5 A;  1NO3 A;  1DMM A;  1HYF A;  3K9M C;  1RGH A;  1QAF A;  3KN4 A;  3GWR A;  1W2B 2;  1TFO A;  1YNV X;  3PXM A;  5CK6 A;  1O7N B;  2XSO B;  5IER A;  1TP6 A;  3NM7 A;  4MMX B;  1BRI A;  2CFD A;  4KVH A;  1I2E A;  3PCR A;  3I0Y A;  1I8V A;  1GOV A;  1OHO A;  2Q07 A;  2R41 A;  3G8Z A;  6STD A;  1VQ7 3;  4KT3 B;  2F4Y A;  3BB9 A;  3K7C A;  3NXJ A;  1A2V A;  1Q7Y 4;  3IJE B;  3BNC A;  2W9Q A;  3NBB A;  5AII A;  1WNH A;  2CG1 A;  5ELJ A;  2ML5 A;  1WTH A;  3SVA A;  2OQE A;  1U5O A;  2RGQ A;  1BRK A;  1IVW A;  4FMD A;  3UL6 A;  4BTW A;  3VF1 A;  1A2K A;  1X1U A;  4HM1 B;  3FG3 A;  3JUO A;  4R9L A;  5AEU B;  1X1W A;  2HMM B;  1RGF A;  3OWY A;  1YVB I;  2L1S A;  4IIA A;  2QEX 3;  1I2F A;  1GMQ A;  4FR9 A;  2P38 A;  2RBI A;  4HOH A;  3N9H A;  5M19 A;  1N5H A;  3BLZ A;  2CFL A;  2XF3 A;  1QJG A;  2GBX B;  2XEP A;  3S67 A;  1FZU A;  1R4Y A;  4HM0 B;  1SAR A;  5IG5 A;  1KQS 2;  3LTD A;  1SII A;  1MWS A;  4XM4 A;  1S5A A;  4I4K A;  1SQW A;  5CXO A;  1B2M A;  1GOY A;  4KZ1 A;  4NPB A;  1OCV A;  1VQL 3;  4FMC A;  3F8X A;  2AAE A;  3BND A;  1EG9 B;  4R80 A;  2HMN B;  1VQN 3;  1BUQ A;  1RDS A;  2RFR A;  1BNJ A;  2PNC A;  5EVH A;  2WOH A;  4MMY B;  1JKG A;  1G0T A;  1VQ8 3;  3I56 3;  2F86 B;  4JRF A;  3OWU A;  1BNE A;  3UNL A;  4R4K A;  1UCJ A;  3FG1 A;  1M9G A;  3KII A;  3RDE A;  3EB8 A;  5CF2 A;  4N6O B;  3FCS B;  1UI8 A;  3SYU A;  2W0Q A;  4K61 A;  4H61 A;  4O2H A;  1U8C B;  1CQS A;  1IT8 A;  2SBL A;  2BU4 A;  5JBS A;  1OF5 B;  4N6L A;  3RGR A;  4STD A;  3EN1 B;  2AAD A;  3Q1C A;  1EUI C;  4EV2 A;  3PGB A;  3FF0 A;  1X1Y A;  2HML B;  4OVM A;  1S72 3;  1EKM A;  3KFQ C;  2C10 A;  3J7Y d;  5LC7 A;  2WGQ A;  1DE3 A;  1GD4 A;  3X40 A;  2YX9 A;  2OOV C;  3DUK A;  1JN5 A;  4RBN A;  4DKI A;  1JZO A;  3KCH A;  3AGO A;  1K28 A;  3X3Y A;  2LQV A;  3DGL A;  2CFG A;  4Q53 A;  1RKY A;  1IVX A;  3NHX A;  4TX4 A;  3WOF B;  1W5Z A;  1BVI A;  2CH9 A;  2MF7 A;  2P05 A;  1ZX2 A;  1GMR A;  1VQ4 3;  2Z77 A;  1I2G A;  1AR0 A;  1BSC A;  4KFD A;  4J8T A;  1BSB A;  2INX A;  4R1K A;  1RNT A;  4ZM8 A;  3CCL 3;  5GSP A;  1O7G B;  2QGU A;  3ZFZ A;  1BAO A;  1ISK A;  4WHA A;  3SOA A;  2HMJ B;  1IU7 A;  1TFK A;  5CLK A;  2BMR B;  3QRD A;  5D82 A;  2OQE C;  2W56 A;  5HGR A;  4EC6 A;  1AVK A;  1I3F A;  4GB5 A;  3AMO A;  1BGS A;  3DGY A;  1RRL A;  4WP5 A;  3CCR 3;  1UI7 A;  4BIR A;  5IF6 A;  1IQY A;  2H0H A;  2HOH A;  4U13 A;  5IEP A;  1MOL A;  3GAX A;  8RNT A;  3NBR A;  5BU4 A;  4BL3 A;  3OWS A;  1DVD A;  1O7M B;  4BU4 A;  4N6V 0;  4K90 B;  4L8O A;  1GOU A;  1IVV A;  2F99 A;  3A76 A;  3H3H A;  1W6G A;  4HM8 B;  1Q81 4;  3MHE A;  1RJO A;  1TIJ A;  1ULJ B;  1RSN A;  3LTA A;  1FUS A;  1KSI A;  1E3R A;  1OHP A;  1OGX A;  1FGT A;  2XH9 A;  1LVN A;  3A5E A;  3IMA B;  3NQZ A;  1D6Z A;  4HKV B;  3CCM 3;  1TJD A;  3Q2P A;  1EQK A;  3BIR A;  8CHO A;  2GBW B;  3MYT A;  1YIT 3;  1F8N A;  1FW7 A;  1Q40 A;  1B27 A;  4LYL B;  2R4I A;  2BMO B;  3CU3 A;  2OOV A;  3T8U A;  4KFE A;  3LTC A;  1RGK A;  3CCE 3;  3JUM A;  1RRH A;  1T3B A;  5AI1 A;  1O7P B;  2KRT A;  2P09 A;  2A15 A;  3G0K A;  3HIG A;  1B2X A;  2E2U A;  3H51 A;  1ZGX A;  3SOY A;  1MNL A;  1PU4 A;  4HM3 B;  2CIU A;  3FF2 A;  2F5M A;  3M8C A;  5HOH A;  2BIR A;  3RNT A;  1AV4 A;  1AVL A;  1JBR A;  1LQG C;  1LOX A;  2CKF B;  3NV0 B;  5BXQ A;  4O3V A;  1WMO A;  3D4A A;  3CNM A;  2E2T A;  3KSP A;  3BU4 A;  1G02 A;  1NDO B;  4KFF A;  3O8Y A;  4GHO A;  5G1K A;  4MJD A;  3MKI A;  1NB5 I;  2Z6B A;  3DZL A;  1N5P A;  1AY7 A;  1ASK A;  4XBY A;  2BHM A;  1JBT A;  1R4C A;  2GU1 A;  1VQO 3;  2H0I A;  1KC8 4;  4RNY A;  5G2G A;  1DMQ A;  1RTU A;  1UCL A;  1Q9E A;  3TDG A;  1RGL A;  1BRN L;  2CW9 A;  2M7O A;  1STF I;  1YJW 3;  1NB3 I;  3DGM A;  3S5C A;  4EXR A;  3FG4 A;  7STD A;  1IK3 A;  4N3V A;  5JPP A;  5KP3 A;  2ZL8 A;  3X3Z A;  4FCZ A;  3CMA 3;  3G4S 3;  3F7S A;  4EYC A;  1MGW A;  1IDP A;  1FUW A;  3D5G A;  5TGN A;  1BNR A;  1E3V A;  1JB5 A;  2OWP A;  4CCV A;  1IV9 A;  1N8Q A;  1OPY A;  3EBT A;  5RNT A;  5EEO A;  3F40 A;  3NBJ A;  4HBR A;  1MWT A;  1AQZ A;  1A90 A;  1ROV A;  1GY7 A;  1Q7H A;  1WMP A;  1Z1S A;  3B4P A;  1B2U A;  1BRG A;  3LH4 A;  3N54 B;  1TU5 A;  3CCV 3;  1STD A;  3EJV A;  3CCQ 3;  2MC8 A;  2KF6 A;  1BSD A;  1PY3 A;  1GY5 A;  1FUT A;  3B4O A;  3HI7 A;  1T2H A;  1YHQ 3;  3KSE D;  3JUN A;  2OTJ 3;  3JUQ A;  5M18 A;  2HMO B;  4WYK A;  2W6J H;  2UUG C;  3UB1 A;  3FSD A;  2IA7 A;  1LOV A;  3EHC A;  4O02 B;  5AIF A;  3FLJ A;  3BNB A;  4LSO A;  4NHF A;  3WA2 X;  1UUG B;  1LXE A;  2GEY A;  2F98 A;  1W4N A;  4I5Q A;  1YVS A;  1W02 A;  2OCT A;  4G1M B;  1LRA A;  3OV4 A;  4RZM A;  2BT3 A;  1B2Z A;  1FGR A;  1GSP A;  1RN4 A;  3FZW A;  3EX9 A;  1IQ8 A;  2XSH B;  5IEO A;  4AKZ A;  3FGY A;  1RNB A;  4J5K A;  5G1L A;  3SED A;  1RN7 A;  2L4V A;  1RLS A;  4QWT A;  4CPK A;  1T2I A;  1K73 4;  3WHO A;  4BTX A;  2K3D A;  4IPB A;  3DGO A;  3EN8 A;  3FKA A;  1OHS A;  4HM6 B;  5STD A;  3LTB A;  6GSP A;  2WO0 A;  1FGO A;  3L0R A;  1E97 A;  1M1K 4;  1D6Y A;  3NQY A;  3KZT A;  1JKG B;  2YFI B;  1FGM A;  4WWU C;  4BTY A;  4JF8 A;  1V74 A;  2CFW A;  4HAA A;  4EV5 A;  3Q90 A;  2IYJ A;  4HM2 B;  5A0O B;  2Y74 A;  2KF3 A;  2GU3 A;  1VQP 3;  4O8S A;  3F9S A;  3WOD G;  3X41 A;  4X2O A;  1I3I A;  1UCI A;  2K54 A;  5BVB A;  2PZV A;  1B3S A;  1BRS A;  3G71 3;  3NUV A;  1CEW I;  1RCL A;  3T8N A;  3U97 A;  1N9E A;  1HKX A;  2BNG A;  2XR8 B;  1BOX A;  3GZB A;  3HZP A;  3V98 A;  3F14 A;  4ORL A;  3WMD A;  1BSA A;  3STD A;  4EBG A;  4XBX A;  3JUP A;  3LOY A;  1UDI I;  1VQ6 3;  1M90 4;  1JN5 B;  1DVC A;  1US1 A;  3MWZ A;  5D83 A;  1Y4K A;  1W7C A;  3VSY A;  2GSP A;  1RGC A;  1W01 A;  1UUW B;  2E2V A;  1I70 A;  1SPU A;  3DH2 A;  1Q82 4;  3ECF A;  4N6T A;  2XGL A;  3MG1 A;  5DRE A;  1DMN A;  2ZA4 A;  4J9A A;  5AYR B;  2CWU A;  2RNT A;  4HM4 B;  1J2B A;  3K63 A;  4IT7 A;  4XDW A;  1K9M 4;  1UW1 A;  2CX1 A;  5I97 A;  4R9K A;  1A67 A;  4N6U A;  1VQK 3;  1N9J A;  5IG3 A;  4GSP A;  2XFT A;  1YJ9 3;  1TTO A;  2YFJ B;  3AGN A;  1ZO2 A;  1YI2 3;  1BIR A;  1UGI A;  2JQ5 A;  4ILF A;  1YGW A;  2W56 B;  4FMA A;  2KF4 A;  3LXU X;  1SIH A;  4HM5 B;  1M1X B;  2KCD A;  4RNT A;  3G6E 3;  2CFK A;  2CG0 A;  1JJ2 2;  3T0U A;  3CNX A;  3PCS A;  1VQ5 3;  1GMP A;  1IVU A;  3AMO B;  4XDV A;  1VZZ A;  2KAA A;  3ROB A;  2WGO A;  1JZD A;  3GZX B;  4NRE A;  2IMJ A;  3GZR A;  4FCM A;  1TUH A;  9RNT A;  1OH0 A;  1WMN A;  1YIJ 3;  2P0M A;  3F8H A;  7RNT A;  1L5G B;  2V1L A;  1B21 A;  4BL2 A;  3SXX A;  1I0X A;  2UGI A;  3K5T A;  1JNQ A;  3S29 A;  5M1A A;  1QVF 2;  1W2Z A;  2O3O A;  5AEW B;  3S27 A;  1KD1 4;  1OUN A;  1RN1 A; 
#chains in the Genus database with same CATH homology
 3MG3 A;  1ULI B;  4LMI A;  4X2H A;  2CC3 A;  2RSX A;  4PEJ A;  2CHC A;  1GY6 A;  1GD3 A;  1OAC A;  4MMZ B;  2FNQ A;  2UX0 A;  5D81 A;  1OF5 A;  3X42 A;  4N6N B;  5LC6 A;  1NWW A;  1Q40 B;  4FCJ A;  1VQ9 3;  1JB2 A;  2W04 A;  4MEI A;  3OXA A;  1K8A 4;  2B24 B;  2YFL B;  2QIY A;  2Z7A A;  4K1V A;  4L8P A;  3MG2 A;  1Q42 A;  1DYU A;  5ELU A;  1CYU A;  3DMC A;  2IUK A;  3S28 A;  4HZB B;  5IG4 A;  1IV7 A;  3DXO A;  3LYG A;  1O7W B;  3NX0 A;  1OGZ A;  2CWV A;  3IPT A;  2KXG A;  5IW9 A;  2BMQ B;  3LT8 A;  4XB5 A;  5FGO A;  2XGN A;  1NJI 4;  4HZ9 B;  1EA2 A;  3CCJ 3;  4GL6 A;  2K0M A;  3SX1 A;  3N8B A;  5CF1 A;  1K41 A;  3OX9 A;  1PFP A;  1W6Y A;  3KKG A;  3G16 A;  2W2C A;  5FW5 A;  2ML6 A;  5KP4 A;  1O7H B;  2C11 A;  3NM2 A;  3WDG B;  3CXC 2;  1YJN 3;  2B1X B;  3CCS 3;  4OK0 A;  4AKY A;  2D1W A;  4LEH A;  2JDI H;  1QAL A;  5AIG A;  1WQL B;  2XFS A;  3UJM A;  1ROA A;  3HK4 A;  3HX8 A;  3PS8 A;  2BO9 B;  4XBT A;  5DRV A;  4AEQ A;  2OTL 3;  1N8R 4;  3LT9 A;  2Z76 A;  3B7C A;  3U1W A;  2GXF A;  3QK9 A;  2I9W A;  3EC9 A;  2FXT A;  1D6U A;  3KE7 A;  3D3L A;  1NU3 A;  3EBY A;  4HJL B;  3VGN A;  4N6M A;  3ALA A;  2IUJ A;  4L7K A;  3F7X A;  1G96 A;  2CWT A;  2GEX A;  2WOF A;  3JVC A;  4HM7 B;  5IEN A;  3ER7 A;  3HII A;  3DM8 A;  1QAK A;  3CPO A;  1C7H A;  2D42 A;  2CK3 H;  1GS3 A;  3EQQ B;  1CYV A;  5IG0 A;  3GZY B;  3CCU 3;  3CC4 3;  3RGA A;  4WYK B;  4WFO A;  1GYB A;  3PZW A;  4HVN A;  3UL5 A;  1YGE A;  3I55 3;  4FMB A;  5JPU A;  1W6C A;  3WOE B;  1QMA A;  3MPH A;  2Y73 A;  1LNH A;  1SJW A;  3EF8 A;  1JB4 A;  3MSO A;  1QVG 2;  1FA3 A;  2RCD A;  3CC7 3;  3K0Z A;  1JV2 B;  3CC2 3;  5EQL A;  3NV0 A;  4HYZ A;  3FH1 A;  3GRD A;  3CD6 3;  2FGT A;  2W03 A;  1VQM 3;  3DY5 A;  1Q86 4;  3CPW 2;  4H3U A;  2W9P A;  3V99 A;  1IT7 A;  2STD A;  4CDL A;  3V92 A;  4LGQ A;  3EE1 A;  2P0X A;  2LYX A;  4K1U A;  4OUQ A;  3E99 A;  4RNZ A;  5AIH A;  1KWI A;  2HMK B;  3DGN A;  3LZA A;  3WA3 A;  1JRQ A;  5KP1 A;  3LML A;  3PYJ A;  3BNE A;  2ZDJ A;  3B8L A;  5AYS C;  1HU9 A;  3D9R A;  3OW2 2;  1UUV B;  2O9U X;  1OUN A;  2QA4 3;  1IQX A;  3X3X A;  3CME 3;  3SLU A;  1W00 A;  1T5Y A;  2XRX B;  4LZI A;  1FGQ A;  1NO3 A;  1DMM A;  3K9M C;  1QAF A;  3KN4 A;  3GWR A;  1W2B 2;  1TFO A;  3PXM A;  5CK6 A;  1O7N B;  2XSO B;  5IER A;  1TP6 A;  3NM7 A;  4MMX B;  2CFD A;  4KVH A;  3PCR A;  3I0Y A;  1OHO A;  2Q07 A;  3G8Z A;  6STD A;  1VQ7 3;  3BB9 A;  3K7C A;  3NXJ A;  1A2V A;  1Q7Y 4;  3IJE B;  3BNC A;  2W9Q A;  3NBB A;  5AII A;  1WNH A;  2CG1 A;  5ELJ A;  2ML5 A;  1WTH A;  3SVA A;  2OQE A;  1U5O A;  2RGQ A;  4FMD A;  1IVW A;  3UL6 A;  4BTW A;  3VF1 A;  1A2K A;  5AEU B;  4HM1 B;  3FG3 A;  3JUO A;  4R9L A;  2HMM B;  3OWY A;  4IIA A;  1YVB I;  2QEX 3;  4FR9 A;  3N9H A;  1N5H A;  3BLZ A;  2CFL A;  2XF3 A;  1QJG A;  2GBX B;  2XEP A;  3S67 A;  4HM0 B;  5IG5 A;  1KQS 2;  3LTD A;  1SII A;  4XM4 A;  1S5A A;  4I4K A;  1SQW A;  5CXO A;  1VQL 3;  4KZ1 A;  1OCV A;  4FMC A;  3F8X A;  1VQN 3;  3BND A;  1EG9 B;  4R80 A;  2HMN B;  1BUQ A;  2RFR A;  2PNC A;  5EVH A;  2WOH A;  4MMY B;  1JKG A;  1VQ8 3;  3I56 3;  2F86 B;  4JRF A;  3OWU A;  3UNL A;  4R4K A;  3FG1 A;  1M9G A;  3KII A;  3RDE A;  3EB8 A;  5CF2 A;  4N6O B;  3FCS B;  1UI8 A;  2W0Q A;  4K61 A;  4H61 A;  4O2H A;  1U8C B;  1CQS A;  1IT8 A;  2SBL A;  5JBS A;  1OF5 B;  4N6L A;  3RGR A;  4STD A;  3EN1 B;  3Q1C A;  4EV2 A;  3PGB A;  3FF0 A;  2HML B;  4OVM A;  1S72 3;  1EKM A;  3KFQ C;  2C10 A;  3J7Y d;  5LC7 A;  2WGQ A;  1GD4 A;  3X40 A;  2YX9 A;  2OOV C;  3DUK A;  1JN5 A;  4RBN A;  1K28 A;  3X3Y A;  2LQV A;  3DGL A;  2CFG A;  4Q53 A;  1RKY A;  1IVX A;  3NHX A;  4TX4 A;  3WOF B;  1W5Z A;  2MF7 A;  2CH9 A;  2P05 A;  1ZX2 A;  1VQ4 3;  2Z77 A;  1AR0 A;  4KFD A;  4J8T A;  4R1K A;  2INX A;  3CCL 3;  4ZM8 A;  1O7G B;  2QGU A;  1ISK A;  4WHA A;  3SOA A;  2HMJ B;  1IU7 A;  1TFK A;  5CLK A;  2BMR B;  3QRD A;  5D82 A;  2OQE C;  2W56 A;  5HGR A;  4EC6 A;  1AVK A;  4GB5 A;  3AMO A;  3CCR 3;  1RRL A;  4WP5 A;  1UI7 A;  5IF6 A;  1IQY A;  4U13 A;  5IEP A;  1MOL A;  3GAX A;  3NBR A;  3OWS A;  1DVD A;  1O7M B;  4N6V 0;  4K90 B;  4L8O A;  1IVV A;  2F99 A;  3A76 A;  3H3H A;  1W6G A;  4HM8 B;  1Q81 4;  3MHE A;  1RJO A;  1TIJ A;  1ULJ B;  3LTA A;  1OHP A;  1KSI A;  1E3R A;  2XH9 A;  1OGX A;  1FGT A;  3IMA B;  1LVN A;  3NQZ A;  1D6Z A;  4HKV B;  3CCM 3;  3Q2P A;  1EQK A;  8CHO A;  2GBW B;  3MYT A;  1YIT 3;  1F8N A;  1Q40 A;  2R4I A;  2BMO B;  3CU3 A;  2OOV A;  3T8U A;  4KFE A;  3LTC A;  3CCE 3;  3JUM A;  1RRH A;  5AI1 A;  1O7P B;  2KRT A;  2P09 A;  2A15 A;  3G0K A;  3HIG A;  2E2U A;  3H51 A;  3SOY A;  1MNL A;  1PU4 A;  4HM3 B;  2CIU A;  3FF2 A;  3M8C A;  1AV4 A;  1AVL A;  1LOX A;  2CKF B;  3NV0 B;  5BXQ A;  4O3V A;  1WMO A;  3CNM A;  2E2T A;  3KSP A;  4KFF A;  1NDO B;  3O8Y A;  4MJD A;  3MKI A;  1NB5 I;  2Z6B A;  3DZL A;  1N5P A;  1ASK A;  4XBY A;  2BHM A;  1R4C A;  2GU1 A;  1VQO 3;  1KC8 4;  4RNY A;  5G2G A;  1DMQ A;  3TDG A;  2CW9 A;  2M7O A;  1STF I;  1YJW 3;  1NB3 I;  3DGM A;  3S5C A;  4EXR A;  3FG4 A;  7STD A;  1IK3 A;  4N3V A;  5JPP A;  5KP3 A;  2ZL8 A;  3X3Z A;  4FCZ A;  3CMA 3;  3G4S 3;  3F7S A;  4EYC A;  1IDP A;  1FUW A;  5TGN A;  1E3V A;  1JB5 A;  2OWP A;  4CCV A;  1IV9 A;  1N8Q A;  1OPY A;  3EBT A;  5EEO A;  3F40 A;  3NBJ A;  4HBR A;  1A90 A;  1ROV A;  1GY7 A;  1WMP A;  1Z1S A;  3B4P A;  3LH4 A;  3N54 B;  1TU5 A;  3CCV 3;  1YHQ 3;  1STD A;  3EJV A;  3CCQ 3;  2MC8 A;  3B4O A;  1GY5 A;  3HI7 A;  2OTJ 3;  3KSE D;  3JUN A;  3JUQ A;  2HMO B;  4WYK A;  2W6J H;  3UB1 A;  3FSD A;  2IA7 A;  3EHC A;  4O02 B;  5AIF A;  3FLJ A;  3BNB A;  4LSO A;  4NHF A;  3WA2 X;  1LXE A;  2GEY A;  2F98 A;  1W4N A;  1W02 A;  2OCT A;  4G1M B;  3OV4 A;  4RZM A;  2BT3 A;  1FGR A;  3FZW A;  5IEO A;  3EX9 A;  1IQ8 A;  2XSH B;  4AKZ A;  3FGY A;  3SED A;  1RN7 A;  2L4V A;  4QWT A;  1K73 4;  4BTX A;  4IPB A;  3DGO A;  3EN8 A;  3FKA A;  1OHS A;  4HM6 B;  5STD A;  3LTB A;  2WO0 A;  1FGO A;  3L0R A;  1E97 A;  1M1K 4;  1D6Y A;  3NQY A;  3KZT A;  1JKG B;  2YFI B;  1FGM A;  4WWU C;  4BTY A;  4JF8 A;  1V74 A;  2CFW A;  4EV5 A;  3Q90 A;  4HM2 B;  5A0O B;  2Y74 A;  2GU3 A;  1VQP 3;  4O8S A;  3F9S A;  3WOD G;  3X41 A;  4X2O A;  2K54 A;  5BVB A;  2PZV A;  3G71 3;  3NUV A;  1CEW I;  3T8N A;  3U97 A;  1N9E A;  1HKX A;  2BNG A;  2XR8 B;  3GZB A;  3HZP A;  3V98 A;  3F14 A;  4ORL A;  3WMD A;  3STD A;  4EBG A;  4XBX A;  3JUP A;  3LOY A;  1VQ6 3;  1M90 4;  1JN5 B;  1DVC A;  1US1 A;  3MWZ A;  5D83 A;  1Y4K A;  1W7C A;  3VSY A;  1W01 A;  1UUW B;  2E2V A;  1SPU A;  1Q82 4;  3ECF A;  4N6T A;  2XGL A;  3MG1 A;  5DRE A;  1DMN A;  4J9A A;  5AYR B;  2CWU A;  4HM4 B;  1J2B A;  3K63 A;  4IT7 A;  4XDW A;  1K9M 4;  1UW1 A;  5I97 A;  4R9K A;  1A67 A;  4N6U A;  1VQK 3;  1N9J A;  5IG3 A;  1YJ9 3;  2XFT A;  2YFJ B;  1ZO2 A;  1YI2 3;  2JQ5 A;  2W56 B;  4FMA A;  3LXU X;  4HM5 B;  1SIH A;  1M1X B;  2KCD A;  3G6E 3;  2CFK A;  2CG0 A;  1JJ2 2;  3T0U A;  3CNX A;  3PCS A;  1VQ5 3;  4XDV A;  1IVU A;  3AMO B;  1VZZ A;  3ROB A;  2WGO A;  3GZX B;  4NRE A;  2IMJ A;  3GZR A;  4FCM A;  1TUH A;  1OH0 A;  1WMN A;  1YIJ 3;  2P0M A;  3F8H A;  1L5G B;  2V1L A;  3SXX A;  3K5T A;  1JNQ A;  3S29 A;  1QVF 2;  1W2Z A;  2O3O A;  5AEW B;  3S27 A;  1KD1 4;  2P38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...