1Q40A

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
165
Chain Sequence
QDPTQQLEPFLKRFLASLDLLYTQSQPFPNVESYATQLGSNLKRSSAIIVNGQPIIPSPQEDCKLQFQKKWLQTPLSSHQLTSYDGHLIPGTGTFVVHFSAKVRFDQSGRNRLGESADLFQENNQRPIWGSWFGVDVNLVVDENVMQDGEIINSMDYRFTYVPND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
total genus 43
structure length 165
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40A00
1O7GB 5D81A 1QJGA 1OPYA 3KZTA 1GY5A 3EBTA 1A2KA 3JUNA 4X2HA 4OVMA 3CU3A 1ZX2A 4J8TA 3ECFA 1O7HB 4R9KA 5G2GA 2YFLB 3EX9A 1JN5A 3T8UA 3MKIA 5CF2A 3JUQA 3KSPA 1O7NB 2BMOB 1Z1SA 1AR0A 4HM1B 4GB5A 3CPOA 2GXFA 1O7PB 3EBYA 4HM6B 5HGRA 1JKGB 4XDWA 3SEDA 1VZZA 1NU3A 3SOAA 3D9RA 4LMIA 4HM2B 2OWPA 2XR8B 1GY6A 4I4KA 3NV0A 4KVHA 2Z77A 5AIIA 1ULIB 3GRDA 5KP3A 2INXA 2STDA 3MYTA 1UUWB 4XDVA 4HJLB 3NHXA 2A15A 1STDA 1OHSA 4CDLA 3OX9A 3VSYA 3NUVA 5TGNA 3VGNA 1W01A 1U5OA 3F14A 4FCMA 4HKVB 4LGQA 2F99A 4L7KA 1WQLB 5DRVA 2Z76A 2XSOB 4RZMA 2XRXB 3MSOA 4L8PA 2BNGA 1NDOB 1Q40B 6STDA 5IERA 4ORLA 3MG1A 3ER7A 5IEPA 3LYGA 3G16A 3F7XA 3JUOA 3B4PA 4XBTA 2XSHB 1O7MB 5EVHA 2CHCA 5IG0A 5D83A 1K41A 1DMQA 3MG3A 3FZWA 4X2OA 3F8HA 5JPUA 8CHOA 3OV4A 4HM5B 4WYKA 3I0YA 3EC9A 3F8XA 4WWUC 4HZ9B 3B7CA 1ZO2A 2BMQB 4HM7B 1OH0A 5AIHA 3STDA 1TUHA 5D82A 3JUMA 3FSDA 5STDA 2HMOB 3DUKA 3S5CA 1JKGA 1OGXA 3UNLA 3A76A 1OGZA 1OF5A 4MJDA 3LZAA 4K1UA 5CXOA 4OUQA 3DM8A 2YFJB 5AIFA 1JN5B 5AEUB 3Q90A 1NWWA 5CLKA 3HX8A 4HM8B 3FLJA 1GS3A 3OWYA 4HM0B 1GY7A 3FF2A 1BUQA 1W00A 2HMLB 2I9WA 1OHPA 3RGRA 5BVBA 4LEHA 3EHCA 3OWUA 3ROBA 3SOYA 3KE7A 3B8LA 3NV0B 3DXOA 3WMDA 4R1KA 5AIGA 5IEOA 3K0ZA 3K7CA 1SJWA 3OWSA 3NXJA 3FH1A 1Q42A 4HM4B 3EJVA 1QMAA 3FKAA 5IENA 3GWRA 3DMCA 2HMMB 3H51A 5CF1A 3EF8A 4U13A 3UJMA 3IPTA 3E99A 5KP4A 1IDPA 3KKGA 4H3UA 5BXQA 5KP1A 2RGQA 3M8CA 5JPPA 2B1XB 2Z7AA 4N3VA 1EG9B 1W6YA 4J9AA 5IF6A 1UUVB 5FW5A 4FCJA 4L8OA 3OXAA 2PZVA 2HMJB 4HM3B 1ISKA 4PEJA 3DZLA 2CKFB 2IMJA 3H3HA 3CNMA 1ASKA 4K1VA 1E3VA 2R4IA 1E3RA 5IG3A 1O7WB 2RFRA 4WYKB 3GZRA 3MG2A 3GZXB 2HMNB 7STDA 3G0KA 2UX0A 1ULJB 1E97A 2F98A 2GEYA 2F86B 1HKXA 3RGAA 4STDA 4XBXA 1EA2A 1OF5B 2JQ5A 1OUNA 2K54A 2QGUA 4HZBB 3T8NA 3MHEA 3G8ZA 2BMRB 3B4OA 2QIYA 2B24B 3JUPA 3GZYB 4HVNA 5IG4A 1TP6A 5DREA 1C7HA 1Q40A 3EQQB 2RCDA 3EN8A 5AEWB 4WP5A 1JB4A 1GYBA 3BLZA 3F7SA 1JB2A 4IIAA 5CK6A 3FF0A 5IG5A 4XBYA 1OCVA 3GZBA 4XM4A 2GBWB 1DMNA 5AI1A 3HK4A 1CQSA 3NBRA 2GBXB 4Q53A 2W2CA 1S5AA 4R9LA 3F40A 1JB5A 3NM2A 2YFIB 2GEXA 4XB5A 3HZPA 1W02A 1OHOA 3F9SA 2HMKB 3BB9A 1DMMA 3EN1B 3CNXA 3FGYA
chains in the Genus database with same CATH superfamily
4MMXB 1O7GB 1K734 1GMQA 4CCVA 5D81A 1W2B2 1UGIA 3KCHA 4NHFA 1QJGA 3CCU3 1OPYA 1RCLA 2ZL8A 4HAAA 3KZTA 1V58A 4JF8A 1JNQA 1JZDA 1LOVA 4EV5A 3FGYA 2CWVA 1VQP3 1DVCA 3LH4A 1GY5A 1Q9EA 1YJN3 2W9QA 1C54A 2SARA 5BU4A 3EBTA 5AYRB 2KCDA 1A2KA 1BSEA 3JUNA 1MGRA 2RBIA 1M1K4 7RNTA 1MOLA 4X2HA 2BO9B 4OVMA 5GSPA 1Q7Y4 4HYZA 3CU3A 3MPHA 1EKMA 1ZX2A 4J8TA 1LOYA 1RGHA 3ECFA 1O7HB 4WFOA 3X3ZA 1RN7A 1DE3A 4R9KA 1BSAA 3G713 1D6ZA 5G2GA 3I553 3AGNA 1NB3I 1UW1A 3DGNA 3CD63 1FGMA 2YFLB 3EX9A 2CG0A 1JN5A 2YX9A 1G0TA 1RCKA 3T8UA 5EQLA 3MKIA 2XH9A 3JUQA 5CF2A 1IQ8A 2SBLA 3QK9A 1A2PA 1RGKA 2XEPA 2OTL3 3KSPA 1O7NB 4EBGA 2BMOB 1IVXA 1Z1SA 1VQ63 1AR0A 2AAEA 2L4VA 1B2XA 4HM1B 3BU4A 1Y4KA 4GB5A 3FCSB 3CPOA 1IT7A 3S29A 3KFQC 2GXFA 1O7PB 1TRPA 2W6JH 3EBYA 4HM6B 2E2VA 5HGRA 3SVAA 1RNBA 2C10A 3VF1A 1JKGB 4NREA 4K90B 4XDWA 3K63A 3SEDA 1I3FA 3D5GA 1YIT3 1VZZA 1NU3A 2RSXA 3SOAA 3D9RA 4LMIA 1CYUA 1BNJA 2Y73A 1BNIA 4HM2B 1VQ83 2UUGC 3A5EA 2KRTA 3RNTA 2KXGA 2OWPA 2XR8B 3UL5A 3WA2X 1GY6A 5AYSC 1RMSA 1JJ22 2KF6A 4EXRA 1SQWA 4I4KA 1B21A 3LT8A 3NV0A 3U97A 3I563 1AQZA 1A67A 4KVHA 2Z77A 1RN4A 1KWIA 5AIIA 3CCQ3 1T3BA 1ULIB 3D79A 2JDIH 3GRDA 5KP3A 1RGFA 2KF3A 2INXA 1US1A 2STDA 3V98A 3MYTA 1UUWB 4XDVA 1B3SA 5FGOA 1STFI 5IW9A 2IUKA 4O3VA 4HJLB 1IV9A 1VQ93 2M7OA 1BNEA 3NHXA 1M904 2A15A 1N5HA 3CCV3 1STDA 1R4YA 1W6CA 1OHSA 4CDLA 3OX9A 3CCS3 2O9UX 3BNDA 4R4KA 3D4AA 3VSYA 2MF7A 3NUVA 5TGNA 3VGNA 2W0QA 1W01A 1U5OA 1YJ93 1B20A 2BHMA 3Q2PA 4DKIA 3F14A 1PYLA 1JZOA 2OOVC 1Q7HA 1RJOA 4FCMA 4HKVB 2E2TA 4LGQA 2F99A 4L7KA 1MWRA 1WQLB 3PZWA 1RN1A 2Q07A 2Z76A 5DRVA 3SX1A 2XSOB 4LYLB 4RZMA 1ROAA 1IVVA 4EYCA 3WR2A 2MC8A 2XRXB 2WO0A 2AADA 3V99A 1JBRA 3MSOA 1X1UA 1I0VA 4L8PA 2BNGA 1NDOB 1I2EA 4FMDA 5ELJA 2W04A 1UCKA 2Z6BA 1Q40B 2QA43 3S28A 2WGOA 6STDA 5IERA 4KZ1A 4AKZA 4ORLA 1RRHA 2PNCA 1KSIA 3DGYA 2KAAA 3MG1A 1G96A 1W2ZA 2XFSA 1BSCA 5G1LA 1BRGA 3ZFZA 1FGOA 2F5MA 3ER7A 4J5GA 5IEPA 3LOYA 1OACA 1YNVX 3LYGA 5HOHA 2UGIA 1WNHA 3AMOB 3F7XA 3G16A 3JUOA 1MGWA 2K0MA 6RNTA 3B4PA 4XBTA 1V74A 5ELUA 1GMRA 2J8XB 5M19A 2XSHB 4FR9A 1JV2B 3GSPA 1O7MB 2BIRA 4EW5A 4QWTA 1VQ53 5EVHA 5EEOA 3LMLA 1Q814 2P09A 4ILFA 2CHCA 4CJNA 1YIJ3 2C4BA 4J5KA 4BTXA 5M18A 2P0XA 3AHSA 1A2VA 3N9HA 1K41A 1W6GA 5D83A 2Y74A 1AV4A 1DMQA 3LXUX 3QRDA 3MG3A 4BIRA 3G6E3 3FZWA 3WOFB 2OTJ3 3CCM3 4X2OA 1VQM3 1WMNA 2BT3A 1BOXA 1FUTA 2H0IA 3F8HA 5JPUA 8CHOA 1I2FA 1RHLA 3N8BA 1PU4A 1IVWA 3OV4A 4HM5B 4WYKA 4BU4A 2IUJA 3CCR3 4KFEA 2OCTA 3I0YA 3HIIA 2BU4A 1WMPA 2XGNA 1GSPA 5IG0A 3EC9A 3F8XA 4WWUC 4HZ9B 3B7CA 3KIIA 3PYJA 1ZO2A 3X42A 4MMYB 3Q1CA 2BMQB 4HM7B 1OH0A 1BANA 5AIHA 1VQ73 3STDA 1BNGA 1TUHA 2CFLA 3LTAA 1FGQA 3HOHA 3JUMA 1YGWA 3FSDA 5D82A 5STDA 3NQZA 3HI7A 4OK0A 1BNSA 1QVG2 1MNLA 1LNIA 3DGMA 1VQO3 1NB5I 2HMOB 4K61A 3DUKA 3TDGA 2H0GA 3S5CA 1B2SA 1JKGA 1M1XB 1T5YA 1OGXA 3UNLA 1FYSA 3JVCA 1K9M4 1UCJA 3A76A 4GHOA 1I0XA 1OGZA 1GD3A 1TTOA 4EC6A 2KF4A 1OF5A 1TRQA 4FMBA 4AEQA 1LRAA 1UDII 4MJDA 3LZAA 3LTDA 4K1UA 4HBRA 3FG1A 5CXOA 4BL2A 1GOYA 4OUQA 3DM8A 1SIHA 2YFJB 5AIFA 2CFDA 1BRSA 5LC7A 3LTCA 1G02A 1JN5B 5AEUB 1RNTA 2OOVA 1CEWI 1GD4A 3FG4A 3Q90A 1NWWA 5CLKA 1ZS7A 4O2HA 1MWSA 3HX8A 3BNEA 4HM8B 4RNTA 1BNFA 1FZUA 1PFPA 3FLJA 4FCZA 3BNCA 1UUGB 1BU4A 1GS3A 5LC6A 3SXXA 3OWYA 4HM0B 4JRFA 4IT7A 1GY7A 1TIJA 3IMAB 2OQEC 1BRHA 1IQYA 2W56A 4N6TA 3SLUA 3FF2A 1UI7A 1B2ZA 1BUQA 1W00A 2HOHA 2HMLB 2I9WA 3HIGA 1OHPA 1RGLA 4MMZB 3RGRA 2CFKA 5BVBA 2L1SA 1VQN3 1X1WA 1I8VA 4KT3B 2IY2A 4LEHA 1U8CB 4N6LA 1RKYA 2E2UA 1W7CA 1JRQA 2K3DA 3EHCA 3DY5A 3OWUA 4RBNA 4CPKA 3ROBA 3WA3A 2QEX3 1BRJA 1HYFA 5JBSA 3SOYA 2CFGA 3KE7A 3B8LA 3NV0B 1QAKA 3DXOA 3K5TA 3O8YA 4LZIA 3WMDA 3G4S3 1LVNA 4R1KA 4TX4A 2WOHA 4G1MB 1JBTA 1ROVA 5AIGA 5IEOA 3K0ZA 3EE1A 3K7CA 1D6UA 1SJWA 3OWSA 1QALA 3NXJA 1EEJA 1W4NA 1PY3A 3FH1A 1K28A 1Q42A 3J7Yd 4HM4B 3CC23 3EJVA 1BSBA 1QMAA 3FKAA 4ZM8A 5IENA 3GWRA 3CC43 3L0RA 1VQL3 4KFDA 3DMCA 2HMMB 4IPBA 3H51A 8RNTA 5CF1A 4GL6A 1N9EA 3EF8A 4U13A 3LTBA 3UJMA 7GSPA 1DETA 2FXTA 3IPTA 1BVIA 3E99A 4BTWA 2P05A 4N6UA 1SARA 4O8SA 2P0MA 2RNTA 2W03A 1IDPA 5KP4A 3Q3FA 1KD14 2LQVA 1UCLA 3KKGA 3AGOA 4FMAA 4H3UA 5BXQA 1DVDA 1YVBI 2ML6A 5A0OB 1AY7A 1RSNA 3UL6A 1LOXA 1A90A 4N6V0 1FUSA 4RNZA 1N8QA 3KN4A 5KP1A 1TFOA 1BGSA 2CC3A 1RLSA 1IVUA 2RGQA 5M1AA 3M8CA 5JPPA 2B1XB 2Z7AA 4N3VA 2CX1A 3SYUA 1X1YA 1EG9B 1W6YA 2W9PA 4H61A 3NM7A 4J9AA 5IF6A 1LQMB 1YVSA 3T0UA 3CXC2 1UUVB 5FW5A 3S67A 4FCJA 2GU1A 4L8OA 3BIRA 3NBJA 3OXAA 1YI23 1TFKA 1K8A4 1J2BA 3PXMA 2PZVA 1VQ43 2CWUA 3MWZA 2CG1A 2HMJB 2IA7A 1IT8A 3FG3A 4HM3B 4RNYA 1ISKA 4PEJA 1RGGA 3DZLA 1QAFA 2CKFB 1T2HA 2IMJA 3KSED 1UGHI 1RTUA 1M9GA 2WOFA 1UI8A 3H3HA 3PCSA 4LSOA 3CME3 1LQGC 2XF3A 3WOEB 3CNMA 1ASKA 2GSPA 1R4CA 1SIIA 3WHOA 2R41A 4MEIA 3RDEA 3GAXA 1BIRA 1S723 2XGLA 1ZGXA 2OQEA 2ZHXB 4K1VA 1WMOA 2KF5A 3CMA3 3ZG0A 2CFWA 4N6OB 1HU9A 1EQKA 1E3VA 2R4IA 1E3RA 5IG3A 1O7WB 2RFRA 1RGAA 4WYKB 4BL3A 1CH0A 3GZRA 4KFFA 3MG2A 3GZXB 2HMNB 4BTYA 1RDSA 1TJDA 2GU3A 4EV2A 2F56A 1N8R4 1LNHA 1GOVA 2WGQA 1BRIA 2V1LA 2FNQA 2ML5A 3PS8A 4NPBA 4R80A 6GSPA 7STDA 1DYUA 1FGTA 3UB1A 4AKYA 4FMCA 1BRNL 3BNBA 5BIRA 3AHWA 3G0KA 1V57A 3DH2A 2UX0A 1ULJB 1E97A 3NX0A 1GOUA 4N6NB 2C11A 3U1WA 2F98A 1WTHA 2GEYA 2F86B 1IK3A 1QVF2 3X3YA 1HKXA 1YHQ3 3NBBA 1B2UA 3LT9A 1YGEA 3RGAA 4STDA 2H0HA 2IYJA 4XBXA 1NJI4 3X41A 1EA2A 1OF5B 3WODG 3ZG5A 2JQ5A 9RNTA 5I97A 1KQS2 1OUNA 2K54A 2QGUA 3IJEB 4HZBB 1IQXA 1I3IA 3T8NA 2D1WA 3MHEA 3OW22 3X3XA 3ALAA 1T2IA 1X1XA 3G8ZA 1FGRA 2BMRB 3B4OA 1NNVA 3CCL3 1L5GB 4I5QA 1RGCA 2QIYA 1TU5A 3V92A 1RRLA 3NQYA 1N9JA 2B24B 2CWTA 3JUPA 1F8NA 1FA3A 1LXEA 3GZYB 4HVNA 1JBSA 4HOHA 5IG4A 2CIUA 1AVKA 1CYVA 1GMPA 2O3OA 1TP6A 3K9MC 5DREA 1BSDA 1IYYA 1C7HA 1AVLA 1Q40A 3EQQB 2CW9A 1RGEA 3URPA 2F4YA 1VQQA 2RCDA 1BRKA 2W56B 1LOWA 3EN8A 1B2MA 5AEWB 1EUIC 4WP5A 3CPW2 1D6YA 1JB4A 1GYBA 1MWTA 2CH9A 3EB8A 1BNRA 2P38A 1VQK3 2ZDJA 1BAOA 1HZ1A 3D3LA 3PGBA 3BLZA 2XFTA 1JB2A 3F7SA 4IIAA 4O02B 5CK6A 3AMOA 1NO3A 3N54B 2D42A 1FW7A 4WHAA 3FF0A 2LYXA 5IG5A 3S27A 4XBYA 3PCRA 1BUJA 1MWUA 1IU7A 1OCVA 2ZA4A 3GZBA 4XM4A 2GBWB 1DMNA 3DGLA 5AI1A 1W5ZA 2F5WA 3D5IA 3HK4A 5G1KA 1CQSA 2CX0A 4N6MA 3NBRA 2GBXB 3WDGB 1Q864 1UCIA 4GSPA 1I70A 4Q53A 2W2CA 1Q824 1S5AA 4R9LA 3F40A 1N5PA 1JB5A 3NM2A 5RNTA 2YFIB 1KC84 2FGTA 2GEXA 4XB5A 3X40A 1YJW3 3HZPA 1W02A 3CC73 3CCJ3 1IV7A 3DGOA 1I2GA 1OHOA 2CK3H 1SPUA 3F9SA 2HMKB 3BB9A 1FUWA 1DMMA 3CCE3 3EN1B 3CNXA 1B27A
chains in the Genus database with same CATH topology
4MMXB 1O7GB 1K734 4CCVA 5D81A 1W2B2 4NHFA 3CCU3 1QJGA 1OPYA 2ZL8A 3KZTA 4JF8A 1JNQA 4EV5A 1VQP3 2CWVA 1DVCA 3LH4A 1GY5A 1YJN3 2W9QA 3EBTA 5AYRB 2KCDA 1A2KA 3JUNA 1M1K4 1MOLA 4X2HA 2BO9B 4OVMA 1Q7Y4 4HYZA 3CU3A 3MPHA 1EKMA 1ZX2A 4J8TA 4WFOA 3ECFA 1O7HB 3X3ZA 1RN7A 4R9KA 3G713 1D6ZA 5G2GA 3I553 1NB3I 1UW1A 3DGNA 3CD63 1FGMA 2YFLB 3EX9A 2CG0A 1JN5A 2YX9A 3T8UA 5EQLA 3MKIA 2XH9A 3JUQA 5CF2A 1IQ8A 2SBLA 3QK9A 2XEPA 2OTL3 3KSPA 1O7NB 4EBGA 2BMOB 1IVXA 1Z1SA 1VQ63 1AR0A 2L4VA 4HM1B 4GB5A 1Y4KA 3FCSB 3CPOA 1IT7A 3S29A 3KFQC 2GXFA 1O7PB 2W6JH 3EBYA 4HM6B 5HGRA 2E2VA 3SVAA 2C10A 3VF1A 1JKGB 4NREA 4K90B 4XDWA 3K63A 3SEDA 1YIT3 1VZZA 1NU3A 2RSXA 3SOAA 3D9RA 4LMIA 1CYUA 2Y73A 4HM2B 1VQ83 2KRTA 2KXGA 2OWPA 2XR8B 3UL5A 3WA2X 1GY6A 5AYSC 1JJ22 4EXRA 1SQWA 4I4KA 3LT8A 3NV0A 3U97A 3I563 1A67A 4KVHA 2Z77A 3CCQ3 1KWIA 5AIIA 1ULIB 2JDIH 3GRDA 5KP3A 2INXA 1US1A 2STDA 3V98A 3MYTA 1UUWB 4XDVA 5FGOA 1STFI 5IW9A 2IUKA 4O3VA 4HJLB 1IV9A 1VQ93 2M7OA 1M904 3NHXA 2A15A 1N5HA 3CCV3 1STDA 1W6CA 1OHSA 4CDLA 3OX9A 3CCS3 2O9UX 3BNDA 4R4KA 3VSYA 2MF7A 3NUVA 5TGNA 3VGNA 2W0QA 1W01A 1U5OA 1YJ93 2BHMA 3Q2PA 3F14A 2OOVC 4FCMA 4HKVB 1RJOA 2E2TA 4LGQA 2F99A 4L7KA 1WQLB 3PZWA 2Q07A 2Z76A 5DRVA 3SX1A 2XSOB 4RZMA 1ROAA 1IVVA 4EYCA 2MC8A 2XRXB 2WO0A 3V99A 3MSOA 4L8PA 2BNGA 1NDOB 4FMDA 5ELJA 2W04A 2Z6BA 1Q40B 2QA43 3S28A 2WGOA 6STDA 5IERA 4KZ1A 4AKZA 4ORLA 1RRHA 2PNCA 1KSIA 3MG1A 1G96A 1W2ZA 2XFSA 1FGOA 3ER7A 5IEPA 3LOYA 1OACA 3LYGA 3AMOB 1WNHA 3G16A 3F7XA 3JUOA 2K0MA 3B4PA 4XBTA 1V74A 5ELUA 2XSHB 4FR9A 1JV2B 1O7MB 4QWTA 1VQ53 5EVHA 5EEOA 3LMLA 1Q814 2P09A 1YIJ3 2CHCA 4BTXA 2P0XA 5IG0A 1A2VA 3N9HA 1K41A 1W6GA 5D83A 2Y74A 1AV4A 1DMQA 3LXUX 3QRDA 3MG3A 3G6E3 3FZWA 3WOFB 2OTJ3 3CCM3 4X2OA 1VQM3 1WMNA 2BT3A 3F8HA 5JPUA 8CHOA 3N8BA 1PU4A 1IVWA 3OV4A 4HM5B 4WYKA 2IUJA 3CCR3 4KFEA 2OCTA 3I0YA 3HIIA 1WMPA 2XGNA 3EC9A 3F8XA 4WWUC 4HZ9B 3B7CA 3KIIA 3PYJA 1ZO2A 3X42A 4MMYB 3Q1CA 2BMQB 4HM7B 1OH0A 5AIHA 1VQ73 3STDA 2CFLA 1TUHA 3LTAA 5D82A 1FGQA 3JUMA 3FSDA 5STDA 3NQZA 3HI7A 4OK0A 1QVG2 1MNLA 3DGMA 1VQO3 1NB5I 2HMOB 4K61A 3DUKA 3TDGA 3S5CA 1JKGA 1M1XB 1T5YA 1OGXA 3UNLA 3JVCA 1K9M4 3A76A 1OGZA 1GD3A 4EC6A 1OF5A 4FMBA 4AEQA 4MJDA 3LZAA 3LTDA 4K1UA 4HBRA 3FG1A 5CXOA 4OUQA 3DM8A 1SIHA 2YFJB 5AIFA 2CFDA 5LC7A 3LTCA 1JN5B 5AEUB 2OOVA 1CEWI 1GD4A 3FG4A 3Q90A 1NWWA 5CLKA 4O2HA 3HX8A 3BNEA 4HM8B 1PFPA 3FLJA 4FCZA 3BNCA 1GS3A 5LC6A 3SXXA 3OWYA 4HM0B 4JRFA 4IT7A 1GY7A 1TIJA 3IMAB 2OQEC 1IQYA 2W56A 4N6TA 3SLUA 3FF2A 1UI7A 1BUQA 1W00A 3HIGA 2HMLB 2I9WA 1OHPA 4MMZB 3RGRA 2CFKA 5BVBA 1VQN3 4LEHA 1U8CB 4N6LA 1RKYA 2E2UA 1W7CA 1JRQA 3EHCA 3DY5A 3OWUA 4RBNA 3ROBA 3WA3A 2QEX3 5JBSA 3SOYA 2CFGA 3KE7A 3B8LA 3NV0B 1QAKA 3DXOA 3K5TA 3O8YA 4LZIA 3WMDA 3G4S3 1LVNA 4R1KA 4TX4A 2WOHA 4G1MB 1ROVA 5AIGA 5IEOA 3K0ZA 3EE1A 3K7CA 1D6UA 1SJWA 3OWSA 1QALA 3NXJA 1W4NA 3FH1A 1K28A 1Q42A 3J7Yd 4HM4B 3CC23 3EJVA 1QMAA 3FKAA 4ZM8A 5IENA 3GWRA 3CC43 3L0RA 1VQL3 4KFDA 3DMCA 2HMMB 4IPBA 3H51A 5CF1A 4GL6A 1N9EA 3EF8A 4U13A 3LTBA 3UJMA 2FXTA 3IPTA 3E99A 4BTWA 2P05A 4N6UA 4O8SA 2P0MA 5KP4A 2W03A 1IDPA 1KD14 2LQVA 3KKGA 4FMAA 4H3UA 5BXQA 1DVDA 1YVBI 2ML6A 5A0OB 3UL6A 1LOXA 1A90A 4N6V0 5KP1A 4RNZA 1N8QA 3KN4A 1TFOA 2CC3A 1IVUA 2RGQA 3M8CA 5JPPA 2B1XB 2Z7AA 4N3VA 1EG9B 1W6YA 2W9PA 4H61A 3NM7A 4J9AA 5IF6A 3T0UA 3CXC2 1UUVB 5FW5A 3S67A 4FCJA 2GU1A 4L8OA 3NBJA 3OXAA 1YI23 1TFKA 1K8A4 1J2BA 3PXMA 2PZVA 1VQ43 2CWUA 3MWZA 2CG1A 2HMJB 2IA7A 1IT8A 3FG3A 4HM3B 4RNYA 1ISKA 4PEJA 3DZLA 1QAFA 2CKFB 2IMJA 3KSED 1M9GA 2WOFA 1UI8A 3H3HA 3PCSA 4LSOA 3CME3 2XF3A 3WOEB 3CNMA 1ASKA 1R4CA 1SIIA 4MEIA 3RDEA 3GAXA 1S723 2XGLA 2OQEA 4K1VA 1WMOA 3CMA3 2CFWA 4N6OB 1HU9A 1EQKA 1E3VA 2R4IA 1E3RA 5IG3A 1O7WB 2RFRA 4WYKB 4KFFA 3GZRA 3MG2A 3GZXB 2HMNB 4BTYA 2GU3A 4EV2A 1N8R4 1LNHA 2WGQA 2V1LA 2FNQA 2ML5A 3PS8A 4R80A 7STDA 1DYUA 1FGTA 3UB1A 4AKYA 4FMCA 3BNBA 3G0KA 2UX0A 1ULJB 1E97A 3NX0A 4N6NB 2C11A 3U1WA 2F98A 1WTHA 2GEYA 2F86B 1IK3A 1QVF2 3X3YA 1HKXA 1YHQ3 3NBBA 3LT9A 1YGEA 3RGAA 4STDA 4XBXA 1NJI4 3X41A 1EA2A 1OF5B 3WODG 5I97A 2JQ5A 1KQS2 1OUNA 2K54A 2QGUA 3IJEB 4HZBB 1IQXA 3T8NA 2D1WA 3MHEA 3OW22 3X3XA 3ALAA 3G8ZA 1FGRA 2BMRB 3B4OA 3CCL3 1L5GB 2QIYA 1TU5A 3V92A 1RRLA 3NQYA 1N9JA 2B24B 2CWTA 3JUPA 1F8NA 1FA3A 1LXEA 3GZYB 4HVNA 5IG4A 2CIUA 1AVKA 1CYVA 2O3OA 1TP6A 3K9MC 5DREA 1C7HA 1AVLA 1Q40A 3EQQB 2CW9A 2RCDA 2W56B 3EN8A 5AEWB 4WP5A 3CPW2 1D6YA 1JB4A 1GYBA 2CH9A 3EB8A 2P38A 1VQK3 2ZDJA 3D3LA 3PGBA 3BLZA 2XFTA 1JB2A 3F7SA 4IIAA 4O02B 5CK6A 3AMOA 1NO3A 3N54B 2D42A 4WHAA 3FF0A 2LYXA 5IG5A 3S27A 4XBYA 3PCRA 1IU7A 1OCVA 3GZBA 4XM4A 2GBWB 1DMNA 3DGLA 5AI1A 1W5ZA 3HK4A 1CQSA 4N6MA 3NBRA 2GBXB 3WDGB 1Q864 4Q53A 2W2CA 1Q824 1S5AA 4R9LA 3F40A 1N5PA 1JB5A 3NM2A 2YFIB 1KC84 2FGTA 2GEXA 4XB5A 3X40A 1YJW3 3HZPA 1W02A 3CC73 3CCJ3 1IV7A 3DGOA 1OHOA 2CK3H 1SPUA 3F9SA 2HMKB 3BB9A 1FUWA 1DMMA 3CCE3 3EN1B 3CNXA 3FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7G B;  5D81 A;  1QJG A;  1OPY A;  3KZT A;  1GY5 A;  3EBT A;  1A2K A;  3JUN A;  4X2H A;  4OVM A;  3CU3 A;  1ZX2 A;  4J8T A;  3ECF A;  1O7H B;  4R9K A;  5G2G A;  2YFL B;  3EX9 A;  1JN5 A;  3T8U A;  3MKI A;  5CF2 A;  3JUQ A;  3KSP A;  1O7N B;  2BMO B;  1Z1S A;  1AR0 A;  4HM1 B;  4GB5 A;  3CPO A;  2GXF A;  1O7P B;  3EBY A;  4HM6 B;  5HGR A;  1JKG B;  4XDW A;  3SED A;  1VZZ A;  1NU3 A;  3SOA A;  3D9R A;  4LMI A;  4HM2 B;  2OWP A;  2XR8 B;  1GY6 A;  4I4K A;  3NV0 A;  4KVH A;  2Z77 A;  5AII A;  1ULI B;  3GRD A;  5KP3 A;  2INX A;  2STD A;  3MYT A;  1UUW B;  4XDV A;  4HJL B;  3NHX A;  2A15 A;  1STD A;  1OHS A;  4CDL A;  3OX9 A;  3VSY A;  3NUV A;  5TGN A;  3VGN A;  1W01 A;  1U5O A;  3F14 A;  4FCM A;  4HKV B;  4LGQ A;  2F99 A;  4L7K A;  1WQL B;  5DRV A;  2Z76 A;  2XSO B;  4RZM A;  2XRX B;  3MSO A;  4L8P A;  2BNG A;  1NDO B;  1Q40 B;  6STD A;  5IER A;  4ORL A;  3MG1 A;  3ER7 A;  5IEP A;  3LYG A;  3G16 A;  3F7X A;  3JUO A;  3B4P A;  4XBT A;  2XSH B;  1O7M B;  5EVH A;  2CHC A;  5IG0 A;  5D83 A;  1K41 A;  1DMQ A;  3MG3 A;  3FZW A;  4X2O A;  3F8H A;  5JPU A;  8CHO A;  3OV4 A;  4HM5 B;  4WYK A;  3I0Y A;  3EC9 A;  3F8X A;  4WWU C;  4HZ9 B;  3B7C A;  1ZO2 A;  2BMQ B;  4HM7 B;  1OH0 A;  5AIH A;  3STD A;  1TUH A;  5D82 A;  3JUM A;  3FSD A;  5STD A;  2HMO B;  3DUK A;  3S5C A;  1JKG A;  1OGX A;  3UNL A;  3A76 A;  1OGZ A;  1OF5 A;  4MJD A;  3LZA A;  4K1U A;  5CXO A;  4OUQ A;  3DM8 A;  2YFJ B;  5AIF A;  1JN5 B;  5AEU B;  3Q90 A;  1NWW A;  5CLK A;  3HX8 A;  4HM8 B;  3FLJ A;  1GS3 A;  3OWY A;  4HM0 B;  1GY7 A;  3FF2 A;  1BUQ A;  1W00 A;  2HML B;  2I9W A;  1OHP A;  3RGR A;  5BVB A;  4LEH A;  3EHC A;  3OWU A;  3ROB A;  3SOY A;  3KE7 A;  3B8L A;  3NV0 B;  3DXO A;  3WMD A;  4R1K A;  5AIG A;  5IEO A;  3K0Z A;  3K7C A;  1SJW A;  3OWS A;  3NXJ A;  3FH1 A;  1Q42 A;  4HM4 B;  3EJV A;  1QMA A;  3FKA A;  5IEN A;  3GWR A;  3DMC A;  2HMM B;  3H51 A;  5CF1 A;  3EF8 A;  4U13 A;  3UJM A;  3IPT A;  3E99 A;  5KP4 A;  1IDP A;  3KKG A;  4H3U A;  5BXQ A;  5KP1 A;  2RGQ A;  3M8C A;  5JPP A;  2B1X B;  2Z7A A;  4N3V A;  1EG9 B;  1W6Y A;  4J9A A;  5IF6 A;  1UUV B;  5FW5 A;  4FCJ A;  4L8O A;  3OXA A;  2PZV A;  2HMJ B;  4HM3 B;  1ISK A;  4PEJ A;  3DZL A;  2CKF B;  2IMJ A;  3H3H A;  3CNM A;  1ASK A;  4K1V A;  1E3V A;  2R4I A;  1E3R A;  5IG3 A;  1O7W B;  2RFR A;  4WYK B;  3GZR A;  3MG2 A;  3GZX B;  2HMN B;  7STD A;  3G0K A;  2UX0 A;  1ULJ B;  1E97 A;  2F98 A;  2GEY A;  2F86 B;  1HKX A;  3RGA A;  4STD A;  4XBX A;  1EA2 A;  1OF5 B;  2JQ5 A;  1OUN A;  2K54 A;  2QGU A;  4HZB B;  3T8N A;  3MHE A;  3G8Z A;  2BMR B;  3B4O A;  2QIY A;  2B24 B;  3JUP A;  3GZY B;  4HVN A;  5IG4 A;  1TP6 A;  5DRE A;  1C7H A;  1Q40 A;  3EQQ B;  2RCD A;  3EN8 A;  5AEW B;  4WP5 A;  1JB4 A;  1GYB A;  3BLZ A;  3F7S A;  1JB2 A;  4IIA A;  5CK6 A;  3FF0 A;  5IG5 A;  4XBY A;  1OCV A;  3GZB A;  4XM4 A;  2GBW B;  1DMN A;  5AI1 A;  3HK4 A;  1CQS A;  3NBR A;  2GBX B;  4Q53 A;  2W2C A;  1S5A A;  4R9L A;  3F40 A;  1JB5 A;  3NM2 A;  2YFI B;  2GEX A;  4XB5 A;  3HZP A;  1W02 A;  1OHO A;  3F9S A;  2HMK B;  3BB9 A;  1DMM A;  3EN1 B;  3CNX A;  3FGY A; 
#chains in the Genus database with same CATH topology
 4MMX B;  1O7G B;  1K73 4;  1GMQ A;  4CCV A;  5D81 A;  1W2B 2;  1UGI A;  3KCH A;  4NHF A;  1QJG A;  3CCU 3;  1OPY A;  1RCL A;  2ZL8 A;  4HAA A;  3KZT A;  1V58 A;  4JF8 A;  1JNQ A;  1JZD A;  1LOV A;  4EV5 A;  3FGY A;  2CWV A;  1VQP 3;  1DVC A;  3LH4 A;  1GY5 A;  1Q9E A;  1YJN 3;  2W9Q A;  1C54 A;  2SAR A;  5BU4 A;  3EBT A;  5AYR B;  2KCD A;  1A2K A;  1BSE A;  3JUN A;  1MGR A;  2RBI A;  1M1K 4;  7RNT A;  1MOL A;  4X2H A;  2BO9 B;  4OVM A;  5GSP A;  1Q7Y 4;  4HYZ A;  3CU3 A;  3MPH A;  1EKM A;  1ZX2 A;  4J8T A;  1LOY A;  1RGH A;  3ECF A;  1O7H B;  4WFO A;  3X3Z A;  1RN7 A;  1DE3 A;  4R9K A;  1BSA A;  3G71 3;  1D6Z A;  5G2G A;  3I55 3;  3AGN A;  1NB3 I;  1UW1 A;  3DGN A;  3CD6 3;  1FGM A;  2YFL B;  3EX9 A;  2CG0 A;  1JN5 A;  2YX9 A;  1G0T A;  1RCK A;  3T8U A;  5EQL A;  3MKI A;  2XH9 A;  3JUQ A;  5CF2 A;  1IQ8 A;  2SBL A;  3QK9 A;  1A2P A;  1RGK A;  2XEP A;  2OTL 3;  3KSP A;  1O7N B;  4EBG A;  2BMO B;  1IVX A;  1Z1S A;  1VQ6 3;  1AR0 A;  2AAE A;  2L4V A;  1B2X A;  4HM1 B;  3BU4 A;  1Y4K A;  4GB5 A;  3FCS B;  3CPO A;  1IT7 A;  3S29 A;  3KFQ C;  2GXF A;  1O7P B;  1TRP A;  2W6J H;  3EBY A;  4HM6 B;  2E2V A;  5HGR A;  3SVA A;  1RNB A;  2C10 A;  3VF1 A;  1JKG B;  4NRE A;  4K90 B;  4XDW A;  3K63 A;  3SED A;  1I3F A;  3D5G A;  1YIT 3;  1VZZ A;  1NU3 A;  2RSX A;  3SOA A;  3D9R A;  4LMI A;  1CYU A;  1BNJ A;  2Y73 A;  1BNI A;  4HM2 B;  1VQ8 3;  2UUG C;  3A5E A;  2KRT A;  3RNT A;  2KXG A;  2OWP A;  2XR8 B;  3UL5 A;  3WA2 X;  1GY6 A;  5AYS C;  1RMS A;  1JJ2 2;  2KF6 A;  4EXR A;  1SQW A;  4I4K A;  1B21 A;  3LT8 A;  3NV0 A;  3U97 A;  3I56 3;  1AQZ A;  1A67 A;  4KVH A;  2Z77 A;  1RN4 A;  1KWI A;  5AII A;  3CCQ 3;  1T3B A;  1ULI B;  3D79 A;  2JDI H;  3GRD A;  5KP3 A;  1RGF A;  2KF3 A;  2INX A;  1US1 A;  2STD A;  3V98 A;  3MYT A;  1UUW B;  4XDV A;  1B3S A;  5FGO A;  1STF I;  5IW9 A;  2IUK A;  4O3V A;  4HJL B;  1IV9 A;  1VQ9 3;  2M7O A;  1BNE A;  3NHX A;  1M90 4;  2A15 A;  1N5H A;  3CCV 3;  1STD A;  1R4Y A;  1W6C A;  1OHS A;  4CDL A;  3OX9 A;  3CCS 3;  2O9U X;  3BND A;  4R4K A;  3D4A A;  3VSY A;  2MF7 A;  3NUV A;  5TGN A;  3VGN A;  2W0Q A;  1W01 A;  1U5O A;  1YJ9 3;  1B20 A;  2BHM A;  3Q2P A;  4DKI A;  3F14 A;  1PYL A;  1JZO A;  2OOV C;  1Q7H A;  1RJO A;  4FCM A;  4HKV B;  2E2T A;  4LGQ A;  2F99 A;  4L7K A;  1MWR A;  1WQL B;  3PZW A;  1RN1 A;  2Q07 A;  2Z76 A;  5DRV A;  3SX1 A;  2XSO B;  4LYL B;  4RZM A;  1ROA A;  1IVV A;  4EYC A;  3WR2 A;  2MC8 A;  2XRX B;  2WO0 A;  2AAD A;  3V99 A;  1JBR A;  3MSO A;  1X1U A;  1I0V A;  4L8P A;  2BNG A;  1NDO B;  1I2E A;  4FMD A;  5ELJ A;  2W04 A;  1UCK A;  2Z6B A;  1Q40 B;  2QA4 3;  3S28 A;  2WGO A;  6STD A;  5IER A;  4KZ1 A;  4AKZ A;  4ORL A;  1RRH A;  2PNC A;  1KSI A;  3DGY A;  2KAA A;  3MG1 A;  1G96 A;  1W2Z A;  2XFS A;  1BSC A;  5G1L A;  1BRG A;  3ZFZ A;  1FGO A;  2F5M A;  3ER7 A;  4J5G A;  5IEP A;  3LOY A;  1OAC A;  1YNV X;  3LYG A;  5HOH A;  2UGI A;  1WNH A;  3AMO B;  3F7X A;  3G16 A;  3JUO A;  1MGW A;  2K0M A;  6RNT A;  3B4P A;  4XBT A;  1V74 A;  5ELU A;  1GMR A;  2J8X B;  5M19 A;  2XSH B;  4FR9 A;  1JV2 B;  3GSP A;  1O7M B;  2BIR A;  4EW5 A;  4QWT A;  1VQ5 3;  5EVH A;  5EEO A;  3LML A;  1Q81 4;  2P09 A;  4ILF A;  2CHC A;  4CJN A;  1YIJ 3;  2C4B A;  4J5K A;  4BTX A;  5M18 A;  2P0X A;  3AHS A;  1A2V A;  3N9H A;  1K41 A;  1W6G A;  5D83 A;  2Y74 A;  1AV4 A;  1DMQ A;  3LXU X;  3QRD A;  3MG3 A;  4BIR A;  3G6E 3;  3FZW A;  3WOF B;  2OTJ 3;  3CCM 3;  4X2O A;  1VQM 3;  1WMN A;  2BT3 A;  1BOX A;  1FUT A;  2H0I A;  3F8H A;  5JPU A;  8CHO A;  1I2F A;  1RHL A;  3N8B A;  1PU4 A;  1IVW A;  3OV4 A;  4HM5 B;  4WYK A;  4BU4 A;  2IUJ A;  3CCR 3;  4KFE A;  2OCT A;  3I0Y A;  3HII A;  2BU4 A;  1WMP A;  2XGN A;  1GSP A;  5IG0 A;  3EC9 A;  3F8X A;  4WWU C;  4HZ9 B;  3B7C A;  3KII A;  3PYJ A;  1ZO2 A;  3X42 A;  4MMY B;  3Q1C A;  2BMQ B;  4HM7 B;  1OH0 A;  1BAN A;  5AIH A;  1VQ7 3;  3STD A;  1BNG A;  1TUH A;  2CFL A;  3LTA A;  1FGQ A;  3HOH A;  3JUM A;  1YGW A;  3FSD A;  5D82 A;  5STD A;  3NQZ A;  3HI7 A;  4OK0 A;  1BNS A;  1QVG 2;  1MNL A;  1LNI A;  3DGM A;  1VQO 3;  1NB5 I;  2HMO B;  4K61 A;  3DUK A;  3TDG A;  2H0G A;  3S5C A;  1B2S A;  1JKG A;  1M1X B;  1T5Y A;  1OGX A;  3UNL A;  1FYS A;  3JVC A;  1K9M 4;  1UCJ A;  3A76 A;  4GHO A;  1I0X A;  1OGZ A;  1GD3 A;  1TTO A;  4EC6 A;  2KF4 A;  1OF5 A;  1TRQ A;  4FMB A;  4AEQ A;  1LRA A;  1UDI I;  4MJD A;  3LZA A;  3LTD A;  4K1U A;  4HBR A;  3FG1 A;  5CXO A;  4BL2 A;  1GOY A;  4OUQ A;  3DM8 A;  1SIH A;  2YFJ B;  5AIF A;  2CFD A;  1BRS A;  5LC7 A;  3LTC A;  1G02 A;  1JN5 B;  5AEU B;  1RNT A;  2OOV A;  1CEW I;  1GD4 A;  3FG4 A;  3Q90 A;  1NWW A;  5CLK A;  1ZS7 A;  4O2H A;  1MWS A;  3HX8 A;  3BNE A;  4HM8 B;  4RNT A;  1BNF A;  1FZU A;  1PFP A;  3FLJ A;  4FCZ A;  3BNC A;  1UUG B;  1BU4 A;  1GS3 A;  5LC6 A;  3SXX A;  3OWY A;  4HM0 B;  4JRF A;  4IT7 A;  1GY7 A;  1TIJ A;  3IMA B;  2OQE C;  1BRH A;  1IQY A;  2W56 A;  4N6T A;  3SLU A;  3FF2 A;  1UI7 A;  1B2Z A;  1BUQ A;  1W00 A;  2HOH A;  2HML B;  2I9W A;  3HIG A;  1OHP A;  1RGL A;  4MMZ B;  3RGR A;  2CFK A;  5BVB A;  2L1S A;  1VQN 3;  1X1W A;  1I8V A;  4KT3 B;  2IY2 A;  4LEH A;  1U8C B;  4N6L A;  1RKY A;  2E2U A;  1W7C A;  1JRQ A;  2K3D A;  3EHC A;  3DY5 A;  3OWU A;  4RBN A;  4CPK A;  3ROB A;  3WA3 A;  2QEX 3;  1BRJ A;  1HYF A;  5JBS A;  3SOY A;  2CFG A;  3KE7 A;  3B8L A;  3NV0 B;  1QAK A;  3DXO A;  3K5T A;  3O8Y A;  4LZI A;  3WMD A;  3G4S 3;  1LVN A;  4R1K A;  4TX4 A;  2WOH A;  4G1M B;  1JBT A;  1ROV A;  5AIG A;  5IEO A;  3K0Z A;  3EE1 A;  3K7C A;  1D6U A;  1SJW A;  3OWS A;  1QAL A;  3NXJ A;  1EEJ A;  1W4N A;  1PY3 A;  3FH1 A;  1K28 A;  1Q42 A;  3J7Y d;  4HM4 B;  3CC2 3;  3EJV A;  1BSB A;  1QMA A;  3FKA A;  4ZM8 A;  5IEN A;  3GWR A;  3CC4 3;  3L0R A;  1VQL 3;  4KFD A;  3DMC A;  2HMM B;  4IPB A;  3H51 A;  8RNT A;  5CF1 A;  4GL6 A;  1N9E A;  3EF8 A;  4U13 A;  3LTB A;  3UJM A;  7GSP A;  1DET A;  2FXT A;  3IPT A;  1BVI A;  3E99 A;  4BTW A;  2P05 A;  4N6U A;  1SAR A;  4O8S A;  2P0M A;  2RNT A;  2W03 A;  1IDP A;  5KP4 A;  3Q3F A;  1KD1 4;  2LQV A;  1UCL A;  3KKG A;  3AGO A;  4FMA A;  4H3U A;  5BXQ A;  1DVD A;  1YVB I;  2ML6 A;  5A0O B;  1AY7 A;  1RSN A;  3UL6 A;  1LOX A;  1A90 A;  4N6V 0;  1FUS A;  4RNZ A;  1N8Q A;  3KN4 A;  5KP1 A;  1TFO A;  1BGS A;  2CC3 A;  1RLS A;  1IVU A;  2RGQ A;  5M1A A;  3M8C A;  5JPP A;  2B1X B;  2Z7A A;  4N3V A;  2CX1 A;  3SYU A;  1X1Y A;  1EG9 B;  1W6Y A;  2W9P A;  4H61 A;  3NM7 A;  4J9A A;  5IF6 A;  1LQM B;  1YVS A;  3T0U A;  3CXC 2;  1UUV B;  5FW5 A;  3S67 A;  4FCJ A;  2GU1 A;  4L8O A;  3BIR A;  3NBJ A;  3OXA A;  1YI2 3;  1TFK A;  1K8A 4;  1J2B A;  3PXM A;  2PZV A;  1VQ4 3;  2CWU A;  3MWZ A;  2CG1 A;  2HMJ B;  2IA7 A;  1IT8 A;  3FG3 A;  4HM3 B;  4RNY A;  1ISK A;  4PEJ A;  1RGG A;  3DZL A;  1QAF A;  2CKF B;  1T2H A;  2IMJ A;  3KSE D;  1UGH I;  1RTU A;  1M9G A;  2WOF A;  1UI8 A;  3H3H A;  3PCS A;  4LSO A;  3CME 3;  1LQG C;  2XF3 A;  3WOE B;  3CNM A;  1ASK A;  2GSP A;  1R4C A;  1SII A;  3WHO A;  2R41 A;  4MEI A;  3RDE A;  3GAX A;  1BIR A;  1S72 3;  2XGL A;  1ZGX A;  2OQE A;  2ZHX B;  4K1V A;  1WMO A;  2KF5 A;  3CMA 3;  3ZG0 A;  2CFW A;  4N6O B;  1HU9 A;  1EQK A;  1E3V A;  2R4I A;  1E3R A;  5IG3 A;  1O7W B;  2RFR A;  1RGA A;  4WYK B;  4BL3 A;  1CH0 A;  3GZR A;  4KFF A;  3MG2 A;  3GZX B;  2HMN B;  4BTY A;  1RDS A;  1TJD A;  2GU3 A;  4EV2 A;  2F56 A;  1N8R 4;  1LNH A;  1GOV A;  2WGQ A;  1BRI A;  2V1L A;  2FNQ A;  2ML5 A;  3PS8 A;  4NPB A;  4R80 A;  6GSP A;  7STD A;  1DYU A;  1FGT A;  3UB1 A;  4AKY A;  4FMC A;  1BRN L;  3BNB A;  5BIR A;  3AHW A;  3G0K A;  1V57 A;  3DH2 A;  2UX0 A;  1ULJ B;  1E97 A;  3NX0 A;  1GOU A;  4N6N B;  2C11 A;  3U1W A;  2F98 A;  1WTH A;  2GEY A;  2F86 B;  1IK3 A;  1QVF 2;  3X3Y A;  1HKX A;  1YHQ 3;  3NBB A;  1B2U A;  3LT9 A;  1YGE A;  3RGA A;  4STD A;  2H0H A;  2IYJ A;  4XBX A;  1NJI 4;  3X41 A;  1EA2 A;  1OF5 B;  3WOD G;  3ZG5 A;  2JQ5 A;  9RNT A;  5I97 A;  1KQS 2;  1OUN A;  2K54 A;  2QGU A;  3IJE B;  4HZB B;  1IQX A;  1I3I A;  3T8N A;  2D1W A;  3MHE A;  3OW2 2;  3X3X A;  3ALA A;  1T2I A;  1X1X A;  3G8Z A;  1FGR A;  2BMR B;  3B4O A;  1NNV A;  3CCL 3;  1L5G B;  4I5Q A;  1RGC A;  2QIY A;  1TU5 A;  3V92 A;  1RRL A;  3NQY A;  1N9J A;  2B24 B;  2CWT A;  3JUP A;  1F8N A;  1FA3 A;  1LXE A;  3GZY B;  4HVN A;  1JBS A;  4HOH A;  5IG4 A;  2CIU A;  1AVK A;  1CYV A;  1GMP A;  2O3O A;  1TP6 A;  3K9M C;  5DRE A;  1BSD A;  1IYY A;  1C7H A;  1AVL A;  1Q40 A;  3EQQ B;  2CW9 A;  1RGE A;  3URP A;  2F4Y A;  1VQQ A;  2RCD A;  1BRK A;  2W56 B;  1LOW A;  3EN8 A;  1B2M A;  5AEW B;  1EUI C;  4WP5 A;  3CPW 2;  1D6Y A;  1JB4 A;  1GYB A;  1MWT A;  2CH9 A;  3EB8 A;  1BNR A;  2P38 A;  1VQK 3;  2ZDJ A;  1BAO A;  1HZ1 A;  3D3L A;  3PGB A;  3BLZ A;  2XFT A;  1JB2 A;  3F7S A;  4IIA A;  4O02 B;  5CK6 A;  3AMO A;  1NO3 A;  3N54 B;  2D42 A;  1FW7 A;  4WHA A;  3FF0 A;  2LYX A;  5IG5 A;  3S27 A;  4XBY A;  3PCR A;  1BUJ A;  1MWU A;  1IU7 A;  1OCV A;  2ZA4 A;  3GZB A;  4XM4 A;  2GBW B;  1DMN A;  3DGL A;  5AI1 A;  1W5Z A;  2F5W A;  3D5I A;  3HK4 A;  5G1K A;  1CQS A;  2CX0 A;  4N6M A;  3NBR A;  2GBX B;  3WDG B;  1Q86 4;  1UCI A;  4GSP A;  1I70 A;  4Q53 A;  2W2C A;  1Q82 4;  1S5A A;  4R9L A;  3F40 A;  1N5P A;  1JB5 A;  3NM2 A;  5RNT A;  2YFI B;  1KC8 4;  2FGT A;  2GEX A;  4XB5 A;  3X40 A;  1YJW 3;  3HZP A;  1W02 A;  3CC7 3;  3CCJ 3;  1IV7 A;  3DGO A;  1I2G A;  1OHO A;  2CK3 H;  1SPU A;  3F9S A;  2HMK B;  3BB9 A;  1FUW A;  1DMM A;  3CCE 3;  3EN1 B;  3CNX A;  1B27 A; 
#chains in the Genus database with same CATH homology
 4MMX B;  1O7G B;  1K73 4;  4CCV A;  5D81 A;  1W2B 2;  4NHF A;  3CCU 3;  1QJG A;  1OPY A;  2ZL8 A;  3KZT A;  4JF8 A;  1JNQ A;  4EV5 A;  1VQP 3;  2CWV A;  1DVC A;  3LH4 A;  1GY5 A;  1YJN 3;  2W9Q A;  3EBT A;  5AYR B;  2KCD A;  1A2K A;  3JUN A;  1M1K 4;  1MOL A;  4X2H A;  2BO9 B;  4OVM A;  1Q7Y 4;  4HYZ A;  3CU3 A;  3MPH A;  1EKM A;  1ZX2 A;  4J8T A;  4WFO A;  3ECF A;  1O7H B;  3X3Z A;  1RN7 A;  4R9K A;  3G71 3;  1D6Z A;  5G2G A;  3I55 3;  1NB3 I;  1UW1 A;  3DGN A;  3CD6 3;  1FGM A;  2YFL B;  3EX9 A;  2CG0 A;  1JN5 A;  2YX9 A;  3T8U A;  5EQL A;  3MKI A;  2XH9 A;  3JUQ A;  5CF2 A;  1IQ8 A;  2SBL A;  3QK9 A;  2XEP A;  2OTL 3;  3KSP A;  1O7N B;  4EBG A;  2BMO B;  1IVX A;  1Z1S A;  1VQ6 3;  1AR0 A;  2L4V A;  4HM1 B;  4GB5 A;  1Y4K A;  3FCS B;  3CPO A;  1IT7 A;  3S29 A;  3KFQ C;  2GXF A;  1O7P B;  2W6J H;  3EBY A;  4HM6 B;  5HGR A;  2E2V A;  3SVA A;  2C10 A;  3VF1 A;  1JKG B;  4NRE A;  4K90 B;  4XDW A;  3K63 A;  3SED A;  1YIT 3;  1VZZ A;  1NU3 A;  2RSX A;  3SOA A;  3D9R A;  4LMI A;  1CYU A;  2Y73 A;  4HM2 B;  1VQ8 3;  2KRT A;  2KXG A;  2OWP A;  2XR8 B;  3UL5 A;  3WA2 X;  1GY6 A;  5AYS C;  1JJ2 2;  4EXR A;  1SQW A;  4I4K A;  3LT8 A;  3NV0 A;  3U97 A;  3I56 3;  1A67 A;  4KVH A;  2Z77 A;  3CCQ 3;  1KWI A;  5AII A;  1ULI B;  2JDI H;  3GRD A;  5KP3 A;  2INX A;  1US1 A;  2STD A;  3V98 A;  3MYT A;  1UUW B;  4XDV A;  5FGO A;  1STF I;  5IW9 A;  2IUK A;  4O3V A;  4HJL B;  1IV9 A;  1VQ9 3;  2M7O A;  1M90 4;  3NHX A;  2A15 A;  1N5H A;  3CCV 3;  1STD A;  1W6C A;  1OHS A;  4CDL A;  3OX9 A;  3CCS 3;  2O9U X;  3BND A;  4R4K A;  3VSY A;  2MF7 A;  3NUV A;  5TGN A;  3VGN A;  2W0Q A;  1W01 A;  1U5O A;  1YJ9 3;  2BHM A;  3Q2P A;  3F14 A;  2OOV C;  4FCM A;  4HKV B;  1RJO A;  2E2T A;  4LGQ A;  2F99 A;  4L7K A;  1WQL B;  3PZW A;  2Q07 A;  2Z76 A;  5DRV A;  3SX1 A;  2XSO B;  4RZM A;  1ROA A;  1IVV A;  4EYC A;  2MC8 A;  2XRX B;  2WO0 A;  3V99 A;  3MSO A;  4L8P A;  2BNG A;  1NDO B;  4FMD A;  5ELJ A;  2W04 A;  2Z6B A;  1Q40 B;  2QA4 3;  3S28 A;  2WGO A;  6STD A;  5IER A;  4KZ1 A;  4AKZ A;  4ORL A;  1RRH A;  2PNC A;  1KSI A;  3MG1 A;  1G96 A;  1W2Z A;  2XFS A;  1FGO A;  3ER7 A;  5IEP A;  3LOY A;  1OAC A;  3LYG A;  3AMO B;  1WNH A;  3G16 A;  3F7X A;  3JUO A;  2K0M A;  3B4P A;  4XBT A;  1V74 A;  5ELU A;  2XSH B;  4FR9 A;  1JV2 B;  1O7M B;  4QWT A;  1VQ5 3;  5EVH A;  5EEO A;  3LML A;  1Q81 4;  2P09 A;  1YIJ 3;  2CHC A;  4BTX A;  2P0X A;  5IG0 A;  1A2V A;  3N9H A;  1K41 A;  1W6G A;  5D83 A;  2Y74 A;  1AV4 A;  1DMQ A;  3LXU X;  3QRD A;  3MG3 A;  3G6E 3;  3FZW A;  3WOF B;  2OTJ 3;  3CCM 3;  4X2O A;  1VQM 3;  1WMN A;  2BT3 A;  3F8H A;  5JPU A;  8CHO A;  3N8B A;  1PU4 A;  1IVW A;  3OV4 A;  4HM5 B;  4WYK A;  2IUJ A;  3CCR 3;  4KFE A;  2OCT A;  3I0Y A;  3HII A;  1WMP A;  2XGN A;  3EC9 A;  3F8X A;  4WWU C;  4HZ9 B;  3B7C A;  3KII A;  3PYJ A;  1ZO2 A;  3X42 A;  4MMY B;  3Q1C A;  2BMQ B;  4HM7 B;  1OH0 A;  5AIH A;  1VQ7 3;  3STD A;  2CFL A;  1TUH A;  3LTA A;  5D82 A;  1FGQ A;  3JUM A;  3FSD A;  5STD A;  3NQZ A;  3HI7 A;  4OK0 A;  1QVG 2;  1MNL A;  3DGM A;  1VQO 3;  1NB5 I;  2HMO B;  4K61 A;  3DUK A;  3TDG A;  3S5C A;  1JKG A;  1M1X B;  1T5Y A;  1OGX A;  3UNL A;  3JVC A;  1K9M 4;  3A76 A;  1OGZ A;  1GD3 A;  4EC6 A;  1OF5 A;  4FMB A;  4AEQ A;  4MJD A;  3LZA A;  3LTD A;  4K1U A;  4HBR A;  3FG1 A;  5CXO A;  4OUQ A;  3DM8 A;  1SIH A;  2YFJ B;  5AIF A;  2CFD A;  5LC7 A;  3LTC A;  1JN5 B;  5AEU B;  2OOV A;  1CEW I;  1GD4 A;  3FG4 A;  3Q90 A;  1NWW A;  5CLK A;  4O2H A;  3HX8 A;  3BNE A;  4HM8 B;  1PFP A;  3FLJ A;  4FCZ A;  3BNC A;  1GS3 A;  5LC6 A;  3SXX A;  3OWY A;  4HM0 B;  4JRF A;  4IT7 A;  1GY7 A;  1TIJ A;  3IMA B;  2OQE C;  1IQY A;  2W56 A;  4N6T A;  3SLU A;  3FF2 A;  1UI7 A;  1BUQ A;  1W00 A;  3HIG A;  2HML B;  2I9W A;  1OHP A;  4MMZ B;  3RGR A;  2CFK A;  5BVB A;  1VQN 3;  4LEH A;  1U8C B;  4N6L A;  1RKY A;  2E2U A;  1W7C A;  1JRQ A;  3EHC A;  3DY5 A;  3OWU A;  4RBN A;  3ROB A;  3WA3 A;  2QEX 3;  5JBS A;  3SOY A;  2CFG A;  3KE7 A;  3B8L A;  3NV0 B;  1QAK A;  3DXO A;  3K5T A;  3O8Y A;  4LZI A;  3WMD A;  3G4S 3;  1LVN A;  4R1K A;  4TX4 A;  2WOH A;  4G1M B;  1ROV A;  5AIG A;  5IEO A;  3K0Z A;  3EE1 A;  3K7C A;  1D6U A;  1SJW A;  3OWS A;  1QAL A;  3NXJ A;  1W4N A;  3FH1 A;  1K28 A;  1Q42 A;  3J7Y d;  4HM4 B;  3CC2 3;  3EJV A;  1QMA A;  3FKA A;  4ZM8 A;  5IEN A;  3GWR A;  3CC4 3;  3L0R A;  1VQL 3;  4KFD A;  3DMC A;  2HMM B;  4IPB A;  3H51 A;  5CF1 A;  4GL6 A;  1N9E A;  3EF8 A;  4U13 A;  3LTB A;  3UJM A;  2FXT A;  3IPT A;  3E99 A;  4BTW A;  2P05 A;  4N6U A;  4O8S A;  2P0M A;  5KP4 A;  2W03 A;  1IDP A;  1KD1 4;  2LQV A;  3KKG A;  4FMA A;  4H3U A;  5BXQ A;  1DVD A;  1YVB I;  2ML6 A;  5A0O B;  3UL6 A;  1LOX A;  1A90 A;  4N6V 0;  5KP1 A;  4RNZ A;  1N8Q A;  3KN4 A;  1TFO A;  2CC3 A;  1IVU A;  2RGQ A;  3M8C A;  5JPP A;  2B1X B;  2Z7A A;  4N3V A;  1EG9 B;  1W6Y A;  2W9P A;  4H61 A;  3NM7 A;  4J9A A;  5IF6 A;  3T0U A;  3CXC 2;  1UUV B;  5FW5 A;  3S67 A;  4FCJ A;  2GU1 A;  4L8O A;  3NBJ A;  3OXA A;  1YI2 3;  1TFK A;  1K8A 4;  1J2B A;  3PXM A;  2PZV A;  1VQ4 3;  2CWU A;  3MWZ A;  2CG1 A;  2HMJ B;  2IA7 A;  1IT8 A;  3FG3 A;  4HM3 B;  4RNY A;  1ISK A;  4PEJ A;  3DZL A;  1QAF A;  2CKF B;  2IMJ A;  3KSE D;  1M9G A;  2WOF A;  1UI8 A;  3H3H A;  3PCS A;  4LSO A;  3CME 3;  2XF3 A;  3WOE B;  3CNM A;  1ASK A;  1R4C A;  1SII A;  4MEI A;  3RDE A;  3GAX A;  1S72 3;  2XGL A;  2OQE A;  4K1V A;  1WMO A;  3CMA 3;  2CFW A;  4N6O B;  1HU9 A;  1EQK A;  1E3V A;  2R4I A;  1E3R A;  5IG3 A;  1O7W B;  2RFR A;  4WYK B;  4KFF A;  3GZR A;  3MG2 A;  3GZX B;  2HMN B;  4BTY A;  2GU3 A;  4EV2 A;  1N8R 4;  1LNH A;  2WGQ A;  2V1L A;  2FNQ A;  2ML5 A;  3PS8 A;  4R80 A;  7STD A;  1DYU A;  1FGT A;  3UB1 A;  4AKY A;  4FMC A;  3BNB A;  3G0K A;  2UX0 A;  1ULJ B;  1E97 A;  3NX0 A;  4N6N B;  2C11 A;  3U1W A;  2F98 A;  1WTH A;  2GEY A;  2F86 B;  1IK3 A;  1QVF 2;  3X3Y A;  1HKX A;  1YHQ 3;  3NBB A;  3LT9 A;  1YGE A;  3RGA A;  4STD A;  4XBX A;  1NJI 4;  3X41 A;  1EA2 A;  1OF5 B;  3WOD G;  5I97 A;  2JQ5 A;  1KQS 2;  1OUN A;  2K54 A;  2QGU A;  3IJE B;  4HZB B;  1IQX A;  3T8N A;  2D1W A;  3MHE A;  3OW2 2;  3X3X A;  3ALA A;  3G8Z A;  1FGR A;  2BMR B;  3B4O A;  3CCL 3;  1L5G B;  2QIY A;  1TU5 A;  3V92 A;  1RRL A;  3NQY A;  1N9J A;  2B24 B;  2CWT A;  3JUP A;  1F8N A;  1FA3 A;  1LXE A;  3GZY B;  4HVN A;  5IG4 A;  2CIU A;  1AVK A;  1CYV A;  2O3O A;  1TP6 A;  3K9M C;  5DRE A;  1C7H A;  1AVL A;  1Q40 A;  3EQQ B;  2CW9 A;  2RCD A;  2W56 B;  3EN8 A;  5AEW B;  4WP5 A;  3CPW 2;  1D6Y A;  1JB4 A;  1GYB A;  2CH9 A;  3EB8 A;  2P38 A;  1VQK 3;  2ZDJ A;  3D3L A;  3PGB A;  3BLZ A;  2XFT A;  1JB2 A;  3F7S A;  4IIA A;  4O02 B;  5CK6 A;  3AMO A;  1NO3 A;  3N54 B;  2D42 A;  4WHA A;  3FF0 A;  2LYX A;  5IG5 A;  3S27 A;  4XBY A;  3PCR A;  1IU7 A;  1OCV A;  3GZB A;  4XM4 A;  2GBW B;  1DMN A;  3DGL A;  5AI1 A;  1W5Z A;  3HK4 A;  1CQS A;  4N6M A;  3NBR A;  2GBX B;  3WDG B;  1Q86 4;  4Q53 A;  2W2C A;  1Q82 4;  1S5A A;  4R9L A;  3F40 A;  1N5P A;  1JB5 A;  3NM2 A;  2YFI B;  1KC8 4;  2FGT A;  2GEX A;  4XB5 A;  3X40 A;  1YJW 3;  3HZP A;  1W02 A;  3CC7 3;  3CCJ 3;  1IV7 A;  3DGO A;  1OHO A;  2CK3 H;  1SPU A;  3F9S A;  2HMK B;  3BB9 A;  1FUW A;  1DMM A;  3CCE 3;  3EN1 B;  3CNX A;  3FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...