1Q40A

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
165
Chain Sequence
b'QDPTQQLEPFLKRFLASLDLLYTQSQPFPNVESYATQLGSNLKRSSAIIVNGQPIIPSPQEDCKLQFQKKWLQTPLSSHQLTSYDGHLIPGTGTFVVHFSAKVRFDQSGRNRLGESADLFQENNQRPIWGSWFGVDVNLVVDENVMQDGEIINSMDYRFTYVPND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
total genus 43
structure length 165
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40A00
4R9LA 4WP5A 4OVMA 3LZAA 2R4IA 2F98A 4R9KA 3BB9A 3HX8A 4HM4B 3Q90A 4XDVA 2BMRB 2CHCA 5D82A 4N3VA 1CQSA 3GZXB 3H51A 4L7KA 2HMJB 4X2HA 1W02A 1GS3A 1S5AA 1HKXA 3CPOA 3EF8A 3NUVA 2HMKB 3OWSA 5FW5A 3SOAA 5IENA 5AEUB 5IG3A 4HM0B 2OWPA 1JB5A 2RGQA 3M8CA 1GY6A 2F99A 4LGQA 2K54A 4GB5A 3JUOA 1O7PB 5CF2A 4KVHA 2PZVA 1AR0A 4XB5A 1O7MB 3EJVA 1OPYA 1TUHA 2B1XB 1OH0A 5D83A 1OHSA 2STDA 3LYGA 3WMDA 4IIAA 3FLJA 1NWWA 3NBRA 2GEXA 5IG5A 1JN5B 1IDPA 3KE7A 2HMNB 3SEDA 3B4OA 3MG3A 3NV0B 1OF5A 5BXQA 5IG4A 4H3UA 2BMQB 3G8ZA 1U5OA 3FSDA 4K1UA 5JPUA 1E3VA 1OCVA 3EX9A 1Q40B 1JB2A 5CK6A 4WYKB 3SOYA 3ECFA 3D9RA 4U13A 4HZBB 6STDA 3F8XA 3H3HA 5AIGA 3DZLA 3KZTA 3I0YA 5EVHA 5KP4A 4LMIA 3EC9A 3F9SA 3NHXA 4FCMA 4OUQA 3JUQA 5KP1A 1K41A 5TGNA 1ZX2A 2HMMB 3B8LA 1O7HB 2CKFB 2IMJA 3K7CA 4HM7B 1TP6A 2UX0A 3T8NA 1JN5A 3NV0A 1Q42A 3DXOA 1SJWA 3VSYA 5BVBA 3S5CA 3ER7A 5KP3A 1DMMA 5AEWB 4CDLA 3NXJA 3UJMA 5IEOA 5DRVA 1JB4A 3RGRA 4X2OA 3KKGA 4HZ9B 2Z76A 1GY7A 4HM3B 3NM2A 3OXAA 5IEPA 4STDA 7STDA 4WYKA 5HGRA 2QIYA 5CF1A 3DMCA 3CU3A 2A15A 1BUQA 4L8PA 1ASKA 3OWYA 3FF2A 4HVNA 1OGXA 3STDA 2GXFA 5IG0A 4LEHA 1ISKA 4Q53A 2GBWB 3E99A 1UUWB 1O7GB 1STDA 5IF6A 1NU3A 5G2GA 1WQLB 4XBTA 4XBXA 4XBYA 3GZRA 3JUNA 1OHPA 2RFRA 2XR8B 3F7SA 1VZZA 1ZO2A 3CNXA 4L8OA 2F86B 2GEYA 4J9AA 2HMLB 2JQ5A 5D81A 4WWUC 3FH1A 3EBTA 4J8TA 3OWUA 5AIIA 2RCDA 5CXOA 3GWRA 3HZPA 1EA2A 1UUVB 3K0ZA 3GRDA 1Z1SA 1GYBA 1QJGA 3EHCA 1ULIB 4FCJA 1W6YA 3JUMA 1A2KA 4XDWA 3EN8A 1DMQA 4HKVB 3B4PA 3A76A 1C7HA 3DUKA 2Z7AA 2YFIB 3GZYB 3FZWA 5AIFA 5DREA 2XRXB 4K1VA 4ORLA 4RZMA 3F40A 1OHOA 3F8HA 5AIHA 1O7WB 3IPTA 3RGAA 4HM8B 1JKGB 3G16A 2YFLB 3MG1A 4HM2B 4XM4A 1DMNA 1ULJB 1OGZA 3FKAA 1QMAA 3F14A 5AI1A 1Q40A 2INXA 3FF0A 3HK4A 3EQQB 3CNMA 2XSHB 2HMOB 3GZBA 3MYTA 4MJDA 5STDA 3T8UA 2YFJB 3F7XA 3MG2A 4HJLB 2GBXB 3MKIA 2B24B 2QGUA 4PEJA 3FGYA 2BMOB 3UNLA 4HM1B 2I9WA 3ROBA 1W00A 1W01A 2BNGA 1OUNA 3BLZA 8CHOA 5IERA 2W2CA 1E3RA 3EBYA 1E97A 3KSPA 3DM8A 4HM5B 1GY5A 5JPPA 3OX9A 1EG9B 3MHEA 3OV4A 1NDOB 1O7NB 3EN1B 1JKGA 3JUPA 4R1KA 4I4KA 3G0KA 3MSOA 3B7CA 4HM6B 2XSOB 2Z77A 1OF5B 5CLKA 3VGNA
chains in the Genus database with same CATH superfamily
6RNTA 4R9LA 2XF3A 1JNQA 2CFDA 4WP5A 3ZG5A 4OVMA 3DY5A 3LZAA 2R4IA 3KCHA 2OTJ3 1I8VA 2F98A 3UB1A 2FNQA 1BSBA 4O2HA 2IUKA 2C11A 4R9KA 3BB9A 3HX8A 4HM4B 1HU9A 2LQVA 3CC23 3Q90A 4XDVA 2OTL3 2BMRB 1FGOA 4KFEA 1BRGA 3CME3 1CEWI 2CHCA 1VQM3 1AY7A 4N3VA 5D82A 1SQWA 2ML6A 1CQSA 3GZXB 2CW9A 1DYUA 3ZG0A 3H51A 2W9QA 4L7KA 1LOWA 1K28A 3BNDA 3UL5A 1EQKA 1CH0A 2HMJB 2GSPA 3FG3A 4X2HA 1W02A 3D79A 1YI23 1YJN3 1VQ93 1FZUA 1GS3A 1S5AA 1LOYA 2RSXA 1MWRA 1HKXA 3CPOA 4N6OB 2IUJA 4EV5A 5RNTA 3EF8A 1JBTA 3NUVA 4BIRA 1QAFA 1A90A 2HMKB 1B2ZA 3OWSA 5FW5A 3SOAA 4AEQA 1VQK3 5IENA 1HYFA 2P38A 3SLUA 1TTOA 5AEUB 3BNCA 5IG3A 1VQ83 2K0MA 3QK9A 4HM0B 2OWPA 1YJ93 3A5EA 1JB5A 2RGQA 3M8CA 4GHOA 1GY6A 1TFKA 2F4YA 2CX1A 2F99A 4LGQA 2XGLA 2PNCA 1YIJ3 1FGQA 2K54A 1MNLA 4GB5A 1R4YA 1RGEA 1I0XA 3J7Yd 1VQN3 3JUOA 1O7PB 4KT3B 5CF2A 2XFTA 4BTYA 4KVHA 4J5GA 1RN4A 2XGNA 2KXGA 3N8BA 2PZVA 1AR0A 1V57A 4GL6A 3WDGB 1RDSA 4XB5A 1VQL3 4IT7A 1O7MB 3EJVA 1OPYA 3AMOA 1TUHA 4NHFA 1RN1A 3CD63 3FG1A 1BNIA 2B1XB 1OH0A 4AKZA 1U8CB 5D83A 1OHSA 2STDA 3LYGA 3WMDA 3NQZA 4IIAA 3FLJA 5ELJA 1NWWA 2CWTA 5M1AA 1IYYA 3NBRA 3MPHA 3RDEA 1KD14 2GEXA 5IG5A 2CWUA 1UCJA 1BSCA 2CFWA 4R80A 5ELUA 3D4AA 1JN5B 1BAOA 5I97A 1IDPA 3KE7A 2W56A 1QALA 2H0IA 4EC6A 1LVNA 2E2VA 3FCSB 4CPKA 3G713 2HMNB 3SEDA 3B4OA 1W5ZA 3MG3A 3NV0B 1TIJA 1OF5A 5BXQA 2CH9A 5IG4A 5BIRA 2ZDJA 4H3UA 3DH2A 4ILFA 5G1KA 3CCL3 3NBBA 2BMQB 1YVBI 3G8ZA 1U5OA 1FGRA 1RGLA 3FSDA 3O8YA 4K1UA 7GSPA 4CCVA 2MF7A 5JPUA 3D5IA 1EEJA 2O3OA 4NPBA 1E3VA 4KFDA 4DKIA 3T0UA 1OCVA 2KF6A 1YGEA 2Z6BA 2KF5A 1GD4A 3SVAA 3AHWA 1UI7A 1DVCA 1RJOA 1B2SA 2WO0A 1FYSA 1B2MA 1I70A 3EX9A 1RGFA 1Q40B 1JBSA 1TFOA 2P09A 3D5GA 4LZIA 1FW7A 1BRJA 1NB3I 4RNYA 2IY2A 1JB2A 5CK6A 4OK0A 1RN7A 4WYKB 1NB5I 3SOYA 1KQS2 1NNVA 3ECFA 1IU7A 1JJ22 2XFSA 3DGMA 4EXRA 5AYSC 3CCE3 3D9RA 2O9UX 1A2PA 4U13A 4HZBB 3X42A 1SIHA 1B20A 3CXC2 1IVXA 1SARA 4EW5A 1BRHA 6STDA 1T3BA 3SXXA 3F8XA 3H3HA 1N5PA 2W04A 3HI7A 2GU3A 4MMYB 3PGBA 4RNZA 1FGMA 1GOYA 1W7CA 2UGIA 3DZLA 1V58A 3KZTA 1RHLA 5AIGA 1QVG2 3I0YA 5LC7A 1B3SA 1BUJA 3DGYA 2CG1A 1BRSA 3GAXA 1GD3A 3WA3A 1RCKA 5EVHA 3ZFZA 1BSAA 1I2GA 4LMIA 3EC9A 5KP4A 1PU4A 3F9SA 3NHXA 4FCMA 4FMAA 4OUQA 1FUTA 3JUQA 3LTBA 5KP1A 2C4BA 1K41A 5TGNA 1ZX2A 1UUGB 1UDII 3WOFB 2HMMB 1MGRA 4N6UA 1I0VA 4NREA 2D42A 1T2IA 3U97A 4ZM8A 4J5KA 2P05A 4MMXB 1RKYA 3B8LA 1O7HB 3DGNA 1WTHA 2CKFB 2IMJA 1YVSA 4JRFA 5LC6A 1IVVA 3G4S3 1S723 2BU4A 1BANA 1BSDA 3K7CA 1AVKA 4HM7B 3S67A 1TP6A 2H0GA 2R41A 5EQLA 2UX0A 3T8NA 1UCIA 4WFOA 4FCZA 2KRTA 2W0QA 3DGLA 1JN5A 2CWVA 3DGOA 4O02B 1BNJA 3NV0A 1Q42A 3DXOA 3K63A 3VGNA 1IV9A 1VQ43 1PY3A 1SJWA 3VSYA 5BVBA 1Q814 4H61A 3S5CA 1RNTA 1A2VA 1F8NA 3WHOA 3ER7A 5FGOA 3WR2A 1IK3A 3LMLA 5KP3A 1Q7HA 1YIT3 1LQGC 1DMMA 1GMPA 9RNTA 1D6ZA 1FA3A 4QWTA 3BU4A 5AEWB 1KC84 1B2UA 2MC8A 2AADA 2QEX3 4KZ1A 1WNHA 4CDLA 1Q824 2KCDA 3NXJA 4N6TA 3UJMA 3KFQC 5IEOA 3UL6A 5DRVA 1JB4A 3HOHA 3RGRA 1UGIA 4X2OA 4R4KA 1SPUA 3KKGA 4HZ9B 2Z76A 1GY7A 3LTCA 4RBNA 4HM3B 3NM2A 3OXAA 1RSNA 2IA7A 2SBLA 4STDA 4FMDA 5IEPA 3S28A 1N9JA 4EBGA 3X40A 2WGQA 1R4CA 4FMCA 1EUIC 3K9MC 7STDA 2CX0A 4WYKA 2OOVC 3CCM3 5HGRA 2QIYA 5CF1A 1YHQ3 1VQ63 3DMCA 1IVWA 1Q864 1I3FA 3CU3A 2A15A 1BUQA 1GMQA 3N9HA 4L8PA 1ASKA 1STFI 3OWYA 3LOYA 3FF2A 1PYLA 1BRKA 1MWSA 1OGXA 2M7OA 4HVNA 3STDA 2FXTA 4FMBA 1K734 1B21A 1YGWA 2GXFA 4LEHA 5IG0A 1GSPA 1JRQA 2H0HA 1ISKA 1FGTA 2SARA 1K9M4 1NO3A 1VQQA 3WA2X 4AKYA 3CCQ3 4Q53A 2CC3A 2GBWB 3E99A 1N8R4 3G6E3 1N5HA 2GU1A 3LT9A 1UUWB 3PCSA 1O7GB 1UCLA 1STDA 5IF6A 1M1K4 3HIIA 4MEIA 1WMOA 1NU3A 2HOHA 5G2GA 3KSED 3CPW2 1WQLB 1K8A4 4XBTA 2OOVA 4XBXA 4XBYA 2K3DA 3GZRA 3JUNA 3Q3FA 1X1XA 3D3LA 5EEOA 3LTAA 3KN4A 3X3YA 1OHPA 2RFRA 2XR8B 3F7SA 3AHSA 3CCS3 3RNTA 1VZZA 3X41A 5IW9A 1ZO2A 1BOXA 4N6LA 3CNXA 2WGOA 4L8OA 1YNVX 4K61A 1W2B2 4JF8A 2F86B 2GEYA 4J9AA 2HMLB 2C10A 4O8SA 1US1A 4EYCA 2JQ5A 2CIUA 5D81A 1TRPA 4WWUC 2ZL8A 1BU4A 3PYJA 2JDIH 3FH1A 3K5TA 4BU4A 3CMA3 3EBTA 1TRQA 1DETA 4J8TA 1OACA 1DVDA 1N9EA 3OWUA 1TJDA 2Y74A 1B27A 1ROAA 2L4VA 4O3VA 5AIIA 4RNTA 2RCDA 3IMAB 5CXOA 2Y73A 3GWRA 4MMZB 1SIIA 1WMNA 3HZPA 1EA2A 5JBSA 1G02A 1Y4KA 4HYZA 3V99A 1RGAA 1UUVB 3K0ZA 3U1WA 3V92A 3GRDA 5GSPA 1EKMA 1Z1SA 1D6UA 1GOVA 1GYBA 1LXEA 1QJGA 3S29A 1NJI4 3EHCA 1DE3A 1ULIB 3BNBA 3LT8A 4LSOA 4FCJA 1L5GB 2D1WA 1RMSA 1W6YA 3JUMA 1RRHA 1WMPA 1A2KA 2BT3A 4XDWA 3EN8A 1DMQA 4HKVB 1IVUA 1G96A 3B4PA 3A76A 1C7HA 1PFPA 1UCKA 1ZGXA 3DUKA 3FG4A 3LH4A 2Z7AA 2YFIB 1RGHA 2KAAA 4LYLB 3GZYB 3NBJA 3FZWA 1D6YA 5AIFA 1RGGA 5DREA 2XRXB 1JBRA 1TU5A 2FGTA 7RNTA 1RCLA 4BTWA 1VQP3 2OQEC 1IQYA 4K1VA 1IQ8A 4ORLA 4RZMA 3CCR3 1B2XA 3F40A 3N54B 1OHOA 2BO9B 1C54A 2RNTA 4N6NB 1BNGA 1FUSA 3F8HA 3JVCA 3MWZA 3EB8A 2Q07A 1O7WB 3IPTA 5AIHA 2UUGC 2IYJA 4WHAA 2BHMA 1VQ53 3LXUX 4HM8B 3RGAA 3CCV3 8RNTA 1JKGB 1W2ZA 1I2EA 1X1UA 2V1LA 2YX9A 4GSPA 3G16A 4EV2A 2YFLB 3MG1A 3L0RA 3CC43 1RRLA 5M19A 4HM2B 4HBRA 1RTUA 4XM4A 4HAAA 3OW22 2CG0A 2ZHXB 1DMNA 5BU4A 1ULJB 1OGZA 3FKAA 1QMAA 3F14A 1ROVA 3HIGA 5AI1A 3TDGA 2L1SA 2P0MA 3Q2PA 1Q40A 1IT8A 2W9PA 2OQEA 3AGOA 2INXA 3VF1A 3FF0A 3EE1A 2WOHA 1QVF2 3HK4A 1UI8A 5A0OB 3LTDA 4CJNA 3EQQB 3CNMA 1LRAA 2XSHB 2HMOB 3GZBA 3S27A 3MYTA 1X1YA 4MJDA 1BSEA 1GMRA 5STDA 3T8UA 2YFJB 4BL3A 1BNFA 1UW1A 3F7XA 1BVIA 3MG2A 3NM7A 1UGHI 4HJLB 1MWTA 2GBXB 1N8QA 1W4NA 3MKIA 1G0TA 3PS8A 2OCTA 2B24B 2QGUA 1M904 1RGCA 1LNHA 4KFFA 4PEJA 2F56A 3NX0A 2AAEA 3FGYA 3GSPA 2BIRA 1M1XB 4BTXA 2BMOB 3UNLA 4HM1B 2RBIA 1LOVA 2XH9A 1Q9EA 2ML5A 1V74A 1VQO3 1BNEA 1IV7A 2XEPA 1M9GA 2I9WA 2E2UA 3WODG 3ROBA 1W00A 1W01A 1W6GA 3URPA 2KF3A 3CC73 2BNGA 1JV2B 3CCJ3 1OUNA 4N6V0 1GOUA 3ALAA 1BNRA 2CFLA 2E2TA 2ZA4A 2QA43 1Q7Y4 3SYUA 3WOEB 1HZ1A 1BIRA 3BLZA 8CHOA 3SX1A 2WOFA 1RLSA 5IERA 1JZOA 2W2CA 1MGWA 1E3RA 3EBYA 3Q1CA 3AGNA 4I5QA 1YJW3 1FUWA 1IQXA 4TX4A 1W6CA 4FR9A 3PCRA 1E97A 2CFGA 1KSIA 3KSPA 1I3IA 3DM8A 3KIIA 4HM5B 5G1LA 1AQZA 2F5MA 3NQYA 2J8XB 4IPBA 5M18A 4HOHA 1GY5A 1LOXA 5JPPA 3OX9A 3QRDA 1LNIA 1I2FA 1EG9B 5HOHA 3I563 3MHEA 3AMOB 2W03A 2P0XA 1NDOB 3OV4A 1AV4A 1O7NB 2CK3H 2F5WA 4K90B 3EN1B 3PZWA 2CFKA 1JKGA 1MOLA 1J2BA 4BL2A 3BNEA 3JUPA 4R1KA 4I4KA 1BRNL 3G0KA 3IJEB 3CCU3 1IT7A 5AYRB 3MSOA 3B7CA 1X1WA 1KWIA 1AVLA 1VQ73 1CYUA 1RNBA 1MWUA 1QAKA 1LQMB 3BIRA 2W56B 4G1MB 6GSPA 3I553 4N6MA 2LYXA 4HM6B 3X3XA 1T5YA 2XSOB 2KF4A 2Z77A 1BNSA 1OF5B 1BGSA 5CLKA 3X3ZA 3PXMA 1BRIA 1JZDA 1T2HA 1RGKA 3V98A 1A67A 2W6JH 1ZS7A 1CYVA
chains in the Genus database with same CATH topology
4R9LA 2XF3A 1JNQA 2CFDA 4WP5A 4OVMA 3DY5A 3LZAA 2R4IA 2OTJ3 2F98A 3UB1A 2FNQA 4O2HA 2IUKA 2C11A 4R9KA 3BB9A 3HX8A 4HM4B 1HU9A 2LQVA 3CC23 3Q90A 4XDVA 2OTL3 2BMRB 1FGOA 4KFEA 3CME3 1CEWI 2CHCA 1VQM3 5D82A 4N3VA 1SQWA 2ML6A 1CQSA 3GZXB 2CW9A 1DYUA 3H51A 2W9QA 4L7KA 1K28A 3BNDA 3UL5A 1EQKA 2HMJB 3FG3A 4X2HA 1W02A 1YI23 1YJN3 1VQ93 1GS3A 1S5AA 2RSXA 4N6OB 2IUJA 1HKXA 3CPOA 4EV5A 3EF8A 3NUVA 1QAFA 1A90A 2HMKB 3OWSA 5FW5A 3SOAA 4AEQA 1VQK3 5IENA 2P38A 3SLUA 5AEUB 3BNCA 5IG3A 1VQ83 2K0MA 3QK9A 4HM0B 2OWPA 1YJ93 1JB5A 2RGQA 3M8CA 1GY6A 1TFKA 2F99A 4LGQA 2XGLA 2PNCA 1YIJ3 2K54A 1FGQA 1MNLA 4GB5A 3J7Yd 1VQN3 3JUOA 1O7PB 5CF2A 2XFTA 4BTYA 4KVHA 3WDGB 2XGNA 2KXGA 3N8BA 2PZVA 1AR0A 4GL6A 4XB5A 1VQL3 4IT7A 1O7MB 3EJVA 1OPYA 3AMOA 1TUHA 4NHFA 3CD63 3FG1A 2B1XB 1OH0A 4AKZA 1U8CB 5D83A 1OHSA 2STDA 3LYGA 3WMDA 3NQZA 4IIAA 3FLJA 5ELJA 1NWWA 2CWTA 3NBRA 3MPHA 3RDEA 1KD14 2GEXA 5IG5A 2CWUA 2CFWA 4R80A 5ELUA 1JN5B 5I97A 1IDPA 3KE7A 2W56A 1QALA 4EC6A 1LVNA 2E2VA 3FCSB 3G713 2HMNB 3SEDA 3B4OA 1W5ZA 3MG3A 3NV0B 1TIJA 1OF5A 5BXQA 2CH9A 5IG4A 2ZDJA 4H3UA 3CCL3 3NBBA 2BMQB 1YVBI 3G8ZA 1U5OA 1FGRA 3FSDA 3O8YA 4K1UA 4CCVA 2MF7A 5JPUA 2O3OA 1E3VA 4KFDA 3T0UA 1OCVA 1YGEA 2Z6BA 1GD4A 3SVAA 1UI7A 1DVCA 1RJOA 2WO0A 3EX9A 1Q40B 1TFOA 2P09A 4LZIA 1NB3I 4RNYA 1JB2A 5CK6A 4OK0A 1RN7A 4WYKB 1NB5I 3SOYA 1KQS2 3ECFA 1IU7A 1JJ22 2XFSA 3DGMA 4EXRA 5AYSC 3CCE3 3D9RA 2O9UX 3X42A 4U13A 4HZBB 1SIHA 3CXC2 1IVXA 6STDA 3SXXA 3F8XA 3H3HA 1N5PA 2W04A 3HI7A 2GU3A 4MMYB 3PGBA 4RNZA 1FGMA 1W7CA 3DZLA 5AIGA 3KZTA 1QVG2 3I0YA 5LC7A 2CG1A 3GAXA 1GD3A 3WA3A 5EVHA 5KP4A 4LMIA 3EC9A 1PU4A 3F9SA 3NHXA 4FCMA 4FMAA 4OUQA 3JUQA 3LTBA 5KP1A 1K41A 5TGNA 1ZX2A 3WOFB 2HMMB 4N6UA 4NREA 2D42A 3U97A 4ZM8A 2P05A 4MMXB 1RKYA 3B8LA 1O7HB 3DGNA 1WTHA 2CKFB 2IMJA 4JRFA 5LC6A 1IVVA 3G4S3 1S723 3K7CA 4HM7B 1AVKA 3S67A 1TP6A 5EQLA 2UX0A 3T8NA 4WFOA 4FCZA 2KRTA 2W0QA 3DGLA 1JN5A 2CWVA 3DGOA 4O02B 3NV0A 1Q42A 3DXOA 3K63A 1IV9A 1VQ43 1SJWA 3VSYA 5BVBA 1Q814 4H61A 3S5CA 1A2VA 1F8NA 3ER7A 5FGOA 1IK3A 3LMLA 5KP3A 1YIT3 1DMMA 1D6ZA 1FA3A 4QWTA 5AEWB 1KC84 2MC8A 2QEX3 4KZ1A 1WNHA 4CDLA 1Q824 2KCDA 3NXJA 4N6TA 3UJMA 3KFQC 5IEOA 3UL6A 5DRVA 1JB4A 3RGRA 4X2OA 4R4KA 1SPUA 3KKGA 4HZ9B 2Z76A 1GY7A 3LTCA 4RBNA 4HM3B 3NM2A 3OXAA 2IA7A 2SBLA 4STDA 4FMDA 5IEPA 3S28A 1N9JA 4EBGA 3X40A 2WGQA 1R4CA 4FMCA 7STDA 3K9MC 4WYKA 3CCM3 2OOVC 5HGRA 2QIYA 5CF1A 1YHQ3 1VQ63 3DMCA 1IVWA 1Q864 3CU3A 2A15A 1BUQA 3N9HA 4L8PA 1ASKA 1STFI 3OWYA 3LOYA 3FF2A 4HVNA 1OGXA 2M7OA 3STDA 2FXTA 4FMBA 1K734 2GXFA 5IG0A 4LEHA 1JRQA 1ISKA 1FGTA 1K9M4 1NO3A 3WA2X 4AKYA 3CCQ3 4Q53A 2CC3A 2GBWB 3E99A 1N8R4 3G6E3 1N5HA 2GU1A 3LT9A 1UUWB 3PCSA 1O7GB 1M1K4 1STDA 5IF6A 3HIIA 4MEIA 1WMOA 1NU3A 5G2GA 3KSED 1WQLB 4XBTA 2OOVA 4XBXA 4XBYA 3GZRA 3JUNA 3D3LA 5EEOA 3LTAA 3KN4A 3X3YA 1OHPA 2RFRA 2XR8B 3F7SA 3CCS3 1VZZA 3X41A 5IW9A 1ZO2A 4N6LA 3CNXA 2WGOA 4L8OA 4K61A 1W2B2 4JF8A 2F86B 2GEYA 4J9AA 2HMLB 2C10A 4O8SA 1US1A 4EYCA 2JQ5A 2CIUA 5D81A 4WWUC 2ZL8A 3PYJA 2JDIH 3FH1A 3K5TA 3CMA3 3EBTA 4J8TA 1OACA 1DVDA 1N9EA 3OWUA 2Y74A 1ROAA 2L4VA 4O3VA 5AIIA 2RCDA 3IMAB 5CXOA 2Y73A 3GWRA 4MMZB 1SIIA 1WMNA 3HZPA 1EA2A 5JBSA 1Y4KA 4HYZA 3V99A 1UUVB 3U1WA 3K0ZA 3V92A 3GRDA 1EKMA 1Z1SA 1D6UA 1GYBA 1QJGA 1LXEA 3S29A 1NJI4 3EHCA 1ULIB 3BNBA 3LT8A 4LSOA 4FCJA 1L5GB 2D1WA 1W6YA 3JUMA 1RRHA 1WMPA 1A2KA 2BT3A 4XDWA 3EN8A 1DMQA 4HKVB 1IVUA 1G96A 3B4PA 3A76A 1C7HA 1PFPA 3DUKA 3FG4A 3LH4A 2Z7AA 2YFIB 3GZYB 3NBJA 3FZWA 1D6YA 5AIFA 5DREA 2XRXB 1TU5A 2FGTA 4BTWA 1VQP3 2OQEC 1IQYA 4K1VA 1IQ8A 4ORLA 4RZMA 3CCR3 3F40A 3N54B 1OHOA 2BO9B 4N6NB 3F8HA 3JVCA 3MWZA 3EB8A 2Q07A 1O7WB 3IPTA 5AIHA 4WHAA 2BHMA 1VQ53 3LXUX 4HM8B 3RGAA 3CCV3 1JKGB 1W2ZA 2V1LA 2YX9A 3G16A 4EV2A 2YFLB 3MG1A 3L0RA 3CC43 1RRLA 4HM2B 4HBRA 4XM4A 3OW22 2CG0A 1DMNA 1ULJB 1OGZA 3FKAA 1QMAA 3F14A 1ROVA 3HIGA 5AI1A 3TDGA 2OQEA 2P0MA 3Q2PA 1Q40A 1IT8A 2W9PA 3VF1A 3CPW2 2INXA 1K8A4 3FF0A 3EE1A 2WOHA 1QVF2 3HK4A 1UI8A 5A0OB 3LTDA 3EQQB 3CNMA 2XSHB 2HMOB 3GZBA 3S27A 3MYTA 4MJDA 5STDA 3T8UA 2YFJB 1UW1A 3F7XA 3MG2A 3NM7A 4HJLB 2GBXB 1N8QA 1W4NA 3MKIA 3PS8A 2OCTA 2B24B 2QGUA 1M904 1LNHA 4KFFA 4PEJA 3NX0A 3FGYA 1M1XB 4BTXA 2BMOB 3UNLA 4HM1B 2XH9A 2ML5A 1V74A 1VQO3 1IV7A 2XEPA 1M9GA 2I9WA 2E2UA 3WODG 3ROBA 1W00A 1W01A 1W6GA 3CC73 3CCJ3 2BNGA 1JV2B 1OUNA 4N6V0 3ALAA 2CFLA 2E2TA 2QA43 1Q7Y4 3WOEB 3BLZA 8CHOA 3SX1A 2WOFA 5IERA 2W2CA 1E3RA 3EBYA 3Q1CA 1YJW3 1FUWA 1IQXA 4TX4A 1W6CA 4FR9A 3PCRA 1E97A 2CFGA 1KSIA 3KSPA 3DM8A 3KIIA 4HM5B 3NQYA 4IPBA 1GY5A 1LOXA 5JPPA 3OX9A 3QRDA 1EG9B 3I563 3MHEA 3AMOB 2W03A 2P0XA 1NDOB 3OV4A 1AV4A 1O7NB 2CK3H 4K90B 3EN1B 3PZWA 2CFKA 1JKGA 1MOLA 1J2BA 3BNEA 3JUPA 4R1KA 4I4KA 3G0KA 3IJEB 3CCU3 1IT7A 5AYRB 3MSOA 3B7CA 1KWIA 1AVLA 1VQ73 1CYUA 1QAKA 2W56B 4G1MB 3I553 4N6MA 2LYXA 4HM6B 3X3XA 1T5YA 2XSOB 2Z77A 1OF5B 5CLKA 3X3ZA 3PXMA 3V98A 1A67A 2W6JH 3VGNA 1CYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9L A;  4WP5 A;  4OVM A;  3LZA A;  2R4I A;  2F98 A;  4R9K A;  3BB9 A;  3HX8 A;  4HM4 B;  3Q90 A;  4XDV A;  2BMR B;  2CHC A;  5D82 A;  4N3V A;  1CQS A;  3GZX B;  3H51 A;  4L7K A;  2HMJ B;  4X2H A;  1W02 A;  1GS3 A;  1S5A A;  1HKX A;  3CPO A;  3EF8 A;  3NUV A;  2HMK B;  3OWS A;  5FW5 A;  3SOA A;  5IEN A;  5AEU B;  5IG3 A;  4HM0 B;  2OWP A;  1JB5 A;  2RGQ A;  3M8C A;  1GY6 A;  2F99 A;  4LGQ A;  2K54 A;  4GB5 A;  3JUO A;  1O7P B;  5CF2 A;  4KVH A;  2PZV A;  1AR0 A;  4XB5 A;  1O7M B;  3EJV A;  1OPY A;  1TUH A;  2B1X B;  1OH0 A;  5D83 A;  1OHS A;  2STD A;  3LYG A;  3WMD A;  4IIA A;  3FLJ A;  1NWW A;  3NBR A;  2GEX A;  5IG5 A;  1JN5 B;  1IDP A;  3KE7 A;  2HMN B;  3SED A;  3B4O A;  3MG3 A;  3NV0 B;  1OF5 A;  5BXQ A;  5IG4 A;  4H3U A;  2BMQ B;  3G8Z A;  1U5O A;  3FSD A;  4K1U A;  5JPU A;  1E3V A;  1OCV A;  3EX9 A;  1Q40 B;  1JB2 A;  5CK6 A;  4WYK B;  3SOY A;  3ECF A;  3D9R A;  4U13 A;  4HZB B;  6STD A;  3F8X A;  3H3H A;  5AIG A;  3DZL A;  3KZT A;  3I0Y A;  5EVH A;  5KP4 A;  4LMI A;  3EC9 A;  3F9S A;  3NHX A;  4FCM A;  4OUQ A;  3JUQ A;  5KP1 A;  1K41 A;  5TGN A;  1ZX2 A;  2HMM B;  3B8L A;  1O7H B;  2CKF B;  2IMJ A;  3K7C A;  4HM7 B;  1TP6 A;  2UX0 A;  3T8N A;  1JN5 A;  3NV0 A;  1Q42 A;  3DXO A;  1SJW A;  3VSY A;  5BVB A;  3S5C A;  3ER7 A;  5KP3 A;  1DMM A;  5AEW B;  4CDL A;  3NXJ A;  3UJM A;  5IEO A;  5DRV A;  1JB4 A;  3RGR A;  4X2O A;  3KKG A;  4HZ9 B;  2Z76 A;  1GY7 A;  4HM3 B;  3NM2 A;  3OXA A;  5IEP A;  4STD A;  7STD A;  4WYK A;  5HGR A;  2QIY A;  5CF1 A;  3DMC A;  3CU3 A;  2A15 A;  1BUQ A;  4L8P A;  1ASK A;  3OWY A;  3FF2 A;  4HVN A;  1OGX A;  3STD A;  2GXF A;  5IG0 A;  4LEH A;  1ISK A;  4Q53 A;  2GBW B;  3E99 A;  1UUW B;  1O7G B;  1STD A;  5IF6 A;  1NU3 A;  5G2G A;  1WQL B;  4XBT A;  4XBX A;  4XBY A;  3GZR A;  3JUN A;  1OHP A;  2RFR A;  2XR8 B;  3F7S A;  1VZZ A;  1ZO2 A;  3CNX A;  4L8O A;  2F86 B;  2GEY A;  4J9A A;  2HML B;  2JQ5 A;  5D81 A;  4WWU C;  3FH1 A;  3EBT A;  4J8T A;  3OWU A;  5AII A;  2RCD A;  5CXO A;  3GWR A;  3HZP A;  1EA2 A;  1UUV B;  3K0Z A;  3GRD A;  1Z1S A;  1GYB A;  1QJG A;  3EHC A;  1ULI B;  4FCJ A;  1W6Y A;  3JUM A;  1A2K A;  4XDW A;  3EN8 A;  1DMQ A;  4HKV B;  3B4P A;  3A76 A;  1C7H A;  3DUK A;  2Z7A A;  2YFI B;  3GZY B;  3FZW A;  5AIF A;  5DRE A;  2XRX B;  4K1V A;  4ORL A;  4RZM A;  3F40 A;  1OHO A;  3F8H A;  5AIH A;  1O7W B;  3IPT A;  3RGA A;  4HM8 B;  1JKG B;  3G16 A;  2YFL B;  3MG1 A;  4HM2 B;  4XM4 A;  1DMN A;  1ULJ B;  1OGZ A;  3FKA A;  1QMA A;  3F14 A;  5AI1 A;  1Q40 A;  2INX A;  3FF0 A;  3HK4 A;  3EQQ B;  3CNM A;  2XSH B;  2HMO B;  3GZB A;  3MYT A;  4MJD A;  5STD A;  3T8U A;  2YFJ B;  3F7X A;  3MG2 A;  4HJL B;  2GBX B;  3MKI A;  2B24 B;  2QGU A;  4PEJ A;  3FGY A;  2BMO B;  3UNL A;  4HM1 B;  2I9W A;  3ROB A;  1W00 A;  1W01 A;  2BNG A;  1OUN A;  3BLZ A;  8CHO A;  5IER A;  2W2C A;  1E3R A;  3EBY A;  1E97 A;  3KSP A;  3DM8 A;  4HM5 B;  1GY5 A;  5JPP A;  3OX9 A;  1EG9 B;  3MHE A;  3OV4 A;  1NDO B;  1O7N B;  3EN1 B;  1JKG A;  3JUP A;  4R1K A;  4I4K A;  3G0K A;  3MSO A;  3B7C A;  4HM6 B;  2XSO B;  2Z77 A;  1OF5 B;  5CLK A;  3VGN A; 
#chains in the Genus database with same CATH topology
 6RNT A;  4R9L A;  2XF3 A;  1JNQ A;  2CFD A;  4WP5 A;  3ZG5 A;  4OVM A;  3DY5 A;  3LZA A;  2R4I A;  3KCH A;  2OTJ 3;  1I8V A;  2F98 A;  3UB1 A;  2FNQ A;  1BSB A;  4O2H A;  2IUK A;  2C11 A;  4R9K A;  3BB9 A;  3HX8 A;  4HM4 B;  1HU9 A;  2LQV A;  3CC2 3;  3Q90 A;  4XDV A;  2OTL 3;  2BMR B;  1FGO A;  4KFE A;  1BRG A;  3CME 3;  1CEW I;  2CHC A;  1VQM 3;  1AY7 A;  4N3V A;  5D82 A;  1SQW A;  2ML6 A;  1CQS A;  3GZX B;  2CW9 A;  1DYU A;  3ZG0 A;  3H51 A;  2W9Q A;  4L7K A;  1LOW A;  1K28 A;  3BND A;  3UL5 A;  1EQK A;  1CH0 A;  2HMJ B;  2GSP A;  3FG3 A;  4X2H A;  1W02 A;  3D79 A;  1YI2 3;  1YJN 3;  1VQ9 3;  1FZU A;  1GS3 A;  1S5A A;  1LOY A;  2RSX A;  1MWR A;  1HKX A;  3CPO A;  4N6O B;  2IUJ A;  4EV5 A;  5RNT A;  3EF8 A;  1JBT A;  3NUV A;  4BIR A;  1QAF A;  1A90 A;  2HMK B;  1B2Z A;  3OWS A;  5FW5 A;  3SOA A;  4AEQ A;  1VQK 3;  5IEN A;  1HYF A;  2P38 A;  3SLU A;  1TTO A;  5AEU B;  3BNC A;  5IG3 A;  1VQ8 3;  2K0M A;  3QK9 A;  4HM0 B;  2OWP A;  1YJ9 3;  3A5E A;  1JB5 A;  2RGQ A;  3M8C A;  4GHO A;  1GY6 A;  1TFK A;  2F4Y A;  2CX1 A;  2F99 A;  4LGQ A;  2XGL A;  2PNC A;  1YIJ 3;  1FGQ A;  2K54 A;  1MNL A;  4GB5 A;  1R4Y A;  1RGE A;  1I0X A;  3J7Y d;  1VQN 3;  3JUO A;  1O7P B;  4KT3 B;  5CF2 A;  2XFT A;  4BTY A;  4KVH A;  4J5G A;  1RN4 A;  2XGN A;  2KXG A;  3N8B A;  2PZV A;  1AR0 A;  1V57 A;  4GL6 A;  3WDG B;  1RDS A;  4XB5 A;  1VQL 3;  4IT7 A;  1O7M B;  3EJV A;  1OPY A;  3AMO A;  1TUH A;  4NHF A;  1RN1 A;  3CD6 3;  3FG1 A;  1BNI A;  2B1X B;  1OH0 A;  4AKZ A;  1U8C B;  5D83 A;  1OHS A;  2STD A;  3LYG A;  3WMD A;  3NQZ A;  4IIA A;  3FLJ A;  5ELJ A;  1NWW A;  2CWT A;  5M1A A;  1IYY A;  3NBR A;  3MPH A;  3RDE A;  1KD1 4;  2GEX A;  5IG5 A;  2CWU A;  1UCJ A;  1BSC A;  2CFW A;  4R80 A;  5ELU A;  3D4A A;  1JN5 B;  1BAO A;  5I97 A;  1IDP A;  3KE7 A;  2W56 A;  1QAL A;  2H0I A;  4EC6 A;  1LVN A;  2E2V A;  3FCS B;  4CPK A;  3G71 3;  2HMN B;  3SED A;  3B4O A;  1W5Z A;  3MG3 A;  3NV0 B;  1TIJ A;  1OF5 A;  5BXQ A;  2CH9 A;  5IG4 A;  5BIR A;  2ZDJ A;  4H3U A;  3DH2 A;  4ILF A;  5G1K A;  3CCL 3;  3NBB A;  2BMQ B;  1YVB I;  3G8Z A;  1U5O A;  1FGR A;  1RGL A;  3FSD A;  3O8Y A;  4K1U A;  7GSP A;  4CCV A;  2MF7 A;  5JPU A;  3D5I A;  1EEJ A;  2O3O A;  4NPB A;  1E3V A;  4KFD A;  4DKI A;  3T0U A;  1OCV A;  2KF6 A;  1YGE A;  2Z6B A;  2KF5 A;  1GD4 A;  3SVA A;  3AHW A;  1UI7 A;  1DVC A;  1RJO A;  1B2S A;  2WO0 A;  1FYS A;  1B2M A;  1I70 A;  3EX9 A;  1RGF A;  1Q40 B;  1JBS A;  1TFO A;  2P09 A;  3D5G A;  4LZI A;  1FW7 A;  1BRJ A;  1NB3 I;  4RNY A;  2IY2 A;  1JB2 A;  5CK6 A;  4OK0 A;  1RN7 A;  4WYK B;  1NB5 I;  3SOY A;  1KQS 2;  1NNV A;  3ECF A;  1IU7 A;  1JJ2 2;  2XFS A;  3DGM A;  4EXR A;  5AYS C;  3CCE 3;  3D9R A;  2O9U X;  1A2P A;  4U13 A;  4HZB B;  3X42 A;  1SIH A;  1B20 A;  3CXC 2;  1IVX A;  1SAR A;  4EW5 A;  1BRH A;  6STD A;  1T3B A;  3SXX A;  3F8X A;  3H3H A;  1N5P A;  2W04 A;  3HI7 A;  2GU3 A;  4MMY B;  3PGB A;  4RNZ A;  1FGM A;  1GOY A;  1W7C A;  2UGI A;  3DZL A;  1V58 A;  3KZT A;  1RHL A;  5AIG A;  1QVG 2;  3I0Y A;  5LC7 A;  1B3S A;  1BUJ A;  3DGY A;  2CG1 A;  1BRS A;  3GAX A;  1GD3 A;  3WA3 A;  1RCK A;  5EVH A;  3ZFZ A;  1BSA A;  1I2G A;  4LMI A;  3EC9 A;  5KP4 A;  1PU4 A;  3F9S A;  3NHX A;  4FCM A;  4FMA A;  4OUQ A;  1FUT A;  3JUQ A;  3LTB A;  5KP1 A;  2C4B A;  1K41 A;  5TGN A;  1ZX2 A;  1UUG B;  1UDI I;  3WOF B;  2HMM B;  1MGR A;  4N6U A;  1I0V A;  4NRE A;  2D42 A;  1T2I A;  3U97 A;  4ZM8 A;  4J5K A;  2P05 A;  4MMX B;  1RKY A;  3B8L A;  1O7H B;  3DGN A;  1WTH A;  2CKF B;  2IMJ A;  1YVS A;  4JRF A;  5LC6 A;  1IVV A;  3G4S 3;  1S72 3;  2BU4 A;  1BAN A;  1BSD A;  3K7C A;  1AVK A;  4HM7 B;  3S67 A;  1TP6 A;  2H0G A;  2R41 A;  5EQL A;  2UX0 A;  3T8N A;  1UCI A;  4WFO A;  4FCZ A;  2KRT A;  2W0Q A;  3DGL A;  1JN5 A;  2CWV A;  3DGO A;  4O02 B;  1BNJ A;  3NV0 A;  1Q42 A;  3DXO A;  3K63 A;  3VGN A;  1IV9 A;  1VQ4 3;  1PY3 A;  1SJW A;  3VSY A;  5BVB A;  1Q81 4;  4H61 A;  3S5C A;  1RNT A;  1A2V A;  1F8N A;  3WHO A;  3ER7 A;  5FGO A;  3WR2 A;  1IK3 A;  3LML A;  5KP3 A;  1Q7H A;  1YIT 3;  1LQG C;  1DMM A;  1GMP A;  9RNT A;  1D6Z A;  1FA3 A;  4QWT A;  3BU4 A;  5AEW B;  1KC8 4;  1B2U A;  2MC8 A;  2AAD A;  2QEX 3;  4KZ1 A;  1WNH A;  4CDL A;  1Q82 4;  2KCD A;  3NXJ A;  4N6T A;  3UJM A;  3KFQ C;  5IEO A;  3UL6 A;  5DRV A;  1JB4 A;  3HOH A;  3RGR A;  1UGI A;  4X2O A;  4R4K A;  1SPU A;  3KKG A;  4HZ9 B;  2Z76 A;  1GY7 A;  3LTC A;  4RBN A;  4HM3 B;  3NM2 A;  3OXA A;  1RSN A;  2IA7 A;  2SBL A;  4STD A;  4FMD A;  5IEP A;  3S28 A;  1N9J A;  4EBG A;  3X40 A;  2WGQ A;  1R4C A;  4FMC A;  1EUI C;  3K9M C;  7STD A;  2CX0 A;  4WYK A;  2OOV C;  3CCM 3;  5HGR A;  2QIY A;  5CF1 A;  1YHQ 3;  1VQ6 3;  3DMC A;  1IVW A;  1Q86 4;  1I3F A;  3CU3 A;  2A15 A;  1BUQ A;  1GMQ A;  3N9H A;  4L8P A;  1ASK A;  1STF I;  3OWY A;  3LOY A;  3FF2 A;  1PYL A;  1BRK A;  1MWS A;  1OGX A;  2M7O A;  4HVN A;  3STD A;  2FXT A;  4FMB A;  1K73 4;  1B21 A;  1YGW A;  2GXF A;  4LEH A;  5IG0 A;  1GSP A;  1JRQ A;  2H0H A;  1ISK A;  1FGT A;  2SAR A;  1K9M 4;  1NO3 A;  1VQQ A;  3WA2 X;  4AKY A;  3CCQ 3;  4Q53 A;  2CC3 A;  2GBW B;  3E99 A;  1N8R 4;  3G6E 3;  1N5H A;  2GU1 A;  3LT9 A;  1UUW B;  3PCS A;  1O7G B;  1UCL A;  1STD A;  5IF6 A;  1M1K 4;  3HII A;  4MEI A;  1WMO A;  1NU3 A;  2HOH A;  5G2G A;  3KSE D;  3CPW 2;  1WQL B;  1K8A 4;  4XBT A;  2OOV A;  4XBX A;  4XBY A;  2K3D A;  3GZR A;  3JUN A;  3Q3F A;  1X1X A;  3D3L A;  5EEO A;  3LTA A;  3KN4 A;  3X3Y A;  1OHP A;  2RFR A;  2XR8 B;  3F7S A;  3AHS A;  3CCS 3;  3RNT A;  1VZZ A;  3X41 A;  5IW9 A;  1ZO2 A;  1BOX A;  4N6L A;  3CNX A;  2WGO A;  4L8O A;  1YNV X;  4K61 A;  1W2B 2;  4JF8 A;  2F86 B;  2GEY A;  4J9A A;  2HML B;  2C10 A;  4O8S A;  1US1 A;  4EYC A;  2JQ5 A;  2CIU A;  5D81 A;  1TRP A;  4WWU C;  2ZL8 A;  1BU4 A;  3PYJ A;  2JDI H;  3FH1 A;  3K5T A;  4BU4 A;  3CMA 3;  3EBT A;  1TRQ A;  1DET A;  4J8T A;  1OAC A;  1DVD A;  1N9E A;  3OWU A;  1TJD A;  2Y74 A;  1B27 A;  1ROA A;  2L4V A;  4O3V A;  5AII A;  4RNT A;  2RCD A;  3IMA B;  5CXO A;  2Y73 A;  3GWR A;  4MMZ B;  1SII A;  1WMN A;  3HZP A;  1EA2 A;  5JBS A;  1G02 A;  1Y4K A;  4HYZ A;  3V99 A;  1RGA A;  1UUV B;  3K0Z A;  3U1W A;  3V92 A;  3GRD A;  5GSP A;  1EKM A;  1Z1S A;  1D6U A;  1GOV A;  1GYB A;  1LXE A;  1QJG A;  3S29 A;  1NJI 4;  3EHC A;  1DE3 A;  1ULI B;  3BNB A;  3LT8 A;  4LSO A;  4FCJ A;  1L5G B;  2D1W A;  1RMS A;  1W6Y A;  3JUM A;  1RRH A;  1WMP A;  1A2K A;  2BT3 A;  4XDW A;  3EN8 A;  1DMQ A;  4HKV B;  1IVU A;  1G96 A;  3B4P A;  3A76 A;  1C7H A;  1PFP A;  1UCK A;  1ZGX A;  3DUK A;  3FG4 A;  3LH4 A;  2Z7A A;  2YFI B;  1RGH A;  2KAA A;  4LYL B;  3GZY B;  3NBJ A;  3FZW A;  1D6Y A;  5AIF A;  1RGG A;  5DRE A;  2XRX B;  1JBR A;  1TU5 A;  2FGT A;  7RNT A;  1RCL A;  4BTW A;  1VQP 3;  2OQE C;  1IQY A;  4K1V A;  1IQ8 A;  4ORL A;  4RZM A;  3CCR 3;  1B2X A;  3F40 A;  3N54 B;  1OHO A;  2BO9 B;  1C54 A;  2RNT A;  4N6N B;  1BNG A;  1FUS A;  3F8H A;  3JVC A;  3MWZ A;  3EB8 A;  2Q07 A;  1O7W B;  3IPT A;  5AIH A;  2UUG C;  2IYJ A;  4WHA A;  2BHM A;  1VQ5 3;  3LXU X;  4HM8 B;  3RGA A;  3CCV 3;  8RNT A;  1JKG B;  1W2Z A;  1I2E A;  1X1U A;  2V1L A;  2YX9 A;  4GSP A;  3G16 A;  4EV2 A;  2YFL B;  3MG1 A;  3L0R A;  3CC4 3;  1RRL A;  5M19 A;  4HM2 B;  4HBR A;  1RTU A;  4XM4 A;  4HAA A;  3OW2 2;  2CG0 A;  2ZHX B;  1DMN A;  5BU4 A;  1ULJ B;  1OGZ A;  3FKA A;  1QMA A;  3F14 A;  1ROV A;  3HIG A;  5AI1 A;  3TDG A;  2L1S A;  2P0M A;  3Q2P A;  1Q40 A;  1IT8 A;  2W9P A;  2OQE A;  3AGO A;  2INX A;  3VF1 A;  3FF0 A;  3EE1 A;  2WOH A;  1QVF 2;  3HK4 A;  1UI8 A;  5A0O B;  3LTD A;  4CJN A;  3EQQ B;  3CNM A;  1LRA A;  2XSH B;  2HMO B;  3GZB A;  3S27 A;  3MYT A;  1X1Y A;  4MJD A;  1BSE A;  1GMR A;  5STD A;  3T8U A;  2YFJ B;  4BL3 A;  1BNF A;  1UW1 A;  3F7X A;  1BVI A;  3MG2 A;  3NM7 A;  1UGH I;  4HJL B;  1MWT A;  2GBX B;  1N8Q A;  1W4N A;  3MKI A;  1G0T A;  3PS8 A;  2OCT A;  2B24 B;  2QGU A;  1M90 4;  1RGC A;  1LNH A;  4KFF A;  4PEJ A;  2F56 A;  3NX0 A;  2AAE A;  3FGY A;  3GSP A;  2BIR A;  1M1X B;  4BTX A;  2BMO B;  3UNL A;  4HM1 B;  2RBI A;  1LOV A;  2XH9 A;  1Q9E A;  2ML5 A;  1V74 A;  1VQO 3;  1BNE A;  1IV7 A;  2XEP A;  1M9G A;  2I9W A;  2E2U A;  3WOD G;  3ROB A;  1W00 A;  1W01 A;  1W6G A;  3URP A;  2KF3 A;  3CC7 3;  2BNG A;  1JV2 B;  3CCJ 3;  1OUN A;  4N6V 0;  1GOU A;  3ALA A;  1BNR A;  2CFL A;  2E2T A;  2ZA4 A;  2QA4 3;  1Q7Y 4;  3SYU A;  3WOE B;  1HZ1 A;  1BIR A;  3BLZ A;  8CHO A;  3SX1 A;  2WOF A;  1RLS A;  5IER A;  1JZO A;  2W2C A;  1MGW A;  1E3R A;  3EBY A;  3Q1C A;  3AGN A;  4I5Q A;  1YJW 3;  1FUW A;  1IQX A;  4TX4 A;  1W6C A;  4FR9 A;  3PCR A;  1E97 A;  2CFG A;  1KSI A;  3KSP A;  1I3I A;  3DM8 A;  3KII A;  4HM5 B;  5G1L A;  1AQZ A;  2F5M A;  3NQY A;  2J8X B;  4IPB A;  5M18 A;  4HOH A;  1GY5 A;  1LOX A;  5JPP A;  3OX9 A;  3QRD A;  1LNI A;  1I2F A;  1EG9 B;  5HOH A;  3I56 3;  3MHE A;  3AMO B;  2W03 A;  2P0X A;  1NDO B;  3OV4 A;  1AV4 A;  1O7N B;  2CK3 H;  2F5W A;  4K90 B;  3EN1 B;  3PZW A;  2CFK A;  1JKG A;  1MOL A;  1J2B A;  4BL2 A;  3BNE A;  3JUP A;  4R1K A;  4I4K A;  1BRN L;  3G0K A;  3IJE B;  3CCU 3;  1IT7 A;  5AYR B;  3MSO A;  3B7C A;  1X1W A;  1KWI A;  1AVL A;  1VQ7 3;  1CYU A;  1RNB A;  1MWU A;  1QAK A;  1LQM B;  3BIR A;  2W56 B;  4G1M B;  6GSP A;  3I55 3;  4N6M A;  2LYX A;  4HM6 B;  3X3X A;  1T5Y A;  2XSO B;  2KF4 A;  2Z77 A;  1BNS A;  1OF5 B;  1BGS A;  5CLK A;  3X3Z A;  3PXM A;  1BRI A;  1JZD A;  1T2H A;  1RGK A;  3V98 A;  1A67 A;  2W6J H;  1ZS7 A;  1CYV A; 
#chains in the Genus database with same CATH homology
 4R9L A;  2XF3 A;  1JNQ A;  2CFD A;  4WP5 A;  4OVM A;  3DY5 A;  3LZA A;  2R4I A;  2OTJ 3;  2F98 A;  3UB1 A;  2FNQ A;  4O2H A;  2IUK A;  2C11 A;  4R9K A;  3BB9 A;  3HX8 A;  4HM4 B;  1HU9 A;  2LQV A;  3CC2 3;  3Q90 A;  4XDV A;  2OTL 3;  2BMR B;  1FGO A;  4KFE A;  3CME 3;  1CEW I;  2CHC A;  1VQM 3;  5D82 A;  4N3V A;  1SQW A;  2ML6 A;  1CQS A;  3GZX B;  2CW9 A;  1DYU A;  3H51 A;  2W9Q A;  4L7K A;  1K28 A;  3BND A;  3UL5 A;  1EQK A;  2HMJ B;  3FG3 A;  4X2H A;  1W02 A;  1YI2 3;  1YJN 3;  1VQ9 3;  1GS3 A;  1S5A A;  2RSX A;  4N6O B;  2IUJ A;  1HKX A;  3CPO A;  4EV5 A;  3EF8 A;  3NUV A;  1QAF A;  1A90 A;  2HMK B;  3OWS A;  5FW5 A;  3SOA A;  4AEQ A;  1VQK 3;  5IEN A;  2P38 A;  3SLU A;  5AEU B;  3BNC A;  5IG3 A;  1VQ8 3;  2K0M A;  3QK9 A;  4HM0 B;  2OWP A;  1YJ9 3;  1JB5 A;  2RGQ A;  3M8C A;  1GY6 A;  1TFK A;  2F99 A;  4LGQ A;  2XGL A;  2PNC A;  1YIJ 3;  2K54 A;  1FGQ A;  1MNL A;  4GB5 A;  3J7Y d;  1VQN 3;  3JUO A;  1O7P B;  5CF2 A;  2XFT A;  4BTY A;  4KVH A;  3WDG B;  2XGN A;  2KXG A;  3N8B A;  2PZV A;  1AR0 A;  4GL6 A;  4XB5 A;  1VQL 3;  4IT7 A;  1O7M B;  3EJV A;  1OPY A;  3AMO A;  1TUH A;  4NHF A;  3CD6 3;  3FG1 A;  2B1X B;  1OH0 A;  4AKZ A;  1U8C B;  5D83 A;  1OHS A;  2STD A;  3LYG A;  3WMD A;  3NQZ A;  4IIA A;  3FLJ A;  5ELJ A;  1NWW A;  2CWT A;  3NBR A;  3MPH A;  3RDE A;  1KD1 4;  2GEX A;  5IG5 A;  2CWU A;  2CFW A;  4R80 A;  5ELU A;  1JN5 B;  5I97 A;  1IDP A;  3KE7 A;  2W56 A;  1QAL A;  4EC6 A;  1LVN A;  2E2V A;  3FCS B;  3G71 3;  2HMN B;  3SED A;  3B4O A;  1W5Z A;  3MG3 A;  3NV0 B;  1TIJ A;  1OF5 A;  5BXQ A;  2CH9 A;  5IG4 A;  2ZDJ A;  4H3U A;  3CCL 3;  3NBB A;  2BMQ B;  1YVB I;  3G8Z A;  1U5O A;  1FGR A;  3FSD A;  3O8Y A;  4K1U A;  4CCV A;  2MF7 A;  5JPU A;  2O3O A;  1E3V A;  4KFD A;  3T0U A;  1OCV A;  1YGE A;  2Z6B A;  1GD4 A;  3SVA A;  1UI7 A;  1DVC A;  1RJO A;  2WO0 A;  3EX9 A;  1Q40 B;  1TFO A;  2P09 A;  4LZI A;  1NB3 I;  4RNY A;  1JB2 A;  5CK6 A;  4OK0 A;  1RN7 A;  4WYK B;  1NB5 I;  3SOY A;  1KQS 2;  3ECF A;  1IU7 A;  1JJ2 2;  2XFS A;  3DGM A;  4EXR A;  5AYS C;  3CCE 3;  3D9R A;  2O9U X;  3X42 A;  4U13 A;  4HZB B;  1SIH A;  3CXC 2;  1IVX A;  6STD A;  3SXX A;  3F8X A;  3H3H A;  1N5P A;  2W04 A;  3HI7 A;  2GU3 A;  4MMY B;  3PGB A;  4RNZ A;  1FGM A;  1W7C A;  3DZL A;  5AIG A;  3KZT A;  1QVG 2;  3I0Y A;  5LC7 A;  2CG1 A;  3GAX A;  1GD3 A;  3WA3 A;  5EVH A;  5KP4 A;  4LMI A;  3EC9 A;  1PU4 A;  3F9S A;  3NHX A;  4FCM A;  4FMA A;  4OUQ A;  3JUQ A;  3LTB A;  5KP1 A;  1K41 A;  5TGN A;  1ZX2 A;  3WOF B;  2HMM B;  4N6U A;  4NRE A;  2D42 A;  3U97 A;  4ZM8 A;  2P05 A;  4MMX B;  1RKY A;  3B8L A;  1O7H B;  3DGN A;  1WTH A;  2CKF B;  2IMJ A;  4JRF A;  5LC6 A;  1IVV A;  3G4S 3;  1S72 3;  3K7C A;  4HM7 B;  1AVK A;  3S67 A;  1TP6 A;  5EQL A;  2UX0 A;  3T8N A;  4WFO A;  4FCZ A;  2KRT A;  2W0Q A;  3DGL A;  1JN5 A;  2CWV A;  3DGO A;  4O02 B;  3NV0 A;  1Q42 A;  3DXO A;  3K63 A;  1IV9 A;  1VQ4 3;  1SJW A;  3VSY A;  5BVB A;  1Q81 4;  4H61 A;  3S5C A;  1A2V A;  1F8N A;  3ER7 A;  5FGO A;  1IK3 A;  3LML A;  5KP3 A;  1YIT 3;  1DMM A;  1D6Z A;  1FA3 A;  4QWT A;  5AEW B;  1KC8 4;  2MC8 A;  2QEX 3;  4KZ1 A;  1WNH A;  4CDL A;  1Q82 4;  2KCD A;  3NXJ A;  4N6T A;  3UJM A;  3KFQ C;  5IEO A;  3UL6 A;  5DRV A;  1JB4 A;  3RGR A;  4X2O A;  4R4K A;  1SPU A;  3KKG A;  4HZ9 B;  2Z76 A;  1GY7 A;  3LTC A;  4RBN A;  4HM3 B;  3NM2 A;  3OXA A;  2IA7 A;  2SBL A;  4STD A;  4FMD A;  5IEP A;  3S28 A;  1N9J A;  4EBG A;  3X40 A;  2WGQ A;  1R4C A;  4FMC A;  7STD A;  3K9M C;  4WYK A;  3CCM 3;  2OOV C;  5HGR A;  2QIY A;  5CF1 A;  1YHQ 3;  1VQ6 3;  3DMC A;  1IVW A;  1Q86 4;  3CU3 A;  2A15 A;  1BUQ A;  3N9H A;  4L8P A;  1ASK A;  1STF I;  3OWY A;  3LOY A;  3FF2 A;  4HVN A;  1OGX A;  2M7O A;  3STD A;  2FXT A;  4FMB A;  1K73 4;  2GXF A;  5IG0 A;  4LEH A;  1JRQ A;  1ISK A;  1FGT A;  1K9M 4;  1NO3 A;  3WA2 X;  4AKY A;  3CCQ 3;  4Q53 A;  2CC3 A;  2GBW B;  3E99 A;  1N8R 4;  3G6E 3;  1N5H A;  2GU1 A;  3LT9 A;  1UUW B;  3PCS A;  1O7G B;  1M1K 4;  1STD A;  5IF6 A;  3HII A;  4MEI A;  1WMO A;  1NU3 A;  5G2G A;  3KSE D;  1WQL B;  4XBT A;  2OOV A;  4XBX A;  4XBY A;  3GZR A;  3JUN A;  3D3L A;  5EEO A;  3LTA A;  3KN4 A;  3X3Y A;  1OHP A;  2RFR A;  2XR8 B;  3F7S A;  3CCS 3;  1VZZ A;  3X41 A;  5IW9 A;  1ZO2 A;  4N6L A;  3CNX A;  2WGO A;  4L8O A;  4K61 A;  1W2B 2;  4JF8 A;  2F86 B;  2GEY A;  4J9A A;  2HML B;  2C10 A;  4O8S A;  1US1 A;  4EYC A;  2JQ5 A;  2CIU A;  5D81 A;  4WWU C;  2ZL8 A;  3PYJ A;  2JDI H;  3FH1 A;  3K5T A;  3CMA 3;  3EBT A;  4J8T A;  1OAC A;  1DVD A;  1N9E A;  3OWU A;  2Y74 A;  1ROA A;  2L4V A;  4O3V A;  5AII A;  2RCD A;  3IMA B;  5CXO A;  2Y73 A;  3GWR A;  4MMZ B;  1SII A;  1WMN A;  3HZP A;  1EA2 A;  5JBS A;  1Y4K A;  4HYZ A;  3V99 A;  1UUV B;  3U1W A;  3K0Z A;  3V92 A;  3GRD A;  1EKM A;  1Z1S A;  1D6U A;  1GYB A;  1QJG A;  1LXE A;  3S29 A;  1NJI 4;  3EHC A;  1ULI B;  3BNB A;  3LT8 A;  4LSO A;  4FCJ A;  1L5G B;  2D1W A;  1W6Y A;  3JUM A;  1RRH A;  1WMP A;  1A2K A;  2BT3 A;  4XDW A;  3EN8 A;  1DMQ A;  4HKV B;  1IVU A;  1G96 A;  3B4P A;  3A76 A;  1C7H A;  1PFP A;  3DUK A;  3FG4 A;  3LH4 A;  2Z7A A;  2YFI B;  3GZY B;  3NBJ A;  3FZW A;  1D6Y A;  5AIF A;  5DRE A;  2XRX B;  1TU5 A;  2FGT A;  4BTW A;  1VQP 3;  2OQE C;  1IQY A;  4K1V A;  1IQ8 A;  4ORL A;  4RZM A;  3CCR 3;  3F40 A;  3N54 B;  1OHO A;  2BO9 B;  4N6N B;  3F8H A;  3JVC A;  3MWZ A;  3EB8 A;  2Q07 A;  1O7W B;  3IPT A;  5AIH A;  4WHA A;  2BHM A;  1VQ5 3;  3LXU X;  4HM8 B;  3RGA A;  3CCV 3;  1JKG B;  1W2Z A;  2V1L A;  2YX9 A;  3G16 A;  4EV2 A;  2YFL B;  3MG1 A;  3L0R A;  3CC4 3;  1RRL A;  4HM2 B;  4HBR A;  4XM4 A;  3OW2 2;  2CG0 A;  1DMN A;  1ULJ B;  1OGZ A;  3FKA A;  1QMA A;  3F14 A;  1ROV A;  3HIG A;  5AI1 A;  3TDG A;  2OQE A;  2P0M A;  3Q2P A;  1Q40 A;  1IT8 A;  2W9P A;  3VF1 A;  3CPW 2;  2INX A;  1K8A 4;  3FF0 A;  3EE1 A;  2WOH A;  1QVF 2;  3HK4 A;  1UI8 A;  5A0O B;  3LTD A;  3EQQ B;  3CNM A;  2XSH B;  2HMO B;  3GZB A;  3S27 A;  3MYT A;  4MJD A;  5STD A;  3T8U A;  2YFJ B;  1UW1 A;  3F7X A;  3MG2 A;  3NM7 A;  4HJL B;  2GBX B;  1N8Q A;  1W4N A;  3MKI A;  3PS8 A;  2OCT A;  2B24 B;  2QGU A;  1M90 4;  1LNH A;  4KFF A;  4PEJ A;  3NX0 A;  3FGY A;  1M1X B;  4BTX A;  2BMO B;  3UNL A;  4HM1 B;  2XH9 A;  2ML5 A;  1V74 A;  1VQO 3;  1IV7 A;  2XEP A;  1M9G A;  2I9W A;  2E2U A;  3WOD G;  3ROB A;  1W00 A;  1W01 A;  1W6G A;  3CC7 3;  3CCJ 3;  2BNG A;  1JV2 B;  1OUN A;  4N6V 0;  3ALA A;  2CFL A;  2E2T A;  2QA4 3;  1Q7Y 4;  3WOE B;  3BLZ A;  8CHO A;  3SX1 A;  2WOF A;  5IER A;  2W2C A;  1E3R A;  3EBY A;  3Q1C A;  1YJW 3;  1FUW A;  1IQX A;  4TX4 A;  1W6C A;  4FR9 A;  3PCR A;  1E97 A;  2CFG A;  1KSI A;  3KSP A;  3DM8 A;  3KII A;  4HM5 B;  3NQY A;  4IPB A;  1GY5 A;  1LOX A;  5JPP A;  3OX9 A;  3QRD A;  1EG9 B;  3I56 3;  3MHE A;  3AMO B;  2W03 A;  2P0X A;  1NDO B;  3OV4 A;  1AV4 A;  1O7N B;  2CK3 H;  4K90 B;  3EN1 B;  3PZW A;  2CFK A;  1JKG A;  1MOL A;  1J2B A;  3BNE A;  3JUP A;  4R1K A;  4I4K A;  3G0K A;  3IJE B;  3CCU 3;  1IT7 A;  5AYR B;  3MSO A;  3B7C A;  1KWI A;  1AVL A;  1VQ7 3;  1CYU A;  1QAK A;  2W56 B;  4G1M B;  3I55 3;  4N6M A;  2LYX A;  4HM6 B;  3X3X A;  1T5Y A;  2XSO B;  2Z77 A;  1OF5 B;  5CLK A;  3X3Z A;  3PXM A;  3V98 A;  1A67 A;  2W6J H;  3VGN A;  1CYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...