1Q40A

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
165
Chain Sequence
QDPTQQLEPFLKRFLASLDLLYTQSQPFPNVESYATQLGSNLKRSSAIIVNGQPIIPSPQEDCKLQFQKKWLQTPLSSHQLTSYDGHLIPGTGTFVVHFSAKVRFDQSGRNRLGESADLFQENNQRPIWGSWFGVDVNLVVDENVMQDGEIINSMDYRFTYVPND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
total genus 43
structure length 165
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40A00
4GB5A 4LMIA 3EF8A 2XRXB 3G0KA 1W6YA 5DREA 2HMLB 2STDA 3KZTA 1JN5A 1O7WB 3F8HA 1EG9B 4XBXA 5IERA 3D9RA 3FKAA 3OWSA 4HVNA 3STDA 1JN5B 3VGNA 1VZZA 1CQSA 1JKGB 2GEYA 3GZYB 3G16A 4HZBB 1OGZA 2BMQB 2XR8B 3EHCA 4K1VA 4RZMA 5CF1A 1W02A 3FF2A 2Z77A 3NBRA 3NV0B 3T8NA 3VSYA 4STDA 1ISKA 4XM4A 5AIGA 1GY6A 3EC9A 4HM3B 1GYBA 4K1UA 5D83A 2HMJB 3JUOA 3WMDA 3HZPA 3LZAA 4FCMA 4WYKB 1O7GB 1K41A 2Z76A 5G2GA 1OH0A 3F40A 3SEDA 2GEXA 7STDA 2RCDA 1OUNA 3CNXA 1UUVB 2GBXB 4X2OA 1QMAA 3H51A 3EQQB 1DMQA 3F7XA 4WYKA 3S5CA 3GRDA 4L7KA 1W00A 3CU3A 3KSPA 3KE7A 1OHSA 3ECFA 5IF6A 2HMOB 2JQ5A 3DUKA 4J8TA 3CPOA 4HZ9B 5IG0A 5IG3A 3DZLA 3FLJA 5CF2A 4HM7B 5STDA 3GZBA 3B8LA 4HM4B 1ZO2A 3FGYA 1JB4A 2K54A 2RGQA 2YFLB 3MG2A 3BB9A 4R9KA 2INXA 2YFIB 4XB5A 5TGNA 5AEWB 1OCVA 1O7HB 1O7NB 1OHOA 3EN8A 3M8CA 4HM6B 4IIAA 1OHPA 1EA2A 2YFJB 2XSOB 1ULJB 2HMMB 3Q90A 1C7HA 5IEOA 3UJMA 5AIIA 1W01A 5FW5A 1NWWA 2XSHB 3MYTA 3UNLA 5AEUB 5IG4A 1DMMA 3NV0A 4FCJA 1Q40B 4MJDA 5AI1A 4HJLB 4HM8B 2CHCA 3JUNA 5D81A 5IG5A 3HX8A 3K0ZA 1E3RA 3DM8A 1QJGA 2HMNB 3B4PA 3F8XA 1OPYA 1SJWA 3DXOA 5D82A 1HKXA 1O7MB 2OWPA 1OF5B 3H3HA 3K7CA 3OX9A 1Q40A 4H3UA 4J9AA 4WWUC 5HGRA 2F98A 1NU3A 1TUHA 4HM5B 2BMOB 3MKIA 4Q53A 4HM2B 5EVHA 2QIYA 5DRVA 5IEPA 5JPUA 1ULIB 5BVBA 1AR0A 1GS3A 3EX9A 4ORLA 2A15A 3NUVA 1UUWB 3IPTA 4N3VA 5CK6A 4CDLA 3NM2A 1ZX2A 2W2CA 3JUPA 3LYGA 4R1KA 2R4IA 4I4KA 1DMNA 3EBYA 3I0YA 2F99A 4KVHA 2GBWB 3RGRA 3JUQA 6STDA 1E97A 4XDVA 1ASKA 1O7PB 3EN1B 4HKVB 1WQLB 4HM0B 3JUMA 1GY5A 3HK4A 3MHEA 4LGQA 5AIFA 2IMJA 4WP5A 4PEJA 3SOYA 2PZVA 2B1XB 3DMCA 3MG3A 1TP6A 2BNGA 3B7CA 3ROBA 3F9SA 5AIHA 3GZRA 3F14A 3FSDA 3FH1A 3OWUA 5KP1A 3MG1A 3FZWA 3NXJA 3ER7A 1STDA 2F86B 2GXFA 3B4OA 3GWRA 3OXAA 3OWYA 2BMRB 1JB2A 1JKGA 1S5AA 3A76A 2QGUA 2CKFB 3F7SA 3G8ZA 3GZXB 3EBTA 1E3VA 4L8PA 4LEHA 4OVMA 1OGXA 2UX0A 2HMKB 2B24B 1OF5A 3NHXA 1NDOB 2RFRA 4X2HA 5CLKA 4U13A 5BXQA 5KP3A 3MSOA 3EJVA 1BUQA 4XDWA 3KKGA 5KP4A 1Q42A 3BLZA 3E99A 2I9WA 3CNMA 4L8OA 5JPPA 3FF0A 4R9LA 4OUQA 4XBTA 3SOAA 1A2KA 3OV4A 1U5OA 2Z7AA 5CXOA 3RGAA 1GY7A 4XBYA 8CHOA 5IENA 1JB5A 1Z1SA 4HM1B 3T8UA 1IDPA
chains in the Genus database with same CATH superfamily
4GB5A 1V74A 7GSPA 1A2VA 5DREA 3KZTA 4OK0A 1GMQA 5AYSC 2F56A 1MGWA 2CG0A 2OQEC 2CFKA 2XH9A 2Q07A 3NQYA 1RCKA 2QEX3 1MWUA 2O9UX 3OWSA 1D6YA 3VGNA 4EYCA 4LYLB 1BSBA 3RDEA 3NQZA 3S29A 1IT7A 3G16A 1YJN3 1OGZA 1LOYA 2CWTA 1PFPA 3WODG 2CX0A 2CWUA 4EV5A 1RGLA 1X1WA 2PNCA 3VSYA 4XM4A 4EBGA 1I3FA 3EC9A 2KAAA 4HM3B 5A0OB 1B21A 1RN7A 3LH4A 3ZG5A 2BIRA 1SQWA 2H0HA 4O2HA 2P05A 3PZWA 1RDSA 3EE1A 1O7GB 1IV9A 1K41A 1QAKA 1OH0A 2F5MA 2Z76A 5G2GA 1IK3A 1VQP3 3I553 2GBXB 1X1YA 2CK3H 3H51A 1VQM3 1VQ63 1DMQA 1I0XA 5IW9A 5AYRB 4L7KA 4FMDA 1FGMA 2ZA4A 3KSED 3SX1A 3N8BA 1W2ZA 5LC6A 2IY2A 3HOHA 2GU1A 1RGKA 3U1WA 4I5QA 2V1LA 3BNEA 3A5EA 2K54A 3BB9A 4H61A 1LNHA 1OCVA 1N9EA 1AV4A 2XFTA 3EN8A 4RNYA 5I97A 1EA2A 4LZIA 2XSOB 1ULJB 4KFDA 2WOFA 1HYFA 5AIIA 1YJW3 3UNLA 5AEUB 1D6ZA 1UGHI 1PY3A 4BU4A 1Q40B 1NO3A 1MOLA 3HX8A 2BT3A 3K0ZA 1LOWA 1QJGA 2HMNB 3DM8A 2MC8A 1R4YA 2RSXA 3K7CA 1HU9A 2C4BA 1FUSA 2KF5A 3OX9A 4KFFA 1NB5I 1NU3A 2UGIA 4HM5B 5EVHA 1WNHA 1CEWI 1KSIA 1M1XB 1ULIB 2ZDJA 2CW9A 3S27A 1GS3A 5CK6A 1UUWB 3IPTA 4J5KA 3CC23 1MGRA 3NM2A 1ZX2A 1WMOA 3J7Yd 1B2MA 1RGHA 2KCDA 4I4KA 1DMNA 5M19A 2F99A 3MWZA 4KVHA 3JUQA 6STDA 4WWUC 3EN1B 3EB8A 5AIFA 2KF6A 1GY5A 3HK4A 2E2TA 5ELJA 1UGIA 4KZ1A 4BL2A 3DMCA 5HOHA 3AMOB 2F5WA 4MMXB 4BL3A 2L4VA 3FSDA 3FH1A 3OWUA 2AAEA 4EC6A 1VQ53 1BIRA 3FZWA 4GSPA 2GXFA 6RNTA 3PS8A 1BRHA 1N8R4 2BMRB 2XFSA 4L8PA 3SYUA 2QGUA 2CKFB 3EBTA 4NREA 1FUWA 1RGCA 2F4YA 4AEQA 1BNIA 1KQS2 3VF1A 1OF5A 1NDOB 2XGLA 1N5PA 1UI8A 4IT7A 1IYYA 4GL6A 2E2UA 3MSOA 1UW1A 3EJVA 1MNLA 1BUQA 4XDWA 1GOYA 3KKGA 1Q42A 4J5GA 4AKZA 3GAXA 1I3IA 1RCLA 3L0RA 2RNTA 4K90B 5G1KA 3SOAA 3WA3A 1LOXA 2Z7AA 3K5TA 5CXOA 3RGAA 2W6JH 3PXMA 1JB5A 4HM1B 4FMBA 1FA3A 1BRGA 2ML6A 4N6OB 1W6YA 1N8QA 1RN1A 3URPA 1F8NA 1LXEA 5GSPA 1W2B2 4JF8A 5LC7A 4MMZB 4XBXA 5IERA 1YI23 1YIJ3 3BNCA 4FR9A 3D9RA 3FKAA 3STDA 1QALA 1AVKA 1RN4A 1UI7A 4KFEA 4TX4A 3UL5A 4ZM8A 1JKGB 2CWVA 3SEDA 4HZBB 1VQ73 1STFI 2CFLA 4RZMA 4FCZA 3NV0B 1BSCA 3X3YA 1IQ8A 1ISKA 1WTHA 3SVAA 1LQMB 1X1UA 1WMPA 2W0QA 2HMJB 2ZHXB 5D83A 1RGFA 4FCMA 3X41A 1RSNA 4HYZA 1OUNA 1UUVB 2WGOA 3CC73 1ROVA 3BU4A 1IV7A 3EQQB 3DY5A 3GSPA 3FCSB 3F7XA 3CCV3 4WYKA 1DVDA 3G713 1OHSA 3BNBA 1BRJA 2HMOB 3DUKA 3D5GA 2BHMA 2JDIH 3LTAA 4HAAA 3FLJA 3U97A 2Z6BA 1GMPA 4HM7B 3CD63 3TDGA 1I0VA 2YFLB 3MG2A 4XB5A 2INXA 2YFIB 4WHAA 1W4NA 2MF7A 3FG3A 1JJ22 1OHOA 1YHQ3 1OHPA 5KP4A 1RHLA 2WO0A 2CG1A 1W01A 2BO9B 2UUGC 5FW5A 3MYTA 1Q7HA 5EEOA 2Y73A 1GOVA 5IG4A 5M18A 3NV0A 1J2BA 3N9HA 4MJDA 5AI1A 1EKMA 4HM8B 5D81A 4DKIA 2OCTA 3F8XA 3HIGA 5EQLA 3CCL3 5D82A 1O7MB 2OWPA 1EQKA 1OF5B 2AADA 4H3UA 1W7CA 2F98A 1ROAA 5IEPA 4LSOA 4Q53A 1IQYA 2QIYA 1G02A 2W56B 1RLSA 5ELUA 1Q9EA 4CPKA 3BIRA 1PU4A 3EX9A 4ORLA 3T0UA 3V98A 2W2CA 1GSPA 2R4IA 1ZS7A 3EBYA 3V92A 1RJOA 1G96A 2SARA 1I2EA 5BIRA 3AMOA 1ASKA 1O7PB 5JPUA 1TFOA 4HM0B 3SOYA 4WP5A 1EEJA 2GU3A 3S67A 4IPBA 1L5GB 1TP6A 3B7CA 1S723 1SIHA 1AVLA 5AIHA 3GZRA 3BNDA 5KP1A 1U8CB 3MG1A 4R4KA 3OXAA 1YGWA 1STDA 3ER7A 3PCRA 1LNIA 3GWRA 5IG3A 1TU5A 3GZXB 3D79A 3LTCA 4LEHA 4OVMA 1NB3I 2H0GA 3D4AA 1OGXA 4R80A 1AQZA 1BNEA 2HMKB 1DYUA 2CC3A 1I2GA 3CC43 1NNVA 3K63A 1US1A 4EV2A 4U13A 5G1LA 4ILFA 1VQL3 2K3DA 1YVSA 3LXUX 3CPW2 3D5IA 2OTJ3 3E99A 1KD14 2I9WA 4L8OA 1A90A 2RBIA 1BRKA 4XBTA 1IU7A 2KXGA 1BRSA 1GY7A 1T3BA 3FG1A 2KF3A 3NX0A 1MWTA 4LMIA 3EF8A 2XRXB 3G0KA 3UB1A 1QVG2 3FG4A 1K734 1JN5A 1BAOA 1FW7A 4G1MB 1BNFA 4NHFA 1X1XA 3LMLA 3NM7A 3O8YA 3SLUA 1VQ83 3KN4A 4K1VA 2BMQB 4AKYA 2XR8B 2R41A 3RNTA 2Z77A 3LT8A 3NBRA 1YIT3 4O8SA 1W6CA 1TRPA 2XGNA 5AIGA 1GY6A 2IA7A 1VQQA 2P0MA 3CCR3 1LRAA 1GYBA 1IVXA 1JBSA 4K1UA 3HZPA 3ZFZA 3F40A 3JVCA 1B2XA 4FMAA 1UCKA 2Y74A 1RKYA 2OQEA 3CCU3 1BU4A 1W00A 3KSPA 3KE7A 3ECFA 1DETA 3AHWA 5IF6A 2JQ5A 1JBRA 4N6TA 3CPOA 1FGOA 1GD3A 4RNTA 1RGAA 1B20A 3B8LA 3FGYA 2RGQA 4HM4B 1BSAA 5AEWB 1DE3A 1BANA 1O7NB 3M8CA 4HM6B 3LOYA 5CF2A 3S5CA 1FUTA 3Q90A 1LQGC 5CF1A 2HMMB 1T2HA 5IEOA 1K8A4 1T5YA 1W5ZA 1GOUA 2WOHA 3DH2A 4BTYA 3IJEB 2XSHB 1SIIA 3CCE3 1DMMA 3NBJA 3DGNA 4FCJA 3QRDA 4HJLB 3SXXA 1YVBI 4N6MA 3B4PA 1RNTA 1OPYA 1SJWA 1BRNL 4GHOA 1YNVX 3X3ZA 3CCQ3 1Q40A 1BVIA 3IMAB 2BMOB 1BGSA 3MKIA 4HM2B 4N6NB 5DRVA 1AR0A 2CFDA 1IVVA 4R1KA 3WOEB 3CMA3 3WDGB 2GBWB 3RGRA 3AGOA 1VQ43 2ML5A 4LGQA 4HKVB 3I563 1RRLA 1M904 2IMJA 1BNGA 2BU4A 2PZVA 2W9QA 3N54B 3CXC2 1JV2B 1M9GA 3MG3A 3ROBA 3ZG0A 1Q824 1A67A 1TTOA 2P09A 2C11A 3F14A 4X2OA 3B4OA 2F86B 1CH0A 1BNRA 3F7SA 1JKGA 1I8VA 3A76A 1IT8A 3G8ZA 2H0IA 1I70A 2KF4A 1VQO3 1E3VA 2UX0A 3V99A 2B24B 3NHXA 1G0TA 1UDII 2RFRA 4O02B 5CLKA 1R4CA 5RNTA 5KP3A 3K9MC 2C10A 1JBTA 1FGQA 2CX1A 3Q2PA 1RMSA 3PCSA 3KFQC 3FF0A 4R9LA 4CCVA 3MPHA 4WFOA 3G6E3 1U5OA 1M1K4 4HOHA 1RNBA 2W9PA 3KCHA 3PYJA 2OOVA 1GD4A 8RNTA 3T8UA 1IDPA 3DGLA 5IENA 3Q3FA 1TIJA 1V57A 1WMNA 4NPBA 1I2FA 1N5HA 2QA43 2HMLB 2STDA 1JZOA 1KC84 1DVCA 1O7WB 3F8HA 1YGEA 3WR2A 1EG9B 2SBLA 1N9JA 2OTL3 2D1WA 5M1AA 1B27A 2YX9A 4HVNA 4RBNA 1B2ZA 1JN5B 1VZZA 1CQSA 2GEYA 3GZYB 4HBRA 3EHCA 4BTXA 4EW5A 1SPUA 3DGOA 1W02A 3FF2A 3T8NA 2K0MA 1C54A 1A2PA 1MWSA 4STDA 3NBBA 1AY7A 3LT9A 3ALAA 2IYJA 2P0XA 3CCS3 1FYSA 3HI7A 3JUOA 3WMDA 3LZAA 1UCLA 1V58A 4WYKB 4CJNA 7STDA 1BRIA 1GMRA 2FXTA 2GEXA 4KT3B 2LQVA 2RCDA 2XF3A 3CNXA 5BU4A 1QMAA 3AGNA 4MMYB 1IVWA 1RRHA 3GRDA 3QK9A 3CU3A 1RGEA 4K61A 2W04A 3KIIA 4J8TA 3WA2X 1RGGA 5IG0A 4HZ9B 3WOFB 1VQ93 2CFGA 1VQN3 3D3LA 3DZLA 1IVUA 1HZ1A 2OOVC 3AHSA 5STDA 1JZDA 2P38A 3GZBA 1FGTA 1UUGB 1JB4A 1ZO2A 2IUJA 3X40A 3X42A 4R9KA 1FGRA 1OACA 5TGNA 4BTWA 1O7HB 4IIAA 2GSPA 2YFJB 1C7HA 3UJMA 1NWWA 1MWRA 2J8XB 1D6UA 1NJI4 3DGMA 1LVNA 2CHCA 2CFWA 2M7OA 3JUNA 4FMCA 4BIRA 1E3RA 1K9M4 2D42A 3CME3 1Q7Y4 2CIUA 6GSPA 3DXOA 1BSDA 1QVF2 1W6GA 1HKXA 3H3HA 3PGBA 5FGOA 1BNSA 5HGRA 1Y4KA 4J9AA 7RNTA 5IG5A 1TUHA 2CH9A 2E2VA 1JNQA 1UCIA 1Q864 5BVBA 3UL6A 1Q814 4QWTA 2A15A 3NUVA 1EUIC 4JRFA 4N3VA 3OW22 1TJDA 2LYXA 3JUPA 3LYGA 2O3OA 2WGQA 3I0YA 1E97A 4XDVA 4CDLA 4EXRA 1WQLB 3JUMA 2ZL8A 3MHEA 2L1SA 5JBSA 4PEJA 2B1XB 2BNGA 3F9SA 1JRQA 4N6V0 3S28A 1CYVA 4O3VA 3CCJ3 1K28A 2KRTA 3LTBA 3NXJA 1B3SA 2HOHA 3DGYA 3OWYA 3CCM3 1JB2A 1S5AA 2FNQA 1IQXA 9RNTA 3WHOA 1B2UA 4MEIA 3X3XA 3G4S3 2IUKA 2XEPA 1KWIA 2FGTA 1VQK3 3LTDA 4X2HA 1QAFA 5BXQA 1BUJA 4N6LA 1BOXA 2W56A 1LOVA 3BLZA 5JPPA 1BSEA 1ZGXA 1FZUA 1PYLA 1UCJA 3CNMA 3HIIA 4N6UA 1T2IA 4OUQA 2W03A 1RTUA 1A2KA 1TFKA 3OV4A 1CYUA 3Q1CA 1B2SA 1BNJA 4RNZA 4XBYA 8CHOA 1YJ93 1TRQA 1Z1SA 1SARA
chains in the Genus database with same CATH topology
4GB5A 1V74A 1A2VA 5DREA 3KZTA 4OK0A 5AYSC 2CG0A 2OQEC 2CFKA 2XH9A 2Q07A 3NQYA 2QEX3 2O9UX 3OWSA 1D6YA 3VGNA 4EYCA 3RDEA 1YJN3 3NQZA 3S29A 1IT7A 3G16A 1OGZA 2CWTA 1PFPA 3WODG 2CWUA 4EV5A 2PNCA 3VSYA 4XM4A 4EBGA 3EC9A 4HM3B 5A0OB 1RN7A 3LH4A 1SQWA 4O2HA 2P05A 3PZWA 3EE1A 1O7GB 1K41A 1IV9A 1QAKA 1OH0A 2Z76A 5G2GA 1IK3A 1VQP3 3I553 2GBXB 2CK3H 3H51A 1VQM3 1VQ63 1DMQA 5IW9A 5AYRB 4L7KA 4FMDA 1FGMA 3KSED 3SX1A 3N8BA 1W2ZA 5LC6A 2GU1A 3U1WA 2V1LA 3BNEA 2K54A 3BB9A 4H61A 1LNHA 1OCVA 1N9EA 1AV4A 2XFTA 3EN8A 4RNYA 5I97A 1EA2A 4LZIA 2XSOB 1ULJB 4KFDA 2WOFA 1YJW3 5AIIA 3UNLA 5AEUB 1D6ZA 1Q40B 1NO3A 1MOLA 3HX8A 2BT3A 3K0ZA 3DM8A 1QJGA 2HMNB 2MC8A 2RSXA 3OX9A 3K7CA 1HU9A 1NB5I 4KFFA 1NU3A 4HM5B 5EVHA 1WNHA 1CEWI 1KSIA 1M1XB 1ULIB 2ZDJA 2CW9A 3S27A 1GS3A 5CK6A 1UUWB 3IPTA 3CC23 3NM2A 1ZX2A 1WMOA 3J7Yd 2KCDA 4I4KA 1DMNA 2F99A 3MWZA 4KVHA 3JUQA 6STDA 4WWUC 3EN1B 3EB8A 5AIFA 1GY5A 3HK4A 2E2TA 5ELJA 4KZ1A 3DMCA 3AMOB 4MMXB 2L4VA 3FSDA 3FH1A 3OWUA 4EC6A 1VQ53 3FZWA 2GXFA 3PS8A 1N8R4 2BMRB 2XFSA 4L8PA 2QGUA 2CKFB 3EBTA 4NREA 1FUWA 4AEQA 1KQS2 3VF1A 1OF5A 1NDOB 2XGLA 1N5PA 1UI8A 4IT7A 4GL6A 2E2UA 3MSOA 1UW1A 3EJVA 1MNLA 1BUQA 4XDWA 3KKGA 1Q42A 4AKZA 3GAXA 3L0RA 4K90B 3SOAA 3WA3A 1LOXA 2Z7AA 3K5TA 5CXOA 3RGAA 2W6JH 3PXMA 1JB5A 4HM1B 4FMBA 1FA3A 2ML6A 4N6OB 1W6YA 1N8QA 1F8NA 1LXEA 1W2B2 4JF8A 5LC7A 4MMZB 4XBXA 5IERA 1YI23 1YIJ3 3BNCA 4FR9A 3D9RA 3FKAA 3STDA 1QALA 1AVKA 4KFEA 1UI7A 4TX4A 3UL5A 4ZM8A 1VQ73 1JKGB 2CWVA 3SEDA 4HZBB 1STFI 2CFLA 4RZMA 4FCZA 3NV0B 3X3YA 1IQ8A 1ISKA 1WTHA 3SVAA 1WMPA 2W0QA 2HMJB 5D83A 3X41A 4FCMA 4HYZA 1OUNA 1UUVB 2WGOA 3CC73 1ROVA 1IV7A 3EQQB 3DY5A 3CCV3 3FCSB 3F7XA 4WYKA 1DVDA 3G713 1OHSA 3BNBA 2HMOB 3DUKA 2BHMA 2JDIH 3LTAA 3FLJA 3U97A 2Z6BA 4HM7B 3CD63 3TDGA 2YFLB 3MG2A 4XB5A 2INXA 2YFIB 4WHAA 1W4NA 2MF7A 3FG3A 1JJ22 1OHOA 1YHQ3 1OHPA 5KP4A 2WO0A 2CG1A 1W01A 2BO9B 5FW5A 3MYTA 5EEOA 2Y73A 5IG4A 3NV0A 1J2BA 3N9HA 4MJDA 5AI1A 1EKMA 4HM8B 5D81A 2OCTA 3F8XA 3HIGA 5EQLA 3CCL3 5D82A 1O7MB 2OWPA 1EQKA 1OF5B 4H3UA 1W7CA 2F98A 1ROAA 5IEPA 4LSOA 4Q53A 1IQYA 2QIYA 2W56B 5ELUA 1PU4A 3EX9A 4ORLA 3T0UA 3V98A 2W2CA 2R4IA 3EBYA 3V92A 1RJOA 1G96A 3AMOA 1ASKA 1O7PB 5JPUA 1TFOA 4HM0B 3SOYA 4WP5A 2GU3A 3S67A 4IPBA 1L5GB 1TP6A 3B7CA 1S723 1SIHA 1AVLA 5AIHA 3GZRA 3BNDA 5KP1A 1U8CB 3MG1A 4R4KA 3OXAA 3ER7A 1STDA 3PCRA 5IG3A 3GWRA 1TU5A 3GZXB 3LTCA 4LEHA 4OVMA 1NB3I 1OGXA 4R80A 2HMKB 1DYUA 2CC3A 3CC43 3K63A 1US1A 4EV2A 4U13A 1VQL3 3LXUX 3CPW2 2OTJ3 3E99A 1KD14 2I9WA 4L8OA 1A90A 4XBTA 1IU7A 2KXGA 1GY7A 3FG1A 3NX0A 4LMIA 3EF8A 2XRXB 3G0KA 3UB1A 1QVG2 3FG4A 1K734 1JN5A 4G1MB 4NHFA 3LMLA 3NM7A 3O8YA 3SLUA 1VQ83 3KN4A 4K1VA 2BMQB 4AKYA 2XR8B 2Z77A 3LT8A 3NBRA 1YIT3 4O8SA 1W6CA 2XGNA 5AIGA 1GY6A 2IA7A 2P0MA 3CCR3 1GYBA 1IVXA 4K1UA 3HZPA 3F40A 3JVCA 4FMAA 2Y74A 1RKYA 2OQEA 3CCU3 1W00A 3KSPA 3KE7A 3ECFA 5IF6A 2JQ5A 4N6TA 3CPOA 1FGOA 1GD3A 3B8LA 4HM4B 3FGYA 2RGQA 5AEWB 1O7NB 3M8CA 4HM6B 5CF2A 3LOYA 5CF1A 3S5CA 3Q90A 2HMMB 5IEOA 1K8A4 1T5YA 1W5ZA 2WOHA 4BTYA 3IJEB 2XSHB 1SIIA 3CCE3 1DMMA 3NBJA 3DGNA 4FCJA 3QRDA 4HJLB 3SXXA 1YVBI 4N6MA 3B4PA 1OPYA 1SJWA 3X3ZA 3CCQ3 1Q40A 3IMAB 2BMOB 3MKIA 4N6NB 4HM2B 5DRVA 1AR0A 2CFDA 1IVVA 4R1KA 3WOEB 3CMA3 3WDGB 2GBWB 3RGRA 1VQ43 2ML5A 4LGQA 4HKVB 3I563 1RRLA 1M904 2IMJA 2PZVA 2W9QA 3N54B 3CXC2 1M9GA 1JV2B 3MG3A 3ROBA 1Q824 1A67A 2P09A 2C11A 3F14A 4X2OA 3B4OA 2F86B 3F7SA 1JKGA 3A76A 3G8ZA 1IT8A 1E3VA 2UX0A 3V99A 2B24B 3NHXA 2RFRA 4O02B 5CLKA 1R4CA 5KP3A 3K9MC 2C10A 1FGQA 3Q2PA 3PCSA 3KFQC 3FF0A 4R9LA 4CCVA 3MPHA 4WFOA 3G6E3 1U5OA 1M1K4 2W9PA 3PYJA 2OOVA 5IENA 1GD4A 3T8UA 3DGLA 1IDPA 1TIJA 1WMNA 2QA43 1N5HA 2HMLB 2STDA 1KC84 1DVCA 1O7WB 3F8HA 1YGEA 1EG9B 2SBLA 1N9JA 2OTL3 2D1WA 2YX9A 4HVNA 4RBNA 1JN5B 1VZZA 1CQSA 2GEYA 3GZYB 4HBRA 3EHCA 4BTXA 1SPUA 3DGOA 1W02A 3FF2A 3T8NA 2K0MA 4STDA 3NBBA 3LT9A 3ALAA 2P0XA 3CCS3 3HI7A 3JUOA 3WMDA 3LZAA 4WYKB 7STDA 2FXTA 2GEXA 2LQVA 3CNXA 2RCDA 2XF3A 1QMAA 4MMYB 1IVWA 1RRHA 3GRDA 3QK9A 3CU3A 3WA2X 4K61A 2W04A 3KIIA 4J8TA 3WOFB 1VQ93 5IG0A 4HZ9B 1VQN3 2CFGA 3D3LA 3DZLA 1IVUA 2OOVC 5STDA 2IUJA 3GZBA 2P38A 1VQO3 1FGTA 1ZO2A 1JB4A 3X40A 3X42A 4R9KA 1FGRA 1OACA 5TGNA 4BTWA 1O7HB 4IIAA 2YFJB 1C7HA 3UJMA 1NWWA 1D6UA 1NJI4 3DGMA 1LVNA 2CHCA 2CFWA 2M7OA 3JUNA 4FMCA 1K9M4 1E3RA 2D42A 3CME3 1Q7Y4 2CIUA 1QVF2 3DXOA 1W6GA 1HKXA 3H3HA 3PGBA 5FGOA 5HGRA 1Y4KA 4J9AA 5IG5A 1TUHA 2CH9A 2E2VA 1JNQA 1Q864 5BVBA 3UL6A 1Q814 4QWTA 2A15A 3NUVA 4JRFA 4N3VA 3OW22 2LYXA 3JUPA 3LYGA 2O3OA 2WGQA 3I0YA 1E97A 4XDVA 4CDLA 4EXRA 1WQLB 3JUMA 2ZL8A 3MHEA 5JBSA 4PEJA 2B1XB 2BNGA 3F9SA 1JRQA 4N6V0 3S28A 1CYVA 4O3VA 3CCJ3 1K28A 2KRTA 3LTBA 3NXJA 3OWYA 3CCM3 1JB2A 1S5AA 2FNQA 1IQXA 4MEIA 3X3XA 3G4S3 2IUKA 2XEPA 1KWIA 2FGTA 1VQK3 3LTDA 4X2HA 1QAFA 5BXQA 4N6LA 2W56A 3BLZA 5JPPA 3CNMA 3HIIA 4N6UA 4OUQA 2W03A 1A2KA 1TFKA 3OV4A 1CYUA 3Q1CA 4RNZA 4XBYA 1YJ93 8CHOA 1Z1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GB5 A;  4LMI A;  3EF8 A;  2XRX B;  3G0K A;  1W6Y A;  5DRE A;  2HML B;  2STD A;  3KZT A;  1JN5 A;  1O7W B;  3F8H A;  1EG9 B;  4XBX A;  5IER A;  3D9R A;  3FKA A;  3OWS A;  4HVN A;  3STD A;  1JN5 B;  3VGN A;  1VZZ A;  1CQS A;  1JKG B;  2GEY A;  3GZY B;  3G16 A;  4HZB B;  1OGZ A;  2BMQ B;  2XR8 B;  3EHC A;  4K1V A;  4RZM A;  5CF1 A;  1W02 A;  3FF2 A;  2Z77 A;  3NBR A;  3NV0 B;  3T8N A;  3VSY A;  4STD A;  1ISK A;  4XM4 A;  5AIG A;  1GY6 A;  3EC9 A;  4HM3 B;  1GYB A;  4K1U A;  5D83 A;  2HMJ B;  3JUO A;  3WMD A;  3HZP A;  3LZA A;  4FCM A;  4WYK B;  1O7G B;  1K41 A;  2Z76 A;  5G2G A;  1OH0 A;  3F40 A;  3SED A;  2GEX A;  7STD A;  2RCD A;  1OUN A;  3CNX A;  1UUV B;  2GBX B;  4X2O A;  1QMA A;  3H51 A;  3EQQ B;  1DMQ A;  3F7X A;  4WYK A;  3S5C A;  3GRD A;  4L7K A;  1W00 A;  3CU3 A;  3KSP A;  3KE7 A;  1OHS A;  3ECF A;  5IF6 A;  2HMO B;  2JQ5 A;  3DUK A;  4J8T A;  3CPO A;  4HZ9 B;  5IG0 A;  5IG3 A;  3DZL A;  3FLJ A;  5CF2 A;  4HM7 B;  5STD A;  3GZB A;  3B8L A;  4HM4 B;  1ZO2 A;  3FGY A;  1JB4 A;  2K54 A;  2RGQ A;  2YFL B;  3MG2 A;  3BB9 A;  4R9K A;  2INX A;  2YFI B;  4XB5 A;  5TGN A;  5AEW B;  1OCV A;  1O7H B;  1O7N B;  1OHO A;  3EN8 A;  3M8C A;  4HM6 B;  4IIA A;  1OHP A;  1EA2 A;  2YFJ B;  2XSO B;  1ULJ B;  2HMM B;  3Q90 A;  1C7H A;  5IEO A;  3UJM A;  5AII A;  1W01 A;  5FW5 A;  1NWW A;  2XSH B;  3MYT A;  3UNL A;  5AEU B;  5IG4 A;  1DMM A;  3NV0 A;  4FCJ A;  1Q40 B;  4MJD A;  5AI1 A;  4HJL B;  4HM8 B;  2CHC A;  3JUN A;  5D81 A;  5IG5 A;  3HX8 A;  3K0Z A;  1E3R A;  3DM8 A;  1QJG A;  2HMN B;  3B4P A;  3F8X A;  1OPY A;  1SJW A;  3DXO A;  5D82 A;  1HKX A;  1O7M B;  2OWP A;  1OF5 B;  3H3H A;  3K7C A;  3OX9 A;  1Q40 A;  4H3U A;  4J9A A;  4WWU C;  5HGR A;  2F98 A;  1NU3 A;  1TUH A;  4HM5 B;  2BMO B;  3MKI A;  4Q53 A;  4HM2 B;  5EVH A;  2QIY A;  5DRV A;  5IEP A;  5JPU A;  1ULI B;  5BVB A;  1AR0 A;  1GS3 A;  3EX9 A;  4ORL A;  2A15 A;  3NUV A;  1UUW B;  3IPT A;  4N3V A;  5CK6 A;  4CDL A;  3NM2 A;  1ZX2 A;  2W2C A;  3JUP A;  3LYG A;  4R1K A;  2R4I A;  4I4K A;  1DMN A;  3EBY A;  3I0Y A;  2F99 A;  4KVH A;  2GBW B;  3RGR A;  3JUQ A;  6STD A;  1E97 A;  4XDV A;  1ASK A;  1O7P B;  3EN1 B;  4HKV B;  1WQL B;  4HM0 B;  3JUM A;  1GY5 A;  3HK4 A;  3MHE A;  4LGQ A;  5AIF A;  2IMJ A;  4WP5 A;  4PEJ A;  3SOY A;  2PZV A;  2B1X B;  3DMC A;  3MG3 A;  1TP6 A;  2BNG A;  3B7C A;  3ROB A;  3F9S A;  5AIH A;  3GZR A;  3F14 A;  3FSD A;  3FH1 A;  3OWU A;  5KP1 A;  3MG1 A;  3FZW A;  3NXJ A;  3ER7 A;  1STD A;  2F86 B;  2GXF A;  3B4O A;  3GWR A;  3OXA A;  3OWY A;  2BMR B;  1JB2 A;  1JKG A;  1S5A A;  3A76 A;  2QGU A;  2CKF B;  3F7S A;  3G8Z A;  3GZX B;  3EBT A;  1E3V A;  4L8P A;  4LEH A;  4OVM A;  1OGX A;  2UX0 A;  2HMK B;  2B24 B;  1OF5 A;  3NHX A;  1NDO B;  2RFR A;  4X2H A;  5CLK A;  4U13 A;  5BXQ A;  5KP3 A;  3MSO A;  3EJV A;  1BUQ A;  4XDW A;  3KKG A;  5KP4 A;  1Q42 A;  3BLZ A;  3E99 A;  2I9W A;  3CNM A;  4L8O A;  5JPP A;  3FF0 A;  4R9L A;  4OUQ A;  4XBT A;  3SOA A;  1A2K A;  3OV4 A;  1U5O A;  2Z7A A;  5CXO A;  3RGA A;  1GY7 A;  4XBY A;  8CHO A;  5IEN A;  1JB5 A;  1Z1S A;  4HM1 B;  3T8U A;  1IDP A; 
#chains in the Genus database with same CATH topology
 4GB5 A;  1V74 A;  7GSP A;  1A2V A;  5DRE A;  3KZT A;  4OK0 A;  1GMQ A;  5AYS C;  2F56 A;  1MGW A;  2CG0 A;  2OQE C;  2CFK A;  2XH9 A;  2Q07 A;  3NQY A;  1RCK A;  2QEX 3;  1MWU A;  2O9U X;  3OWS A;  1D6Y A;  3VGN A;  4EYC A;  4LYL B;  1BSB A;  3RDE A;  3NQZ A;  3S29 A;  1IT7 A;  3G16 A;  1YJN 3;  1OGZ A;  1LOY A;  2CWT A;  1PFP A;  3WOD G;  2CX0 A;  2CWU A;  4EV5 A;  1RGL A;  1X1W A;  2PNC A;  3VSY A;  4XM4 A;  4EBG A;  1I3F A;  3EC9 A;  2KAA A;  4HM3 B;  5A0O B;  1B21 A;  1RN7 A;  3LH4 A;  3ZG5 A;  2BIR A;  1SQW A;  2H0H A;  4O2H A;  2P05 A;  3PZW A;  1RDS A;  3EE1 A;  1O7G B;  1IV9 A;  1K41 A;  1QAK A;  1OH0 A;  2F5M A;  2Z76 A;  5G2G A;  1IK3 A;  1VQP 3;  3I55 3;  2GBX B;  1X1Y A;  2CK3 H;  3H51 A;  1VQM 3;  1VQ6 3;  1DMQ A;  1I0X A;  5IW9 A;  5AYR B;  4L7K A;  4FMD A;  1FGM A;  2ZA4 A;  3KSE D;  3SX1 A;  3N8B A;  1W2Z A;  5LC6 A;  2IY2 A;  3HOH A;  2GU1 A;  1RGK A;  3U1W A;  4I5Q A;  2V1L A;  3BNE A;  3A5E A;  2K54 A;  3BB9 A;  4H61 A;  1LNH A;  1OCV A;  1N9E A;  1AV4 A;  2XFT A;  3EN8 A;  4RNY A;  5I97 A;  1EA2 A;  4LZI A;  2XSO B;  1ULJ B;  4KFD A;  2WOF A;  1HYF A;  5AII A;  1YJW 3;  3UNL A;  5AEU B;  1D6Z A;  1UGH I;  1PY3 A;  4BU4 A;  1Q40 B;  1NO3 A;  1MOL A;  3HX8 A;  2BT3 A;  3K0Z A;  1LOW A;  1QJG A;  2HMN B;  3DM8 A;  2MC8 A;  1R4Y A;  2RSX A;  3K7C A;  1HU9 A;  2C4B A;  1FUS A;  2KF5 A;  3OX9 A;  4KFF A;  1NB5 I;  1NU3 A;  2UGI A;  4HM5 B;  5EVH A;  1WNH A;  1CEW I;  1KSI A;  1M1X B;  1ULI B;  2ZDJ A;  2CW9 A;  3S27 A;  1GS3 A;  5CK6 A;  1UUW B;  3IPT A;  4J5K A;  3CC2 3;  1MGR A;  3NM2 A;  1ZX2 A;  1WMO A;  3J7Y d;  1B2M A;  1RGH A;  2KCD A;  4I4K A;  1DMN A;  5M19 A;  2F99 A;  3MWZ A;  4KVH A;  3JUQ A;  6STD A;  4WWU C;  3EN1 B;  3EB8 A;  5AIF A;  2KF6 A;  1GY5 A;  3HK4 A;  2E2T A;  5ELJ A;  1UGI A;  4KZ1 A;  4BL2 A;  3DMC A;  5HOH A;  3AMO B;  2F5W A;  4MMX B;  4BL3 A;  2L4V A;  3FSD A;  3FH1 A;  3OWU A;  2AAE A;  4EC6 A;  1VQ5 3;  1BIR A;  3FZW A;  4GSP A;  2GXF A;  6RNT A;  3PS8 A;  1BRH A;  1N8R 4;  2BMR B;  2XFS A;  4L8P A;  3SYU A;  2QGU A;  2CKF B;  3EBT A;  4NRE A;  1FUW A;  1RGC A;  2F4Y A;  4AEQ A;  1BNI A;  1KQS 2;  3VF1 A;  1OF5 A;  1NDO B;  2XGL A;  1N5P A;  1UI8 A;  4IT7 A;  1IYY A;  4GL6 A;  2E2U A;  3MSO A;  1UW1 A;  3EJV A;  1MNL A;  1BUQ A;  4XDW A;  1GOY A;  3KKG A;  1Q42 A;  4J5G A;  4AKZ A;  3GAX A;  1I3I A;  1RCL A;  3L0R A;  2RNT A;  4K90 B;  5G1K A;  3SOA A;  3WA3 A;  1LOX A;  2Z7A A;  3K5T A;  5CXO A;  3RGA A;  2W6J H;  3PXM A;  1JB5 A;  4HM1 B;  4FMB A;  1FA3 A;  1BRG A;  2ML6 A;  4N6O B;  1W6Y A;  1N8Q A;  1RN1 A;  3URP A;  1F8N A;  1LXE A;  5GSP A;  1W2B 2;  4JF8 A;  5LC7 A;  4MMZ B;  4XBX A;  5IER A;  1YI2 3;  1YIJ 3;  3BNC A;  4FR9 A;  3D9R A;  3FKA A;  3STD A;  1QAL A;  1AVK A;  1RN4 A;  1UI7 A;  4KFE A;  4TX4 A;  3UL5 A;  4ZM8 A;  1JKG B;  2CWV A;  3SED A;  4HZB B;  1VQ7 3;  1STF I;  2CFL A;  4RZM A;  4FCZ A;  3NV0 B;  1BSC A;  3X3Y A;  1IQ8 A;  1ISK A;  1WTH A;  3SVA A;  1LQM B;  1X1U A;  1WMP A;  2W0Q A;  2HMJ B;  2ZHX B;  5D83 A;  1RGF A;  4FCM A;  3X41 A;  1RSN A;  4HYZ A;  1OUN A;  1UUV B;  2WGO A;  3CC7 3;  1ROV A;  3BU4 A;  1IV7 A;  3EQQ B;  3DY5 A;  3GSP A;  3FCS B;  3F7X A;  3CCV 3;  4WYK A;  1DVD A;  3G71 3;  1OHS A;  3BNB A;  1BRJ A;  2HMO B;  3DUK A;  3D5G A;  2BHM A;  2JDI H;  3LTA A;  4HAA A;  3FLJ A;  3U97 A;  2Z6B A;  1GMP A;  4HM7 B;  3CD6 3;  3TDG A;  1I0V A;  2YFL B;  3MG2 A;  4XB5 A;  2INX A;  2YFI B;  4WHA A;  1W4N A;  2MF7 A;  3FG3 A;  1JJ2 2;  1OHO A;  1YHQ 3;  1OHP A;  5KP4 A;  1RHL A;  2WO0 A;  2CG1 A;  1W01 A;  2BO9 B;  2UUG C;  5FW5 A;  3MYT A;  1Q7H A;  5EEO A;  2Y73 A;  1GOV A;  5IG4 A;  5M18 A;  3NV0 A;  1J2B A;  3N9H A;  4MJD A;  5AI1 A;  1EKM A;  4HM8 B;  5D81 A;  4DKI A;  2OCT A;  3F8X A;  3HIG A;  5EQL A;  3CCL 3;  5D82 A;  1O7M B;  2OWP A;  1EQK A;  1OF5 B;  2AAD A;  4H3U A;  1W7C A;  2F98 A;  1ROA A;  5IEP A;  4LSO A;  4Q53 A;  1IQY A;  2QIY A;  1G02 A;  2W56 B;  1RLS A;  5ELU A;  1Q9E A;  4CPK A;  3BIR A;  1PU4 A;  3EX9 A;  4ORL A;  3T0U A;  3V98 A;  2W2C A;  1GSP A;  2R4I A;  1ZS7 A;  3EBY A;  3V92 A;  1RJO A;  1G96 A;  2SAR A;  1I2E A;  5BIR A;  3AMO A;  1ASK A;  1O7P B;  5JPU A;  1TFO A;  4HM0 B;  3SOY A;  4WP5 A;  1EEJ A;  2GU3 A;  3S67 A;  4IPB A;  1L5G B;  1TP6 A;  3B7C A;  1S72 3;  1SIH A;  1AVL A;  5AIH A;  3GZR A;  3BND A;  5KP1 A;  1U8C B;  3MG1 A;  4R4K A;  3OXA A;  1YGW A;  1STD A;  3ER7 A;  3PCR A;  1LNI A;  3GWR A;  5IG3 A;  1TU5 A;  3GZX B;  3D79 A;  3LTC A;  4LEH A;  4OVM A;  1NB3 I;  2H0G A;  3D4A A;  1OGX A;  4R80 A;  1AQZ A;  1BNE A;  2HMK B;  1DYU A;  2CC3 A;  1I2G A;  3CC4 3;  1NNV A;  3K63 A;  1US1 A;  4EV2 A;  4U13 A;  5G1L A;  4ILF A;  1VQL 3;  2K3D A;  1YVS A;  3LXU X;  3CPW 2;  3D5I A;  2OTJ 3;  3E99 A;  1KD1 4;  2I9W A;  4L8O A;  1A90 A;  2RBI A;  1BRK A;  4XBT A;  1IU7 A;  2KXG A;  1BRS A;  1GY7 A;  1T3B A;  3FG1 A;  2KF3 A;  3NX0 A;  1MWT A;  4LMI A;  3EF8 A;  2XRX B;  3G0K A;  3UB1 A;  1QVG 2;  3FG4 A;  1K73 4;  1JN5 A;  1BAO A;  1FW7 A;  4G1M B;  1BNF A;  4NHF A;  1X1X A;  3LML A;  3NM7 A;  3O8Y A;  3SLU A;  1VQ8 3;  3KN4 A;  4K1V A;  2BMQ B;  4AKY A;  2XR8 B;  2R41 A;  3RNT A;  2Z77 A;  3LT8 A;  3NBR A;  1YIT 3;  4O8S A;  1W6C A;  1TRP A;  2XGN A;  5AIG A;  1GY6 A;  2IA7 A;  1VQQ A;  2P0M A;  3CCR 3;  1LRA A;  1GYB A;  1IVX A;  1JBS A;  4K1U A;  3HZP A;  3ZFZ A;  3F40 A;  3JVC A;  1B2X A;  4FMA A;  1UCK A;  2Y74 A;  1RKY A;  2OQE A;  3CCU 3;  1BU4 A;  1W00 A;  3KSP A;  3KE7 A;  3ECF A;  1DET A;  3AHW A;  5IF6 A;  2JQ5 A;  1JBR A;  4N6T A;  3CPO A;  1FGO A;  1GD3 A;  4RNT A;  1RGA A;  1B20 A;  3B8L A;  3FGY A;  2RGQ A;  4HM4 B;  1BSA A;  5AEW B;  1DE3 A;  1BAN A;  1O7N B;  3M8C A;  4HM6 B;  3LOY A;  5CF2 A;  3S5C A;  1FUT A;  3Q90 A;  1LQG C;  5CF1 A;  2HMM B;  1T2H A;  5IEO A;  1K8A 4;  1T5Y A;  1W5Z A;  1GOU A;  2WOH A;  3DH2 A;  4BTY A;  3IJE B;  2XSH B;  1SII A;  3CCE 3;  1DMM A;  3NBJ A;  3DGN A;  4FCJ A;  3QRD A;  4HJL B;  3SXX A;  1YVB I;  4N6M A;  3B4P A;  1RNT A;  1OPY A;  1SJW A;  1BRN L;  4GHO A;  1YNV X;  3X3Z A;  3CCQ 3;  1Q40 A;  1BVI A;  3IMA B;  2BMO B;  1BGS A;  3MKI A;  4HM2 B;  4N6N B;  5DRV A;  1AR0 A;  2CFD A;  1IVV A;  4R1K A;  3WOE B;  3CMA 3;  3WDG B;  2GBW B;  3RGR A;  3AGO A;  1VQ4 3;  2ML5 A;  4LGQ A;  4HKV B;  3I56 3;  1RRL A;  1M90 4;  2IMJ A;  1BNG A;  2BU4 A;  2PZV A;  2W9Q A;  3N54 B;  3CXC 2;  1JV2 B;  1M9G A;  3MG3 A;  3ROB A;  3ZG0 A;  1Q82 4;  1A67 A;  1TTO A;  2P09 A;  2C11 A;  3F14 A;  4X2O A;  3B4O A;  2F86 B;  1CH0 A;  1BNR A;  3F7S A;  1JKG A;  1I8V A;  3A76 A;  1IT8 A;  3G8Z A;  2H0I A;  1I70 A;  2KF4 A;  1VQO 3;  1E3V A;  2UX0 A;  3V99 A;  2B24 B;  3NHX A;  1G0T A;  1UDI I;  2RFR A;  4O02 B;  5CLK A;  1R4C A;  5RNT A;  5KP3 A;  3K9M C;  2C10 A;  1JBT A;  1FGQ A;  2CX1 A;  3Q2P A;  1RMS A;  3PCS A;  3KFQ C;  3FF0 A;  4R9L A;  4CCV A;  3MPH A;  4WFO A;  3G6E 3;  1U5O A;  1M1K 4;  4HOH A;  1RNB A;  2W9P A;  3KCH A;  3PYJ A;  2OOV A;  1GD4 A;  8RNT A;  3T8U A;  1IDP A;  3DGL A;  5IEN A;  3Q3F A;  1TIJ A;  1V57 A;  1WMN A;  4NPB A;  1I2F A;  1N5H A;  2QA4 3;  2HML B;  2STD A;  1JZO A;  1KC8 4;  1DVC A;  1O7W B;  3F8H A;  1YGE A;  3WR2 A;  1EG9 B;  2SBL A;  1N9J A;  2OTL 3;  2D1W A;  5M1A A;  1B27 A;  2YX9 A;  4HVN A;  4RBN A;  1B2Z A;  1JN5 B;  1VZZ A;  1CQS A;  2GEY A;  3GZY B;  4HBR A;  3EHC A;  4BTX A;  4EW5 A;  1SPU A;  3DGO A;  1W02 A;  3FF2 A;  3T8N A;  2K0M A;  1C54 A;  1A2P A;  1MWS A;  4STD A;  3NBB A;  1AY7 A;  3LT9 A;  3ALA A;  2IYJ A;  2P0X A;  3CCS 3;  1FYS A;  3HI7 A;  3JUO A;  3WMD A;  3LZA A;  1UCL A;  1V58 A;  4WYK B;  4CJN A;  7STD A;  1BRI A;  1GMR A;  2FXT A;  2GEX A;  4KT3 B;  2LQV A;  2RCD A;  2XF3 A;  3CNX A;  5BU4 A;  1QMA A;  3AGN A;  4MMY B;  1IVW A;  1RRH A;  3GRD A;  3QK9 A;  3CU3 A;  1RGE A;  4K61 A;  2W04 A;  3KII A;  4J8T A;  3WA2 X;  1RGG A;  5IG0 A;  4HZ9 B;  3WOF B;  1VQ9 3;  2CFG A;  1VQN 3;  3D3L A;  3DZL A;  1IVU A;  1HZ1 A;  2OOV C;  3AHS A;  5STD A;  1JZD A;  2P38 A;  3GZB A;  1FGT A;  1UUG B;  1JB4 A;  1ZO2 A;  2IUJ A;  3X40 A;  3X42 A;  4R9K A;  1FGR A;  1OAC A;  5TGN A;  4BTW A;  1O7H B;  4IIA A;  2GSP A;  2YFJ B;  1C7H A;  3UJM A;  1NWW A;  1MWR A;  2J8X B;  1D6U A;  1NJI 4;  3DGM A;  1LVN A;  2CHC A;  2CFW A;  2M7O A;  3JUN A;  4FMC A;  4BIR A;  1E3R A;  1K9M 4;  2D42 A;  3CME 3;  1Q7Y 4;  2CIU A;  6GSP A;  3DXO A;  1BSD A;  1QVF 2;  1W6G A;  1HKX A;  3H3H A;  3PGB A;  5FGO A;  1BNS A;  5HGR A;  1Y4K A;  4J9A A;  7RNT A;  5IG5 A;  1TUH A;  2CH9 A;  2E2V A;  1JNQ A;  1UCI A;  1Q86 4;  5BVB A;  3UL6 A;  1Q81 4;  4QWT A;  2A15 A;  3NUV A;  1EUI C;  4JRF A;  4N3V A;  3OW2 2;  1TJD A;  2LYX A;  3JUP A;  3LYG A;  2O3O A;  2WGQ A;  3I0Y A;  1E97 A;  4XDV A;  4CDL A;  4EXR A;  1WQL B;  3JUM A;  2ZL8 A;  3MHE A;  2L1S A;  5JBS A;  4PEJ A;  2B1X B;  2BNG A;  3F9S A;  1JRQ A;  4N6V 0;  3S28 A;  1CYV A;  4O3V A;  3CCJ 3;  1K28 A;  2KRT A;  3LTB A;  3NXJ A;  1B3S A;  2HOH A;  3DGY A;  3OWY A;  3CCM 3;  1JB2 A;  1S5A A;  2FNQ A;  1IQX A;  9RNT A;  3WHO A;  1B2U A;  4MEI A;  3X3X A;  3G4S 3;  2IUK A;  2XEP A;  1KWI A;  2FGT A;  1VQK 3;  3LTD A;  4X2H A;  1QAF A;  5BXQ A;  1BUJ A;  4N6L A;  1BOX A;  2W56 A;  1LOV A;  3BLZ A;  5JPP A;  1BSE A;  1ZGX A;  1FZU A;  1PYL A;  1UCJ A;  3CNM A;  3HII A;  4N6U A;  1T2I A;  4OUQ A;  2W03 A;  1RTU A;  1A2K A;  1TFK A;  3OV4 A;  1CYU A;  3Q1C A;  1B2S A;  1BNJ A;  4RNZ A;  4XBY A;  8CHO A;  1YJ9 3;  1TRQ A;  1Z1S A;  1SAR A; 
#chains in the Genus database with same CATH homology
 4GB5 A;  1V74 A;  1A2V A;  5DRE A;  3KZT A;  4OK0 A;  5AYS C;  2CG0 A;  2OQE C;  2CFK A;  2XH9 A;  2Q07 A;  3NQY A;  2QEX 3;  2O9U X;  3OWS A;  1D6Y A;  3VGN A;  4EYC A;  3RDE A;  1YJN 3;  3NQZ A;  3S29 A;  1IT7 A;  3G16 A;  1OGZ A;  2CWT A;  1PFP A;  3WOD G;  2CWU A;  4EV5 A;  2PNC A;  3VSY A;  4XM4 A;  4EBG A;  3EC9 A;  4HM3 B;  5A0O B;  1RN7 A;  3LH4 A;  1SQW A;  4O2H A;  2P05 A;  3PZW A;  3EE1 A;  1O7G B;  1K41 A;  1IV9 A;  1QAK A;  1OH0 A;  2Z76 A;  5G2G A;  1IK3 A;  1VQP 3;  3I55 3;  2GBX B;  2CK3 H;  3H51 A;  1VQM 3;  1VQ6 3;  1DMQ A;  5IW9 A;  5AYR B;  4L7K A;  4FMD A;  1FGM A;  3KSE D;  3SX1 A;  3N8B A;  1W2Z A;  5LC6 A;  2GU1 A;  3U1W A;  2V1L A;  3BNE A;  2K54 A;  3BB9 A;  4H61 A;  1LNH A;  1OCV A;  1N9E A;  1AV4 A;  2XFT A;  3EN8 A;  4RNY A;  5I97 A;  1EA2 A;  4LZI A;  2XSO B;  1ULJ B;  4KFD A;  2WOF A;  1YJW 3;  5AII A;  3UNL A;  5AEU B;  1D6Z A;  1Q40 B;  1NO3 A;  1MOL A;  3HX8 A;  2BT3 A;  3K0Z A;  3DM8 A;  1QJG A;  2HMN B;  2MC8 A;  2RSX A;  3OX9 A;  3K7C A;  1HU9 A;  1NB5 I;  4KFF A;  1NU3 A;  4HM5 B;  5EVH A;  1WNH A;  1CEW I;  1KSI A;  1M1X B;  1ULI B;  2ZDJ A;  2CW9 A;  3S27 A;  1GS3 A;  5CK6 A;  1UUW B;  3IPT A;  3CC2 3;  3NM2 A;  1ZX2 A;  1WMO A;  3J7Y d;  2KCD A;  4I4K A;  1DMN A;  2F99 A;  3MWZ A;  4KVH A;  3JUQ A;  6STD A;  4WWU C;  3EN1 B;  3EB8 A;  5AIF A;  1GY5 A;  3HK4 A;  2E2T A;  5ELJ A;  4KZ1 A;  3DMC A;  3AMO B;  4MMX B;  2L4V A;  3FSD A;  3FH1 A;  3OWU A;  4EC6 A;  1VQ5 3;  3FZW A;  2GXF A;  3PS8 A;  1N8R 4;  2BMR B;  2XFS A;  4L8P A;  2QGU A;  2CKF B;  3EBT A;  4NRE A;  1FUW A;  4AEQ A;  1KQS 2;  3VF1 A;  1OF5 A;  1NDO B;  2XGL A;  1N5P A;  1UI8 A;  4IT7 A;  4GL6 A;  2E2U A;  3MSO A;  1UW1 A;  3EJV A;  1MNL A;  1BUQ A;  4XDW A;  3KKG A;  1Q42 A;  4AKZ A;  3GAX A;  3L0R A;  4K90 B;  3SOA A;  3WA3 A;  1LOX A;  2Z7A A;  3K5T A;  5CXO A;  3RGA A;  2W6J H;  3PXM A;  1JB5 A;  4HM1 B;  4FMB A;  1FA3 A;  2ML6 A;  4N6O B;  1W6Y A;  1N8Q A;  1F8N A;  1LXE A;  1W2B 2;  4JF8 A;  5LC7 A;  4MMZ B;  4XBX A;  5IER A;  1YI2 3;  1YIJ 3;  3BNC A;  4FR9 A;  3D9R A;  3FKA A;  3STD A;  1QAL A;  1AVK A;  4KFE A;  1UI7 A;  4TX4 A;  3UL5 A;  4ZM8 A;  1VQ7 3;  1JKG B;  2CWV A;  3SED A;  4HZB B;  1STF I;  2CFL A;  4RZM A;  4FCZ A;  3NV0 B;  3X3Y A;  1IQ8 A;  1ISK A;  1WTH A;  3SVA A;  1WMP A;  2W0Q A;  2HMJ B;  5D83 A;  3X41 A;  4FCM A;  4HYZ A;  1OUN A;  1UUV B;  2WGO A;  3CC7 3;  1ROV A;  1IV7 A;  3EQQ B;  3DY5 A;  3CCV 3;  3FCS B;  3F7X A;  4WYK A;  1DVD A;  3G71 3;  1OHS A;  3BNB A;  2HMO B;  3DUK A;  2BHM A;  2JDI H;  3LTA A;  3FLJ A;  3U97 A;  2Z6B A;  4HM7 B;  3CD6 3;  3TDG A;  2YFL B;  3MG2 A;  4XB5 A;  2INX A;  2YFI B;  4WHA A;  1W4N A;  2MF7 A;  3FG3 A;  1JJ2 2;  1OHO A;  1YHQ 3;  1OHP A;  5KP4 A;  2WO0 A;  2CG1 A;  1W01 A;  2BO9 B;  5FW5 A;  3MYT A;  5EEO A;  2Y73 A;  5IG4 A;  3NV0 A;  1J2B A;  3N9H A;  4MJD A;  5AI1 A;  1EKM A;  4HM8 B;  5D81 A;  2OCT A;  3F8X A;  3HIG A;  5EQL A;  3CCL 3;  5D82 A;  1O7M B;  2OWP A;  1EQK A;  1OF5 B;  4H3U A;  1W7C A;  2F98 A;  1ROA A;  5IEP A;  4LSO A;  4Q53 A;  1IQY A;  2QIY A;  2W56 B;  5ELU A;  1PU4 A;  3EX9 A;  4ORL A;  3T0U A;  3V98 A;  2W2C A;  2R4I A;  3EBY A;  3V92 A;  1RJO A;  1G96 A;  3AMO A;  1ASK A;  1O7P B;  5JPU A;  1TFO A;  4HM0 B;  3SOY A;  4WP5 A;  2GU3 A;  3S67 A;  4IPB A;  1L5G B;  1TP6 A;  3B7C A;  1S72 3;  1SIH A;  1AVL A;  5AIH A;  3GZR A;  3BND A;  5KP1 A;  1U8C B;  3MG1 A;  4R4K A;  3OXA A;  3ER7 A;  1STD A;  3PCR A;  5IG3 A;  3GWR A;  1TU5 A;  3GZX B;  3LTC A;  4LEH A;  4OVM A;  1NB3 I;  1OGX A;  4R80 A;  2HMK B;  1DYU A;  2CC3 A;  3CC4 3;  3K63 A;  1US1 A;  4EV2 A;  4U13 A;  1VQL 3;  3LXU X;  3CPW 2;  2OTJ 3;  3E99 A;  1KD1 4;  2I9W A;  4L8O A;  1A90 A;  4XBT A;  1IU7 A;  2KXG A;  1GY7 A;  3FG1 A;  3NX0 A;  4LMI A;  3EF8 A;  2XRX B;  3G0K A;  3UB1 A;  1QVG 2;  3FG4 A;  1K73 4;  1JN5 A;  4G1M B;  4NHF A;  3LML A;  3NM7 A;  3O8Y A;  3SLU A;  1VQ8 3;  3KN4 A;  4K1V A;  2BMQ B;  4AKY A;  2XR8 B;  2Z77 A;  3LT8 A;  3NBR A;  1YIT 3;  4O8S A;  1W6C A;  2XGN A;  5AIG A;  1GY6 A;  2IA7 A;  2P0M A;  3CCR 3;  1GYB A;  1IVX A;  4K1U A;  3HZP A;  3F40 A;  3JVC A;  4FMA A;  2Y74 A;  1RKY A;  2OQE A;  3CCU 3;  1W00 A;  3KSP A;  3KE7 A;  3ECF A;  5IF6 A;  2JQ5 A;  4N6T A;  3CPO A;  1FGO A;  1GD3 A;  3B8L A;  4HM4 B;  3FGY A;  2RGQ A;  5AEW B;  1O7N B;  3M8C A;  4HM6 B;  5CF2 A;  3LOY A;  5CF1 A;  3S5C A;  3Q90 A;  2HMM B;  5IEO A;  1K8A 4;  1T5Y A;  1W5Z A;  2WOH A;  4BTY A;  3IJE B;  2XSH B;  1SII A;  3CCE 3;  1DMM A;  3NBJ A;  3DGN A;  4FCJ A;  3QRD A;  4HJL B;  3SXX A;  1YVB I;  4N6M A;  3B4P A;  1OPY A;  1SJW A;  3X3Z A;  3CCQ 3;  1Q40 A;  3IMA B;  2BMO B;  3MKI A;  4N6N B;  4HM2 B;  5DRV A;  1AR0 A;  2CFD A;  1IVV A;  4R1K A;  3WOE B;  3CMA 3;  3WDG B;  2GBW B;  3RGR A;  1VQ4 3;  2ML5 A;  4LGQ A;  4HKV B;  3I56 3;  1RRL A;  1M90 4;  2IMJ A;  2PZV A;  2W9Q A;  3N54 B;  3CXC 2;  1M9G A;  1JV2 B;  3MG3 A;  3ROB A;  1Q82 4;  1A67 A;  2P09 A;  2C11 A;  3F14 A;  4X2O A;  3B4O A;  2F86 B;  3F7S A;  1JKG A;  3A76 A;  3G8Z A;  1IT8 A;  1E3V A;  2UX0 A;  3V99 A;  2B24 B;  3NHX A;  2RFR A;  4O02 B;  5CLK A;  1R4C A;  5KP3 A;  3K9M C;  2C10 A;  1FGQ A;  3Q2P A;  3PCS A;  3KFQ C;  3FF0 A;  4R9L A;  4CCV A;  3MPH A;  4WFO A;  3G6E 3;  1U5O A;  1M1K 4;  2W9P A;  3PYJ A;  2OOV A;  5IEN A;  1GD4 A;  3T8U A;  3DGL A;  1IDP A;  1TIJ A;  1WMN A;  2QA4 3;  1N5H A;  2HML B;  2STD A;  1KC8 4;  1DVC A;  1O7W B;  3F8H A;  1YGE A;  1EG9 B;  2SBL A;  1N9J A;  2OTL 3;  2D1W A;  2YX9 A;  4HVN A;  4RBN A;  1JN5 B;  1VZZ A;  1CQS A;  2GEY A;  3GZY B;  4HBR A;  3EHC A;  4BTX A;  1SPU A;  3DGO A;  1W02 A;  3FF2 A;  3T8N A;  2K0M A;  4STD A;  3NBB A;  3LT9 A;  3ALA A;  2P0X A;  3CCS 3;  3HI7 A;  3JUO A;  3WMD A;  3LZA A;  4WYK B;  7STD A;  2FXT A;  2GEX A;  2LQV A;  3CNX A;  2RCD A;  2XF3 A;  1QMA A;  4MMY B;  1IVW A;  1RRH A;  3GRD A;  3QK9 A;  3CU3 A;  3WA2 X;  4K61 A;  2W04 A;  3KII A;  4J8T A;  3WOF B;  1VQ9 3;  5IG0 A;  4HZ9 B;  1VQN 3;  2CFG A;  3D3L A;  3DZL A;  1IVU A;  2OOV C;  5STD A;  2IUJ A;  3GZB A;  2P38 A;  1VQO 3;  1FGT A;  1ZO2 A;  1JB4 A;  3X40 A;  3X42 A;  4R9K A;  1FGR A;  1OAC A;  5TGN A;  4BTW A;  1O7H B;  4IIA A;  2YFJ B;  1C7H A;  3UJM A;  1NWW A;  1D6U A;  1NJI 4;  3DGM A;  1LVN A;  2CHC A;  2CFW A;  2M7O A;  3JUN A;  4FMC A;  1K9M 4;  1E3R A;  2D42 A;  3CME 3;  1Q7Y 4;  2CIU A;  1QVF 2;  3DXO A;  1W6G A;  1HKX A;  3H3H A;  3PGB A;  5FGO A;  5HGR A;  1Y4K A;  4J9A A;  5IG5 A;  1TUH A;  2CH9 A;  2E2V A;  1JNQ A;  1Q86 4;  5BVB A;  3UL6 A;  1Q81 4;  4QWT A;  2A15 A;  3NUV A;  4JRF A;  4N3V A;  3OW2 2;  2LYX A;  3JUP A;  3LYG A;  2O3O A;  2WGQ A;  3I0Y A;  1E97 A;  4XDV A;  4CDL A;  4EXR A;  1WQL B;  3JUM A;  2ZL8 A;  3MHE A;  5JBS A;  4PEJ A;  2B1X B;  2BNG A;  3F9S A;  1JRQ A;  4N6V 0;  3S28 A;  1CYV A;  4O3V A;  3CCJ 3;  1K28 A;  2KRT A;  3LTB A;  3NXJ A;  3OWY A;  3CCM 3;  1JB2 A;  1S5A A;  2FNQ A;  1IQX A;  4MEI A;  3X3X A;  3G4S 3;  2IUK A;  2XEP A;  1KWI A;  2FGT A;  1VQK 3;  3LTD A;  4X2H A;  1QAF A;  5BXQ A;  4N6L A;  2W56 A;  3BLZ A;  5JPP A;  3CNM A;  3HII A;  4N6U A;  4OUQ A;  2W03 A;  1A2K A;  1TFK A;  3OV4 A;  1CYU A;  3Q1C A;  4RNZ A;  4XBY A;  1YJ9 3;  8CHO A;  1Z1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...