3EE1A

Novel fold of vira, a type iii secretion system effector protein from shigella flexneri
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
399
structure length
341
Chain Sequence
EVASYCDRVVAAVEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFPVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQLNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPENNCGHIIKINAVVPGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Effector protein virA
publication title Novel fold of VirA, a type III secretion system effector protein from Shigella flexneri
pubmed doi rcsb
source organism Shigella flexneri
total genus 86
structure length 341
sequence length 399
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ee1A01
3EE1A 4FMDA 4FMCA 3Q1CA 4FMAA 3EB8A 3PCSA 4FMBA 3PCRA
chains in the Genus database with same CATH superfamily
1W01A 1WMNA 4WP5A 1PYLA 1UGIA 3ALAA 2BO9B 1A67A 4KT3B 1WTHA 3GSPA 7STDA 1JN5A 3K0ZA 3ROBA 1JNQA 1MGRA 3AHWA 3HX8A 1UCLA 1W7CA 3WODG 1CYUA 1BRSA 4XM4A 3SYUA 1A2KA 3OX9A 3B4PA 4H61A 2GU1A 1W4NA 3LTCA 1JRQA 2BHMA 4EYCA 1C7HA 1ZO2A 4XBTA 2MC8A 4GB5A 5AI1A 3QRDA 2JQ5A 3WOEB 5G2GA 3GZYB 1YIJ3 1TU5A 1Q9EA 3EB8A 1Q42A 4N6OB 4NPBA 2A15A 1B27A 2CIUA 3X42A 3K7CA 5IG3A 1BSEA 1RCKA 2RGQA 3EE1A 1OPYA 4RNYA 1BNRA 2E2TA 1UUGB 1W00A 4LSOA 3X40A 5M18A 5CF1A 1YJW3 3AGNA 1RGEA 3LT8A 1IQ8A 1BNGA 3JVCA 1BSBA 2F56A 1N8QA 1T2IA 4OK0A 3X3YA 1GS3A 2CH9A 7GSPA 1UUVB 3OWYA 1Q40B 2CFWA 4HM0B 2R4IA 7RNTA 1AQZA 1BNSA 4FMCA 1NB5I 4KVHA 1UGHI 3RGAA 1A2VA 1FGMA 1KSIA 4XDVA 1RN1A 2WO0A 1RDSA 1UI8A 1RRLA 3PCRA 3PXMA 4NREA 3FG1A 1K41A 1LQMB 1B2UA 1GY7A 2FGTA 4O2HA 3ZFZA 2O3OA 4HJLB 1N9EA 1QAKA 1YHQ3 1GOVA 4Q53A 1K8A4 1RTUA 1TUHA 2Z76A 3KFQC 4PEJA 3UB1A 3URPA 4BTWA 1FUTA 1FGOA 1JN5B 4RNTA 1GMRA 1NB3I 2F99A 3DGMA 1I0VA 1NWWA 1X1XA 2SBLA 4MMXB 1ROVA 3NQZA 5IERA 1M904 3UNLA 3IMAB 1K9M4 2D1WA 5ELJA 2C4BA 3EHCA 4RBNA 1IYYA 1MWTA 3KSPA 1TP6A 3MKIA 4O02B 4N6V0 2HMKB 2W9PA 1BRJA 1X1UA 3FSDA 1RGFA 2QGUA 5D81A 1ISKA 1G0TA 1TFOA 1B21A 4XB5A 1OUNA 3CNXA 2F4YA 4N6UA 4LMIA 1HKXA 2OWPA 1CEWI 3CU3A 4N6TA 6GSPA 6RNTA 2BMRB 1LQGC 1W5ZA 4U13A 2WGQA 5D82A 1VQ73 2CFKA 1QVG2 3EN8A 3D5IA 1JB4A 2CG0A 1C54A 1RRHA 1YGEA 2Z7AA 3J7Yd 1BU4A 1OACA 2BT3A 3EBYA 3FZWA 3NM2A 1DE3A 1TRPA 1K28A 2KF5A 1D6YA 1B20A 5CLKA 2UX0A 3GAXA 2JDIH 3X41A 1W2B2 3MHEA 2XRXB 4BU4A 4ZM8A 1BRNL 3KIIA 1OF5B 3PCSA 1X1YA 5AIGA 4AKYA 1IT8A 1GMPA 2F5WA 3K63A 3G16A 5AYRB 5AYSC 8RNTA 1VQ83 2PZVA 5G1KA 2W6JH 3Q3FA 4ILFA 4WYKA 3RNTA 1A2PA 1JBSA 1QJGA 3CNMA 1SJWA 4X2OA 1EA2A 1HYFA 1LVNA 4CPKA 4JRFA 4N3VA 2HMLB 2E2VA 4CCVA 1ROAA 3CD63 2XFTA 4KFEA 1T3BA 4BTXA 1BSAA 2UUGC 2W0QA 3NHXA 1UW1A 1T2HA 3ECFA 3JUQA 3DGLA 4DKIA 1FGQA 4H3UA 1V58A 1I2FA 1Q40A 2B1XB 4HM1B 2GXFA 2PNCA 3NUVA 5DREA 1I70A 1X1WA 5KP3A 1AY7A 3D79A 8CHOA 1VQ63 3GZBA 2L4VA 4I4KA 5IEOA 1QVF2 4STDA 1SQWA 1N8R4 1KD14 5JPPA 5CK6A 2IUJA 1VQ43 3S29A 1AR0A 3CC23 4FCMA 1BUQA 1PFPA 1V74A 2W56A 5AEWB 3KE7A 3N9HA 4R80A 2W03A 2R41A 3UL5A 2CWUA 2QEX3 3D5GA 3LZAA 3GWRA 5AIIA 1GYBA 3WR2A 2GEYA 5M1AA 1BNIA 5IF6A 1BNJA 1LOWA 1B2ZA 1WMPA 3DGOA 5AIHA 2ZL8A 1RGKA 1BRGA 2F86B 3WOFB 1NO3A 5BXQA 1F8NA 2YFIB 1S723 4IT7A 3A76A 1MWSA 2QIYA 3DUKA 3G0KA 1NJI4 4EV2A 5STDA 1R4CA 5TGNA 5I97A 4WYKB 1FYSA 1KQS2 1BIRA 2RSXA 1QALA 3AGOA 2XSHB 1GOYA 1HU9A 3MG1A 4FR9A 1RGCA 4HVNA 2KAAA 1OH0A 1UCKA 4KZ1A 2E2UA 3WA3A 4HM5B 3LT9A 3TDGA 3WMDA 1BSDA 1BSCA 3CMA3 1W6CA 5KP4A 4CJNA 1GOUA 2HMMB 1B3SA 1STFI 5LC6A 2L1SA 3PS8A 1VQK3 3FH1A 1YJN3 1N5PA 3FG4A 3NXJA 4HM8B 1VQL3 2KF3A 1O7GB 1QMAA 1OF5A 4O3VA 2CG1A 4J5KA 1MOLA 1EQKA 3KSED 2ML5A 2O9UX 3KN4A 4OVMA 4JF8A 1IT7A 2W56B 4MMZB 4R4KA 5DRVA 1BNEA 1YVBI 3D9RA 3EX9A 2KRTA 3G6E3 1IK3A 2BMQB 1KC84 2W2CA 1TTOA 1BNFA 3L0RA 2XGLA 4KFFA 3O8YA 1JB2A 2CX1A 4N6LA 3DY5A 4NHFA 4WHAA 4EBGA 4EW5A 3G4S3 1LRAA 1DETA 1BOXA 1GY5A 3U97A 5HOHA 1YI23 2KF4A 2BNGA 4GSPA 2LYXA 3KKGA 2CK3H 3MG3A 1GMQA 4MJDA 2OQEA 1LOVA 1V57A 2RNTA 4R9KA 5AEUB 1I0XA 3BIRA 1TFKA 3JUOA 3MYTA 3SLUA 3V92A 1UCIA 4K61A 2KCDA 3G8ZA 2CKFB 1VQ53 1W2ZA 2OTL3 3PYJA 1CQSA 1RNBA 3F7XA 1BGSA 2GBXB 3CPOA 3HIGA 1OGXA 1BRIA 1JBRA 2OQEC 2XFSA 2QA43 1WNHA 3HOHA 1UUWB 1I3FA 3NV0B 2IYJA 3OWSA 1BANA 1JKGA 4BTYA 2P09A 2ZA4A 2GBWB 4X2HA 1YJ93 1A90A 3F14A 3F8HA 2K0MA 2OCTA 2XF3A 2XEPA 1KWIA 5BU4A 5IEPA 2CHCA 3NX0A 3CCM3 4LYLB 3F8XA 3CCV3 3MPHA 1U5OA 3Q2PA 2BU4A 1B2XA 1B2SA 1M1XB 4HAAA 2CWTA 2K3DA 1JJ22 1LXEA 2P38A 2CFGA 2Y73A 1M1K4 2AAEA 3HK4A 3I563 3CCR3 2INXA 3UL6A 2XSOB 3LXUX 1UCJA 3S28A 1SIHA 2C11A 3K9MC 1RN4A 1ULIB 3DGYA 3LYGA 1LNIA 3ER7A 5GSPA 3V98A 3M8CA 4N6MA 3KCHA 5FW5A 5BIRA 1I3IA 1D6ZA 1EKMA 2M7OA 3EF8A 1OHSA 1IDPA 5EQLA 2IA7A 1ZS7A 3DMCA 3WA2X 1GD4A 3HZPA 3RDEA 1O7HB 1WMOA 4HOHA 1FUWA 5FGOA 4WWUC 3X3ZA 4FMDA 3VSYA 1UI7A 1ULJB 2GU3A 3B8LA 4O8SA 4QWTA 4BL3A 1FUSA 4HZBB 5M19A 1EEJA 2RFRA 2H0IA 2J8XB 4IIAA 3LMLA 1S5AA 3X3XA 2B24B 3SOYA 1JZDA 1SPUA 1LOYA 1RHLA 3V99A 1LOXA 3CCU3 1IVXA 1YIT3 1MGWA 3ZG5A 3CCQ3 2P05A 1JKGB 4HM6B 3BNCA 1G02A 3D3LA 1IQYA 4HM2B 1FZUA 1I8VA 2F5MA 3AMOA 1RSNA 3PGBA 5LC7A 3F9SA 2P0XA 4EC6A 2CW9A 1GY6A 4G1MB 1W6GA 1R4YA 3CCL3 3KZTA 3LTBA 3DXOA 4L8PA 1O7PB 3HIIA 1RN7A 3CCJ3 1RMSA 3T0UA 1Q7Y4 1HZ1A 2V1LA 2FNQA 1STDA 3BNEA 5A0OB 3S5CA 1VQP3 3FG3A 1GSPA 1RCLA 1RNTA 2W9QA 4J5GA 3FLJA 5IW9A 3OW22 1FW7A 1VZZA 1OCVA 1RKYA 4GL6A 1Z1SA 3DM8A 3IPTA 1Q7HA 3FKAA 3B7CA 3NQYA 1JV2B 3FF0A 5HGRA 5CXOA 2WGOA 3JUMA 4XBXA 3A5EA 4HM4B 1RGHA 1G96A 3OXAA 3OWUA 1W02A 1W6YA 3WHOA 3NV0A 1JBTA 1BAOA 2Q07A 4K1UA 1IV9A 1FGRA 3LH4A 2YFJB 1NU3A 4FMAA 4FMBA 2OOVA 2OTJ3 1DVCA 1O7WB 2CFDA 1I2GA 1MWRA 1J2BA 3Q90A 2HMOB 4L8OA 3BNDA 2BMOB 6STDA 3JUPA 3OV4A 2HOHA 3U1WA 4FCJA 1FGTA 1YVSA 3MWZA 1DVDA 4MMYB 1BUJA 3SEDA 1E97A 3SOAA 2YX9A 2W04A 2IUKA 1IV7A 2XH9A 5AIFA 3EQQB 4J8TA 1YGWA 5EEOA 3DGNA 4XBYA 2GSPA 3DH2A 4BL2A 3CCS3 2STDA 3IJEB 5ELUA 1RGLA 4HM3B 1DMNA 2Z77A 5IG5A 1UDII 3CC43 4LEHA 1Q814 1Q864 3EBTA 1VQO3 4MEIA 2LQVA 3I0YA 4R9LA 1TIJA 3AHSA 3DZLA 4TX4A 3AMOB 4R1KA 2IMJA 2H0GA 1RGGA 1T5YA 1PY3A 1SIIA 2KF6A 3H51A 1NNVA 3WDGB 1US1A 1VQN3 1NDOB 3BLZA 2SARA 3FCSB 3NBBA 4EV5A 3H3HA 4HZ9B 4OUQA 3STDA 5IG4A 1MWUA 1AVKA 2UGIA 3NBJA 9RNTA 1IQXA 3MSOA 1FA3A 4BIRA 2KXGA 2ZHXB 1VQ93 3T8NA 1BRHA 2MF7A 1EUIC 1Y4KA 2WOHA 3SXXA 4CDLA 1ZGXA 3EJVA 1LNHA 3CXC2 5JBSA 1AVLA 4HKVB 1IVWA 1AV4A 3GZRA 1B2MA 1ZX2A 1QAFA 2K54A 3NBRA 3VGNA 3I553 2D42A 2RBIA 3HI7A 3MG2A 3Q1CA 1DYUA 2CFLA 2HMNB 3N54B 4LZIA 5RNTA 4HM7B 3ZG0A 3F7SA 4HBRA 2F98A 1DMMA 1JB5A 4AEQA 4FCZA 2FXTA 5KP1A 1RJOA 1BRKA 5G1LA 4HYZA 1I2EA 1OHOA 2HMJB 2I9WA 3B4OA 4L7KA 3CCE3 2CC3A 3SX1A 2Y74A 5IENA 4RZMA 3S27A 3S67A 3RGRA 1M9GA 3CME3 4J9AA 4EXRA 3D4AA 4K1VA 3BB9A 3LTDA 3FGYA 2H0HA 3QK9A 3BNBA 1L5GB 3PZWA 3K5TA 3JUNA 1ASKA 2P0MA 2GEXA 1YNVX 2OOVC 4ORLA 3E99A 1O7MB 2RCDA 5BVBA 1K734 4AKZA 1N9JA 3FF2A 1JZOA 3GZXB 5EVHA 3N8BA 5CF2A 2AADA 1D6UA 1BVIA 1RLSA 4GHOA 3SVAA 3UJMA 4I5QA 3LOYA 1Q824 2C10A 1VQQA 3G713 1CYVA 4K90B 3NM7A 5D83A 1OHPA 4WFOA 1O7NB 4IPBA 4KFDA 4RNZA 1IVUA 5IG0A 3CPW2 1OGZA 2CX0A 2WOFA 2XGNA 4LGQA 4N6NB 1EG9B 2Z6BA 1IU7A 1PU4A 1VQM3 4XDWA 1GD3A 1RGAA 1IVVA 3VF1A 2ZDJA 3CC73 1TRQA 1U8CB 5JPUA 3EC9A 2IY2A 2BIRA 1E3VA 3EN1B 1SARA 3T8UA 2XR8B 3F40A 1TJDA 3BU4A 1DMQA 1N5HA 1WQLB 2YFLB 3LTAA 1E3RA 3GRDA 2CWVA 1MNLA 2ML6A 1CH0A
chains in the Genus database with same CATH topology
1W01A 1WMNA 4WP5A 3ALAA 1A67A 2BO9B 1WTHA 7STDA 1JN5A 3K0ZA 3ROBA 1JNQA 3HX8A 3WODG 1W7CA 1CYUA 4XM4A 1A2KA 3OX9A 3B4PA 4H61A 2GU1A 1W4NA 3LTCA 1JRQA 2BHMA 4EYCA 1C7HA 1ZO2A 4XBTA 2MC8A 4GB5A 5AI1A 3QRDA 2JQ5A 3WOEB 3GZYB 1YIJ3 1TU5A 3EB8A 1Q42A 4N6OB 2A15A 2CIUA 3X42A 5IG3A 3K7CA 2RGQA 3EE1A 4RNYA 1OPYA 2E2TA 1W00A 4LSOA 3X40A 5CF1A 1YJW3 3LT8A 1IQ8A 3JVCA 4OK0A 3X3YA 1N8QA 1GS3A 2CH9A 1UUVB 3OWYA 1Q40B 2CFWA 4HM0B 2R4IA 4FMCA 1NB5I 4KVHA 3RGAA 1A2VA 1FGMA 1KSIA 4XDVA 2WO0A 3PCRA 3PXMA 1UI8A 1RRLA 4NREA 3FG1A 1K41A 4O2HA 1GY7A 2FGTA 2O3OA 4HJLB 1N9EA 1QAKA 1YHQ3 4Q53A 1K8A4 1TUHA 2Z76A 3KFQC 4PEJA 4BTWA 3UB1A 1FGOA 1JN5B 1NB3I 2F99A 3DGMA 2SBLA 1NWWA 4MMXB 1ROVA 3NQZA 5IERA 1M904 3UNLA 3IMAB 1K9M4 2D1WA 5ELJA 3EHCA 4RBNA 3KSPA 1TP6A 3MKIA 4O02B 4N6V0 2HMKB 2W9PA 3FSDA 2QGUA 5D81A 1ISKA 1TFOA 4XB5A 1OUNA 3CNXA 4N6UA 4LMIA 1HKXA 2OWPA 1CEWI 3CU3A 4N6TA 2BMRB 1W5ZA 4U13A 5D82A 2WGQA 1VQ73 2CFKA 1QVG2 3EN8A 1JB4A 2CG0A 1RRHA 1YGEA 2Z7AA 3J7Yd 1OACA 2BT3A 3EBYA 3FZWA 3NM2A 1K28A 1D6YA 5CLKA 2UX0A 3GAXA 2JDIH 3X41A 1W2B2 3MHEA 2XRXB 4ZM8A 3KIIA 1OF5B 3PCSA 5AIGA 4AKYA 1IT8A 5AYRB 3K63A 1VQ83 3G16A 5AYSC 2PZVA 2W6JH 4WYKA 1QJGA 3CNMA 1SJWA 4X2OA 1EA2A 1LVNA 4JRFA 4N3VA 2HMLB 2E2VA 4CCVA 1ROAA 3CD63 2XFTA 4KFEA 4BTXA 2W0QA 3NHXA 1UW1A 3ECFA 3JUQA 3DGLA 1FGQA 4H3UA 1Q40A 4HM1B 2B1XB 2GXFA 2PNCA 3NUVA 5DREA 5KP3A 8CHOA 1VQ63 3GZBA 2L4VA 4I4KA 5IEOA 1QVF2 4STDA 1SQWA 1N8R4 1KD14 5JPPA 5CK6A 2IUJA 1VQ43 3S29A 1AR0A 3CC23 4FCMA 1BUQA 1PFPA 1V74A 2W56A 5AEWB 3KE7A 3N9HA 4R80A 2W03A 3UL5A 2CWUA 2QEX3 3LZAA 3GWRA 5AIIA 1GYBA 2GEYA 5IF6A 1WMPA 3DGOA 5AIHA 2ZL8A 2F86B 3WOFB 1NO3A 5BXQA 1F8NA 2YFIB 1S723 4IT7A 3A76A 3DUKA 2QIYA 3G0KA 1NJI4 4EV2A 5STDA 1R4CA 5TGNA 5I97A 4WYKB 1KQS2 2RSXA 1QALA 2XSHB 1HU9A 3MG1A 4FR9A 4HVNA 1OH0A 4KZ1A 3WA3A 2E2UA 4HM5B 3LT9A 3TDGA 3WMDA 3CMA3 1W6CA 5KP4A 2HMMB 1STFI 5LC6A 3PS8A 1VQK3 3FH1A 1YJN3 1N5PA 3FG4A 3NXJA 4HM8B 1VQL3 1O7GB 1QMAA 1OF5A 4O3VA 2CG1A 1MOLA 1EQKA 3KSED 2ML5A 2O9UX 3KN4A 4OVMA 4JF8A 1IT7A 2W56B 4MMZB 4R4KA 5DRVA 1YVBI 3D9RA 3EX9A 2KRTA 3G6E3 1IK3A 2BMQB 1KC84 2W2CA 3L0RA 2XGLA 4KFFA 3O8YA 1JB2A 4N6LA 4NHFA 3DY5A 4WHAA 4EBGA 3G4S3 1GY5A 3U97A 1YI23 2BNGA 2LYXA 3KKGA 2CK3H 3MG3A 4MJDA 2OQEA 4R9KA 5AEUB 1TFKA 3JUOA 3MYTA 3SLUA 3V92A 4K61A 2KCDA 3G8ZA 2CKFB 1VQ53 1W2ZA 2OTL3 3PYJA 1CQSA 3F7XA 2GBXB 3CPOA 3HIGA 1OGXA 2OQEC 2XFSA 2QA43 1WNHA 3NV0B 1UUWB 3OWSA 1JKGA 4BTYA 2P09A 4X2HA 2GBWB 1YJ93 1A90A 3F14A 3F8HA 2K0MA 2OCTA 2XF3A 2XEPA 1KWIA 5IEPA 2CHCA 3NX0A 3CCM3 3F8XA 3CCV3 3MPHA 1U5OA 3Q2PA 1M1XB 2CWTA 1JJ22 1LXEA 2P38A 2CFGA 2Y73A 1M1K4 3I563 3HK4A 3CCR3 2INXA 3UL6A 2XSOB 3LXUX 3S28A 1SIHA 2C11A 3K9MC 3LYGA 1ULIB 3ER7A 3V98A 3M8CA 4N6MA 5FW5A 1D6ZA 1EKMA 2M7OA 3EF8A 1OHSA 1IDPA 5EQLA 2IA7A 3DMCA 3WA2X 1GD4A 3HZPA 3RDEA 1O7HB 1WMOA 1FUWA 5FGOA 4WWUC 3X3ZA 4FMDA 3VSYA 1UI7A 1ULJB 2GU3A 3B8LA 4O8SA 4QWTA 4HZBB 2RFRA 4IIAA 3LMLA 1S5AA 3X3XA 2B24B 3SOYA 1SPUA 3V99A 1LOXA 3CCU3 1IVXA 1YIT3 3CCQ3 2P05A 1JKGB 4HM6B 3BNCA 3D3LA 1IQYA 4HM2B 3AMOA 3PGBA 5LC7A 3F9SA 2P0XA 4EC6A 2CW9A 1GY6A 4G1MB 1W6GA 3CCL3 3KZTA 3LTBA 3DXOA 4L8PA 1O7PB 3HIIA 1RN7A 3CCJ3 1Q7Y4 3T0UA 2V1LA 2FNQA 1STDA 3BNEA 5A0OB 3S5CA 1VQP3 3FG3A 5IW9A 3OW22 2W9QA 3FLJA 1VZZA 1OCVA 1RKYA 4GL6A 1Z1SA 3DM8A 3IPTA 3FKAA 3B7CA 3NQYA 1JV2B 3FF0A 5HGRA 5CXOA 2WGOA 3JUMA 4XBXA 4HM4B 1G96A 3OXAA 3OWUA 1W02A 1W6YA 3NV0A 2Q07A 4K1UA 1IV9A 1FGRA 3LH4A 2YFJB 1NU3A 4FMAA 4FMBA 2OOVA 2OTJ3 1DVCA 1O7WB 2CFDA 1J2BA 3Q90A 2HMOB 4L8OA 3BNDA 2BMOB 6STDA 3JUPA 3OV4A 3U1WA 4FCJA 1FGTA 3MWZA 1DVDA 4MMYB 3SEDA 1E97A 3SOAA 2YX9A 2W04A 2IUKA 2XH9A 1IV7A 5AIFA 3EQQB 4J8TA 5EEOA 3DGNA 4XBYA 3CCS3 2STDA 3IJEB 5ELUA 4HM3B 1DMNA 2Z77A 5IG5A 3CC43 4LEHA 1Q814 1Q864 3EBTA 1VQO3 4MEIA 2LQVA 3I0YA 4R9LA 1TIJA 3DZLA 4TX4A 3AMOB 4R1KA 2IMJA 1T5YA 1SIIA 3H51A 3WDGB 1US1A 1VQN3 1NDOB 3BLZA 3FCSB 3NBBA 4EV5A 3H3HA 4HZ9B 4OUQA 3STDA 5IG4A 1AVKA 3NBJA 1IQXA 3MSOA 1FA3A 2KXGA 1VQ93 3T8NA 2MF7A 1Y4KA 2WOHA 3SXXA 4CDLA 3EJVA 3CXC2 1LNHA 5JBSA 1AVLA 4HKVB 1IVWA 1AV4A 3GZRA 1ZX2A 1QAFA 2K54A 3NBRA 3VGNA 3I553 2D42A 3HI7A 3MG2A 3Q1CA 1DYUA 2CFLA 2HMNB 3N54B 4LZIA 4HM7B 3F7SA 4HBRA 2F98A 1DMMA 1JB5A 4AEQA 4FCZA 2FXTA 5KP1A 1RJOA 4HYZA 1OHOA 2HMJB 2I9WA 3B4OA 4L7KA 3CCE3 2CC3A 3SX1A 2Y74A 5IENA 4RZMA 3S27A 3S67A 3RGRA 1M9GA 3CME3 4J9AA 4EXRA 4K1VA 3BB9A 3LTDA 3FGYA 3QK9A 3BNBA 1L5GB 3PZWA 3K5TA 3JUNA 1ASKA 2P0MA 2GEXA 2OOVC 4ORLA 3E99A 1O7MB 2RCDA 5BVBA 1K734 4AKZA 1N9JA 3FF2A 3GZXB 5EVHA 3N8BA 5CF2A 1D6UA 3SVAA 3UJMA 3LOYA 1Q824 2C10A 3G713 1CYVA 4K90B 3NM7A 5D83A 1OHPA 4WFOA 1O7NB 4IPBA 4KFDA 4RNZA 1IVUA 5IG0A 3CPW2 1OGZA 2WOFA 2XGNA 4LGQA 4N6NB 1EG9B 2Z6BA 1IU7A 1PU4A 1VQM3 4XDWA 1GD3A 1IVVA 3VF1A 2ZDJA 3CC73 1U8CB 5JPUA 3EC9A 1E3VA 3EN1B 3T8UA 2XR8B 3F40A 1DMQA 1N5HA 1WQLB 2YFLB 3LTAA 1E3RA 3GRDA 2CWVA 1MNLA 2ML6A 5G2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE1 A;  4FMD A;  4FMC A;  3Q1C A;  4FMA A;  3EB8 A;  3PCS A;  4FMB A;  3PCR A; 
#chains in the Genus database with same CATH topology
 1W01 A;  1WMN A;  4WP5 A;  1PYL A;  1UGI A;  3ALA A;  2BO9 B;  1A67 A;  4KT3 B;  1WTH A;  3GSP A;  7STD A;  1JN5 A;  3K0Z A;  3ROB A;  1JNQ A;  1MGR A;  3AHW A;  3HX8 A;  1UCL A;  1W7C A;  3WOD G;  1CYU A;  1BRS A;  4XM4 A;  3SYU A;  1A2K A;  3OX9 A;  3B4P A;  4H61 A;  2GU1 A;  1W4N A;  3LTC A;  1JRQ A;  2BHM A;  4EYC A;  1C7H A;  1ZO2 A;  4XBT A;  2MC8 A;  4GB5 A;  5AI1 A;  3QRD A;  2JQ5 A;  3WOE B;  5G2G A;  3GZY B;  1YIJ 3;  1TU5 A;  1Q9E A;  3EB8 A;  1Q42 A;  4N6O B;  4NPB A;  2A15 A;  1B27 A;  2CIU A;  3X42 A;  3K7C A;  5IG3 A;  1BSE A;  1RCK A;  2RGQ A;  3EE1 A;  1OPY A;  4RNY A;  1BNR A;  2E2T A;  1UUG B;  1W00 A;  4LSO A;  3X40 A;  5M18 A;  5CF1 A;  1YJW 3;  3AGN A;  1RGE A;  3LT8 A;  1IQ8 A;  1BNG A;  3JVC A;  1BSB A;  2F56 A;  1N8Q A;  1T2I A;  4OK0 A;  3X3Y A;  1GS3 A;  2CH9 A;  7GSP A;  1UUV B;  3OWY A;  1Q40 B;  2CFW A;  4HM0 B;  2R4I A;  7RNT A;  1AQZ A;  1BNS A;  4FMC A;  1NB5 I;  4KVH A;  1UGH I;  3RGA A;  1A2V A;  1FGM A;  1KSI A;  4XDV A;  1RN1 A;  2WO0 A;  1RDS A;  1UI8 A;  1RRL A;  3PCR A;  3PXM A;  4NRE A;  3FG1 A;  1K41 A;  1LQM B;  1B2U A;  1GY7 A;  2FGT A;  4O2H A;  3ZFZ A;  2O3O A;  4HJL B;  1N9E A;  1QAK A;  1YHQ 3;  1GOV A;  4Q53 A;  1K8A 4;  1RTU A;  1TUH A;  2Z76 A;  3KFQ C;  4PEJ A;  3UB1 A;  3URP A;  4BTW A;  1FUT A;  1FGO A;  1JN5 B;  4RNT A;  1GMR A;  1NB3 I;  2F99 A;  3DGM A;  1I0V A;  1NWW A;  1X1X A;  2SBL A;  4MMX B;  1ROV A;  3NQZ A;  5IER A;  1M90 4;  3UNL A;  3IMA B;  1K9M 4;  2D1W A;  5ELJ A;  2C4B A;  3EHC A;  4RBN A;  1IYY A;  1MWT A;  3KSP A;  1TP6 A;  3MKI A;  4O02 B;  4N6V 0;  2HMK B;  2W9P A;  1BRJ A;  1X1U A;  3FSD A;  1RGF A;  2QGU A;  5D81 A;  1ISK A;  1G0T A;  1TFO A;  1B21 A;  4XB5 A;  1OUN A;  3CNX A;  2F4Y A;  4N6U A;  4LMI A;  1HKX A;  2OWP A;  1CEW I;  3CU3 A;  4N6T A;  6GSP A;  6RNT A;  2BMR B;  1LQG C;  1W5Z A;  4U13 A;  2WGQ A;  5D82 A;  1VQ7 3;  2CFK A;  1QVG 2;  3EN8 A;  3D5I A;  1JB4 A;  2CG0 A;  1C54 A;  1RRH A;  1YGE A;  2Z7A A;  3J7Y d;  1BU4 A;  1OAC A;  2BT3 A;  3EBY A;  3FZW A;  3NM2 A;  1DE3 A;  1TRP A;  1K28 A;  2KF5 A;  1D6Y A;  1B20 A;  5CLK A;  2UX0 A;  3GAX A;  2JDI H;  3X41 A;  1W2B 2;  3MHE A;  2XRX B;  4BU4 A;  4ZM8 A;  1BRN L;  3KII A;  1OF5 B;  3PCS A;  1X1Y A;  5AIG A;  4AKY A;  1IT8 A;  1GMP A;  2F5W A;  3K63 A;  3G16 A;  5AYR B;  5AYS C;  8RNT A;  1VQ8 3;  2PZV A;  5G1K A;  2W6J H;  3Q3F A;  4ILF A;  4WYK A;  3RNT A;  1A2P A;  1JBS A;  1QJG A;  3CNM A;  1SJW A;  4X2O A;  1EA2 A;  1HYF A;  1LVN A;  4CPK A;  4JRF A;  4N3V A;  2HML B;  2E2V A;  4CCV A;  1ROA A;  3CD6 3;  2XFT A;  4KFE A;  1T3B A;  4BTX A;  1BSA A;  2UUG C;  2W0Q A;  3NHX A;  1UW1 A;  1T2H A;  3ECF A;  3JUQ A;  3DGL A;  4DKI A;  1FGQ A;  4H3U A;  1V58 A;  1I2F A;  1Q40 A;  2B1X B;  4HM1 B;  2GXF A;  2PNC A;  3NUV A;  5DRE A;  1I70 A;  1X1W A;  5KP3 A;  1AY7 A;  3D79 A;  8CHO A;  1VQ6 3;  3GZB A;  2L4V A;  4I4K A;  5IEO A;  1QVF 2;  4STD A;  1SQW A;  1N8R 4;  1KD1 4;  5JPP A;  5CK6 A;  2IUJ A;  1VQ4 3;  3S29 A;  1AR0 A;  3CC2 3;  4FCM A;  1BUQ A;  1PFP A;  1V74 A;  2W56 A;  5AEW B;  3KE7 A;  3N9H A;  4R80 A;  2W03 A;  2R41 A;  3UL5 A;  2CWU A;  2QEX 3;  3D5G A;  3LZA A;  3GWR A;  5AII A;  1GYB A;  3WR2 A;  2GEY A;  5M1A A;  1BNI A;  5IF6 A;  1BNJ A;  1LOW A;  1B2Z A;  1WMP A;  3DGO A;  5AIH A;  2ZL8 A;  1RGK A;  1BRG A;  2F86 B;  3WOF B;  1NO3 A;  5BXQ A;  1F8N A;  2YFI B;  1S72 3;  4IT7 A;  3A76 A;  1MWS A;  2QIY A;  3DUK A;  3G0K A;  1NJI 4;  4EV2 A;  5STD A;  1R4C A;  5TGN A;  5I97 A;  4WYK B;  1FYS A;  1KQS 2;  1BIR A;  2RSX A;  1QAL A;  3AGO A;  2XSH B;  1GOY A;  1HU9 A;  3MG1 A;  4FR9 A;  1RGC A;  4HVN A;  2KAA A;  1OH0 A;  1UCK A;  4KZ1 A;  2E2U A;  3WA3 A;  4HM5 B;  3LT9 A;  3TDG A;  3WMD A;  1BSD A;  1BSC A;  3CMA 3;  1W6C A;  5KP4 A;  4CJN A;  1GOU A;  2HMM B;  1B3S A;  1STF I;  5LC6 A;  2L1S A;  3PS8 A;  1VQK 3;  3FH1 A;  1YJN 3;  1N5P A;  3FG4 A;  3NXJ A;  4HM8 B;  1VQL 3;  2KF3 A;  1O7G B;  1QMA A;  1OF5 A;  4O3V A;  2CG1 A;  4J5K A;  1MOL A;  1EQK A;  3KSE D;  2ML5 A;  2O9U X;  3KN4 A;  4OVM A;  4JF8 A;  1IT7 A;  2W56 B;  4MMZ B;  4R4K A;  5DRV A;  1BNE A;  1YVB I;  3D9R A;  3EX9 A;  2KRT A;  3G6E 3;  1IK3 A;  2BMQ B;  1KC8 4;  2W2C A;  1TTO A;  1BNF A;  3L0R A;  2XGL A;  4KFF A;  3O8Y A;  1JB2 A;  2CX1 A;  4N6L A;  3DY5 A;  4NHF A;  4WHA A;  4EBG A;  4EW5 A;  3G4S 3;  1LRA A;  1DET A;  1BOX A;  1GY5 A;  3U97 A;  5HOH A;  1YI2 3;  2KF4 A;  2BNG A;  4GSP A;  2LYX A;  3KKG A;  2CK3 H;  3MG3 A;  1GMQ A;  4MJD A;  2OQE A;  1LOV A;  1V57 A;  2RNT A;  4R9K A;  5AEU B;  1I0X A;  3BIR A;  1TFK A;  3JUO A;  3MYT A;  3SLU A;  3V92 A;  1UCI A;  4K61 A;  2KCD A;  3G8Z A;  2CKF B;  1VQ5 3;  1W2Z A;  2OTL 3;  3PYJ A;  1CQS A;  1RNB A;  3F7X A;  1BGS A;  2GBX B;  3CPO A;  3HIG A;  1OGX A;  1BRI A;  1JBR A;  2OQE C;  2XFS A;  2QA4 3;  1WNH A;  3HOH A;  1UUW B;  1I3F A;  3NV0 B;  2IYJ A;  3OWS A;  1BAN A;  1JKG A;  4BTY A;  2P09 A;  2ZA4 A;  2GBW B;  4X2H A;  1YJ9 3;  1A90 A;  3F14 A;  3F8H A;  2K0M A;  2OCT A;  2XF3 A;  2XEP A;  1KWI A;  5BU4 A;  5IEP A;  2CHC A;  3NX0 A;  3CCM 3;  4LYL B;  3F8X A;  3CCV 3;  3MPH A;  1U5O A;  3Q2P A;  2BU4 A;  1B2X A;  1B2S A;  1M1X B;  4HAA A;  2CWT A;  2K3D A;  1JJ2 2;  1LXE A;  2P38 A;  2CFG A;  2Y73 A;  1M1K 4;  2AAE A;  3HK4 A;  3I56 3;  3CCR 3;  2INX A;  3UL6 A;  2XSO B;  3LXU X;  1UCJ A;  3S28 A;  1SIH A;  2C11 A;  3K9M C;  1RN4 A;  1ULI B;  3DGY A;  3LYG A;  1LNI A;  3ER7 A;  5GSP A;  3V98 A;  3M8C A;  4N6M A;  3KCH A;  5FW5 A;  5BIR A;  1I3I A;  1D6Z A;  1EKM A;  2M7O A;  3EF8 A;  1OHS A;  1IDP A;  5EQL A;  2IA7 A;  1ZS7 A;  3DMC A;  3WA2 X;  1GD4 A;  3HZP A;  3RDE A;  1O7H B;  1WMO A;  4HOH A;  1FUW A;  5FGO A;  4WWU C;  3X3Z A;  4FMD A;  3VSY A;  1UI7 A;  1ULJ B;  2GU3 A;  3B8L A;  4O8S A;  4QWT A;  4BL3 A;  1FUS A;  4HZB B;  5M19 A;  1EEJ A;  2RFR A;  2H0I A;  2J8X B;  4IIA A;  3LML A;  1S5A A;  3X3X A;  2B24 B;  3SOY A;  1JZD A;  1SPU A;  1LOY A;  1RHL A;  3V99 A;  1LOX A;  3CCU 3;  1IVX A;  1YIT 3;  1MGW A;  3ZG5 A;  3CCQ 3;  2P05 A;  1JKG B;  4HM6 B;  3BNC A;  1G02 A;  3D3L A;  1IQY A;  4HM2 B;  1FZU A;  1I8V A;  2F5M A;  3AMO A;  1RSN A;  3PGB A;  5LC7 A;  3F9S A;  2P0X A;  4EC6 A;  2CW9 A;  1GY6 A;  4G1M B;  1W6G A;  1R4Y A;  3CCL 3;  3KZT A;  3LTB A;  3DXO A;  4L8P A;  1O7P B;  3HII A;  1RN7 A;  3CCJ 3;  1RMS A;  3T0U A;  1Q7Y 4;  1HZ1 A;  2V1L A;  2FNQ A;  1STD A;  3BNE A;  5A0O B;  3S5C A;  1VQP 3;  3FG3 A;  1GSP A;  1RCL A;  1RNT A;  2W9Q A;  4J5G A;  3FLJ A;  5IW9 A;  3OW2 2;  1FW7 A;  1VZZ A;  1OCV A;  1RKY A;  4GL6 A;  1Z1S A;  3DM8 A;  3IPT A;  1Q7H A;  3FKA A;  3B7C A;  3NQY A;  1JV2 B;  3FF0 A;  5HGR A;  5CXO A;  2WGO A;  3JUM A;  4XBX A;  3A5E A;  4HM4 B;  1RGH A;  1G96 A;  3OXA A;  3OWU A;  1W02 A;  1W6Y A;  3WHO A;  3NV0 A;  1JBT A;  1BAO A;  2Q07 A;  4K1U A;  1IV9 A;  1FGR A;  3LH4 A;  2YFJ B;  1NU3 A;  4FMA A;  4FMB A;  2OOV A;  2OTJ 3;  1DVC A;  1O7W B;  2CFD A;  1I2G A;  1MWR A;  1J2B A;  3Q90 A;  2HMO B;  4L8O A;  3BND A;  2BMO B;  6STD A;  3JUP A;  3OV4 A;  2HOH A;  3U1W A;  4FCJ A;  1FGT A;  1YVS A;  3MWZ A;  1DVD A;  4MMY B;  1BUJ A;  3SED A;  1E97 A;  3SOA A;  2YX9 A;  2W04 A;  2IUK A;  1IV7 A;  2XH9 A;  5AIF A;  3EQQ B;  4J8T A;  1YGW A;  5EEO A;  3DGN A;  4XBY A;  2GSP A;  3DH2 A;  4BL2 A;  3CCS 3;  2STD A;  3IJE B;  5ELU A;  1RGL A;  4HM3 B;  1DMN A;  2Z77 A;  5IG5 A;  1UDI I;  3CC4 3;  4LEH A;  1Q81 4;  1Q86 4;  3EBT A;  1VQO 3;  4MEI A;  2LQV A;  3I0Y A;  4R9L A;  1TIJ A;  3AHS A;  3DZL A;  4TX4 A;  3AMO B;  4R1K A;  2IMJ A;  2H0G A;  1RGG A;  1T5Y A;  1PY3 A;  1SII A;  2KF6 A;  3H51 A;  1NNV A;  3WDG B;  1US1 A;  1VQN 3;  1NDO B;  3BLZ A;  2SAR A;  3FCS B;  3NBB A;  4EV5 A;  3H3H A;  4HZ9 B;  4OUQ A;  3STD A;  5IG4 A;  1MWU A;  1AVK A;  2UGI A;  3NBJ A;  9RNT A;  1IQX A;  3MSO A;  1FA3 A;  4BIR A;  2KXG A;  2ZHX B;  1VQ9 3;  3T8N A;  1BRH A;  2MF7 A;  1EUI C;  1Y4K A;  2WOH A;  3SXX A;  4CDL A;  1ZGX A;  3EJV A;  1LNH A;  3CXC 2;  5JBS A;  1AVL A;  4HKV B;  1IVW A;  1AV4 A;  3GZR A;  1B2M A;  1ZX2 A;  1QAF A;  2K54 A;  3NBR A;  3VGN A;  3I55 3;  2D42 A;  2RBI A;  3HI7 A;  3MG2 A;  3Q1C A;  1DYU A;  2CFL A;  2HMN B;  3N54 B;  4LZI A;  5RNT A;  4HM7 B;  3ZG0 A;  3F7S A;  4HBR A;  2F98 A;  1DMM A;  1JB5 A;  4AEQ A;  4FCZ A;  2FXT A;  5KP1 A;  1RJO A;  1BRK A;  5G1L A;  4HYZ A;  1I2E A;  1OHO A;  2HMJ B;  2I9W A;  3B4O A;  4L7K A;  3CCE 3;  2CC3 A;  3SX1 A;  2Y74 A;  5IEN A;  4RZM A;  3S27 A;  3S67 A;  3RGR A;  1M9G A;  3CME 3;  4J9A A;  4EXR A;  3D4A A;  4K1V A;  3BB9 A;  3LTD A;  3FGY A;  2H0H A;  3QK9 A;  3BNB A;  1L5G B;  3PZW A;  3K5T A;  3JUN A;  1ASK A;  2P0M A;  2GEX A;  1YNV X;  2OOV C;  4ORL A;  3E99 A;  1O7M B;  2RCD A;  5BVB A;  1K73 4;  4AKZ A;  1N9J A;  3FF2 A;  1JZO A;  3GZX B;  5EVH A;  3N8B A;  5CF2 A;  2AAD A;  1D6U A;  1BVI A;  1RLS A;  4GHO A;  3SVA A;  3UJM A;  4I5Q A;  3LOY A;  1Q82 4;  2C10 A;  1VQQ A;  3G71 3;  1CYV A;  4K90 B;  3NM7 A;  5D83 A;  1OHP A;  4WFO A;  1O7N B;  4IPB A;  4KFD A;  4RNZ A;  1IVU A;  5IG0 A;  3CPW 2;  1OGZ A;  2CX0 A;  2WOF A;  2XGN A;  4LGQ A;  4N6N B;  1EG9 B;  2Z6B A;  1IU7 A;  1PU4 A;  1VQM 3;  4XDW A;  1GD3 A;  1RGA A;  1IVV A;  3VF1 A;  2ZDJ A;  3CC7 3;  1TRQ A;  1U8C B;  5JPU A;  3EC9 A;  2IY2 A;  2BIR A;  1E3V A;  3EN1 B;  1SAR A;  3T8U A;  2XR8 B;  3F40 A;  1TJD A;  3BU4 A;  1DMQ A;  1N5H A;  1WQL B;  2YFL B;  3LTA A;  1E3R A;  3GRD A;  2CWV A;  1MNL A;  2ML6 A;  1CH0 A; 
#chains in the Genus database with same CATH homology
 1W01 A;  1WMN A;  4WP5 A;  3ALA A;  1A67 A;  2BO9 B;  1WTH A;  7STD A;  1JN5 A;  3K0Z A;  3ROB A;  1JNQ A;  3HX8 A;  3WOD G;  1W7C A;  1CYU A;  4XM4 A;  1A2K A;  3OX9 A;  3B4P A;  4H61 A;  2GU1 A;  1W4N A;  3LTC A;  1JRQ A;  2BHM A;  4EYC A;  1C7H A;  1ZO2 A;  4XBT A;  2MC8 A;  4GB5 A;  5AI1 A;  3QRD A;  2JQ5 A;  3WOE B;  3GZY B;  1YIJ 3;  1TU5 A;  3EB8 A;  1Q42 A;  4N6O B;  2A15 A;  2CIU A;  3X42 A;  5IG3 A;  3K7C A;  2RGQ A;  3EE1 A;  4RNY A;  1OPY A;  2E2T A;  1W00 A;  4LSO A;  3X40 A;  5CF1 A;  1YJW 3;  3LT8 A;  1IQ8 A;  3JVC A;  4OK0 A;  3X3Y A;  1N8Q A;  1GS3 A;  2CH9 A;  1UUV B;  3OWY A;  1Q40 B;  2CFW A;  4HM0 B;  2R4I A;  4FMC A;  1NB5 I;  4KVH A;  3RGA A;  1A2V A;  1FGM A;  1KSI A;  4XDV A;  2WO0 A;  3PCR A;  3PXM A;  1UI8 A;  1RRL A;  4NRE A;  3FG1 A;  1K41 A;  4O2H A;  1GY7 A;  2FGT A;  2O3O A;  4HJL B;  1N9E A;  1QAK A;  1YHQ 3;  4Q53 A;  1K8A 4;  1TUH A;  2Z76 A;  3KFQ C;  4PEJ A;  4BTW A;  3UB1 A;  1FGO A;  1JN5 B;  1NB3 I;  2F99 A;  3DGM A;  2SBL A;  1NWW A;  4MMX B;  1ROV A;  3NQZ A;  5IER A;  1M90 4;  3UNL A;  3IMA B;  1K9M 4;  2D1W A;  5ELJ A;  3EHC A;  4RBN A;  3KSP A;  1TP6 A;  3MKI A;  4O02 B;  4N6V 0;  2HMK B;  2W9P A;  3FSD A;  2QGU A;  5D81 A;  1ISK A;  1TFO A;  4XB5 A;  1OUN A;  3CNX A;  4N6U A;  4LMI A;  1HKX A;  2OWP A;  1CEW I;  3CU3 A;  4N6T A;  2BMR B;  1W5Z A;  4U13 A;  5D82 A;  2WGQ A;  1VQ7 3;  2CFK A;  1QVG 2;  3EN8 A;  1JB4 A;  2CG0 A;  1RRH A;  1YGE A;  2Z7A A;  3J7Y d;  1OAC A;  2BT3 A;  3EBY A;  3FZW A;  3NM2 A;  1K28 A;  1D6Y A;  5CLK A;  2UX0 A;  3GAX A;  2JDI H;  3X41 A;  1W2B 2;  3MHE A;  2XRX B;  4ZM8 A;  3KII A;  1OF5 B;  3PCS A;  5AIG A;  4AKY A;  1IT8 A;  5AYR B;  3K63 A;  1VQ8 3;  3G16 A;  5AYS C;  2PZV A;  2W6J H;  4WYK A;  1QJG A;  3CNM A;  1SJW A;  4X2O A;  1EA2 A;  1LVN A;  4JRF A;  4N3V A;  2HML B;  2E2V A;  4CCV A;  1ROA A;  3CD6 3;  2XFT A;  4KFE A;  4BTX A;  2W0Q A;  3NHX A;  1UW1 A;  3ECF A;  3JUQ A;  3DGL A;  1FGQ A;  4H3U A;  1Q40 A;  4HM1 B;  2B1X B;  2GXF A;  2PNC A;  3NUV A;  5DRE A;  5KP3 A;  8CHO A;  1VQ6 3;  3GZB A;  2L4V A;  4I4K A;  5IEO A;  1QVF 2;  4STD A;  1SQW A;  1N8R 4;  1KD1 4;  5JPP A;  5CK6 A;  2IUJ A;  1VQ4 3;  3S29 A;  1AR0 A;  3CC2 3;  4FCM A;  1BUQ A;  1PFP A;  1V74 A;  2W56 A;  5AEW B;  3KE7 A;  3N9H A;  4R80 A;  2W03 A;  3UL5 A;  2CWU A;  2QEX 3;  3LZA A;  3GWR A;  5AII A;  1GYB A;  2GEY A;  5IF6 A;  1WMP A;  3DGO A;  5AIH A;  2ZL8 A;  2F86 B;  3WOF B;  1NO3 A;  5BXQ A;  1F8N A;  2YFI B;  1S72 3;  4IT7 A;  3A76 A;  3DUK A;  2QIY A;  3G0K A;  1NJI 4;  4EV2 A;  5STD A;  1R4C A;  5TGN A;  5I97 A;  4WYK B;  1KQS 2;  2RSX A;  1QAL A;  2XSH B;  1HU9 A;  3MG1 A;  4FR9 A;  4HVN A;  1OH0 A;  4KZ1 A;  3WA3 A;  2E2U A;  4HM5 B;  3LT9 A;  3TDG A;  3WMD A;  3CMA 3;  1W6C A;  5KP4 A;  2HMM B;  1STF I;  5LC6 A;  3PS8 A;  1VQK 3;  3FH1 A;  1YJN 3;  1N5P A;  3FG4 A;  3NXJ A;  4HM8 B;  1VQL 3;  1O7G B;  1QMA A;  1OF5 A;  4O3V A;  2CG1 A;  1MOL A;  1EQK A;  3KSE D;  2ML5 A;  2O9U X;  3KN4 A;  4OVM A;  4JF8 A;  1IT7 A;  2W56 B;  4MMZ B;  4R4K A;  5DRV A;  1YVB I;  3D9R A;  3EX9 A;  2KRT A;  3G6E 3;  1IK3 A;  2BMQ B;  1KC8 4;  2W2C A;  3L0R A;  2XGL A;  4KFF A;  3O8Y A;  1JB2 A;  4N6L A;  4NHF A;  3DY5 A;  4WHA A;  4EBG A;  3G4S 3;  1GY5 A;  3U97 A;  1YI2 3;  2BNG A;  2LYX A;  3KKG A;  2CK3 H;  3MG3 A;  4MJD A;  2OQE A;  4R9K A;  5AEU B;  1TFK A;  3JUO A;  3MYT A;  3SLU A;  3V92 A;  4K61 A;  2KCD A;  3G8Z A;  2CKF B;  1VQ5 3;  1W2Z A;  2OTL 3;  3PYJ A;  1CQS A;  3F7X A;  2GBX B;  3CPO A;  3HIG A;  1OGX A;  2OQE C;  2XFS A;  2QA4 3;  1WNH A;  3NV0 B;  1UUW B;  3OWS A;  1JKG A;  4BTY A;  2P09 A;  4X2H A;  2GBW B;  1YJ9 3;  1A90 A;  3F14 A;  3F8H A;  2K0M A;  2OCT A;  2XF3 A;  2XEP A;  1KWI A;  5IEP A;  2CHC A;  3NX0 A;  3CCM 3;  3F8X A;  3CCV 3;  3MPH A;  1U5O A;  3Q2P A;  1M1X B;  2CWT A;  1JJ2 2;  1LXE A;  2P38 A;  2CFG A;  2Y73 A;  1M1K 4;  3I56 3;  3HK4 A;  3CCR 3;  2INX A;  3UL6 A;  2XSO B;  3LXU X;  3S28 A;  1SIH A;  2C11 A;  3K9M C;  3LYG A;  1ULI B;  3ER7 A;  3V98 A;  3M8C A;  4N6M A;  5FW5 A;  1D6Z A;  1EKM A;  2M7O A;  3EF8 A;  1OHS A;  1IDP A;  5EQL A;  2IA7 A;  3DMC A;  3WA2 X;  1GD4 A;  3HZP A;  3RDE A;  1O7H B;  1WMO A;  1FUW A;  5FGO A;  4WWU C;  3X3Z A;  4FMD A;  3VSY A;  1UI7 A;  1ULJ B;  2GU3 A;  3B8L A;  4O8S A;  4QWT A;  4HZB B;  2RFR A;  4IIA A;  3LML A;  1S5A A;  3X3X A;  2B24 B;  3SOY A;  1SPU A;  3V99 A;  1LOX A;  3CCU 3;  1IVX A;  1YIT 3;  3CCQ 3;  2P05 A;  1JKG B;  4HM6 B;  3BNC A;  3D3L A;  1IQY A;  4HM2 B;  3AMO A;  3PGB A;  5LC7 A;  3F9S A;  2P0X A;  4EC6 A;  2CW9 A;  1GY6 A;  4G1M B;  1W6G A;  3CCL 3;  3KZT A;  3LTB A;  3DXO A;  4L8P A;  1O7P B;  3HII A;  1RN7 A;  3CCJ 3;  1Q7Y 4;  3T0U A;  2V1L A;  2FNQ A;  1STD A;  3BNE A;  5A0O B;  3S5C A;  1VQP 3;  3FG3 A;  5IW9 A;  3OW2 2;  2W9Q A;  3FLJ A;  1VZZ A;  1OCV A;  1RKY A;  4GL6 A;  1Z1S A;  3DM8 A;  3IPT A;  3FKA A;  3B7C A;  3NQY A;  1JV2 B;  3FF0 A;  5HGR A;  5CXO A;  2WGO A;  3JUM A;  4XBX A;  4HM4 B;  1G96 A;  3OXA A;  3OWU A;  1W02 A;  1W6Y A;  3NV0 A;  2Q07 A;  4K1U A;  1IV9 A;  1FGR A;  3LH4 A;  2YFJ B;  1NU3 A;  4FMA A;  4FMB A;  2OOV A;  2OTJ 3;  1DVC A;  1O7W B;  2CFD A;  1J2B A;  3Q90 A;  2HMO B;  4L8O A;  3BND A;  2BMO B;  6STD A;  3JUP A;  3OV4 A;  3U1W A;  4FCJ A;  1FGT A;  3MWZ A;  1DVD A;  4MMY B;  3SED A;  1E97 A;  3SOA A;  2YX9 A;  2W04 A;  2IUK A;  2XH9 A;  1IV7 A;  5AIF A;  3EQQ B;  4J8T A;  5EEO A;  3DGN A;  4XBY A;  3CCS 3;  2STD A;  3IJE B;  5ELU A;  4HM3 B;  1DMN A;  2Z77 A;  5IG5 A;  3CC4 3;  4LEH A;  1Q81 4;  1Q86 4;  3EBT A;  1VQO 3;  4MEI A;  2LQV A;  3I0Y A;  4R9L A;  1TIJ A;  3DZL A;  4TX4 A;  3AMO B;  4R1K A;  2IMJ A;  1T5Y A;  1SII A;  3H51 A;  3WDG B;  1US1 A;  1VQN 3;  1NDO B;  3BLZ A;  3FCS B;  3NBB A;  4EV5 A;  3H3H A;  4HZ9 B;  4OUQ A;  3STD A;  5IG4 A;  1AVK A;  3NBJ A;  1IQX A;  3MSO A;  1FA3 A;  2KXG A;  1VQ9 3;  3T8N A;  2MF7 A;  1Y4K A;  2WOH A;  3SXX A;  4CDL A;  3EJV A;  3CXC 2;  1LNH A;  5JBS A;  1AVL A;  4HKV B;  1IVW A;  1AV4 A;  3GZR A;  1ZX2 A;  1QAF A;  2K54 A;  3NBR A;  3VGN A;  3I55 3;  2D42 A;  3HI7 A;  3MG2 A;  3Q1C A;  1DYU A;  2CFL A;  2HMN B;  3N54 B;  4LZI A;  4HM7 B;  3F7S A;  4HBR A;  2F98 A;  1DMM A;  1JB5 A;  4AEQ A;  4FCZ A;  2FXT A;  5KP1 A;  1RJO A;  4HYZ A;  1OHO A;  2HMJ B;  2I9W A;  3B4O A;  4L7K A;  3CCE 3;  2CC3 A;  3SX1 A;  2Y74 A;  5IEN A;  4RZM A;  3S27 A;  3S67 A;  3RGR A;  1M9G A;  3CME 3;  4J9A A;  4EXR A;  4K1V A;  3BB9 A;  3LTD A;  3FGY A;  3QK9 A;  3BNB A;  1L5G B;  3PZW A;  3K5T A;  3JUN A;  1ASK A;  2P0M A;  2GEX A;  2OOV C;  4ORL A;  3E99 A;  1O7M B;  2RCD A;  5BVB A;  1K73 4;  4AKZ A;  1N9J A;  3FF2 A;  3GZX B;  5EVH A;  3N8B A;  5CF2 A;  1D6U A;  3SVA A;  3UJM A;  3LOY A;  1Q82 4;  2C10 A;  3G71 3;  1CYV A;  4K90 B;  3NM7 A;  5D83 A;  1OHP A;  4WFO A;  1O7N B;  4IPB A;  4KFD A;  4RNZ A;  1IVU A;  5IG0 A;  3CPW 2;  1OGZ A;  2WOF A;  2XGN A;  4LGQ A;  4N6N B;  1EG9 B;  2Z6B A;  1IU7 A;  1PU4 A;  1VQM 3;  4XDW A;  1GD3 A;  1IVV A;  3VF1 A;  2ZDJ A;  3CC7 3;  1U8C B;  5JPU A;  3EC9 A;  1E3V A;  3EN1 B;  3T8U A;  2XR8 B;  3F40 A;  1DMQ A;  1N5H A;  1WQL B;  2YFL B;  3LTA A;  1E3R A;  3GRD A;  2CWV A;  1MNL A;  2ML6 A;  5G2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...