3EE1A

Novel fold of vira, a type iii secretion system effector protein from shigella flexneri
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
399
structure length
341
Chain Sequence
EVASYCDRVVAAVEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFPVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQLNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPENNCGHIIKINAVVPGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Effector protein virA
publication title Novel fold of VirA, a type III secretion system effector protein from Shigella flexneri
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Hydrolase
total genus 86
structure length 341
sequence length 399
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ee1A01
4FMAA 3Q1CA 3EB8A 3PCRA 4FMCA 3EE1A 4FMBA 3PCSA 4FMDA
chains in the Genus database with same CATH superfamily
4X2OA 1QMAA 2HMOB 1NDOB 1BOXA 4PEJA 1X1XA 1E97A 3PCRA 2M7OA 1UW1A 4CPKA 1MGWA 1MWTA 3B4OA 9RNTA 4RNZA 5STDA 2OWPA 1IVVA 1UCLA 4GSPA 1YI23 5AI1A 1VQO3 1U8CB 4X2HA 4N6MA 1B3SA 3GZYB 1BRKA 4H61A 1BRSA 4N6LA 2CW9A 4O02B 1FA3A 2FXTA 2KF6A 1SPUA 2XSOB 4HYZA 3NV0B 5D81A 3A5EA 1UCJA 1U5OA 1N8R4 1UI7A 2P09A 1SIIA 3O8YA 3WODG 5CF1A 1KD14 1N5PA 5JPPA 1B20A 1QJGA 2OCTA 3EN8A 1KSIA 4MMXB 1VQ93 1PY3A 1RGLA 4N6TA 3URPA 4LEHA 5IEPA 1M1K4 1RCKA 3NBRA 4RBNA 1MNLA 1I3IA 4KZ1A 4WYKA 4EXRA 3JUOA 4XBXA 3D9RA 1JBRA 1B2ZA 3VF1A 1WMNA 1EKMA 4AEQA 2ZA4A 3EE1A 3RNTA 1PFPA 1RTUA 1W6CA 1WTHA 2HMLB 1CYVA 1A67A 1BUJA 2KXGA 3S28A 5IG3A 1Q814 2B24B 1UI8A 1SJWA 1Y4KA 4N6NB 1RGFA 3F7SA 1IT8A 1HU9A 4KVHA 1VQ73 4L8PA 1RRHA 1UUGB 1RGGA 1AR0A 4XM4A 1R4YA 1FZUA 3KE7A 3ZFZA 2CFDA 2PZVA 1I3FA 3D5GA 4GHOA 5IERA 4XDVA 1KWIA 3FG4A 3IMAB 2MF7A 2W9PA 8CHOA 3KN4A 1JNQA 1OGXA 3ECFA 3Q1CA 1JKGA 2INXA 3SOAA 1GOVA 3N8BA 1AY7A 3F8HA 2P05A 2RSXA 4IIAA 1ZX2A 2BT3A 3FH1A 3FCSB 5G1LA 3X42A 1CYUA 5AEWB 2XR8B 3KKGA 1QALA 4L8OA 4HM6B 1DE3A 1I2GA 1NWWA 1DVDA 2GSPA 4HZBB 4BTXA 3CC73 3X3YA 3LZAA 5IG4A 1RGHA 3LOYA 4OK0A 2IA7A 3JUNA 1VQK3 1JBTA 3G713 1HYFA 4J9AA 1RKYA 1MWUA 5M18A 2PNCA 1W2B2 3N9HA 2FGTA 2RNTA 1BNJA 4HZ9B 1NB5I 1O7WB 5EEOA 1JRQA 1B21A 1JB4A 4JF8A 1G0TA 3UNLA 1EA2A 2RFRA 2HMNB 2W04A 2CX1A 1W7CA 4NPBA 3K7CA 1BNFA 2CFGA 1IDPA 3CCQ3 1OF5A 2H0GA 5JBSA 3NX0A 2XSHB 1AVLA 3CCE3 4ILFA 2UGIA 1TTOA 3FG3A 3HIGA 1AVKA 1IVUA 1WMPA 1T2IA 4ORLA 5I97A 2IUJA 1VQP3 1VQ43 1NO3A 4EV5A 2YFIB 1VQN3 1W00A 3X3XA 3CPW2 1GY7A 3GWRA 1SIHA 3TDGA 3ZG0A 1BSDA 3EN1B 2QA43 2E2VA 2KCDA 1W5ZA 1V57A 1RRLA 2XFSA 3JUPA 3L0RA 4OUQA 3MG3A 4K1VA 5KP3A 4K90B 1AV4A 1OGZA 1KC84 2WO0A 1STDA 1FUTA 2XF3A 3F7XA 4NREA 4BL3A 4MMYB 2F4YA 4XBYA 5IF6A 3EQQB 1GMPA 4WWUC 3MWZA 2Z7AA 1ASKA 1FGQA 4I4KA 3JUQA 1LVNA 2CG0A 1WMOA 3MG1A 4HAAA 4KFFA 2W56B 1O7HB 4EYCA 1B2SA 4RNYA 2BU4A 5BIRA 2B1XB 2FNQA 5IG5A 5GSPA 3EBTA 3MPHA 4EBGA 1Q824 3F9SA 3HX8A 5LC7A 3T0UA 2CHCA 3I563 3OXAA 3KZTA 1FYSA 3SXXA 2CK3H 3NV0A 7STDA 1BNEA 2L4VA 3PCSA 1BSAA 5KP4A 2CFLA 5TGNA 1VQL3 2Y74A 2F98A 3PZWA 2WGOA 5HGRA 3WOEB 4BL2A 1YHQ3 4DKIA 5CLKA 1B27A 3NUVA 3CMA3 1CH0A 2YFLB 3K9MC 5AIGA 3OV4A 1BNRA 3WHOA 1G96A 1LOWA 1UUVB 4RNTA 1NJI4 4FMCA 2WGQA 3B7CA 1YIJ3 5IEOA 2L1SA 2XFTA 3EB8A 1TP6A 1GY6A 2IYJA 2IY2A 3G8ZA 3S27A 3T8UA 1DMMA 1GY5A 2CWTA 3H3HA 3LTAA 4XDWA 1DMQA 1OCVA 3BNDA 4HM2B 4CDLA 2CFKA 2O9UX 4HM5B 1X1UA 2W03A 2XEPA 1RGAA 3ZG5A 1O7GB 3DGMA 1NB3I 5CXOA 5DREA 1YJ93 1TFOA 1RGKA 2C4BA 1FW7A 1B2XA 1IV9A 3HIIA 4J5GA 3RGAA 3OWSA 3PXMA 2CIUA 1YVBI 3LMLA 2ML5A 3Q90A 1B2MA 5AYRB 1CEWI 3DGLA 1A90A 3CCU3 2STDA 1YJW3 1I2EA 4FMBA 3RDEA 2D42A 2I9WA 3WA2X 1W01A 2BIRA 3BNEA 1L5GB 1ISKA 3VSYA 4IPBA 2GEXA 3WA3A 1RMSA 1OHPA 1LNIA 3AHWA 2OOVC 1LXEA 4CCVA 3NBBA 1YJN3 2HMKB 1R4CA 5G1KA 3X40A 2BNGA 4EV2A 3PGBA 1BRNL 2C10A 1VQ63 2CH9A 3DGYA 1YIT3 1BU4A 3AMOB 3CCM3 3WMDA 3J7Yd 3EX9A 1STFI 5BVBA 3D4AA 3V98A 4LSOA 1EUIC 1BNGA 2GU1A 2LYXA 1BNSA 2O3OA 1DYUA 3H51A 4GL6A 5LC6A 4EW5A 1I2FA 2J8XB 1JBSA 3QRDA 3VGNA 3STDA 4H3UA 4XBTA 3EJVA 5KP1A 5BXQA 4LMIA 1VQM3 1C7HA 4HM0B 3UL6A 1JB2A 1JN5B 1RJOA 4HOHA 3ROBA 1K28A 2KF5A 2KAAA 2CWVA 2WOFA 3G16A 4MEIA 5D82A 5CF2A 3DY5A 2F56A 2OQEC 3OW22 3I553 1EQKA 1NU3A 5AIHA 1BGSA 2RCDA 5AIFA 4O2HA 4Q53A 4RZMA 1PYLA 1IQYA 1X1YA 4FCZA 4R9KA 4N6UA 2K0MA 1C54A 4J8TA 2E2TA 4FMDA 1MWRA 3FG1A 5DRVA 1UCIA 1GYBA 2W56A 1RCLA 3SYUA 1CQSA 2IUKA 2R4IA 1BRJA 2XH9A 1V74A 3A76A 1N9JA 4LGQA 1RSNA 2BMRB 2CKFB 1ULIB 3HI7A 3SX1A 3IPTA 1GMQA 2YFJB 3LTCA 1BAOA 1RNBA 1F8NA 4HM4B 2KF3A 5EVHA 3CC23 1FGOA 2JQ5A 3SVAA 4JRFA 4BIRA 2RBIA 1G02A 1O7MB 1ZO2A 2W0QA 1SARA 2F86B 3E99A 2Z77A 5M19A 2UUGC 1T2HA 3NQZA 1ROAA 2SARA 1TRPA 3F40A 1RDSA 1I70A 2IMJA 2KRTA 1A2PA 2QGUA 1Q864 3NBJA 2CWUA 2P38A 3CC43 1HKXA 1A2KA 3V92A 2GBWB 2K3DA 4MJDA 3HOHA 3X41A 3AHSA 2ZHXB 1M904 2GU3A 3BU4A 2KF4A 2YX9A 1ZGXA 3KIIA 2E2UA 1JV2B 3OX9A 7RNTA 3ER7A 1UGIA 3GZBA 2W9QA 1MOLA 1RN4A 3NQYA 1MGRA 4K61A 3CME3 1RN1A 5CK6A 1QAKA 4MMZB 3CXC2 3D5IA 1S723 1E3VA 1FGMA 4HM7B 1LRAA 2F5MA 1OHOA 2OTJ3 1DVCA 2R41A 4R9LA 4OVMA 2OQEA 1QAFA 1BIRA 1K41A 1RGEA 1WNHA 3LYGA 5ELUA 1MWSA 1YNVX 1LNHA 3MKIA 1M9GA 1Q40B 1IT7A 4NHFA 3CPOA 2XRXB 4GB5A 3FLJA 3FF0A 1LOXA 2LQVA 3T8NA 3CCL3 3B8LA 3MSOA 4J5KA 3X3ZA 5IENA 3UB1A 1YVSA 1YGEA 3SLUA 4HJLB 4AKZA 1AQZA 1TFKA 3FSDA 3MG2A 3N54B 4KT3B 4U13A 2WOHA 3BLZA 3Q3FA 4N3VA 1Q7Y4 3LTDA 2HMMB 3BIRA 1D6ZA 3EBYA 4WHAA 3CNMA 4I5QA 4LYLB 1K9M4 3QK9A 1NNVA 2W2CA 3AMOA 1RN7A 1TRQA 4FCJA 4LZIA 1Q42A 4KFDA 5D83A 4HM3B 6STDA 1A2VA 4N6V0 2V1LA 3PS8A 1US1A 2P0XA 3DGOA 3F14A 2BMOB 4HVNA 5AYSC 3AGNA 1FUSA 5AEUB 4O3VA 1IYYA 4AKYA 1I8VA 2W6JH 3F8XA 1OUNA 2K54A 1D6YA 3NHXA 3G4S3 3G6E3 1GSPA 2XGNA 3KFQC 4FR9A 1IK3A 1FGTA 1JN5A 1W2ZA 4HKVB 2BHMA 3MYTA 3OWYA 4EC6A 5JPUA 3KCHA 4IT7A 5FW5A 1RLSA 3Q2PA 2AAEA 4HM8B 1BRIA 4R4KA 3CCR3 3HZPA 1BUQA 3IJEB 5A0OB 1K8A4 1OH0A 1BVIA 1ROVA 3DZLA 3WDGB 8RNTA 1VZZA 3DM8A 2A15A 3K5TA 2HOHA 2UX0A 6GSPA 4TX4A 1JZOA 3S67A 1Q9EA 3V99A 2F5WA 3GAXA 1D6UA 1OACA 3CU3A 3AGOA 3DH2A 4WFOA 1LQMB 4L7KA 2CFWA 5G2GA 2RGQA 4HBRA 1DETA 5IG0A 1QVG2 3D79A 1GOUA 1J2BA 3GZXB 3U97A 1LOVA 1N5HA 4HM1B 3PYJA 4WYKB 3G0KA 1BNIA 2BMQB 2Z6BA 4ZM8A 1FUWA 3LH4A 1GS3A 3K0ZA 3UJMA 1UCKA 1IV7A 2AADA 3ALAA 1T5YA 1WQLB 5IW9A 3CCV3 2H0HA 2CX0A 1I0XA 3NM2A 3BNCA 1YGWA 3HK4A 3KSPA 1DMNA 1GMRA 2JDIH 2H0IA 3GZRA 4CJNA 2CG1A 1FGRA 3OWUA 1QVF2 3LTBA 2CC3A 3DMCA 2D1WA 1RNTA 5ELJA 1JJ22 1EEJA 1Z1SA 3CNXA 4QWTA 3GSPA 1VQ53 3MHEA 4O8SA 2ML6A 4BTYA 3S29A 4K1UA 1JKGB 1O7NB 1OPYA 1W02A 4R1KA 2ZL8A 4BTWA 1IQ8A 3WR2A 1ULJB 4XB5A 1SQWA 3LXUX 2OOVA 1BANA 1IVXA 3FF2A 4N6OB 1UGHI 1N8QA 1TUHA 5FGOA 4FCMA 3CCS3 2OTL3 1LQGC 1EG9B 3JVCA 5EQLA 2QEX3 1W6YA 1B2UA 1TIJA 3I0YA 1LOYA 3SEDA 3D3LA 1BSCA 3DGNA 4G1MB 7GSPA 1S5AA 1IVWA 1Q7HA 3FKAA 1Q40A 1T3BA 1E3RA 4STDA 5M1AA 3SOYA 3WOFB 1PU4A 1W6GA 3BNBA 1O7PB 1OHSA 2SBLA 1BSBA 4BU4A 3GRDA 3FZWA 3DUKA 1UDII 3CCJ3 1JZDA 1VQQA 3EF8A 2GBXB 3BB9A 3NM7A 6RNTA 5HOHA 1OF5B 2ZDJA 2F99A 3EHCA 1KQS2 1RHLA 2Y73A 3JUMA 5AIIA 5BU4A 2GEYA 3M8CA 1BRGA 2Q07A 3DXOA 1VQ83 1JB5A 1IU7A 3KSED 1IQXA 3NXJA 3U1WA 2XGLA 1UUWB 1GOYA 3CD63 1N9EA 5RNTA 1RGCA 2Z76A 1BRHA 2C11A 3S5CA 2MC8A 2P0MA 1BSEA 3K63A 1ZS7A 3LT9A 4WP5A 2BO9B 3FGYA 3LT8A 2QIYA 1GD3A 3B4PA 2GXFA 3EC9A 4KFEA 3UL5A 1K734 1I0VA 4FMAA 1TU5A 2HMJB 3RGRA 1M1XB 1W4NA 1GD4A 1TJDA 1V58A 4R80A 1X1WA 1HZ1A
chains in the Genus database with same CATH topology
4X2OA 1QMAA 2HMOB 1NDOB 4PEJA 1E97A 3PCRA 2M7OA 1UW1A 3B4OA 4RNZA 5STDA 2OWPA 1IVVA 1YI23 5AI1A 1VQO3 1U8CB 4X2HA 4N6MA 3GZYB 4N6LA 4H61A 2CW9A 4O02B 1FA3A 2FXTA 2XSOB 1SPUA 4HYZA 5D81A 3NV0B 1U5OA 1N8R4 1UI7A 2P09A 1SIIA 3O8YA 3WODG 5CF1A 1KD14 1N5PA 5JPPA 1QJGA 4MMXB 2OCTA 3EN8A 1KSIA 1VQ93 4N6TA 4LEHA 5IEPA 1M1K4 3NBRA 4RBNA 1MNLA 4WYKA 4KZ1A 4EXRA 3JUOA 4XBXA 3D9RA 3VF1A 1WMNA 1EKMA 4AEQA 3EE1A 1PFPA 1A67A 1W6CA 1WTHA 2HMLB 1CYVA 2KXGA 3S28A 5IG3A 1Q814 2B24B 1UI8A 1SJWA 1Y4KA 4N6NB 3F7SA 1IT8A 1HU9A 4KVHA 1VQ73 4L8PA 1RRHA 1AR0A 4XM4A 3KE7A 2CFDA 2PZVA 5IERA 4XDVA 1KWIA 3FG4A 3IMAB 2MF7A 2W9PA 8CHOA 3KN4A 1JNQA 1OGXA 3ECFA 3Q1CA 1JKGA 2INXA 3SOAA 3N8BA 3F8HA 2P05A 2RSXA 4IIAA 1ZX2A 2BT3A 3FH1A 3FCSB 3X42A 1CYUA 5AEWB 2XR8B 3KKGA 1QALA 4L8OA 4HM6B 1NWWA 1DVDA 4HZBB 4BTXA 3CC73 3X3YA 3LZAA 5IG4A 4OK0A 3LOYA 2IA7A 3JUNA 1VQK3 3G713 4J9AA 1RKYA 2PNCA 1W2B2 3N9HA 2FGTA 4HZ9B 1NB5I 1O7WB 5EEOA 1JRQA 1JB4A 4JF8A 3UNLA 1EA2A 2RFRA 2HMNB 2W04A 1W7CA 3K7CA 2CFGA 1IDPA 3CCQ3 1OF5A 5JBSA 3NX0A 2XSHB 1AVLA 3CCE3 3FG3A 3HIGA 1IVUA 1AVKA 1WMPA 4ORLA 5I97A 2IUJA 1VQP3 1VQ43 1NO3A 4EV5A 2YFIB 1VQN3 1W00A 3X3XA 3CPW2 1GY7A 3GWRA 1SIHA 3TDGA 3EN1B 2QA43 2E2VA 2KCDA 1W5ZA 1RRLA 2XFSA 3JUPA 3L0RA 4OUQA 3MG3A 4K1VA 5KP3A 4K90B 1AV4A 1OGZA 1KC84 2WO0A 1STDA 2XF3A 3F7XA 4NREA 4MMYB 4XBYA 5IF6A 3EQQB 4WWUC 3MWZA 2Z7AA 1ASKA 1FGQA 4I4KA 3JUQA 1LVNA 2CG0A 1WMOA 3MG1A 4KFFA 2W56B 1O7HB 4EYCA 4RNYA 2B1XB 2FNQA 5IG5A 3EBTA 3MPHA 4EBGA 1Q824 3F9SA 3HX8A 5LC7A 3T0UA 2CHCA 3I563 3OXAA 3KZTA 3SXXA 2CK3H 3NV0A 7STDA 2L4VA 3PCSA 5KP4A 2CFLA 5TGNA 1VQL3 2Y74A 2F98A 3PZWA 2WGOA 5HGRA 3WOEB 1YHQ3 5CLKA 3NUVA 3CMA3 2YFLB 3K9MC 5AIGA 3OV4A 1G96A 1UUVB 1NJI4 4FMCA 2WGQA 3B7CA 1YIJ3 5IEOA 2XFTA 3EB8A 1TP6A 1GY6A 3G8ZA 3S27A 3T8UA 1DMMA 1GY5A 2CWTA 3H3HA 3LTAA 4XDWA 1DMQA 1OCVA 3BNDA 4HM2B 4CDLA 2CFKA 2O9UX 4HM5B 2XEPA 2W03A 1O7GB 3DGMA 1NB3I 5CXOA 5DREA 1YJ93 1TFOA 1IV9A 3HIIA 3RGAA 3OWSA 3PXMA 2CIUA 1YVBI 3LMLA 2ML5A 3Q90A 5AYRB 1CEWI 3DGLA 1A90A 3CCU3 2STDA 1YJW3 4FMBA 3RDEA 2D42A 2I9WA 3WA2X 1W01A 3BNEA 1L5GB 1ISKA 3VSYA 4IPBA 2GEXA 3WA3A 1OHPA 2OOVC 1LXEA 4CCVA 3NBBA 1YJN3 2HMKB 1R4CA 3X40A 2BNGA 4EV2A 3PGBA 2C10A 1VQ63 2CH9A 1YIT3 3AMOB 3CCM3 3WMDA 3J7Yd 3EX9A 1STFI 5BVBA 3V98A 4LSOA 2O3OA 2GU1A 2LYXA 5LC6A 4GL6A 1DYUA 3H51A 3QRDA 3VGNA 3STDA 4H3UA 4XBTA 3EJVA 5KP1A 5BXQA 4LMIA 1VQM3 1C7HA 4HM0B 3UL6A 1JB2A 1JN5B 1RJOA 3ROBA 1K28A 2CWVA 2WOFA 3G16A 5D82A 5CF2A 3DY5A 2OQEC 3OW22 3I553 1EQKA 1NU3A 5AIHA 2RCDA 5AIFA 4O2HA 4Q53A 4RZMA 1IQYA 4FCZA 4R9KA 4N6UA 2K0MA 4J8TA 2E2TA 4FMDA 3FG1A 5DRVA 1GYBA 2W56A 1CQSA 2IUKA 2R4IA 2XH9A 3A76A 1V74A 4LGQA 1N9JA 2BMRB 2CKFB 1ULIB 3HI7A 3SX1A 3IPTA 2YFJB 3LTCA 1F8NA 4HM4B 5EVHA 3CC23 1FGOA 2JQ5A 3SVAA 4JRFA 1O7MB 1ZO2A 2W0QA 3E99A 2F86B 2Z77A 3NQZA 1ROAA 3F40A 2IMJA 2KRTA 2QGUA 1Q864 3NBJA 2CWUA 2P38A 3CC43 1HKXA 1A2KA 3V92A 2GBWB 4MJDA 3X41A 1M904 2GU3A 2YX9A 3KIIA 2E2UA 1JV2B 3OX9A 3ER7A 3GZBA 2W9QA 1MOLA 3NQYA 4K61A 3CME3 5CK6A 1QAKA 4MMZB 3CXC2 1S723 1E3VA 1FGMA 4HM7B 1OHOA 2OTJ3 1DVCA 4R9LA 4OVMA 2OQEA 1QAFA 5ELUA 1K41A 1WNHA 1VQ83 3LYGA 1LNHA 3MKIA 1M9GA 1Q40B 1IT7A 4NHFA 3CPOA 2XRXB 4GB5A 3FLJA 3FF0A 1LOXA 2LQVA 3T8NA 3CCL3 3B8LA 3MSOA 3X3ZA 5IENA 3UB1A 3SLUA 1YGEA 4HJLB 4AKZA 1TFKA 3FSDA 3MG2A 3N54B 4U13A 2WOHA 3BLZA 4N3VA 1Q7Y4 3LTDA 2HMMB 1D6ZA 3EBYA 4WHAA 3CNMA 1K9M4 3QK9A 2W2CA 3AMOA 1RN7A 4FCJA 4LZIA 1Q42A 4KFDA 5D83A 4HM3B 6STDA 1A2VA 4N6V0 2V1LA 3PS8A 1US1A 2P0XA 3DGOA 3F14A 2BMOB 4HVNA 5AYSC 5AEUB 4O3VA 4AKYA 2W6JH 3F8XA 1OUNA 2K54A 1D6YA 3NHXA 3G4S3 3G6E3 2XGNA 4FR9A 3KFQC 1IK3A 1FGTA 1JN5A 1W2ZA 4HKVB 2BHMA 3MYTA 3OWYA 4EC6A 5JPUA 4IT7A 5FW5A 3Q2PA 4HM8B 4R4KA 3CCR3 3HZPA 1BUQA 3IJEB 5A0OB 1K8A4 1OH0A 3DZLA 1ROVA 3WDGB 1VZZA 3DM8A 2A15A 3K5TA 2UX0A 4TX4A 3S67A 3V99A 3GAXA 1D6UA 1OACA 3CU3A 4WFOA 4L7KA 2CFWA 5G2GA 2RGQA 4HBRA 5IG0A 1QVG2 1J2BA 3GZXB 3U97A 1N5HA 4HM1B 3PYJA 4WYKB 3G0KA 2BMQB 2Z6BA 4ZM8A 1FUWA 3LH4A 1GS3A 3K0ZA 3UJMA 1IV7A 3ALAA 1T5YA 1WQLB 5IW9A 3CCV3 3NM2A 3BNCA 3HK4A 3KSPA 1DMNA 2JDIH 3GZRA 2CG1A 1FGRA 3OWUA 1QVF2 3LTBA 2CC3A 3DMCA 2D1WA 5ELJA 1JJ22 1Z1SA 3CNXA 4QWTA 1VQ53 3MHEA 4O8SA 2ML6A 4BTYA 3S29A 4K1UA 1JKGB 1O7NB 1OPYA 1W02A 4R1KA 2ZL8A 4BTWA 1IQ8A 1ULJB 4XB5A 1SQWA 3LXUX 2OOVA 1IVXA 3FF2A 4N6OB 1N8QA 1TUHA 5FGOA 4FCMA 3CCS3 2OTL3 1EG9B 3JVCA 5EQLA 2QEX3 1W6YA 1TIJA 3I0YA 3SEDA 3D3LA 3DGNA 4G1MB 1S5AA 1IVWA 3FKAA 1Q40A 1E3RA 4STDA 3SOYA 3WOFB 1PU4A 1W6GA 3BNBA 1O7PB 1OHSA 2SBLA 3GRDA 3FZWA 3DUKA 3CCJ3 3EF8A 2GBXB 3BB9A 3NM7A 1OF5B 2ZDJA 2F99A 3EHCA 1KQS2 2Y73A 3JUMA 5AIIA 2GEYA 3M8CA 2Q07A 3DXOA 1JB5A 1IU7A 3KSED 1IQXA 3NXJA 3U1WA 2XGLA 1UUWB 3CD63 1N9EA 2Z76A 2C11A 3S5CA 2MC8A 2P0MA 3LT9A 3K63A 4WP5A 2BO9B 3FGYA 3LT8A 2QIYA 1GD3A 3B4PA 2GXFA 3EC9A 4KFEA 3UL5A 1K734 4FMAA 1TU5A 2HMJB 3RGRA 1M1XB 1W4NA 1GD4A 4R80A 4MEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMA A;  3Q1C A;  3EB8 A;  3PCR A;  4FMC A;  3EE1 A;  4FMB A;  3PCS A;  4FMD A; 
#chains in the Genus database with same CATH topology
 4X2O A;  1QMA A;  2HMO B;  1NDO B;  1BOX A;  4PEJ A;  1X1X A;  1E97 A;  3PCR A;  2M7O A;  1UW1 A;  4CPK A;  1MGW A;  1MWT A;  3B4O A;  9RNT A;  4RNZ A;  5STD A;  2OWP A;  1IVV A;  1UCL A;  4GSP A;  1YI2 3;  5AI1 A;  1VQO 3;  1U8C B;  4X2H A;  4N6M A;  1B3S A;  3GZY B;  1BRK A;  4H61 A;  1BRS A;  4N6L A;  2CW9 A;  4O02 B;  1FA3 A;  2FXT A;  2KF6 A;  1SPU A;  2XSO B;  4HYZ A;  3NV0 B;  5D81 A;  3A5E A;  1UCJ A;  1U5O A;  1N8R 4;  1UI7 A;  2P09 A;  1SII A;  3O8Y A;  3WOD G;  5CF1 A;  1KD1 4;  1N5P A;  5JPP A;  1B20 A;  1QJG A;  2OCT A;  3EN8 A;  1KSI A;  4MMX B;  1VQ9 3;  1PY3 A;  1RGL A;  4N6T A;  3URP A;  4LEH A;  5IEP A;  1M1K 4;  1RCK A;  3NBR A;  4RBN A;  1MNL A;  1I3I A;  4KZ1 A;  4WYK A;  4EXR A;  3JUO A;  4XBX A;  3D9R A;  1JBR A;  1B2Z A;  3VF1 A;  1WMN A;  1EKM A;  4AEQ A;  2ZA4 A;  3EE1 A;  3RNT A;  1PFP A;  1RTU A;  1W6C A;  1WTH A;  2HML B;  1CYV A;  1A67 A;  1BUJ A;  2KXG A;  3S28 A;  5IG3 A;  1Q81 4;  2B24 B;  1UI8 A;  1SJW A;  1Y4K A;  4N6N B;  1RGF A;  3F7S A;  1IT8 A;  1HU9 A;  4KVH A;  1VQ7 3;  4L8P A;  1RRH A;  1UUG B;  1RGG A;  1AR0 A;  4XM4 A;  1R4Y A;  1FZU A;  3KE7 A;  3ZFZ A;  2CFD A;  2PZV A;  1I3F A;  3D5G A;  4GHO A;  5IER A;  4XDV A;  1KWI A;  3FG4 A;  3IMA B;  2MF7 A;  2W9P A;  8CHO A;  3KN4 A;  1JNQ A;  1OGX A;  3ECF A;  3Q1C A;  1JKG A;  2INX A;  3SOA A;  1GOV A;  3N8B A;  1AY7 A;  3F8H A;  2P05 A;  2RSX A;  4IIA A;  1ZX2 A;  2BT3 A;  3FH1 A;  3FCS B;  5G1L A;  3X42 A;  1CYU A;  5AEW B;  2XR8 B;  3KKG A;  1QAL A;  4L8O A;  4HM6 B;  1DE3 A;  1I2G A;  1NWW A;  1DVD A;  2GSP A;  4HZB B;  4BTX A;  3CC7 3;  3X3Y A;  3LZA A;  5IG4 A;  1RGH A;  3LOY A;  4OK0 A;  2IA7 A;  3JUN A;  1VQK 3;  1JBT A;  3G71 3;  1HYF A;  4J9A A;  1RKY A;  1MWU A;  5M18 A;  2PNC A;  1W2B 2;  3N9H A;  2FGT A;  2RNT A;  1BNJ A;  4HZ9 B;  1NB5 I;  1O7W B;  5EEO A;  1JRQ A;  1B21 A;  1JB4 A;  4JF8 A;  1G0T A;  3UNL A;  1EA2 A;  2RFR A;  2HMN B;  2W04 A;  2CX1 A;  1W7C A;  4NPB A;  3K7C A;  1BNF A;  2CFG A;  1IDP A;  3CCQ 3;  1OF5 A;  2H0G A;  5JBS A;  3NX0 A;  2XSH B;  1AVL A;  3CCE 3;  4ILF A;  2UGI A;  1TTO A;  3FG3 A;  3HIG A;  1AVK A;  1IVU A;  1WMP A;  1T2I A;  4ORL A;  5I97 A;  2IUJ A;  1VQP 3;  1VQ4 3;  1NO3 A;  4EV5 A;  2YFI B;  1VQN 3;  1W00 A;  3X3X A;  3CPW 2;  1GY7 A;  3GWR A;  1SIH A;  3TDG A;  3ZG0 A;  1BSD A;  3EN1 B;  2QA4 3;  2E2V A;  2KCD A;  1W5Z A;  1V57 A;  1RRL A;  2XFS A;  3JUP A;  3L0R A;  4OUQ A;  3MG3 A;  4K1V A;  5KP3 A;  4K90 B;  1AV4 A;  1OGZ A;  1KC8 4;  2WO0 A;  1STD A;  1FUT A;  2XF3 A;  3F7X A;  4NRE A;  4BL3 A;  4MMY B;  2F4Y A;  4XBY A;  5IF6 A;  3EQQ B;  1GMP A;  4WWU C;  3MWZ A;  2Z7A A;  1ASK A;  1FGQ A;  4I4K A;  3JUQ A;  1LVN A;  2CG0 A;  1WMO A;  3MG1 A;  4HAA A;  4KFF A;  2W56 B;  1O7H B;  4EYC A;  1B2S A;  4RNY A;  2BU4 A;  5BIR A;  2B1X B;  2FNQ A;  5IG5 A;  5GSP A;  3EBT A;  3MPH A;  4EBG A;  1Q82 4;  3F9S A;  3HX8 A;  5LC7 A;  3T0U A;  2CHC A;  3I56 3;  3OXA A;  3KZT A;  1FYS A;  3SXX A;  2CK3 H;  3NV0 A;  7STD A;  1BNE A;  2L4V A;  3PCS A;  1BSA A;  5KP4 A;  2CFL A;  5TGN A;  1VQL 3;  2Y74 A;  2F98 A;  3PZW A;  2WGO A;  5HGR A;  3WOE B;  4BL2 A;  1YHQ 3;  4DKI A;  5CLK A;  1B27 A;  3NUV A;  3CMA 3;  1CH0 A;  2YFL B;  3K9M C;  5AIG A;  3OV4 A;  1BNR A;  3WHO A;  1G96 A;  1LOW A;  1UUV B;  4RNT A;  1NJI 4;  4FMC A;  2WGQ A;  3B7C A;  1YIJ 3;  5IEO A;  2L1S A;  2XFT A;  3EB8 A;  1TP6 A;  1GY6 A;  2IYJ A;  2IY2 A;  3G8Z A;  3S27 A;  3T8U A;  1DMM A;  1GY5 A;  2CWT A;  3H3H A;  3LTA A;  4XDW A;  1DMQ A;  1OCV A;  3BND A;  4HM2 B;  4CDL A;  2CFK A;  2O9U X;  4HM5 B;  1X1U A;  2W03 A;  2XEP A;  1RGA A;  3ZG5 A;  1O7G B;  3DGM A;  1NB3 I;  5CXO A;  5DRE A;  1YJ9 3;  1TFO A;  1RGK A;  2C4B A;  1FW7 A;  1B2X A;  1IV9 A;  3HII A;  4J5G A;  3RGA A;  3OWS A;  3PXM A;  2CIU A;  1YVB I;  3LML A;  2ML5 A;  3Q90 A;  1B2M A;  5AYR B;  1CEW I;  3DGL A;  1A90 A;  3CCU 3;  2STD A;  1YJW 3;  1I2E A;  4FMB A;  3RDE A;  2D42 A;  2I9W A;  3WA2 X;  1W01 A;  2BIR A;  3BNE A;  1L5G B;  1ISK A;  3VSY A;  4IPB A;  2GEX A;  3WA3 A;  1RMS A;  1OHP A;  1LNI A;  3AHW A;  2OOV C;  1LXE A;  4CCV A;  3NBB A;  1YJN 3;  2HMK B;  1R4C A;  5G1K A;  3X40 A;  2BNG A;  4EV2 A;  3PGB A;  1BRN L;  2C10 A;  1VQ6 3;  2CH9 A;  3DGY A;  1YIT 3;  1BU4 A;  3AMO B;  3CCM 3;  3WMD A;  3J7Y d;  3EX9 A;  1STF I;  5BVB A;  3D4A A;  3V98 A;  4LSO A;  1EUI C;  1BNG A;  2GU1 A;  2LYX A;  1BNS A;  2O3O A;  1DYU A;  3H51 A;  4GL6 A;  5LC6 A;  4EW5 A;  1I2F A;  2J8X B;  1JBS A;  3QRD A;  3VGN A;  3STD A;  4H3U A;  4XBT A;  3EJV A;  5KP1 A;  5BXQ A;  4LMI A;  1VQM 3;  1C7H A;  4HM0 B;  3UL6 A;  1JB2 A;  1JN5 B;  1RJO A;  4HOH A;  3ROB A;  1K28 A;  2KF5 A;  2KAA A;  2CWV A;  2WOF A;  3G16 A;  4MEI A;  5D82 A;  5CF2 A;  3DY5 A;  2F56 A;  2OQE C;  3OW2 2;  3I55 3;  1EQK A;  1NU3 A;  5AIH A;  1BGS A;  2RCD A;  5AIF A;  4O2H A;  4Q53 A;  4RZM A;  1PYL A;  1IQY A;  1X1Y A;  4FCZ A;  4R9K A;  4N6U A;  2K0M A;  1C54 A;  4J8T A;  2E2T A;  4FMD A;  1MWR A;  3FG1 A;  5DRV A;  1UCI A;  1GYB A;  2W56 A;  1RCL A;  3SYU A;  1CQS A;  2IUK A;  2R4I A;  1BRJ A;  2XH9 A;  1V74 A;  3A76 A;  1N9J A;  4LGQ A;  1RSN A;  2BMR B;  2CKF B;  1ULI B;  3HI7 A;  3SX1 A;  3IPT A;  1GMQ A;  2YFJ B;  3LTC A;  1BAO A;  1RNB A;  1F8N A;  4HM4 B;  2KF3 A;  5EVH A;  3CC2 3;  1FGO A;  2JQ5 A;  3SVA A;  4JRF A;  4BIR A;  2RBI A;  1G02 A;  1O7M B;  1ZO2 A;  2W0Q A;  1SAR A;  2F86 B;  3E99 A;  2Z77 A;  5M19 A;  2UUG C;  1T2H A;  3NQZ A;  1ROA A;  2SAR A;  1TRP A;  3F40 A;  1RDS A;  1I70 A;  2IMJ A;  2KRT A;  1A2P A;  2QGU A;  1Q86 4;  3NBJ A;  2CWU A;  2P38 A;  3CC4 3;  1HKX A;  1A2K A;  3V92 A;  2GBW B;  2K3D A;  4MJD A;  3HOH A;  3X41 A;  3AHS A;  2ZHX B;  1M90 4;  2GU3 A;  3BU4 A;  2KF4 A;  2YX9 A;  1ZGX A;  3KII A;  2E2U A;  1JV2 B;  3OX9 A;  7RNT A;  3ER7 A;  1UGI A;  3GZB A;  2W9Q A;  1MOL A;  1RN4 A;  3NQY A;  1MGR A;  4K61 A;  3CME 3;  1RN1 A;  5CK6 A;  1QAK A;  4MMZ B;  3CXC 2;  3D5I A;  1S72 3;  1E3V A;  1FGM A;  4HM7 B;  1LRA A;  2F5M A;  1OHO A;  2OTJ 3;  1DVC A;  2R41 A;  4R9L A;  4OVM A;  2OQE A;  1QAF A;  1BIR A;  1K41 A;  1RGE A;  1WNH A;  3LYG A;  5ELU A;  1MWS A;  1YNV X;  1LNH A;  3MKI A;  1M9G A;  1Q40 B;  1IT7 A;  4NHF A;  3CPO A;  2XRX B;  4GB5 A;  3FLJ A;  3FF0 A;  1LOX A;  2LQV A;  3T8N A;  3CCL 3;  3B8L A;  3MSO A;  4J5K A;  3X3Z A;  5IEN A;  3UB1 A;  1YVS A;  1YGE A;  3SLU A;  4HJL B;  4AKZ A;  1AQZ A;  1TFK A;  3FSD A;  3MG2 A;  3N54 B;  4KT3 B;  4U13 A;  2WOH A;  3BLZ A;  3Q3F A;  4N3V A;  1Q7Y 4;  3LTD A;  2HMM B;  3BIR A;  1D6Z A;  3EBY A;  4WHA A;  3CNM A;  4I5Q A;  4LYL B;  1K9M 4;  3QK9 A;  1NNV A;  2W2C A;  3AMO A;  1RN7 A;  1TRQ A;  4FCJ A;  4LZI A;  1Q42 A;  4KFD A;  5D83 A;  4HM3 B;  6STD A;  1A2V A;  4N6V 0;  2V1L A;  3PS8 A;  1US1 A;  2P0X A;  3DGO A;  3F14 A;  2BMO B;  4HVN A;  5AYS C;  3AGN A;  1FUS A;  5AEU B;  4O3V A;  1IYY A;  4AKY A;  1I8V A;  2W6J H;  3F8X A;  1OUN A;  2K54 A;  1D6Y A;  3NHX A;  3G4S 3;  3G6E 3;  1GSP A;  2XGN A;  3KFQ C;  4FR9 A;  1IK3 A;  1FGT A;  1JN5 A;  1W2Z A;  4HKV B;  2BHM A;  3MYT A;  3OWY A;  4EC6 A;  5JPU A;  3KCH A;  4IT7 A;  5FW5 A;  1RLS A;  3Q2P A;  2AAE A;  4HM8 B;  1BRI A;  4R4K A;  3CCR 3;  3HZP A;  1BUQ A;  3IJE B;  5A0O B;  1K8A 4;  1OH0 A;  1BVI A;  1ROV A;  3DZL A;  3WDG B;  8RNT A;  1VZZ A;  3DM8 A;  2A15 A;  3K5T A;  2HOH A;  2UX0 A;  6GSP A;  4TX4 A;  1JZO A;  3S67 A;  1Q9E A;  3V99 A;  2F5W A;  3GAX A;  1D6U A;  1OAC A;  3CU3 A;  3AGO A;  3DH2 A;  4WFO A;  1LQM B;  4L7K A;  2CFW A;  5G2G A;  2RGQ A;  4HBR A;  1DET A;  5IG0 A;  1QVG 2;  3D79 A;  1GOU A;  1J2B A;  3GZX B;  3U97 A;  1LOV A;  1N5H A;  4HM1 B;  3PYJ A;  4WYK B;  3G0K A;  1BNI A;  2BMQ B;  2Z6B A;  4ZM8 A;  1FUW A;  3LH4 A;  1GS3 A;  3K0Z A;  3UJM A;  1UCK A;  1IV7 A;  2AAD A;  3ALA A;  1T5Y A;  1WQL B;  5IW9 A;  3CCV 3;  2H0H A;  2CX0 A;  1I0X A;  3NM2 A;  3BNC A;  1YGW A;  3HK4 A;  3KSP A;  1DMN A;  1GMR A;  2JDI H;  2H0I A;  3GZR A;  4CJN A;  2CG1 A;  1FGR A;  3OWU A;  1QVF 2;  3LTB A;  2CC3 A;  3DMC A;  2D1W A;  1RNT A;  5ELJ A;  1JJ2 2;  1EEJ A;  1Z1S A;  3CNX A;  4QWT A;  3GSP A;  1VQ5 3;  3MHE A;  4O8S A;  2ML6 A;  4BTY A;  3S29 A;  4K1U A;  1JKG B;  1O7N B;  1OPY A;  1W02 A;  4R1K A;  2ZL8 A;  4BTW A;  1IQ8 A;  3WR2 A;  1ULJ B;  4XB5 A;  1SQW A;  3LXU X;  2OOV A;  1BAN A;  1IVX A;  3FF2 A;  4N6O B;  1UGH I;  1N8Q A;  1TUH A;  5FGO A;  4FCM A;  3CCS 3;  2OTL 3;  1LQG C;  1EG9 B;  3JVC A;  5EQL A;  2QEX 3;  1W6Y A;  1B2U A;  1TIJ A;  3I0Y A;  1LOY A;  3SED A;  3D3L A;  1BSC A;  3DGN A;  4G1M B;  7GSP A;  1S5A A;  1IVW A;  1Q7H A;  3FKA A;  1Q40 A;  1T3B A;  1E3R A;  4STD A;  5M1A A;  3SOY A;  3WOF B;  1PU4 A;  1W6G A;  3BNB A;  1O7P B;  1OHS A;  2SBL A;  1BSB A;  4BU4 A;  3GRD A;  3FZW A;  3DUK A;  1UDI I;  3CCJ 3;  1JZD A;  1VQQ A;  3EF8 A;  2GBX B;  3BB9 A;  3NM7 A;  6RNT A;  5HOH A;  1OF5 B;  2ZDJ A;  2F99 A;  3EHC A;  1KQS 2;  1RHL A;  2Y73 A;  3JUM A;  5AII A;  5BU4 A;  2GEY A;  3M8C A;  1BRG A;  2Q07 A;  3DXO A;  1VQ8 3;  1JB5 A;  1IU7 A;  3KSE D;  1IQX A;  3NXJ A;  3U1W A;  2XGL A;  1UUW B;  1GOY A;  3CD6 3;  1N9E A;  5RNT A;  1RGC A;  2Z76 A;  1BRH A;  2C11 A;  3S5C A;  2MC8 A;  2P0M A;  1BSE A;  3K63 A;  1ZS7 A;  3LT9 A;  4WP5 A;  2BO9 B;  3FGY A;  3LT8 A;  2QIY A;  1GD3 A;  3B4P A;  2GXF A;  3EC9 A;  4KFE A;  3UL5 A;  1K73 4;  1I0V A;  4FMA A;  1TU5 A;  2HMJ B;  3RGR A;  1M1X B;  1W4N A;  1GD4 A;  1TJD A;  1V58 A;  4R80 A;  1X1W A;  1HZ1 A; 
#chains in the Genus database with same CATH homology
 4X2O A;  1QMA A;  2HMO B;  1NDO B;  4PEJ A;  1E97 A;  3PCR A;  2M7O A;  1UW1 A;  3B4O A;  4RNZ A;  5STD A;  2OWP A;  1IVV A;  1YI2 3;  5AI1 A;  1VQO 3;  1U8C B;  4X2H A;  4N6M A;  3GZY B;  4N6L A;  4H61 A;  2CW9 A;  4O02 B;  1FA3 A;  2FXT A;  2XSO B;  1SPU A;  4HYZ A;  5D81 A;  3NV0 B;  1U5O A;  1N8R 4;  1UI7 A;  2P09 A;  1SII A;  3O8Y A;  3WOD G;  5CF1 A;  1KD1 4;  1N5P A;  5JPP A;  1QJG A;  4MMX B;  2OCT A;  3EN8 A;  1KSI A;  1VQ9 3;  4N6T A;  4LEH A;  5IEP A;  1M1K 4;  3NBR A;  4RBN A;  1MNL A;  4WYK A;  4KZ1 A;  4EXR A;  3JUO A;  4XBX A;  3D9R A;  3VF1 A;  1WMN A;  1EKM A;  4AEQ A;  3EE1 A;  1PFP A;  1A67 A;  1W6C A;  1WTH A;  2HML B;  1CYV A;  2KXG A;  3S28 A;  5IG3 A;  1Q81 4;  2B24 B;  1UI8 A;  1SJW A;  1Y4K A;  4N6N B;  3F7S A;  1IT8 A;  1HU9 A;  4KVH A;  1VQ7 3;  4L8P A;  1RRH A;  1AR0 A;  4XM4 A;  3KE7 A;  2CFD A;  2PZV A;  5IER A;  4XDV A;  1KWI A;  3FG4 A;  3IMA B;  2MF7 A;  2W9P A;  8CHO A;  3KN4 A;  1JNQ A;  1OGX A;  3ECF A;  3Q1C A;  1JKG A;  2INX A;  3SOA A;  3N8B A;  3F8H A;  2P05 A;  2RSX A;  4IIA A;  1ZX2 A;  2BT3 A;  3FH1 A;  3FCS B;  3X42 A;  1CYU A;  5AEW B;  2XR8 B;  3KKG A;  1QAL A;  4L8O A;  4HM6 B;  1NWW A;  1DVD A;  4HZB B;  4BTX A;  3CC7 3;  3X3Y A;  3LZA A;  5IG4 A;  4OK0 A;  3LOY A;  2IA7 A;  3JUN A;  1VQK 3;  3G71 3;  4J9A A;  1RKY A;  2PNC A;  1W2B 2;  3N9H A;  2FGT A;  4HZ9 B;  1NB5 I;  1O7W B;  5EEO A;  1JRQ A;  1JB4 A;  4JF8 A;  3UNL A;  1EA2 A;  2RFR A;  2HMN B;  2W04 A;  1W7C A;  3K7C A;  2CFG A;  1IDP A;  3CCQ 3;  1OF5 A;  5JBS A;  3NX0 A;  2XSH B;  1AVL A;  3CCE 3;  3FG3 A;  3HIG A;  1IVU A;  1AVK A;  1WMP A;  4ORL A;  5I97 A;  2IUJ A;  1VQP 3;  1VQ4 3;  1NO3 A;  4EV5 A;  2YFI B;  1VQN 3;  1W00 A;  3X3X A;  3CPW 2;  1GY7 A;  3GWR A;  1SIH A;  3TDG A;  3EN1 B;  2QA4 3;  2E2V A;  2KCD A;  1W5Z A;  1RRL A;  2XFS A;  3JUP A;  3L0R A;  4OUQ A;  3MG3 A;  4K1V A;  5KP3 A;  4K90 B;  1AV4 A;  1OGZ A;  1KC8 4;  2WO0 A;  1STD A;  2XF3 A;  3F7X A;  4NRE A;  4MMY B;  4XBY A;  5IF6 A;  3EQQ B;  4WWU C;  3MWZ A;  2Z7A A;  1ASK A;  1FGQ A;  4I4K A;  3JUQ A;  1LVN A;  2CG0 A;  1WMO A;  3MG1 A;  4KFF A;  2W56 B;  1O7H B;  4EYC A;  4RNY A;  2B1X B;  2FNQ A;  5IG5 A;  3EBT A;  3MPH A;  4EBG A;  1Q82 4;  3F9S A;  3HX8 A;  5LC7 A;  3T0U A;  2CHC A;  3I56 3;  3OXA A;  3KZT A;  3SXX A;  2CK3 H;  3NV0 A;  7STD A;  2L4V A;  3PCS A;  5KP4 A;  2CFL A;  5TGN A;  1VQL 3;  2Y74 A;  2F98 A;  3PZW A;  2WGO A;  5HGR A;  3WOE B;  1YHQ 3;  5CLK A;  3NUV A;  3CMA 3;  2YFL B;  3K9M C;  5AIG A;  3OV4 A;  1G96 A;  1UUV B;  1NJI 4;  4FMC A;  2WGQ A;  3B7C A;  1YIJ 3;  5IEO A;  2XFT A;  3EB8 A;  1TP6 A;  1GY6 A;  3G8Z A;  3S27 A;  3T8U A;  1DMM A;  1GY5 A;  2CWT A;  3H3H A;  3LTA A;  4XDW A;  1DMQ A;  1OCV A;  3BND A;  4HM2 B;  4CDL A;  2CFK A;  2O9U X;  4HM5 B;  2XEP A;  2W03 A;  1O7G B;  3DGM A;  1NB3 I;  5CXO A;  5DRE A;  1YJ9 3;  1TFO A;  1IV9 A;  3HII A;  3RGA A;  3OWS A;  3PXM A;  2CIU A;  1YVB I;  3LML A;  2ML5 A;  3Q90 A;  5AYR B;  1CEW I;  3DGL A;  1A90 A;  3CCU 3;  2STD A;  1YJW 3;  4FMB A;  3RDE A;  2D42 A;  2I9W A;  3WA2 X;  1W01 A;  3BNE A;  1L5G B;  1ISK A;  3VSY A;  4IPB A;  2GEX A;  3WA3 A;  1OHP A;  2OOV C;  1LXE A;  4CCV A;  3NBB A;  1YJN 3;  2HMK B;  1R4C A;  3X40 A;  2BNG A;  4EV2 A;  3PGB A;  2C10 A;  1VQ6 3;  2CH9 A;  1YIT 3;  3AMO B;  3CCM 3;  3WMD A;  3J7Y d;  3EX9 A;  1STF I;  5BVB A;  3V98 A;  4LSO A;  2O3O A;  2GU1 A;  2LYX A;  5LC6 A;  4GL6 A;  1DYU A;  3H51 A;  3QRD A;  3VGN A;  3STD A;  4H3U A;  4XBT A;  3EJV A;  5KP1 A;  5BXQ A;  4LMI A;  1VQM 3;  1C7H A;  4HM0 B;  3UL6 A;  1JB2 A;  1JN5 B;  1RJO A;  3ROB A;  1K28 A;  2CWV A;  2WOF A;  3G16 A;  5D82 A;  5CF2 A;  3DY5 A;  2OQE C;  3OW2 2;  3I55 3;  1EQK A;  1NU3 A;  5AIH A;  2RCD A;  5AIF A;  4O2H A;  4Q53 A;  4RZM A;  1IQY A;  4FCZ A;  4R9K A;  4N6U A;  2K0M A;  4J8T A;  2E2T A;  4FMD A;  3FG1 A;  5DRV A;  1GYB A;  2W56 A;  1CQS A;  2IUK A;  2R4I A;  2XH9 A;  3A76 A;  1V74 A;  4LGQ A;  1N9J A;  2BMR B;  2CKF B;  1ULI B;  3HI7 A;  3SX1 A;  3IPT A;  2YFJ B;  3LTC A;  1F8N A;  4HM4 B;  5EVH A;  3CC2 3;  1FGO A;  2JQ5 A;  3SVA A;  4JRF A;  1O7M B;  1ZO2 A;  2W0Q A;  3E99 A;  2F86 B;  2Z77 A;  3NQZ A;  1ROA A;  3F40 A;  2IMJ A;  2KRT A;  2QGU A;  1Q86 4;  3NBJ A;  2CWU A;  2P38 A;  3CC4 3;  1HKX A;  1A2K A;  3V92 A;  2GBW B;  4MJD A;  3X41 A;  1M90 4;  2GU3 A;  2YX9 A;  3KII A;  2E2U A;  1JV2 B;  3OX9 A;  3ER7 A;  3GZB A;  2W9Q A;  1MOL A;  3NQY A;  4K61 A;  3CME 3;  5CK6 A;  1QAK A;  4MMZ B;  3CXC 2;  1S72 3;  1E3V A;  1FGM A;  4HM7 B;  1OHO A;  2OTJ 3;  1DVC A;  4R9L A;  4OVM A;  2OQE A;  1QAF A;  5ELU A;  1K41 A;  1WNH A;  1VQ8 3;  3LYG A;  1LNH A;  3MKI A;  1M9G A;  1Q40 B;  1IT7 A;  4NHF A;  3CPO A;  2XRX B;  4GB5 A;  3FLJ A;  3FF0 A;  1LOX A;  2LQV A;  3T8N A;  3CCL 3;  3B8L A;  3MSO A;  3X3Z A;  5IEN A;  3UB1 A;  3SLU A;  1YGE A;  4HJL B;  4AKZ A;  1TFK A;  3FSD A;  3MG2 A;  3N54 B;  4U13 A;  2WOH A;  3BLZ A;  4N3V A;  1Q7Y 4;  3LTD A;  2HMM B;  1D6Z A;  3EBY A;  4WHA A;  3CNM A;  1K9M 4;  3QK9 A;  2W2C A;  3AMO A;  1RN7 A;  4FCJ A;  4LZI A;  1Q42 A;  4KFD A;  5D83 A;  4HM3 B;  6STD A;  1A2V A;  4N6V 0;  2V1L A;  3PS8 A;  1US1 A;  2P0X A;  3DGO A;  3F14 A;  2BMO B;  4HVN A;  5AYS C;  5AEU B;  4O3V A;  4AKY A;  2W6J H;  3F8X A;  1OUN A;  2K54 A;  1D6Y A;  3NHX A;  3G4S 3;  3G6E 3;  2XGN A;  4FR9 A;  3KFQ C;  1IK3 A;  1FGT A;  1JN5 A;  1W2Z A;  4HKV B;  2BHM A;  3MYT A;  3OWY A;  4EC6 A;  5JPU A;  4IT7 A;  5FW5 A;  3Q2P A;  4HM8 B;  4R4K A;  3CCR 3;  3HZP A;  1BUQ A;  3IJE B;  5A0O B;  1K8A 4;  1OH0 A;  3DZL A;  1ROV A;  3WDG B;  1VZZ A;  3DM8 A;  2A15 A;  3K5T A;  2UX0 A;  4TX4 A;  3S67 A;  3V99 A;  3GAX A;  1D6U A;  1OAC A;  3CU3 A;  4WFO A;  4L7K A;  2CFW A;  5G2G A;  2RGQ A;  4HBR A;  5IG0 A;  1QVG 2;  1J2B A;  3GZX B;  3U97 A;  1N5H A;  4HM1 B;  3PYJ A;  4WYK B;  3G0K A;  2BMQ B;  2Z6B A;  4ZM8 A;  1FUW A;  3LH4 A;  1GS3 A;  3K0Z A;  3UJM A;  1IV7 A;  3ALA A;  1T5Y A;  1WQL B;  5IW9 A;  3CCV 3;  3NM2 A;  3BNC A;  3HK4 A;  3KSP A;  1DMN A;  2JDI H;  3GZR A;  2CG1 A;  1FGR A;  3OWU A;  1QVF 2;  3LTB A;  2CC3 A;  3DMC A;  2D1W A;  5ELJ A;  1JJ2 2;  1Z1S A;  3CNX A;  4QWT A;  1VQ5 3;  3MHE A;  4O8S A;  2ML6 A;  4BTY A;  3S29 A;  4K1U A;  1JKG B;  1O7N B;  1OPY A;  1W02 A;  4R1K A;  2ZL8 A;  4BTW A;  1IQ8 A;  1ULJ B;  4XB5 A;  1SQW A;  3LXU X;  2OOV A;  1IVX A;  3FF2 A;  4N6O B;  1N8Q A;  1TUH A;  5FGO A;  4FCM A;  3CCS 3;  2OTL 3;  1EG9 B;  3JVC A;  5EQL A;  2QEX 3;  1W6Y A;  1TIJ A;  3I0Y A;  3SED A;  3D3L A;  3DGN A;  4G1M B;  1S5A A;  1IVW A;  3FKA A;  1Q40 A;  1E3R A;  4STD A;  3SOY A;  3WOF B;  1PU4 A;  1W6G A;  3BNB A;  1O7P B;  1OHS A;  2SBL A;  3GRD A;  3FZW A;  3DUK A;  3CCJ 3;  3EF8 A;  2GBX B;  3BB9 A;  3NM7 A;  1OF5 B;  2ZDJ A;  2F99 A;  3EHC A;  1KQS 2;  2Y73 A;  3JUM A;  5AII A;  2GEY A;  3M8C A;  2Q07 A;  3DXO A;  1JB5 A;  1IU7 A;  3KSE D;  1IQX A;  3NXJ A;  3U1W A;  2XGL A;  1UUW B;  3CD6 3;  1N9E A;  2Z76 A;  2C11 A;  3S5C A;  2MC8 A;  2P0M A;  3LT9 A;  3K63 A;  4WP5 A;  2BO9 B;  3FGY A;  3LT8 A;  2QIY A;  1GD3 A;  3B4P A;  2GXF A;  3EC9 A;  4KFE A;  3UL5 A;  1K73 4;  4FMA A;  1TU5 A;  2HMJ B;  3RGR A;  1M1X B;  1W4N A;  1GD4 A;  4R80 A;  4MEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...