3EE1A

Novel fold of vira, a type iii secretion system effector protein from shigella flexneri
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
399
structure length
341
Chain Sequence
EVASYCDRVVAAVEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFPVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQLNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPENNCGHIIKINAVVPGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Effector protein virA
publication title Novel fold of VirA, a type III secretion system effector protein from Shigella flexneri
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Hydrolase
total genus 86
structure length 341
sequence length 399
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ee1A01
3Q1CA 3EB8A 4FMAA 4FMDA 3PCSA 4FMCA 4FMBA 3EE1A 3PCRA
chains in the Genus database with same CATH superfamily
3F40A 4L7KA 4BTXA 1OF5A 1O7HB 3DGMA 1J2BA 1EA2A 1UGIA 1FUWA 1LRAA 2HMMB 1D6YA 2KRTA 1NWWA 3FGYA 1A2VA 1NB3I 3SX1A 2WO0A 3UJMA 3ZFZA 3X42A 2HOHA 3S27A 4WFOA 2XFSA 1MWRA 2J8XB 4J5KA 5BIRA 1G0TA 3IMAB 3HIGA 5ELJA 3NHXA 3F8XA 4XM4A 2O3OA 4K1VA 1BGSA 3D4AA 3IPTA 3UB1A 2H0GA 3IJEB 5STDA 4R4KA 1GMQA 5EVHA 2F4YA 4STDA 1RRHA 1ZX2A 4BL3A 1O7MB 1I70A 1JB5A 1BOXA 1LNHA 5TGNA 2RBIA 5AIIA 1QVG2 1QALA 5IEOA 1Q7HA 3K0ZA 1PFPA 5ELUA 4EV5A 2IYJA 2Z7AA 3KKGA 4KZ1A 2HMKB 1BNIA 1UUWB 2MF7A 3HZPA 1FYSA 3PXMA 1FUTA 3CPW2 3CC43 1DMQA 2OOVA 1UUVB 1YJ93 2GBXB 4FCJA 2ZA4A 1UDII 1B2XA 1B2UA 1X1UA 3CPOA 1W02A 4N6TA 3STDA 4TX4A 1TJDA 4R80A 4KT3B 5KP4A 1GMRA 3HK4A 5IG3A 1I0XA 1UCJA 2XGLA 3GZXB 1IVUA 3RGAA 1STFI 1N9EA 1B21A 1GD3A 1RN4A 1VZZA 1I3IA 3ROBA 4X2HA 4N6V0 1W7CA 2KF4A 3B7CA 3ECFA 4WWUC 4X2OA 1IQYA 2CWUA 5CK6A 1JJ22 2P0MA 1RHLA 2FNQA 2BU4A 1NO3A 1LXEA 2C4BA 2E2TA 1QJGA 1YIJ3 3DXOA 1JZOA 3A5EA 3X3YA 2R4IA 1VQM3 1GY5A 1M1XB 2HMOB 3EBYA 4O2HA 1E97A 5A0OB 3AGNA 1EQKA 4FCZA 2F98A 1JBSA 1MOLA 3AMOA 3EC9A 5FGOA 2F5MA 1RGLA 4O3VA 1TFKA 1AY7A 1R4YA 2BT3A 3FG3A 3CNXA 1SIIA 2KF5A 2P09A 3X40A 5IF6A 3HX8A 5D81A 3LTBA 3ZG0A 4EBGA 2RGQA 2CFDA 1FGRA 6STDA 3ZG5A 3K7CA 2CFLA 1FZUA 1ZGXA 3NBJA 3G6E3 3WDGB 3G713 1ROVA 4ILFA 3X3XA 1YI23 1W6YA 3SXXA 1CYUA 2W9QA 1EEJA 2W56A 2ZDJA 4FCMA 3WR2A 4LZIA 1UI8A 4HAAA 1BIRA 3MSOA 2AAEA 3B4OA 2IMJA 1YGEA 3BIRA 5CF2A 1GYBA 2C11A 5IENA 2R41A 1V74A 1RSNA 1D6ZA 3DGYA 2OTL3 3KCHA 1GOVA 1UUGB 3K63A 4FMCA 5D82A 5AYSC 2PNCA 5M1AA 1JBRA 3KN4A 3CNMA 1BRSA 2K3DA 3WODG 1G96A 4WP5A 5AIFA 3X3ZA 1B20A 3BLZA 3I563 1T3BA 5HGRA 1BSAA 1RN1A 3WA3A 1IV9A 8CHOA 4HJLB 3CCQ3 1WQLB 2CG0A 3NBBA 1YVBI 3RGRA 1JN5B 1GS3A 1RJOA 4I5QA 4R1KA 4L8PA 1HKXA 1TIJA 4GSPA 1Q864 1QMAA 1F8NA 2F86B 1TTOA 1UI7A 3GZYB 2XSHB 3CCL3 1DMNA 1YHQ3 4K61A 3FG1A 3EN8A 5JBSA 3LTCA 3NV0B 1QAFA 2A15A 3D5GA 3B8LA 1X1XA 4K1UA 4EV2A 2Y73A 4MJDA 3CC23 3FKAA 1A2KA 1M9GA 3CCE3 4IT7A 1ASKA 3OWUA 1CH0A 1FW7A 2FGTA 3G8ZA 1IDPA 2CX0A 3BU4A 3OWSA 1RGHA 3WOEB 1ULJB 3A76A 2CWVA 3NXJA 4Q53A 3K9MC 1RCKA 1W2B2 1O7NB 4FMBA 1OPYA 1NDOB 1NU3A 4JF8A 3WA2X 3OV4A 1M1K4 1GMPA 4O02B 1S723 5BVBA 3MWZA 1RNBA 3AGOA 2WGQA 4WHAA 2ZHXB 4RZMA 3SVAA 3VGNA 2XSOB 3F9SA 2FXTA 4QWTA 1M904 3F14A 2CC3A 2CW9A 4HKVB 1YVSA 4N6UA 1PU4A 2BMQB 1B2MA 1GOYA 1WMNA 1LOXA 4CDLA 1HYFA 1BNGA 3FF2A 1BRJA 1IT7A 4XBXA 3SOAA 1UGHI 2OCTA 2QEX3 2BO9B 1JZDA 4GL6A 1FUSA 1OHOA 3LTAA 1W5ZA 3LH4A 1SARA 2F99A 3HOHA 3MG2A 3Q2PA 1EKMA 2MC8A 1VQ53 3BNEA 1R4CA 1RGCA 1IU7A 2C10A 2P38A 3WMDA 2GEXA 5JPUA 2D1WA 1BUQA 5FW5A 1OHPA 1IQ8A 1WTHA 1DVDA 1N8R4 1V58A 1IQXA 4HM4B 1ZO2A 1MGWA 1JB4A 3SOYA 4LMIA 4ORLA 1VQQA 4DKIA 1BSDA 1JRQA 2KF6A 2STDA 1VQ43 1GOUA 2CKFB 3J7Yd 1VQL3 2CX1A 1A90A 1JKGB 1E3RA 3S67A 3T0UA 1NNVA 4MEIA 1MWUA 3G16A 2INXA 3LYGA 3PS8A 5AEUB 5D83A 3Q3FA 4K90B 1YJW3 1AQZA 5G1KA 1UCIA 1E3VA 5AIHA 2AADA 2IA7A 1RN7A 4HM7B 1I8VA 1RGKA 2B24B 2BMOB 3E99A 3T8NA 4IPBA 5IW9A 1TUHA 4OK0A 5AEWB 2RSXA 4HM3B 4OVMA 4NREA 1RRLA 3SLUA 1JN5A 3BNBA 4EW5A 1IYYA 3V98A 2Q07A 5LC6A 1GSPA 2GXFA 4ZM8A 3LT8A 2GBWB 3FF0A 5LC7A 1BRKA 3NV0A 2HMNB 4R9LA 3AHWA 1Q824 3S5CA 4L8OA 1B3SA 3HI7A 3VSYA 2ZL8A 1BUJA 3GRDA 2OQEC 3EJVA 3K5TA 1ISKA 1DVCA 3DY5A 1BNRA 1VQK3 3DZLA 3OXAA 3QK9A 4H3UA 3D5IA 1JNQA 3NX0A 3LTDA 5CLKA 2KXGA 3D79A 3G4S3 2M7OA 2W0QA 1RGFA 3RNTA 2CH9A 1SJWA 1ROAA 1K8A4 1YNVX 3PCSA 3DM8A 1DE3A 3OX9A 1W6GA 4HM8B 4EYCA 5BXQA 3MKIA 1B2ZA 1B2SA 5KP3A 5I97A 4J8TA 2UX0A 1D6UA 3O8YA 4LYLB 4FR9A 4CPKA 3CCU3 1OH0A 3U97A 3N54B 2I9WA 2HMJB 3GSPA 3NM7A 3CMA3 3I0YA 4MMXB 2F56A 4XBTA 4LGQA 1T2IA 6GSPA 3FZWA 3DGOA 3RDEA 3F8HA 3PZWA 3AHSA 3SEDA 2XR8B 5G1LA 1MWTA 5HOHA 1IV7A 4HBRA 4XDWA 1KC84 4HVNA 4H61A 1BSEA 2JQ5A 3B4PA 1BU4A 3WOFB 4G1MB 1BNEA 1G02A 1NB5I 1WMOA 1DYUA 1N5PA 3L0RA 3JUPA 3OW22 1I3FA 4GB5A 1YIT3 2WOHA 3EF8A 3S29A 1RGAA 1SPUA 1BRNL 1Q42A 1PY3A 4BTWA 3H3HA 1ZS7A 3D3LA 4U13A 4WYKB 2BMRB 2W6JH 3LT9A 4CJNA 2GU3A 8RNTA 5DREA 1RCLA 4AKZA 2YFLB 3PYJA 1GY7A 1Q40B 4KVHA 1RGEA 4LSOA 2YFJB 1C7HA 1N5HA 1OGXA 1RGGA 3N8BA 1GD4A 3DH2A 2Y74A 1FA3A 3GZRA 3D9RA 2L1SA 1VQ93 2B1XB 1JKGA 3OWYA 5AIGA 2O9UX 3DGNA 3CXC2 1UW1A 3NQYA 4HM6B 3BB9A 2HMLB 3FG4A 3H51A 3HIIA 5EEOA 3MHEA 1FGQA 4MMYB 1OHSA 5CF1A 5JPPA 1FGMA 2GU1A 4J5GA 3DUKA 4R9KA 5IERA 1BSCA 1BRGA 1FGOA 1RLSA 1C54A 1BNJA 1WMPA 1MWSA 1W01A 3GWRA 3V92A 1A67A 1IVVA 2F5WA 2RNTA 4XB5A 4BU4A 2Z6BA 4HZBB 3I553 4MMZB 4BL2A 1SIHA 7STDA 1YJN3 3LMLA 1I2GA 1JV2B 4HM2B 2KAAA 2WOFA 3GAXA 1BAOA 3DGLA 2OQEA 3BNCA 2ML5A 1U8CB 1T5YA 4N6MA 3CU3A 2CFKA 2XGNA 3LZAA 4AEQA 6RNTA 1VQP3 1HZ1A 2GSPA 3N9HA 4FMAA 1YGWA 1I2FA 3G0KA 2SBLA 2YFIB 4J9AA 5G2GA 3U1WA 1KQS2 4HOHA 1X1YA 1RKYA 3DMCA 1O7GB 1BANA 3X41A 4HM0B 1HU9A 3PGBA 3JUQA 2UGIA 3EN1B 1STDA 1CQSA 3Q90A 1OCVA 2W03A 5EQLA 5IG4A 3Q1CA 2QIYA 3NQZA 2BIRA 3S28A 4N6NB 3UNLA 2PZVA 1VQN3 3F7SA 4RNTA 3UL6A 2QGUA 1Q814 1OGZA 2H0HA 2JDIH 3ALAA 4FMDA 3BNDA 1US1A 1CYVA 2XFTA 2IY2A 5AI1A 2IUJA 1VQ63 4RNZA 1DETA 3PCRA 2Z76A 3KE7A 2CIUA 4IIAA 1N9JA 1N8QA 5BU4A 1OF5B 3LXUX 1JBTA 2GEYA 2CFWA 4HZ9B 1K28A 4JRFA 1TRQA 4HM1B 7GSPA 2CG1A 3SYUA 7RNTA 4AKYA 3CCR3 4PEJA 5IG5A 5RNTA 1AV4A 3KFQC 1Z1SA 1TRPA 1IK3A 3NM2A 4LEHA 1VQO3 3CCM3 1I2EA 1TFOA 3JUOA 1AVLA 1CEWI 2RCDA 1DMMA 1W2ZA 3MG3A 1QVF2 5AYRB 2P0XA 1ULIB 1QAKA 2CHCA 1VQ73 1W6CA 1WNHA 2XEPA 1IT8A 1GY6A 4NPBA 4XBYA 2Z77A 2OTJ3 4WYKA 2CWTA 3QRDA 4N6LA 2BNGA 4XDVA 5KP1A 3UL5A 1EG9B 1UCLA 2XF3A 2ML6A 2IUKA 4KFFA 1LVNA 4EC6A 3NBRA 1Q40A 1JB2A 5CXOA 1Y4KA 3T8UA 2RFRA 2OWPA 4HYZA 1OUNA 2BHMA 4HM5B 1U5OA 1AVKA 3JUNA 3NUVA 1BNFA 2OOVC 1O7WB 1V57A 1IVXA 1TP6A 2SARA 1BRIA 2LYXA 3EB8A 2YX9A 3CME3 1Q9EA 1RDSA 2LQVA 3FLJA 3MPHA 4O8SA 4RNYA 4NHFA 2E2VA 3M8CA 1O7PB 1LQMB 4OUQA 3KSED 3V99A 4N3VA 4N6OB 1AR0A 2K0MA 2P05A 3EHCA 1Q7Y4 3EBTA 4RBNA 2W2CA 1SQWA 3URPA 4EXRA 1K734 1UCKA 1LOYA 2L4VA 3CC73 1BVIA 1T2HA 3FH1A 5M18A 1KWIA 1S5AA 1LOVA 5IG0A 3AMOB 1LQGC 2UUGC 2E2UA 2CFGA 3FSDA 4I4KA 1LNIA 1KD14 4GHOA 1K41A 3MG1A 2H0IA 3JVCA 3LOYA 3JUMA 1A2PA 1LOWA 5M19A 3GZBA 3MYTA 5IEPA 1VQ83 3CD63 2D42A 3KSPA 1L5GB 1BNSA 1I0VA 1BRHA 1B27A 1MGRA 1NJI4 1PYLA 4KFEA 3TDGA 4KFDA 3EQQB 9RNTA 4BIRA 1IVWA 1BSBA 1W4NA 2K54A 2W56B 5DRVA 1RMSA 3FCSB 3KZTA 2KCDA 1RNTA 1RTUA 1FGTA 5GSPA 2XH9A 3CCV3 4CCVA 2QA43 3EX9A 1MNLA 3CCS3 2CK3H 1EUIC 3EE1A 2KF3A 4BTYA 3CCJ3 1K9M4 2W9PA 2W04A 1X1WA 3F7XA 3VF1A 1KSIA 1TU5A 1OACA 2WGOA 2XRXB 3KIIA 2V1LA 1W00A 3WHOA 3ER7A
chains in the Genus database with same CATH topology
3F40A 4L7KA 4BTXA 1OF5A 1O7HB 3DGMA 1J2BA 1EA2A 1FUWA 2KRTA 2HMMB 1D6YA 3FGYA 1NWWA 3SX1A 1A2VA 1NB3I 3UJMA 2WO0A 3X42A 3S27A 4WFOA 2XFSA 3IMAB 3HIGA 5ELJA 3NHXA 3F8XA 4XM4A 2O3OA 4K1VA 3IPTA 3UB1A 3IJEB 5STDA 4R4KA 5EVHA 4STDA 1RRHA 1ZX2A 1O7MB 1JB5A 5TGNA 1LNHA 5AIIA 1QVG2 1QALA 5IEOA 3K0ZA 1PFPA 5ELUA 4EV5A 4KZ1A 2Z7AA 3KKGA 2HMKB 1UUWB 2MF7A 3HZPA 3PXMA 3CPW2 3CC43 1DMQA 2OOVA 1UUVB 1YJ93 2GBXB 4FCJA 3CPOA 1W02A 4N6TA 3STDA 4TX4A 4R80A 5KP4A 3HK4A 5IG3A 2XGLA 3GZXB 1IVUA 3RGAA 1STFI 1N9EA 1GD3A 1VZZA 3ROBA 4X2HA 4N6V0 1W7CA 3B7CA 3ECFA 4WWUC 4X2OA 1IQYA 2CWUA 5CK6A 1JJ22 2P0MA 2FNQA 1NO3A 1LXEA 2E2TA 1QJGA 1YIJ3 3DXOA 3X3YA 2R4IA 1VQM3 1GY5A 1M1XB 2HMOB 3EBYA 4O2HA 1E97A 5A0OB 1EQKA 4FCZA 2F98A 1MOLA 3AMOA 3EC9A 5FGOA 4O3VA 1TFKA 2BT3A 3FG3A 3CNXA 1SIIA 2P09A 3X40A 5IF6A 3HX8A 5D81A 3LTBA 4EBGA 2RGQA 2CFDA 1FGRA 6STDA 3K7CA 2CFLA 3NBJA 3G6E3 3WDGB 3G713 1ROVA 3X3XA 1YI23 1W6YA 3SXXA 1CYUA 2W9QA 2W56A 2ZDJA 4FCMA 4LZIA 1UI8A 3MSOA 3B4OA 2IMJA 1YGEA 5CF2A 1GYBA 2C11A 5IENA 1V74A 1D6ZA 2OTL3 3K63A 4FMCA 5D82A 5AYSC 2PNCA 3KN4A 3CNMA 3WODG 1G96A 4WP5A 5AIFA 3X3ZA 3BLZA 3I563 5HGRA 3WA3A 1IV9A 8CHOA 4HJLB 3CCQ3 2CG0A 1WQLB 3NBBA 1YVBI 3RGRA 1JN5B 1GS3A 1RJOA 4R1KA 4L8PA 1HKXA 1TIJA 1Q864 1QMAA 1F8NA 2F86B 3GZYB 1UI7A 3CCL3 2XSHB 1DMNA 1YHQ3 4K61A 3FG1A 3EN8A 5JBSA 3LTCA 3NV0B 1QAFA 2A15A 3B8LA 4EV2A 4K1UA 2Y73A 4MJDA 3CC23 3FKAA 1A2KA 1M9GA 3CCE3 4IT7A 1ASKA 3OWUA 2FGTA 3G8ZA 1IDPA 3OWSA 3WOEB 1ULJB 1W00A 3A76A 2CWVA 3NXJA 4Q53A 3K9MC 1W2B2 1O7NB 4FMBA 1OPYA 1NDOB 1NU3A 4JF8A 3WA2X 3OV4A 1M1K4 4O02B 1S723 5BVBA 3MWZA 2WGQA 4WHAA 4RZMA 3SVAA 3VGNA 2XSOB 3F9SA 2FXTA 4QWTA 1M904 3F14A 2CC3A 2CW9A 4HKVB 4N6UA 1PU4A 2BMQB 1WMNA 1LOXA 4CDLA 3FF2A 1IT7A 4XBXA 3SOAA 2OCTA 2QEX3 2BO9B 4GL6A 1OHOA 3LTAA 1W5ZA 3LH4A 2F99A 3MG2A 3Q2PA 2MC8A 1VQ53 1EKMA 3BNEA 1R4CA 2C10A 1IU7A 3WMDA 2GEXA 5JPUA 2D1WA 1BUQA 5FW5A 1OHPA 1IQ8A 1WTHA 1DVDA 1N8R4 1IQXA 4HM4B 1ZO2A 1JB4A 3SOYA 4LMIA 4ORLA 1JRQA 2STDA 2CKFB 3J7Yd 1VQL3 1A90A 1JKGB 1E3RA 3S67A 3T0UA 4MEIA 3G16A 2INXA 3LYGA 3PS8A 5AEUB 5D83A 1YJW3 4K90B 1E3VA 5AIHA 2IA7A 4HM7B 1RN7A 2B24B 2BMOB 3E99A 3T8NA 4IPBA 5IW9A 1TUHA 4OK0A 5AEWB 2RSXA 4HM3B 4OVMA 4NREA 1RRLA 3SLUA 1JN5A 3BNBA 3V98A 2Q07A 5LC6A 2GXFA 4ZM8A 3LT8A 2GBWB 3FF0A 5LC7A 3NV0A 2HMNB 4R9LA 1Q824 3S5CA 4L8OA 3HI7A 3VSYA 2ZL8A 3GRDA 2OQEC 3EJVA 3K5TA 1ISKA 1DVCA 3DY5A 1VQK3 3DZLA 3OXAA 3QK9A 4H3UA 1JNQA 3NX0A 3LTDA 5CLKA 2KXGA 3G4S3 2M7OA 2W0QA 2CH9A 1SJWA 1ROAA 1K8A4 3PCSA 3DM8A 3OX9A 1W6GA 4HM8B 4EYCA 5BXQA 3MKIA 5KP3A 5I97A 4J8TA 2UX0A 1D6UA 3O8YA 4FR9A 3CCU3 1OH0A 3U97A 3N54B 2I9WA 2HMJB 3NM7A 3CMA3 3I0YA 4MMXB 4XBTA 4LGQA 3FZWA 3DGOA 3RDEA 3F8HA 3PZWA 3SEDA 2XR8B 1IV7A 4HBRA 4XDWA 1KC84 4HVNA 4H61A 2JQ5A 3B4PA 3WOFB 4G1MB 1NB5I 1WMOA 1DYUA 1N5PA 3L0RA 3JUPA 3OW22 4GB5A 1YIT3 2WOHA 3EF8A 3S29A 1SPUA 1Q42A 4BTWA 3H3HA 3D3LA 4U13A 4WYKB 2BMRB 2W6JH 3LT9A 2GU3A 5DREA 4AKZA 2YFLB 3PYJA 1GY7A 1Q40B 4KVHA 4LSOA 2YFJB 1N5HA 1C7HA 1OGXA 3N8BA 1GD4A 1FA3A 2Y74A 3GZRA 3D9RA 1VQ93 2B1XB 1JKGA 3OWYA 5AIGA 2O9UX 3DGNA 3CXC2 1UW1A 3NQYA 4HM6B 3BB9A 2HMLB 3FG4A 3H51A 3HIIA 5EEOA 3MHEA 1FGQA 4MMYB 1OHSA 5CF1A 5JPPA 1FGMA 2GU1A 4R9KA 3DUKA 5IERA 1FGOA 1WMPA 3V92A 1W01A 3GWRA 1A67A 1IVVA 4XB5A 2Z6BA 4HZBB 3I553 4MMZB 1SIHA 7STDA 1YJN3 3LMLA 1JV2B 4HM2B 2WOFA 3GAXA 3DGLA 2OQEA 3BNCA 2ML5A 1U8CB 1T5YA 4N6MA 3CU3A 2CFKA 2XGNA 3LZAA 4AEQA 1VQP3 3N9HA 4FMAA 3G0KA 2SBLA 2YFIB 4J9AA 5G2GA 3U1WA 1KQS2 1RKYA 3DMCA 1O7GB 3X41A 4HM0B 1HU9A 3PGBA 3JUQA 3EN1B 1STDA 1CQSA 3Q90A 1OCVA 2W03A 5EQLA 5IG4A 3Q1CA 2QIYA 3NQZA 3S28A 4N6NB 3UNLA 2PZVA 1VQN3 3F7SA 3UL6A 1Q814 2QGUA 1OGZA 2JDIH 3ALAA 4FMDA 3BNDA 1US1A 1CYVA 2XFTA 5AI1A 2IUJA 1VQ63 4RNZA 3PCRA 2Z76A 3KE7A 2CIUA 4IIAA 1N9JA 1N8QA 1OF5B 3LXUX 2GEYA 2CFWA 4HZ9B 1K28A 4JRFA 4HM1B 2CG1A 4AKYA 3CCR3 4PEJA 5IG5A 1AV4A 3KFQC 1Z1SA 1IK3A 3NM2A 4LEHA 1VQO3 3CCM3 1TFOA 3JUOA 1AVLA 1CEWI 2RCDA 1DMMA 1W2ZA 3MG3A 1QVF2 5AYRB 2P0XA 1ULIB 1QAKA 2CHCA 1VQ73 1W6CA 1WNHA 2XEPA 1IT8A 1GY6A 4XBYA 2Z77A 2OTJ3 4WYKA 2CWTA 3QRDA 4N6LA 2BNGA 4XDVA 5KP1A 3UL5A 1EG9B 2XF3A 2ML6A 2IUKA 4KFFA 1LVNA 4EC6A 3NBRA 1Q40A 1JB2A 5CXOA 1Y4KA 3T8UA 2RFRA 2OWPA 4HYZA 1OUNA 2BHMA 4HM5B 1U5OA 1AVKA 3JUNA 3NUVA 2OOVC 1O7WB 1IVXA 1TP6A 2LYXA 3EB8A 2YX9A 3CME3 2LQVA 3FLJA 3MPHA 4O8SA 4RNYA 4NHFA 2E2VA 3M8CA 1O7PB 4OUQA 3KSED 3V99A 4N3VA 4N6OB 1AR0A 2K0MA 2P05A 3EHCA 1Q7Y4 3EBTA 4RBNA 2W2CA 1SQWA 4EXRA 1K734 2L4VA 3CC73 3FH1A 1KWIA 1S5AA 5IG0A 3AMOB 2E2UA 2CFGA 3FSDA 4I4KA 1KD14 1K41A 3MG1A 3JVCA 3LOYA 3JUMA 3GZBA 3MYTA 5IEPA 1VQ83 3CD63 2D42A 3KSPA 1L5GB 1NJI4 4KFEA 3TDGA 4KFDA 3EQQB 1IVWA 1W4NA 2K54A 2W56B 5DRVA 3FCSB 3KZTA 1VQ43 2KCDA 2QA43 1FGTA 2XH9A 3CCV3 4CCVA 3EX9A 1MNLA 3CCS3 2CK3H 3EE1A 4BTYA 3CCJ3 1K9M4 2W9PA 2W04A 3F7XA 3VF1A 1KSIA 1TU5A 1OACA 2WGOA 2XRXB 3KIIA 2V1LA 2P38A 3ER7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1C A;  3EB8 A;  4FMA A;  4FMD A;  3PCS A;  4FMC A;  4FMB A;  3EE1 A;  3PCR A; 
#chains in the Genus database with same CATH topology
 3F40 A;  4L7K A;  4BTX A;  1OF5 A;  1O7H B;  3DGM A;  1J2B A;  1EA2 A;  1UGI A;  1FUW A;  1LRA A;  2HMM B;  1D6Y A;  2KRT A;  1NWW A;  3FGY A;  1A2V A;  1NB3 I;  3SX1 A;  2WO0 A;  3UJM A;  3ZFZ A;  3X42 A;  2HOH A;  3S27 A;  4WFO A;  2XFS A;  1MWR A;  2J8X B;  4J5K A;  5BIR A;  1G0T A;  3IMA B;  3HIG A;  5ELJ A;  3NHX A;  3F8X A;  4XM4 A;  2O3O A;  4K1V A;  1BGS A;  3D4A A;  3IPT A;  3UB1 A;  2H0G A;  3IJE B;  5STD A;  4R4K A;  1GMQ A;  5EVH A;  2F4Y A;  4STD A;  1RRH A;  1ZX2 A;  4BL3 A;  1O7M B;  1I70 A;  1JB5 A;  1BOX A;  1LNH A;  5TGN A;  2RBI A;  5AII A;  1QVG 2;  1QAL A;  5IEO A;  1Q7H A;  3K0Z A;  1PFP A;  5ELU A;  4EV5 A;  2IYJ A;  2Z7A A;  3KKG A;  4KZ1 A;  2HMK B;  1BNI A;  1UUW B;  2MF7 A;  3HZP A;  1FYS A;  3PXM A;  1FUT A;  3CPW 2;  3CC4 3;  1DMQ A;  2OOV A;  1UUV B;  1YJ9 3;  2GBX B;  4FCJ A;  2ZA4 A;  1UDI I;  1B2X A;  1B2U A;  1X1U A;  3CPO A;  1W02 A;  4N6T A;  3STD A;  4TX4 A;  1TJD A;  4R80 A;  4KT3 B;  5KP4 A;  1GMR A;  3HK4 A;  5IG3 A;  1I0X A;  1UCJ A;  2XGL A;  3GZX B;  1IVU A;  3RGA A;  1STF I;  1N9E A;  1B21 A;  1GD3 A;  1RN4 A;  1VZZ A;  1I3I A;  3ROB A;  4X2H A;  4N6V 0;  1W7C A;  2KF4 A;  3B7C A;  3ECF A;  4WWU C;  4X2O A;  1IQY A;  2CWU A;  5CK6 A;  1JJ2 2;  2P0M A;  1RHL A;  2FNQ A;  2BU4 A;  1NO3 A;  1LXE A;  2C4B A;  2E2T A;  1QJG A;  1YIJ 3;  3DXO A;  1JZO A;  3A5E A;  3X3Y A;  2R4I A;  1VQM 3;  1GY5 A;  1M1X B;  2HMO B;  3EBY A;  4O2H A;  1E97 A;  5A0O B;  3AGN A;  1EQK A;  4FCZ A;  2F98 A;  1JBS A;  1MOL A;  3AMO A;  3EC9 A;  5FGO A;  2F5M A;  1RGL A;  4O3V A;  1TFK A;  1AY7 A;  1R4Y A;  2BT3 A;  3FG3 A;  3CNX A;  1SII A;  2KF5 A;  2P09 A;  3X40 A;  5IF6 A;  3HX8 A;  5D81 A;  3LTB A;  3ZG0 A;  4EBG A;  2RGQ A;  2CFD A;  1FGR A;  6STD A;  3ZG5 A;  3K7C A;  2CFL A;  1FZU A;  1ZGX A;  3NBJ A;  3G6E 3;  3WDG B;  3G71 3;  1ROV A;  4ILF A;  3X3X A;  1YI2 3;  1W6Y A;  3SXX A;  1CYU A;  2W9Q A;  1EEJ A;  2W56 A;  2ZDJ A;  4FCM A;  3WR2 A;  4LZI A;  1UI8 A;  4HAA A;  1BIR A;  3MSO A;  2AAE A;  3B4O A;  2IMJ A;  1YGE A;  3BIR A;  5CF2 A;  1GYB A;  2C11 A;  5IEN A;  2R41 A;  1V74 A;  1RSN A;  1D6Z A;  3DGY A;  2OTL 3;  3KCH A;  1GOV A;  1UUG B;  3K63 A;  4FMC A;  5D82 A;  5AYS C;  2PNC A;  5M1A A;  1JBR A;  3KN4 A;  3CNM A;  1BRS A;  2K3D A;  3WOD G;  1G96 A;  4WP5 A;  5AIF A;  3X3Z A;  1B20 A;  3BLZ A;  3I56 3;  1T3B A;  5HGR A;  1BSA A;  1RN1 A;  3WA3 A;  1IV9 A;  8CHO A;  4HJL B;  3CCQ 3;  1WQL B;  2CG0 A;  3NBB A;  1YVB I;  3RGR A;  1JN5 B;  1GS3 A;  1RJO A;  4I5Q A;  4R1K A;  4L8P A;  1HKX A;  1TIJ A;  4GSP A;  1Q86 4;  1QMA A;  1F8N A;  2F86 B;  1TTO A;  1UI7 A;  3GZY B;  2XSH B;  3CCL 3;  1DMN A;  1YHQ 3;  4K61 A;  3FG1 A;  3EN8 A;  5JBS A;  3LTC A;  3NV0 B;  1QAF A;  2A15 A;  3D5G A;  3B8L A;  1X1X A;  4K1U A;  4EV2 A;  2Y73 A;  4MJD A;  3CC2 3;  3FKA A;  1A2K A;  1M9G A;  3CCE 3;  4IT7 A;  1ASK A;  3OWU A;  1CH0 A;  1FW7 A;  2FGT A;  3G8Z A;  1IDP A;  2CX0 A;  3BU4 A;  3OWS A;  1RGH A;  3WOE B;  1ULJ B;  3A76 A;  2CWV A;  3NXJ A;  4Q53 A;  3K9M C;  1RCK A;  1W2B 2;  1O7N B;  4FMB A;  1OPY A;  1NDO B;  1NU3 A;  4JF8 A;  3WA2 X;  3OV4 A;  1M1K 4;  1GMP A;  4O02 B;  1S72 3;  5BVB A;  3MWZ A;  1RNB A;  3AGO A;  2WGQ A;  4WHA A;  2ZHX B;  4RZM A;  3SVA A;  3VGN A;  2XSO B;  3F9S A;  2FXT A;  4QWT A;  1M90 4;  3F14 A;  2CC3 A;  2CW9 A;  4HKV B;  1YVS A;  4N6U A;  1PU4 A;  2BMQ B;  1B2M A;  1GOY A;  1WMN A;  1LOX A;  4CDL A;  1HYF A;  1BNG A;  3FF2 A;  1BRJ A;  1IT7 A;  4XBX A;  3SOA A;  1UGH I;  2OCT A;  2QEX 3;  2BO9 B;  1JZD A;  4GL6 A;  1FUS A;  1OHO A;  3LTA A;  1W5Z A;  3LH4 A;  1SAR A;  2F99 A;  3HOH A;  3MG2 A;  3Q2P A;  1EKM A;  2MC8 A;  1VQ5 3;  3BNE A;  1R4C A;  1RGC A;  1IU7 A;  2C10 A;  2P38 A;  3WMD A;  2GEX A;  5JPU A;  2D1W A;  1BUQ A;  5FW5 A;  1OHP A;  1IQ8 A;  1WTH A;  1DVD A;  1N8R 4;  1V58 A;  1IQX A;  4HM4 B;  1ZO2 A;  1MGW A;  1JB4 A;  3SOY A;  4LMI A;  4ORL A;  1VQQ A;  4DKI A;  1BSD A;  1JRQ A;  2KF6 A;  2STD A;  1VQ4 3;  1GOU A;  2CKF B;  3J7Y d;  1VQL 3;  2CX1 A;  1A90 A;  1JKG B;  1E3R A;  3S67 A;  3T0U A;  1NNV A;  4MEI A;  1MWU A;  3G16 A;  2INX A;  3LYG A;  3PS8 A;  5AEU B;  5D83 A;  3Q3F A;  4K90 B;  1YJW 3;  1AQZ A;  5G1K A;  1UCI A;  1E3V A;  5AIH A;  2AAD A;  2IA7 A;  1RN7 A;  4HM7 B;  1I8V A;  1RGK A;  2B24 B;  2BMO B;  3E99 A;  3T8N A;  4IPB A;  5IW9 A;  1TUH A;  4OK0 A;  5AEW B;  2RSX A;  4HM3 B;  4OVM A;  4NRE A;  1RRL A;  3SLU A;  1JN5 A;  3BNB A;  4EW5 A;  1IYY A;  3V98 A;  2Q07 A;  5LC6 A;  1GSP A;  2GXF A;  4ZM8 A;  3LT8 A;  2GBW B;  3FF0 A;  5LC7 A;  1BRK A;  3NV0 A;  2HMN B;  4R9L A;  3AHW A;  1Q82 4;  3S5C A;  4L8O A;  1B3S A;  3HI7 A;  3VSY A;  2ZL8 A;  1BUJ A;  3GRD A;  2OQE C;  3EJV A;  3K5T A;  1ISK A;  1DVC A;  3DY5 A;  1BNR A;  1VQK 3;  3DZL A;  3OXA A;  3QK9 A;  4H3U A;  3D5I A;  1JNQ A;  3NX0 A;  3LTD A;  5CLK A;  2KXG A;  3D79 A;  3G4S 3;  2M7O A;  2W0Q A;  1RGF A;  3RNT A;  2CH9 A;  1SJW A;  1ROA A;  1K8A 4;  1YNV X;  3PCS A;  3DM8 A;  1DE3 A;  3OX9 A;  1W6G A;  4HM8 B;  4EYC A;  5BXQ A;  3MKI A;  1B2Z A;  1B2S A;  5KP3 A;  5I97 A;  4J8T A;  2UX0 A;  1D6U A;  3O8Y A;  4LYL B;  4FR9 A;  4CPK A;  3CCU 3;  1OH0 A;  3U97 A;  3N54 B;  2I9W A;  2HMJ B;  3GSP A;  3NM7 A;  3CMA 3;  3I0Y A;  4MMX B;  2F56 A;  4XBT A;  4LGQ A;  1T2I A;  6GSP A;  3FZW A;  3DGO A;  3RDE A;  3F8H A;  3PZW A;  3AHS A;  3SED A;  2XR8 B;  5G1L A;  1MWT A;  5HOH A;  1IV7 A;  4HBR A;  4XDW A;  1KC8 4;  4HVN A;  4H61 A;  1BSE A;  2JQ5 A;  3B4P A;  1BU4 A;  3WOF B;  4G1M B;  1BNE A;  1G02 A;  1NB5 I;  1WMO A;  1DYU A;  1N5P A;  3L0R A;  3JUP A;  3OW2 2;  1I3F A;  4GB5 A;  1YIT 3;  2WOH A;  3EF8 A;  3S29 A;  1RGA A;  1SPU A;  1BRN L;  1Q42 A;  1PY3 A;  4BTW A;  3H3H A;  1ZS7 A;  3D3L A;  4U13 A;  4WYK B;  2BMR B;  2W6J H;  3LT9 A;  4CJN A;  2GU3 A;  8RNT A;  5DRE A;  1RCL A;  4AKZ A;  2YFL B;  3PYJ A;  1GY7 A;  1Q40 B;  4KVH A;  1RGE A;  4LSO A;  2YFJ B;  1C7H A;  1N5H A;  1OGX A;  1RGG A;  3N8B A;  1GD4 A;  3DH2 A;  2Y74 A;  1FA3 A;  3GZR A;  3D9R A;  2L1S A;  1VQ9 3;  2B1X B;  1JKG A;  3OWY A;  5AIG A;  2O9U X;  3DGN A;  3CXC 2;  1UW1 A;  3NQY A;  4HM6 B;  3BB9 A;  2HML B;  3FG4 A;  3H51 A;  3HII A;  5EEO A;  3MHE A;  1FGQ A;  4MMY B;  1OHS A;  5CF1 A;  5JPP A;  1FGM A;  2GU1 A;  4J5G A;  3DUK A;  4R9K A;  5IER A;  1BSC A;  1BRG A;  1FGO A;  1RLS A;  1C54 A;  1BNJ A;  1WMP A;  1MWS A;  1W01 A;  3GWR A;  3V92 A;  1A67 A;  1IVV A;  2F5W A;  2RNT A;  4XB5 A;  4BU4 A;  2Z6B A;  4HZB B;  3I55 3;  4MMZ B;  4BL2 A;  1SIH A;  7STD A;  1YJN 3;  3LML A;  1I2G A;  1JV2 B;  4HM2 B;  2KAA A;  2WOF A;  3GAX A;  1BAO A;  3DGL A;  2OQE A;  3BNC A;  2ML5 A;  1U8C B;  1T5Y A;  4N6M A;  3CU3 A;  2CFK A;  2XGN A;  3LZA A;  4AEQ A;  6RNT A;  1VQP 3;  1HZ1 A;  2GSP A;  3N9H A;  4FMA A;  1YGW A;  1I2F A;  3G0K A;  2SBL A;  2YFI B;  4J9A A;  5G2G A;  3U1W A;  1KQS 2;  4HOH A;  1X1Y A;  1RKY A;  3DMC A;  1O7G B;  1BAN A;  3X41 A;  4HM0 B;  1HU9 A;  3PGB A;  3JUQ A;  2UGI A;  3EN1 B;  1STD A;  1CQS A;  3Q90 A;  1OCV A;  2W03 A;  5EQL A;  5IG4 A;  3Q1C A;  2QIY A;  3NQZ A;  2BIR A;  3S28 A;  4N6N B;  3UNL A;  2PZV A;  1VQN 3;  3F7S A;  4RNT A;  3UL6 A;  2QGU A;  1Q81 4;  1OGZ A;  2H0H A;  2JDI H;  3ALA A;  4FMD A;  3BND A;  1US1 A;  1CYV A;  2XFT A;  2IY2 A;  5AI1 A;  2IUJ A;  1VQ6 3;  4RNZ A;  1DET A;  3PCR A;  2Z76 A;  3KE7 A;  2CIU A;  4IIA A;  1N9J A;  1N8Q A;  5BU4 A;  1OF5 B;  3LXU X;  1JBT A;  2GEY A;  2CFW A;  4HZ9 B;  1K28 A;  4JRF A;  1TRQ A;  4HM1 B;  7GSP A;  2CG1 A;  3SYU A;  7RNT A;  4AKY A;  3CCR 3;  4PEJ A;  5IG5 A;  5RNT A;  1AV4 A;  3KFQ C;  1Z1S A;  1TRP A;  1IK3 A;  3NM2 A;  4LEH A;  1VQO 3;  3CCM 3;  1I2E A;  1TFO A;  3JUO A;  1AVL A;  1CEW I;  2RCD A;  1DMM A;  1W2Z A;  3MG3 A;  1QVF 2;  5AYR B;  2P0X A;  1ULI B;  1QAK A;  2CHC A;  1VQ7 3;  1W6C A;  1WNH A;  2XEP A;  1IT8 A;  1GY6 A;  4NPB A;  4XBY A;  2Z77 A;  2OTJ 3;  4WYK A;  2CWT A;  3QRD A;  4N6L A;  2BNG A;  4XDV A;  5KP1 A;  3UL5 A;  1EG9 B;  1UCL A;  2XF3 A;  2ML6 A;  2IUK A;  4KFF A;  1LVN A;  4EC6 A;  3NBR A;  1Q40 A;  1JB2 A;  5CXO A;  1Y4K A;  3T8U A;  2RFR A;  2OWP A;  4HYZ A;  1OUN A;  2BHM A;  4HM5 B;  1U5O A;  1AVK A;  3JUN A;  3NUV A;  1BNF A;  2OOV C;  1O7W B;  1V57 A;  1IVX A;  1TP6 A;  2SAR A;  1BRI A;  2LYX A;  3EB8 A;  2YX9 A;  3CME 3;  1Q9E A;  1RDS A;  2LQV A;  3FLJ A;  3MPH A;  4O8S A;  4RNY A;  4NHF A;  2E2V A;  3M8C A;  1O7P B;  1LQM B;  4OUQ A;  3KSE D;  3V99 A;  4N3V A;  4N6O B;  1AR0 A;  2K0M A;  2P05 A;  3EHC A;  1Q7Y 4;  3EBT A;  4RBN A;  2W2C A;  1SQW A;  3URP A;  4EXR A;  1K73 4;  1UCK A;  1LOY A;  2L4V A;  3CC7 3;  1BVI A;  1T2H A;  3FH1 A;  5M18 A;  1KWI A;  1S5A A;  1LOV A;  5IG0 A;  3AMO B;  1LQG C;  2UUG C;  2E2U A;  2CFG A;  3FSD A;  4I4K A;  1LNI A;  1KD1 4;  4GHO A;  1K41 A;  3MG1 A;  2H0I A;  3JVC A;  3LOY A;  3JUM A;  1A2P A;  1LOW A;  5M19 A;  3GZB A;  3MYT A;  5IEP A;  1VQ8 3;  3CD6 3;  2D42 A;  3KSP A;  1L5G B;  1BNS A;  1I0V A;  1BRH A;  1B27 A;  1MGR A;  1NJI 4;  1PYL A;  4KFE A;  3TDG A;  4KFD A;  3EQQ B;  9RNT A;  4BIR A;  1IVW A;  1BSB A;  1W4N A;  2K54 A;  2W56 B;  5DRV A;  1RMS A;  3FCS B;  3KZT A;  2KCD A;  1RNT A;  1RTU A;  1FGT A;  5GSP A;  2XH9 A;  3CCV 3;  4CCV A;  2QA4 3;  3EX9 A;  1MNL A;  3CCS 3;  2CK3 H;  1EUI C;  3EE1 A;  2KF3 A;  4BTY A;  3CCJ 3;  1K9M 4;  2W9P A;  2W04 A;  1X1W A;  3F7X A;  3VF1 A;  1KSI A;  1TU5 A;  1OAC A;  2WGO A;  2XRX B;  3KII A;  2V1L A;  1W00 A;  3WHO A;  3ER7 A; 
#chains in the Genus database with same CATH homology
 3F40 A;  4L7K A;  4BTX A;  1OF5 A;  1O7H B;  3DGM A;  1J2B A;  1EA2 A;  1FUW A;  2KRT A;  2HMM B;  1D6Y A;  3FGY A;  1NWW A;  3SX1 A;  1A2V A;  1NB3 I;  3UJM A;  2WO0 A;  3X42 A;  3S27 A;  4WFO A;  2XFS A;  3IMA B;  3HIG A;  5ELJ A;  3NHX A;  3F8X A;  4XM4 A;  2O3O A;  4K1V A;  3IPT A;  3UB1 A;  3IJE B;  5STD A;  4R4K A;  5EVH A;  4STD A;  1RRH A;  1ZX2 A;  1O7M B;  1JB5 A;  5TGN A;  1LNH A;  5AII A;  1QVG 2;  1QAL A;  5IEO A;  3K0Z A;  1PFP A;  5ELU A;  4EV5 A;  4KZ1 A;  2Z7A A;  3KKG A;  2HMK B;  1UUW B;  2MF7 A;  3HZP A;  3PXM A;  3CPW 2;  3CC4 3;  1DMQ A;  2OOV A;  1UUV B;  1YJ9 3;  2GBX B;  4FCJ A;  3CPO A;  1W02 A;  4N6T A;  3STD A;  4TX4 A;  4R80 A;  5KP4 A;  3HK4 A;  5IG3 A;  2XGL A;  3GZX B;  1IVU A;  3RGA A;  1STF I;  1N9E A;  1GD3 A;  1VZZ A;  3ROB A;  4X2H A;  4N6V 0;  1W7C A;  3B7C A;  3ECF A;  4WWU C;  4X2O A;  1IQY A;  2CWU A;  5CK6 A;  1JJ2 2;  2P0M A;  2FNQ A;  1NO3 A;  1LXE A;  2E2T A;  1QJG A;  1YIJ 3;  3DXO A;  3X3Y A;  2R4I A;  1VQM 3;  1GY5 A;  1M1X B;  2HMO B;  3EBY A;  4O2H A;  1E97 A;  5A0O B;  1EQK A;  4FCZ A;  2F98 A;  1MOL A;  3AMO A;  3EC9 A;  5FGO A;  4O3V A;  1TFK A;  2BT3 A;  3FG3 A;  3CNX A;  1SII A;  2P09 A;  3X40 A;  5IF6 A;  3HX8 A;  5D81 A;  3LTB A;  4EBG A;  2RGQ A;  2CFD A;  1FGR A;  6STD A;  3K7C A;  2CFL A;  3NBJ A;  3G6E 3;  3WDG B;  3G71 3;  1ROV A;  3X3X A;  1YI2 3;  1W6Y A;  3SXX A;  1CYU A;  2W9Q A;  2W56 A;  2ZDJ A;  4FCM A;  4LZI A;  1UI8 A;  3MSO A;  3B4O A;  2IMJ A;  1YGE A;  5CF2 A;  1GYB A;  2C11 A;  5IEN A;  1V74 A;  1D6Z A;  2OTL 3;  3K63 A;  4FMC A;  5D82 A;  5AYS C;  2PNC A;  3KN4 A;  3CNM A;  3WOD G;  1G96 A;  4WP5 A;  5AIF A;  3X3Z A;  3BLZ A;  3I56 3;  5HGR A;  3WA3 A;  1IV9 A;  8CHO A;  4HJL B;  3CCQ 3;  2CG0 A;  1WQL B;  3NBB A;  1YVB I;  3RGR A;  1JN5 B;  1GS3 A;  1RJO A;  4R1K A;  4L8P A;  1HKX A;  1TIJ A;  1Q86 4;  1QMA A;  1F8N A;  2F86 B;  3GZY B;  1UI7 A;  3CCL 3;  2XSH B;  1DMN A;  1YHQ 3;  4K61 A;  3FG1 A;  3EN8 A;  5JBS A;  3LTC A;  3NV0 B;  1QAF A;  2A15 A;  3B8L A;  4EV2 A;  4K1U A;  2Y73 A;  4MJD A;  3CC2 3;  3FKA A;  1A2K A;  1M9G A;  3CCE 3;  4IT7 A;  1ASK A;  3OWU A;  2FGT A;  3G8Z A;  1IDP A;  3OWS A;  3WOE B;  1ULJ B;  1W00 A;  3A76 A;  2CWV A;  3NXJ A;  4Q53 A;  3K9M C;  1W2B 2;  1O7N B;  4FMB A;  1OPY A;  1NDO B;  1NU3 A;  4JF8 A;  3WA2 X;  3OV4 A;  1M1K 4;  4O02 B;  1S72 3;  5BVB A;  3MWZ A;  2WGQ A;  4WHA A;  4RZM A;  3SVA A;  3VGN A;  2XSO B;  3F9S A;  2FXT A;  4QWT A;  1M90 4;  3F14 A;  2CC3 A;  2CW9 A;  4HKV B;  4N6U A;  1PU4 A;  2BMQ B;  1WMN A;  1LOX A;  4CDL A;  3FF2 A;  1IT7 A;  4XBX A;  3SOA A;  2OCT A;  2QEX 3;  2BO9 B;  4GL6 A;  1OHO A;  3LTA A;  1W5Z A;  3LH4 A;  2F99 A;  3MG2 A;  3Q2P A;  2MC8 A;  1VQ5 3;  1EKM A;  3BNE A;  1R4C A;  2C10 A;  1IU7 A;  3WMD A;  2GEX A;  5JPU A;  2D1W A;  1BUQ A;  5FW5 A;  1OHP A;  1IQ8 A;  1WTH A;  1DVD A;  1N8R 4;  1IQX A;  4HM4 B;  1ZO2 A;  1JB4 A;  3SOY A;  4LMI A;  4ORL A;  1JRQ A;  2STD A;  2CKF B;  3J7Y d;  1VQL 3;  1A90 A;  1JKG B;  1E3R A;  3S67 A;  3T0U A;  4MEI A;  3G16 A;  2INX A;  3LYG A;  3PS8 A;  5AEU B;  5D83 A;  1YJW 3;  4K90 B;  1E3V A;  5AIH A;  2IA7 A;  4HM7 B;  1RN7 A;  2B24 B;  2BMO B;  3E99 A;  3T8N A;  4IPB A;  5IW9 A;  1TUH A;  4OK0 A;  5AEW B;  2RSX A;  4HM3 B;  4OVM A;  4NRE A;  1RRL A;  3SLU A;  1JN5 A;  3BNB A;  3V98 A;  2Q07 A;  5LC6 A;  2GXF A;  4ZM8 A;  3LT8 A;  2GBW B;  3FF0 A;  5LC7 A;  3NV0 A;  2HMN B;  4R9L A;  1Q82 4;  3S5C A;  4L8O A;  3HI7 A;  3VSY A;  2ZL8 A;  3GRD A;  2OQE C;  3EJV A;  3K5T A;  1ISK A;  1DVC A;  3DY5 A;  1VQK 3;  3DZL A;  3OXA A;  3QK9 A;  4H3U A;  1JNQ A;  3NX0 A;  3LTD A;  5CLK A;  2KXG A;  3G4S 3;  2M7O A;  2W0Q A;  2CH9 A;  1SJW A;  1ROA A;  1K8A 4;  3PCS A;  3DM8 A;  3OX9 A;  1W6G A;  4HM8 B;  4EYC A;  5BXQ A;  3MKI A;  5KP3 A;  5I97 A;  4J8T A;  2UX0 A;  1D6U A;  3O8Y A;  4FR9 A;  3CCU 3;  1OH0 A;  3U97 A;  3N54 B;  2I9W A;  2HMJ B;  3NM7 A;  3CMA 3;  3I0Y A;  4MMX B;  4XBT A;  4LGQ A;  3FZW A;  3DGO A;  3RDE A;  3F8H A;  3PZW A;  3SED A;  2XR8 B;  1IV7 A;  4HBR A;  4XDW A;  1KC8 4;  4HVN A;  4H61 A;  2JQ5 A;  3B4P A;  3WOF B;  4G1M B;  1NB5 I;  1WMO A;  1DYU A;  1N5P A;  3L0R A;  3JUP A;  3OW2 2;  4GB5 A;  1YIT 3;  2WOH A;  3EF8 A;  3S29 A;  1SPU A;  1Q42 A;  4BTW A;  3H3H A;  3D3L A;  4U13 A;  4WYK B;  2BMR B;  2W6J H;  3LT9 A;  2GU3 A;  5DRE A;  4AKZ A;  2YFL B;  3PYJ A;  1GY7 A;  1Q40 B;  4KVH A;  4LSO A;  2YFJ B;  1N5H A;  1C7H A;  1OGX A;  3N8B A;  1GD4 A;  1FA3 A;  2Y74 A;  3GZR A;  3D9R A;  1VQ9 3;  2B1X B;  1JKG A;  3OWY A;  5AIG A;  2O9U X;  3DGN A;  3CXC 2;  1UW1 A;  3NQY A;  4HM6 B;  3BB9 A;  2HML B;  3FG4 A;  3H51 A;  3HII A;  5EEO A;  3MHE A;  1FGQ A;  4MMY B;  1OHS A;  5CF1 A;  5JPP A;  1FGM A;  2GU1 A;  4R9K A;  3DUK A;  5IER A;  1FGO A;  1WMP A;  3V92 A;  1W01 A;  3GWR A;  1A67 A;  1IVV A;  4XB5 A;  2Z6B A;  4HZB B;  3I55 3;  4MMZ B;  1SIH A;  7STD A;  1YJN 3;  3LML A;  1JV2 B;  4HM2 B;  2WOF A;  3GAX A;  3DGL A;  2OQE A;  3BNC A;  2ML5 A;  1U8C B;  1T5Y A;  4N6M A;  3CU3 A;  2CFK A;  2XGN A;  3LZA A;  4AEQ A;  1VQP 3;  3N9H A;  4FMA A;  3G0K A;  2SBL A;  2YFI B;  4J9A A;  5G2G A;  3U1W A;  1KQS 2;  1RKY A;  3DMC A;  1O7G B;  3X41 A;  4HM0 B;  1HU9 A;  3PGB A;  3JUQ A;  3EN1 B;  1STD A;  1CQS A;  3Q90 A;  1OCV A;  2W03 A;  5EQL A;  5IG4 A;  3Q1C A;  2QIY A;  3NQZ A;  3S28 A;  4N6N B;  3UNL A;  2PZV A;  1VQN 3;  3F7S A;  3UL6 A;  1Q81 4;  2QGU A;  1OGZ A;  2JDI H;  3ALA A;  4FMD A;  3BND A;  1US1 A;  1CYV A;  2XFT A;  5AI1 A;  2IUJ A;  1VQ6 3;  4RNZ A;  3PCR A;  2Z76 A;  3KE7 A;  2CIU A;  4IIA A;  1N9J A;  1N8Q A;  1OF5 B;  3LXU X;  2GEY A;  2CFW A;  4HZ9 B;  1K28 A;  4JRF A;  4HM1 B;  2CG1 A;  4AKY A;  3CCR 3;  4PEJ A;  5IG5 A;  1AV4 A;  3KFQ C;  1Z1S A;  1IK3 A;  3NM2 A;  4LEH A;  1VQO 3;  3CCM 3;  1TFO A;  3JUO A;  1AVL A;  1CEW I;  2RCD A;  1DMM A;  1W2Z A;  3MG3 A;  1QVF 2;  5AYR B;  2P0X A;  1ULI B;  1QAK A;  2CHC A;  1VQ7 3;  1W6C A;  1WNH A;  2XEP A;  1IT8 A;  1GY6 A;  4XBY A;  2Z77 A;  2OTJ 3;  4WYK A;  2CWT A;  3QRD A;  4N6L A;  2BNG A;  4XDV A;  5KP1 A;  3UL5 A;  1EG9 B;  2XF3 A;  2ML6 A;  2IUK A;  4KFF A;  1LVN A;  4EC6 A;  3NBR A;  1Q40 A;  1JB2 A;  5CXO A;  1Y4K A;  3T8U A;  2RFR A;  2OWP A;  4HYZ A;  1OUN A;  2BHM A;  4HM5 B;  1U5O A;  1AVK A;  3JUN A;  3NUV A;  2OOV C;  1O7W B;  1IVX A;  1TP6 A;  2LYX A;  3EB8 A;  2YX9 A;  3CME 3;  2LQV A;  3FLJ A;  3MPH A;  4O8S A;  4RNY A;  4NHF A;  2E2V A;  3M8C A;  1O7P B;  4OUQ A;  3KSE D;  3V99 A;  4N3V A;  4N6O B;  1AR0 A;  2K0M A;  2P05 A;  3EHC A;  1Q7Y 4;  3EBT A;  4RBN A;  2W2C A;  1SQW A;  4EXR A;  1K73 4;  2L4V A;  3CC7 3;  3FH1 A;  1KWI A;  1S5A A;  5IG0 A;  3AMO B;  2E2U A;  2CFG A;  3FSD A;  4I4K A;  1KD1 4;  1K41 A;  3MG1 A;  3JVC A;  3LOY A;  3JUM A;  3GZB A;  3MYT A;  5IEP A;  1VQ8 3;  3CD6 3;  2D42 A;  3KSP A;  1L5G B;  1NJI 4;  4KFE A;  3TDG A;  4KFD A;  3EQQ B;  1IVW A;  1W4N A;  2K54 A;  2W56 B;  5DRV A;  3FCS B;  3KZT A;  1VQ4 3;  2KCD A;  2QA4 3;  1FGT A;  2XH9 A;  3CCV 3;  4CCV A;  3EX9 A;  1MNL A;  3CCS 3;  2CK3 H;  3EE1 A;  4BTY A;  3CCJ 3;  1K9M 4;  2W9P A;  2W04 A;  3F7X A;  3VF1 A;  1KSI A;  1TU5 A;  1OAC A;  2WGO A;  2XRX B;  3KII A;  2V1L A;  2P38 A;  3ER7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...