3CCE3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cce300
1K9M4 1JJ22 3CD63 1VQK3 1KQS2 3CCM3 3CC73 1VQ63 3CCS3 1YIJ3 3CC43 1M904 2OTJ3 3OW22 1VQM3 3CPW2 3CCR3 1VQL3 3CCL3 1YIT3 1Q814 2OTL3 1Q7Y4 3I563 3I553 3CXC2 1Q824 3CCJ3 1NJI4 1K8A4 1K734 1YHQ3 1S723 1VQ43 1YJW3 1VQP3 1VQN3 1VQ73 1KD14 1VQ53 2QA43 3CCV3 3G6E3 2QEX3 1QVG2 1VQ83 1Q864 3CMA3 1W2B2 1QVF2 3CME3 3CC23 1YI23 1M1K4 3G4S3 3CCE3 3CCU3 3CCQ3 1YJ93 3G713 1KC84 1VQO3 1YJN3 1VQ93 1N8R4
chains in the Genus database with same CATH superfamily
1N9JA 3HOHA 3X3XA 1BRGA 1W01A 1VQ63 2WOFA 3D79A 1OGZA 3CCS3 1RN7A 2IUKA 3BLZA 8CHOA 1M904 3SLUA 5CXOA 4GL6A 4GSPA 1WMOA 3O8YA 1RDSA 4MEIA 2XSOB 3WA2X 1A90A 4XBYA 6GSPA 2F5WA 1I2FA 1W5ZA 3FF2A 3N9HA 5BU4A 3J7Yd 4N6MA 5KP3A 3V98A 1MGRA 4R1KA 2CFKA 3X3YA 4N6OB 1STFI 2BMRB 3JUNA 1RCLA 1TFOA 3ALAA 3LMLA 2W9PA 1Q864 1G96A 1QVF2 3OV4A 1RJOA 3T0UA 5ELUA 4HVNA 1IVXA 5AIGA 1E3RA 2ZHXB 4N6TA 3MG2A 3F8HA 4FR9A 1C54A 2F98A 1BNIA 1Z1SA 4N3VA 2YX9A 1UCKA 1ZGXA 3H3HA 7GSPA 1JBRA 3X3ZA 1YGEA 3D5GA 3LXUX 4HM0B 1GYBA 4KZ1A 1FGRA 2XR8B 1GOYA 5AYSC 1BNSA 1OH0A 1TTOA 1LVNA 4FMAA 3WHOA 2F4YA 2D1WA 1K734 3K63A 1OCVA 2E2TA 5EVHA 1YNVX 2CK3H 1J2BA 2K3DA 3AHWA 3STDA 2HOHA 1CEWI 3OX9A 3G6E3 3X42A 4H3UA 2UGIA 2BO9B 4EV2A 3HIGA 3PCSA 4I4KA 1T3BA 3LTDA 4H61A 2BHMA 1ULJB 3L0RA 2JDIH 1E97A 2WGQA 3IMAB 3IPTA 3ROBA 1W6GA 1K9M4 2BMOB 1QALA 2PNCA 3EE1A 3CCM3 3AHSA 1EA2A 1BOXA 1AR0A 3KSPA 1OF5B 4K90B 3ZG0A 4XBTA 3FLJA 2GSPA 4BL3A 3Q2PA 5IG0A 5IW9A 3S27A 1UGIA 1G02A 1T2HA 3AMOA 4HM1B 1UDII 1ISKA 5D81A 3IJEB 1HYFA 2B1XB 1TFKA 1PY3A 1DVCA 3SXXA 1W6CA 4LYLB 2MF7A 2O3OA 1CYVA 2C4BA 2QEX3 1ROVA 4MMXB 1VQ83 3M8CA 2CHCA 3KE7A 3DUKA 2P38A 3HZPA 3MKIA 1TU5A 2Z76A 1RGLA 4WHAA 1I70A 2INXA 3KZTA 3A5EA 2ZA4A 3JUOA 2C10A 3PXMA 3MYTA 1MGWA 3FF0A 3F7XA 1UCLA 2RBIA 3LYGA 1V57A 3CC43 3MG1A 3OW22 2CH9A 5BVBA 3BNEA 3WOEB 4J5GA 3G8ZA 4HM3B 5IG4A 1U5OA 3I563 3LT9A 2ZL8A 4HM6B 3S28A 1SQWA 4L7KA 2L1SA 2CG1A 2LYXA 3ECFA 3JUPA 2K54A 2XGNA 4NHFA 3NBJA 4NREA 5JPUA 3F14A 4AKZA 3LZAA 3EX9A 5CF1A 2QA43 2HMLB 3B4OA 1QVG2 1PFPA 1ULIB 5AIFA 2OCTA 1UCJA 4EV5A 1X1WA 3CPOA 2W04A 1O7MB 1GOUA 3MSOA 3NXJA 3CCQ3 3PYJA 3B8LA 2OWPA 4Q53A 2CWUA 1GMPA 1OACA 2FGTA 1MOLA 2ML6A 2CFWA 3KN4A 4LGQA 1STDA 2Z7AA 1LQMB 1RGCA 2IMJA 4BU4A 3N54B 3FCSB 1BSEA 4TX4A 5IEPA 1BRKA 1W6YA 5CK6A 1TP6A 2P0XA 4CDLA 1O7HB 4L8PA 2KAAA 1LQGC 1A2PA 1IT8A 1Y4KA 2AAEA 3F40A 1BNFA 3AGOA 3UB1A 1FGOA 1BAOA 1GS3A 1OF5A 3BB9A 3K0ZA 1VQN3 1ZO2A 3WDGB 3N8BA 2CWTA 3EJVA 4JRFA 3FGYA 1DVDA 1E3VA 1I2GA 5I97A 2M7OA 1BNJA 1I8VA 1IDPA 1QJGA 2H0GA 1FGQA 5A0OB 3FSDA 3CC23 1YI23 2OOVC 1HZ1A 2JQ5A 3SVAA 1UUGB 2YFLB 1BGSA 3ER7A 1NDOB 1YVSA 2W6JH 3FG1A 1JN5B 4STDA 1IQ8A 3NV0A 3V99A 5DREA 3WA3A 2XGLA 4WYKA 3CXC2 5CF2A 1LRAA 3CCJ3 1IYYA 1ZS7A 1IVUA 1NO3A 4NPBA 1IT7A 4K61A 2GBXB 1B2UA 2F5MA 3LTAA 2OQEA 3U1WA 1FUSA 1MWSA 1BIRA 1NWWA 3G16A 1B21A 1RGAA 1D6ZA 1ZX2A 5M19A 1GY7A 3V92A 6STDA 3SOAA 1FYSA 3EN8A 5LC7A 4J8TA 3I0YA 2RGQA 1WQLB 2IYJA 2WOHA 1OHPA 3OWYA 3MWZA 1EG9B 2OTJ3 3HI7A 1LNIA 4K1UA 3TDGA 1DMQA 3CCR3 3AMOB 1YIT3 3K9MC 1BSCA 1JBTA 3PCRA 2D42A 1CYUA 4FMBA 1RGKA 4HYZA 3GZBA 4HM7B 4IPBA 3DGYA 1V58A 6RNTA 1U8CB 3GAXA 3DXOA 2J8XB 4HBRA 1GY5A 4WWUC 1W00A 1IQYA 1OGXA 1AVLA 1BRSA 2W56B 1FGMA 1N5PA 1OHSA 1RGEA 5AEWB 1B2XA 1SPUA 5M18A 2LQVA 1BANA 2H0IA 2KF5A 3LTCA 3QRDA 1EKMA 2CIUA 3HX8A 1QAKA 4I5QA 4X2OA 3UL5A 3KIIA 5M1AA 4DKIA 1VQQA 2IY2A 3D5IA 2IUJA 2STDA 2UX0A 5STDA 5G1LA 1CH0A 2KCDA 4KVHA 5AIHA 1IK3A 4WP5A 3MG3A 4R9KA 3CPW2 1IV7A 1AVKA 1RN4A 2KXGA 3U97A 2F56A 4FCJA 1O7NB 2KF6A 3AGNA 1A67A 1N9EA 1JN5A 2BNGA 2CX1A 3FH1A 2OQEC 4IIAA 3Q3FA 3DGLA 2FXTA 1HU9A 1YGWA 3DGMA 3NM2A 1GD3A 1RRHA 2A15A 1L5GB 4EYCA 1M1XB 3S67A 1BNEA 1D6UA 3BU4A 3NBBA 4RBNA 1BRIA 3X40A 1D6YA 3PGBA 4CCVA 3DY5A 3DMCA 2O9UX 2SARA 1KWIA 2ML5A 1VQM3 1JV2B 2AADA 5HGRA 3MHEA 1Q814 1GSPA 5CLKA 4BIRA 1FUTA 2C11A 1HKXA 4MMYB 1WMNA 4FCMA 1C7HA 1K8A4 4O2HA 4LZIA 4OVMA 1JB4A 3SEDA 3VGNA 4IT7A 4RZMA 3X41A 4BTWA 5RNTA 4FCZA 1BNGA 1I2EA 1TIJA 4N6NB 4RNTA 2CKFB 4QWTA 3F9SA 2R4IA 2W56A 3QK9A 4R4KA 1NB5I 2XH9A 3NV0B 5IG3A 5G1KA 4WYKB 3KSED 5IENA 1CQSA 3D3LA 1JBSA 1B2SA 3BNDA 2WO0A 5JBSA 5GSPA 1IVWA 1IQXA 5IF6A 1WMPA 2XFSA 2CC3A 1RGHA 4AEQA 4HM4B 1FGTA 3OWUA 4HJLB 1VQ43 1OHOA 3PS8A 3K7CA 1VQP3 1LOXA 1VQ73 4OUQA 1X1YA 1TJDA 2GU1A 2I9WA 1BRHA 2F99A 3DGNA 4XDVA 3WODG 4BL2A 1FUWA 4HOHA 2P09A 4KFEA 3UJMA 1BU4A 1BRJA 5G2GA 3RGAA 4XB5A 1YJ93 1KC84 3S29A 3KCHA 2XSHB 1I0XA 2Y73A 1JZOA 1JJ22 1RLSA 3WMDA 4EC6A 1KQS2 3GZYB 2HMNB 5D82A 1JB2A 1W7CA 1UW1A 3H51A 1I3IA 3K5TA 5EQLA 1AY7A 2IA7A 4R9LA 1OUNA 2GEYA 3I553 1SIIA 2CFDA 3B4PA 1B27A 1Q824 2P05A 3D9RA 4U13A 2RCDA 4R80A 2W2CA 4HZBB 4N6V0 1LXEA 5AIIA 1BUQA 3EBTA 3JUMA 1JNQA 3S5CA 2RNTA 3NBRA 5TGNA 3CCV3 1I0VA 1BVIA 2HMMB 5AEUB 3SOYA 2BU4A 2BT3A 4EBGA 5LC6A 3PZWA 3G4S3 1NU3A 2CWVA 3EQQB 3NX0A 4O3VA 4GB5A 2Q07A 1DMMA 1Q9EA 3E99A 5FGOA 4J5KA 1VQK3 3DH2A 1N5HA 1BRNL 1FA3A 1FZUA 3CC73 1EUIC 2CG0A 8RNTA 1K28A 2UUGC 3BNBA 3CCL3 3RNTA 3CNMA 1Q42A 2B24B 4LEHA 3A76A 1IU7A 1YVBI 3ZFZA 4CPKA 1BUJA 4N6LA 5AYRB 2MC8A 1W4NA 2HMJB 3DZLA 3URPA 5BXQA 1MWRA 3RGRA 1PYLA 1Q40A 2QGUA 1DE3A 4HM8B 1GMRA 1AQZA 1X1UA 4BTYA 1MWTA 2BIRA 3EBYA 1IV9A 3G0KA 1GD4A 2GEXA 4HAAA 7RNTA 3F8XA 1UUWB 1LOWA 1UI8A 1O7PB 3GWRA 3HIIA 3Q1CA 2H0HA 9RNTA 2CW9A 1LOYA 2CX0A 5D83A 5IERA 3EB8A 4KT3B 3RDEA 3T8NA 1A2VA 1TUHA 4XM4A 1DMNA 1R4YA 1X1XA 1MWUA 3SYUA 1RHLA 1K41A 7STDA 3EF8A 1JKGA 1YIJ3 1RTUA 1R4CA 1B2MA 2QIYA 4LMIA 2Z77A 4FMDA 2KRTA 2BMQB 1RCKA 3EN1B 1ROAA 3FG4A 2F86B 4AKYA 1YHQ3 1S723 5ELJA 3NHXA 4EW5A 1B20A 1MNLA 4N6UA 1KD14 1VQ53 2PZVA 3OXAA 1JZDA 3DM8A 3FZWA 1WTHA 4RNYA 2WGOA 3UNLA 4HKVB 4EXRA 3CMA3 4ILFA 2SBLA 4O02B 4GHOA 1DETA 3F7SA 3LTBA 3G713 4OK0A 3LH4A 1VQ93 2OOVA 3GSPA 3CU3A 3GZXB 1TRQA 3OWSA 1N8QA 3BNCA 1TRPA 1BNRA 3LOYA 2XRXB 4HZ9B 1EQKA 1JRQA 3GZRA 3UL6A 5KP1A 3JVCA 2Z6BA 3JUQA 1IVVA 1Q7Y4 2P0MA 1QAFA 4MJDA 2E2VA 5DRVA 1NJI4 3ZG5A 2Y74A 4J9AA 3T8UA 1RNBA 4MMZB 1YJW3 3VSYA 4L8OA 3GRDA 1RGFA 1UI7A 1G0TA 1LOVA 2E2UA 1NB3I 1RMSA 3Q90A 1GY6A 1RN1A 3CME3 2HMOB 4LSOA 1S5AA 2XEPA 5HOHA 1F8NA 2K0MA 4KFFA 4G1MB 1N8R4 1Q40B 5EEOA 1AV4A 1OPYA 4PEJA 4ZM8A 3CD63 2KF4A 4JF8A 1UGHI 3VF1A 5IG5A 2W0QA 1EEJA 3D4AA 1W02A 1UUVB 3WR2A 1W2ZA 5IEOA 1PU4A 2W03A 2HMKB 5JPPA 1QMAA 1RNTA 2YFJB 3NQYA 1SJWA 3LT8A 1I3FA 1GOVA 1SARA 2XFTA 4O8SA 1JKGB 1T5YA 2GXFA 1VZZA 4X2HA 1BSBA 3EC9A 2CFLA 2XF3A 2ZDJA 3SX1A 5KP4A 3NM7A 2W9QA 1A2KA 3KFQC 1WNHA 3NQZA 1M1K4 4XBXA 3WOFB 1VQO3 1B3SA 2RFRA 1JB5A 4HM2B 1KSIA 4KFDA 3KKGA 4CJNA 3DGOA 5AI1A 3BIRA 4K1VA 2KF3A 1VQL3 4FMCA 2OTL3 1DYUA 3HK4A 4ORLA 4BTXA 1RRLA 2V1LA 3NUVA 3CNXA 1RGGA 2RSXA 2YFIB 3FKAA 1RKYA 1US1A 2GBWB 4XDWA 3B7CA 1Q7HA 2CFGA 5FW5A 4WFOA 1SIHA 4RNZA 1FW7A 1T2IA 3FG3A 4HM5B 2L4VA 1LNHA 2GU3A 1O7GB 2FNQA 1RSNA 3EHCA 1W2B2 1V74A 1M9GA 5BIRA 1NNVA 1UCIA 1BSAA 1BSDA 3MPHA 1B2ZA 2R41A 1GMQA 3CCE3 1ASKA 3CCU3 1YJN3 1O7WB
chains in the Genus database with same CATH topology
1N9JA 3X3XA 1W01A 2WOFA 1OGZA 3CCS3 1RN7A 2IUKA 3BLZA 8CHOA 1M904 3SLUA 5CXOA 4GL6A 1WMOA 3O8YA 4MEIA 2XSOB 3WA2X 1A90A 4XBYA 1W5ZA 3FF2A 3N9HA 3J7Yd 4N6MA 5KP3A 3V98A 4R1KA 3X3YA 2CFKA 4N6OB 1STFI 2BMRB 3JUNA 1TFOA 3ALAA 3LMLA 2W9PA 1Q864 1G96A 1QVF2 3OV4A 1RJOA 3T0UA 5ELUA 4HVNA 1IVXA 5AIGA 1E3RA 4N6TA 3MG2A 3F8HA 4FR9A 2F98A 1Z1SA 4N3VA 2YX9A 3H3HA 3X3ZA 1YGEA 3LXUX 4HM0B 1GYBA 4KZ1A 1FGRA 2XR8B 5AYSC 1OH0A 4FMAA 1LVNA 2D1WA 1K734 3K63A 1OCVA 2E2TA 5EVHA 2CK3H 1J2BA 3STDA 1CEWI 3OX9A 3G6E3 3X42A 4H3UA 2BO9B 4EV2A 3HIGA 3PCSA 4I4KA 3LTDA 4H61A 2BHMA 1ULJB 3L0RA 2JDIH 1E97A 2WGQA 3IMAB 3IPTA 3ROBA 1W6GA 1K9M4 2BMOB 1QALA 2PNCA 3EE1A 3CCM3 1EA2A 1AR0A 3KSPA 1OF5B 4K90B 4XBTA 3FLJA 3Q2PA 5IG0A 5IW9A 3S27A 3AMOA 4HM1B 1ISKA 5D81A 3IJEB 1TFKA 2B1XB 1DVCA 3SXXA 1W6CA 2MF7A 2O3OA 1CYVA 2QEX3 1ROVA 4MMXB 1VQ83 3M8CA 2CHCA 3KE7A 3DUKA 2P38A 3HZPA 3MKIA 1TU5A 2Z76A 4WHAA 2INXA 3KZTA 3JUOA 2C10A 3PXMA 3MYTA 3FF0A 3F7XA 3LYGA 3CC43 3MG1A 3OW22 2CH9A 5BVBA 3BNEA 3WOEB 3G8ZA 4HM3B 5IG4A 1U5OA 3I563 3LT9A 2ZL8A 4HM6B 3S28A 1SQWA 4L7KA 2CG1A 2LYXA 3ECFA 3JUPA 2K54A 2XGNA 4NHFA 3NBJA 4NREA 5JPUA 3F14A 4AKZA 3LZAA 3EX9A 5CF1A 2QA43 2HMLB 3B4OA 1QVG2 1PFPA 1ULIB 5AIFA 2OCTA 3CCQ3 4EV5A 3CPOA 2W04A 1O7MB 3MSOA 3NXJA 3PYJA 3B8LA 2OWPA 4Q53A 2CWUA 1OACA 2FGTA 1MOLA 2ML6A 2CFWA 3KN4A 4LGQA 1STDA 2Z7AA 2IMJA 3N54B 3FCSB 4TX4A 5IEPA 4CDLA 1W6YA 5CK6A 1TP6A 2P0XA 1O7HB 4L8PA 1IT8A 1Y4KA 3F40A 3UB1A 1FGOA 1GS3A 1OF5A 3BB9A 3K0ZA 1VQN3 1ZO2A 3WDGB 3N8BA 2CWTA 3EJVA 4JRFA 3FGYA 1DVDA 1E3VA 5I97A 2M7OA 1QJGA 1IDPA 1FGQA 5A0OB 3FSDA 3CC23 1YI23 2OOVC 2JQ5A 3SVAA 2YFLB 3ER7A 1NDOB 2W6JH 3FG1A 1JN5B 4STDA 1IQ8A 3NV0A 3V99A 5DREA 3WA3A 2XGLA 4WYKA 3CXC2 5CF2A 3CCJ3 1IVUA 1NO3A 1IT7A 4K61A 2GBXB 3LTAA 2OQEA 3U1WA 1NWWA 3G16A 1D6ZA 1ZX2A 1GY7A 3V92A 6STDA 3SOAA 3EN8A 5LC7A 4J8TA 3I0YA 2RGQA 1WQLB 2WOHA 1OHPA 3OWYA 3MWZA 1EG9B 2OTJ3 3HI7A 3TDGA 1DMQA 3CCR3 3AMOB 1YIT3 3K9MC 3PCRA 2D42A 1CYUA 4FMBA 4HYZA 3GZBA 4HM7B 4IPBA 1U8CB 3GAXA 3DXOA 4HBRA 1GY5A 4WWUC 1W00A 1IQYA 1OGXA 1AVLA 2W56B 1FGMA 1N5PA 1OHSA 5AEWB 1SPUA 2LQVA 4X2OA 3LTCA 3QRDA 1EKMA 2CIUA 3HX8A 1QAKA 3UL5A 3KIIA 2IUJA 2STDA 2UX0A 5STDA 2KCDA 4KVHA 5AIHA 1IK3A 4WP5A 3MG3A 4R9KA 3CPW2 1IV7A 1AVKA 2KXGA 3U97A 4FCJA 1O7NB 1A67A 1N9EA 1JN5A 2BNGA 3FH1A 2OQEC 4IIAA 3DGLA 2FXTA 1HU9A 3NM2A 3DGMA 1GD3A 1RRHA 2A15A 1L5GB 4EYCA 1M1XB 3S67A 1D6UA 3NBBA 4RBNA 3X40A 1D6YA 3PGBA 4CCVA 3DY5A 3DMCA 2O9UX 1KWIA 2ML5A 1VQM3 1JV2B 5HGRA 3MHEA 1Q814 5CLKA 2C11A 1HKXA 4MMYB 1WMNA 4FCMA 1C7HA 1K8A4 4O2HA 4LZIA 4OVMA 1JB4A 3SEDA 3VGNA 4IT7A 4RZMA 3X41A 4BTWA 4FCZA 1TIJA 4N6NB 2CKFB 4QWTA 3F9SA 2R4IA 2W56A 3QK9A 4R4KA 1NB5I 2XH9A 3NV0B 5IG3A 4WYKB 3KSED 5IENA 1CQSA 3D3LA 3BNDA 2WO0A 5JBSA 1IVWA 1IQXA 5IF6A 1WMPA 2XFSA 2CC3A 4AEQA 4HM4B 1FGTA 3OWUA 4HJLB 1VQ43 1OHOA 3PS8A 3K7CA 1VQP3 1LOXA 1VQ73 4OUQA 2GU1A 2I9WA 3DGNA 2F99A 4XDVA 3WODG 1FUWA 2P09A 4KFEA 3UJMA 5G2GA 3RGAA 1KC84 4XB5A 1YJ93 3S29A 2XSHB 2Y73A 1JJ22 3WMDA 4EC6A 1KQS2 3GZYB 2HMNB 5D82A 1JB2A 1W7CA 1UW1A 3H51A 5EQLA 3K5TA 2IA7A 4R9LA 1OUNA 2GEYA 3I553 1SIIA 2CFDA 3B4PA 1Q824 2P05A 3D9RA 4U13A 2RCDA 4R80A 2W2CA 4HZBB 4N6V0 1LXEA 5AIIA 1BUQA 3EBTA 3JUMA 1JNQA 3S5CA 3NBRA 5TGNA 3CCV3 2HMMB 5AEUB 3SOYA 2BT3A 4EBGA 5LC6A 3PZWA 3G4S3 1NU3A 2CWVA 3EQQB 3NX0A 4O3VA 4GB5A 2Q07A 1DMMA 5FGOA 3E99A 1VQK3 1FA3A 1N5HA 3CC73 2CG0A 1K28A 3BNBA 3CCL3 3CNMA 1Q42A 2B24B 4LEHA 3A76A 1IU7A 1YVBI 4N6LA 5AYRB 2MC8A 1W4NA 2HMJB 3DZLA 5BXQA 3RGRA 1Q40A 2QGUA 4HM8B 4BTYA 3EBYA 1IV9A 3G0KA 1GD4A 2GEXA 3F8XA 1UUWB 1UI8A 1O7PB 3GWRA 3HIIA 3Q1CA 2CW9A 5D83A 5IERA 3EB8A 3RDEA 3T8NA 1A2VA 1TUHA 4XM4A 1DMNA 1VQ63 1YIJ3 1K41A 7STDA 3EF8A 1JKGA 1R4CA 2QIYA 4LMIA 2Z77A 4FMDA 2KRTA 2BMQB 3EN1B 1ROAA 3FG4A 2F86B 4AKYA 1YHQ3 1S723 5ELJA 3NHXA 1MNLA 4N6UA 1KD14 1VQ53 2PZVA 3OXAA 3FZWA 3DM8A 1WTHA 4RNYA 2WGOA 3UNLA 4HKVB 4EXRA 3CMA3 2SBLA 4O02B 3F7SA 3LTBA 3G713 4OK0A 3LH4A 1VQ93 2OOVA 3CU3A 3GZXB 3OWSA 1N8QA 3BNCA 3LOYA 2XRXB 4HZ9B 1EQKA 1JRQA 3GZRA 3UL6A 5KP1A 3JVCA 2Z6BA 3JUQA 1IVVA 1Q7Y4 2P0MA 1QAFA 4MJDA 2E2VA 5DRVA 1NJI4 2Y74A 4J9AA 3T8UA 4MMZB 1YJW3 3VSYA 4L8OA 3GRDA 1UI7A 2E2UA 1NB3I 3Q90A 1GY6A 3CME3 2HMOB 4LSOA 1S5AA 2XEPA 1F8NA 2K0MA 4KFFA 4G1MB 1N8R4 1Q40B 5EEOA 1AV4A 1OPYA 4PEJA 4ZM8A 3CD63 4JF8A 3VF1A 5IG5A 2W0QA 1W02A 1UUVB 1W2ZA 5IEOA 1PU4A 2W03A 2HMKB 5JPPA 1QMAA 2YFJB 3NQYA 1SJWA 3LT8A 2XFTA 4O8SA 1JKGB 1T5YA 2GXFA 1VZZA 4X2HA 3EC9A 2CFLA 2XF3A 2ZDJA 3SX1A 5KP4A 3NM7A 2W9QA 1A2KA 3KFQC 1WNHA 3NQZA 1M1K4 4XBXA 3WOFB 1VQO3 2RFRA 1JB5A 4HM2B 1KSIA 4KFDA 3KKGA 3DGOA 5AI1A 4K1VA 1VQL3 4FMCA 2OTL3 1DYUA 3HK4A 4ORLA 4BTXA 1RRLA 2V1LA 3NUVA 3CNXA 2YFIB 2RSXA 3FKAA 1RKYA 1US1A 2GBWB 4XDWA 3B7CA 2CFGA 5FW5A 4WFOA 1SIHA 4RNZA 3FG3A 4HM5B 2L4VA 1LNHA 2GU3A 3EHCA 1O7GB 2FNQA 1W2B2 1V74A 1M9GA 3MPHA 3CCU3 3CCE3 4K1UA 1ASKA 1YJN3 1O7WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 4;  1JJ2 2;  3CD6 3;  1VQK 3;  1KQS 2;  3CCM 3;  3CC7 3;  1VQ6 3;  3CCS 3;  1YIJ 3;  3CC4 3;  1M90 4;  2OTJ 3;  3OW2 2;  1VQM 3;  3CPW 2;  3CCR 3;  1VQL 3;  3CCL 3;  1YIT 3;  1Q81 4;  2OTL 3;  1Q7Y 4;  3I56 3;  3I55 3;  3CXC 2;  1Q82 4;  3CCJ 3;  1NJI 4;  1K8A 4;  1K73 4;  1YHQ 3;  1S72 3;  1VQ4 3;  1YJW 3;  1VQP 3;  1VQN 3;  1VQ7 3;  1KD1 4;  1VQ5 3;  2QA4 3;  3CCV 3;  3G6E 3;  2QEX 3;  1QVG 2;  1VQ8 3;  1Q86 4;  3CMA 3;  1W2B 2;  1QVF 2;  3CME 3;  3CC2 3;  1YI2 3;  1M1K 4;  3G4S 3;  3CCE 3;  3CCU 3;  3CCQ 3;  1YJ9 3;  3G71 3;  1KC8 4;  1VQO 3;  1YJN 3;  1VQ9 3;  1N8R 4; 
#chains in the Genus database with same CATH topology
 1N9J A;  3HOH A;  3X3X A;  1BRG A;  1W01 A;  1VQ6 3;  2WOF A;  3D79 A;  1OGZ A;  3CCS 3;  1RN7 A;  2IUK A;  3BLZ A;  8CHO A;  1M90 4;  3SLU A;  5CXO A;  4GL6 A;  4GSP A;  1WMO A;  3O8Y A;  1RDS A;  4MEI A;  2XSO B;  3WA2 X;  1A90 A;  4XBY A;  6GSP A;  2F5W A;  1I2F A;  1W5Z A;  3FF2 A;  3N9H A;  5BU4 A;  3J7Y d;  4N6M A;  5KP3 A;  3V98 A;  1MGR A;  4R1K A;  2CFK A;  3X3Y A;  4N6O B;  1STF I;  2BMR B;  3JUN A;  1RCL A;  1TFO A;  3ALA A;  3LML A;  2W9P A;  1Q86 4;  1G96 A;  1QVF 2;  3OV4 A;  1RJO A;  3T0U A;  5ELU A;  4HVN A;  1IVX A;  5AIG A;  1E3R A;  2ZHX B;  4N6T A;  3MG2 A;  3F8H A;  4FR9 A;  1C54 A;  2F98 A;  1BNI A;  1Z1S A;  4N3V A;  2YX9 A;  1UCK A;  1ZGX A;  3H3H A;  7GSP A;  1JBR A;  3X3Z A;  1YGE A;  3D5G A;  3LXU X;  4HM0 B;  1GYB A;  4KZ1 A;  1FGR A;  2XR8 B;  1GOY A;  5AYS C;  1BNS A;  1OH0 A;  1TTO A;  1LVN A;  4FMA A;  3WHO A;  2F4Y A;  2D1W A;  1K73 4;  3K63 A;  1OCV A;  2E2T A;  5EVH A;  1YNV X;  2CK3 H;  1J2B A;  2K3D A;  3AHW A;  3STD A;  2HOH A;  1CEW I;  3OX9 A;  3G6E 3;  3X42 A;  4H3U A;  2UGI A;  2BO9 B;  4EV2 A;  3HIG A;  3PCS A;  4I4K A;  1T3B A;  3LTD A;  4H61 A;  2BHM A;  1ULJ B;  3L0R A;  2JDI H;  1E97 A;  2WGQ A;  3IMA B;  3IPT A;  3ROB A;  1W6G A;  1K9M 4;  2BMO B;  1QAL A;  2PNC A;  3EE1 A;  3CCM 3;  3AHS A;  1EA2 A;  1BOX A;  1AR0 A;  3KSP A;  1OF5 B;  4K90 B;  3ZG0 A;  4XBT A;  3FLJ A;  2GSP A;  4BL3 A;  3Q2P A;  5IG0 A;  5IW9 A;  3S27 A;  1UGI A;  1G02 A;  1T2H A;  3AMO A;  4HM1 B;  1UDI I;  1ISK A;  5D81 A;  3IJE B;  1HYF A;  2B1X B;  1TFK A;  1PY3 A;  1DVC A;  3SXX A;  1W6C A;  4LYL B;  2MF7 A;  2O3O A;  1CYV A;  2C4B A;  2QEX 3;  1ROV A;  4MMX B;  1VQ8 3;  3M8C A;  2CHC A;  3KE7 A;  3DUK A;  2P38 A;  3HZP A;  3MKI A;  1TU5 A;  2Z76 A;  1RGL A;  4WHA A;  1I70 A;  2INX A;  3KZT A;  3A5E A;  2ZA4 A;  3JUO A;  2C10 A;  3PXM A;  3MYT A;  1MGW A;  3FF0 A;  3F7X A;  1UCL A;  2RBI A;  3LYG A;  1V57 A;  3CC4 3;  3MG1 A;  3OW2 2;  2CH9 A;  5BVB A;  3BNE A;  3WOE B;  4J5G A;  3G8Z A;  4HM3 B;  5IG4 A;  1U5O A;  3I56 3;  3LT9 A;  2ZL8 A;  4HM6 B;  3S28 A;  1SQW A;  4L7K A;  2L1S A;  2CG1 A;  2LYX A;  3ECF A;  3JUP A;  2K54 A;  2XGN A;  4NHF A;  3NBJ A;  4NRE A;  5JPU A;  3F14 A;  4AKZ A;  3LZA A;  3EX9 A;  5CF1 A;  2QA4 3;  2HML B;  3B4O A;  1QVG 2;  1PFP A;  1ULI B;  5AIF A;  2OCT A;  1UCJ A;  4EV5 A;  1X1W A;  3CPO A;  2W04 A;  1O7M B;  1GOU A;  3MSO A;  3NXJ A;  3CCQ 3;  3PYJ A;  3B8L A;  2OWP A;  4Q53 A;  2CWU A;  1GMP A;  1OAC A;  2FGT A;  1MOL A;  2ML6 A;  2CFW A;  3KN4 A;  4LGQ A;  1STD A;  2Z7A A;  1LQM B;  1RGC A;  2IMJ A;  4BU4 A;  3N54 B;  3FCS B;  1BSE A;  4TX4 A;  5IEP A;  1BRK A;  1W6Y A;  5CK6 A;  1TP6 A;  2P0X A;  4CDL A;  1O7H B;  4L8P A;  2KAA A;  1LQG C;  1A2P A;  1IT8 A;  1Y4K A;  2AAE A;  3F40 A;  1BNF A;  3AGO A;  3UB1 A;  1FGO A;  1BAO A;  1GS3 A;  1OF5 A;  3BB9 A;  3K0Z A;  1VQN 3;  1ZO2 A;  3WDG B;  3N8B A;  2CWT A;  3EJV A;  4JRF A;  3FGY A;  1DVD A;  1E3V A;  1I2G A;  5I97 A;  2M7O A;  1BNJ A;  1I8V A;  1IDP A;  1QJG A;  2H0G A;  1FGQ A;  5A0O B;  3FSD A;  3CC2 3;  1YI2 3;  2OOV C;  1HZ1 A;  2JQ5 A;  3SVA A;  1UUG B;  2YFL B;  1BGS A;  3ER7 A;  1NDO B;  1YVS A;  2W6J H;  3FG1 A;  1JN5 B;  4STD A;  1IQ8 A;  3NV0 A;  3V99 A;  5DRE A;  3WA3 A;  2XGL A;  4WYK A;  3CXC 2;  5CF2 A;  1LRA A;  3CCJ 3;  1IYY A;  1ZS7 A;  1IVU A;  1NO3 A;  4NPB A;  1IT7 A;  4K61 A;  2GBX B;  1B2U A;  2F5M A;  3LTA A;  2OQE A;  3U1W A;  1FUS A;  1MWS A;  1BIR A;  1NWW A;  3G16 A;  1B21 A;  1RGA A;  1D6Z A;  1ZX2 A;  5M19 A;  1GY7 A;  3V92 A;  6STD A;  3SOA A;  1FYS A;  3EN8 A;  5LC7 A;  4J8T A;  3I0Y A;  2RGQ A;  1WQL B;  2IYJ A;  2WOH A;  1OHP A;  3OWY A;  3MWZ A;  1EG9 B;  2OTJ 3;  3HI7 A;  1LNI A;  4K1U A;  3TDG A;  1DMQ A;  3CCR 3;  3AMO B;  1YIT 3;  3K9M C;  1BSC A;  1JBT A;  3PCR A;  2D42 A;  1CYU A;  4FMB A;  1RGK A;  4HYZ A;  3GZB A;  4HM7 B;  4IPB A;  3DGY A;  1V58 A;  6RNT A;  1U8C B;  3GAX A;  3DXO A;  2J8X B;  4HBR A;  1GY5 A;  4WWU C;  1W00 A;  1IQY A;  1OGX A;  1AVL A;  1BRS A;  2W56 B;  1FGM A;  1N5P A;  1OHS A;  1RGE A;  5AEW B;  1B2X A;  1SPU A;  5M18 A;  2LQV A;  1BAN A;  2H0I A;  2KF5 A;  3LTC A;  3QRD A;  1EKM A;  2CIU A;  3HX8 A;  1QAK A;  4I5Q A;  4X2O A;  3UL5 A;  3KII A;  5M1A A;  4DKI A;  1VQQ A;  2IY2 A;  3D5I A;  2IUJ A;  2STD A;  2UX0 A;  5STD A;  5G1L A;  1CH0 A;  2KCD A;  4KVH A;  5AIH A;  1IK3 A;  4WP5 A;  3MG3 A;  4R9K A;  3CPW 2;  1IV7 A;  1AVK A;  1RN4 A;  2KXG A;  3U97 A;  2F56 A;  4FCJ A;  1O7N B;  2KF6 A;  3AGN A;  1A67 A;  1N9E A;  1JN5 A;  2BNG A;  2CX1 A;  3FH1 A;  2OQE C;  4IIA A;  3Q3F A;  3DGL A;  2FXT A;  1HU9 A;  1YGW A;  3DGM A;  3NM2 A;  1GD3 A;  1RRH A;  2A15 A;  1L5G B;  4EYC A;  1M1X B;  3S67 A;  1BNE A;  1D6U A;  3BU4 A;  3NBB A;  4RBN A;  1BRI A;  3X40 A;  1D6Y A;  3PGB A;  4CCV A;  3DY5 A;  3DMC A;  2O9U X;  2SAR A;  1KWI A;  2ML5 A;  1VQM 3;  1JV2 B;  2AAD A;  5HGR A;  3MHE A;  1Q81 4;  1GSP A;  5CLK A;  4BIR A;  1FUT A;  2C11 A;  1HKX A;  4MMY B;  1WMN A;  4FCM A;  1C7H A;  1K8A 4;  4O2H A;  4LZI A;  4OVM A;  1JB4 A;  3SED A;  3VGN A;  4IT7 A;  4RZM A;  3X41 A;  4BTW A;  5RNT A;  4FCZ A;  1BNG A;  1I2E A;  1TIJ A;  4N6N B;  4RNT A;  2CKF B;  4QWT A;  3F9S A;  2R4I A;  2W56 A;  3QK9 A;  4R4K A;  1NB5 I;  2XH9 A;  3NV0 B;  5IG3 A;  5G1K A;  4WYK B;  3KSE D;  5IEN A;  1CQS A;  3D3L A;  1JBS A;  1B2S A;  3BND A;  2WO0 A;  5JBS A;  5GSP A;  1IVW A;  1IQX A;  5IF6 A;  1WMP A;  2XFS A;  2CC3 A;  1RGH A;  4AEQ A;  4HM4 B;  1FGT A;  3OWU A;  4HJL B;  1VQ4 3;  1OHO A;  3PS8 A;  3K7C A;  1VQP 3;  1LOX A;  1VQ7 3;  4OUQ A;  1X1Y A;  1TJD A;  2GU1 A;  2I9W A;  1BRH A;  2F99 A;  3DGN A;  4XDV A;  3WOD G;  4BL2 A;  1FUW A;  4HOH A;  2P09 A;  4KFE A;  3UJM A;  1BU4 A;  1BRJ A;  5G2G A;  3RGA A;  4XB5 A;  1YJ9 3;  1KC8 4;  3S29 A;  3KCH A;  2XSH B;  1I0X A;  2Y73 A;  1JZO A;  1JJ2 2;  1RLS A;  3WMD A;  4EC6 A;  1KQS 2;  3GZY B;  2HMN B;  5D82 A;  1JB2 A;  1W7C A;  1UW1 A;  3H51 A;  1I3I A;  3K5T A;  5EQL A;  1AY7 A;  2IA7 A;  4R9L A;  1OUN A;  2GEY A;  3I55 3;  1SII A;  2CFD A;  3B4P A;  1B27 A;  1Q82 4;  2P05 A;  3D9R A;  4U13 A;  2RCD A;  4R80 A;  2W2C A;  4HZB B;  4N6V 0;  1LXE A;  5AII A;  1BUQ A;  3EBT A;  3JUM A;  1JNQ A;  3S5C A;  2RNT A;  3NBR A;  5TGN A;  3CCV 3;  1I0V A;  1BVI A;  2HMM B;  5AEU B;  3SOY A;  2BU4 A;  2BT3 A;  4EBG A;  5LC6 A;  3PZW A;  3G4S 3;  1NU3 A;  2CWV A;  3EQQ B;  3NX0 A;  4O3V A;  4GB5 A;  2Q07 A;  1DMM A;  1Q9E A;  3E99 A;  5FGO A;  4J5K A;  1VQK 3;  3DH2 A;  1N5H A;  1BRN L;  1FA3 A;  1FZU A;  3CC7 3;  1EUI C;  2CG0 A;  8RNT A;  1K28 A;  2UUG C;  3BNB A;  3CCL 3;  3RNT A;  3CNM A;  1Q42 A;  2B24 B;  4LEH A;  3A76 A;  1IU7 A;  1YVB I;  3ZFZ A;  4CPK A;  1BUJ A;  4N6L A;  5AYR B;  2MC8 A;  1W4N A;  2HMJ B;  3DZL A;  3URP A;  5BXQ A;  1MWR A;  3RGR A;  1PYL A;  1Q40 A;  2QGU A;  1DE3 A;  4HM8 B;  1GMR A;  1AQZ A;  1X1U A;  4BTY A;  1MWT A;  2BIR A;  3EBY A;  1IV9 A;  3G0K A;  1GD4 A;  2GEX A;  4HAA A;  7RNT A;  3F8X A;  1UUW B;  1LOW A;  1UI8 A;  1O7P B;  3GWR A;  3HII A;  3Q1C A;  2H0H A;  9RNT A;  2CW9 A;  1LOY A;  2CX0 A;  5D83 A;  5IER A;  3EB8 A;  4KT3 B;  3RDE A;  3T8N A;  1A2V A;  1TUH A;  4XM4 A;  1DMN A;  1R4Y A;  1X1X A;  1MWU A;  3SYU A;  1RHL A;  1K41 A;  7STD A;  3EF8 A;  1JKG A;  1YIJ 3;  1RTU A;  1R4C A;  1B2M A;  2QIY A;  4LMI A;  2Z77 A;  4FMD A;  2KRT A;  2BMQ B;  1RCK A;  3EN1 B;  1ROA A;  3FG4 A;  2F86 B;  4AKY A;  1YHQ 3;  1S72 3;  5ELJ A;  3NHX A;  4EW5 A;  1B20 A;  1MNL A;  4N6U A;  1KD1 4;  1VQ5 3;  2PZV A;  3OXA A;  1JZD A;  3DM8 A;  3FZW A;  1WTH A;  4RNY A;  2WGO A;  3UNL A;  4HKV B;  4EXR A;  3CMA 3;  4ILF A;  2SBL A;  4O02 B;  4GHO A;  1DET A;  3F7S A;  3LTB A;  3G71 3;  4OK0 A;  3LH4 A;  1VQ9 3;  2OOV A;  3GSP A;  3CU3 A;  3GZX B;  1TRQ A;  3OWS A;  1N8Q A;  3BNC A;  1TRP A;  1BNR A;  3LOY A;  2XRX B;  4HZ9 B;  1EQK A;  1JRQ A;  3GZR A;  3UL6 A;  5KP1 A;  3JVC A;  2Z6B A;  3JUQ A;  1IVV A;  1Q7Y 4;  2P0M A;  1QAF A;  4MJD A;  2E2V A;  5DRV A;  1NJI 4;  3ZG5 A;  2Y74 A;  4J9A A;  3T8U A;  1RNB A;  4MMZ B;  1YJW 3;  3VSY A;  4L8O A;  3GRD A;  1RGF A;  1UI7 A;  1G0T A;  1LOV A;  2E2U A;  1NB3 I;  1RMS A;  3Q90 A;  1GY6 A;  1RN1 A;  3CME 3;  2HMO B;  4LSO A;  1S5A A;  2XEP A;  5HOH A;  1F8N A;  2K0M A;  4KFF A;  4G1M B;  1N8R 4;  1Q40 B;  5EEO A;  1AV4 A;  1OPY A;  4PEJ A;  4ZM8 A;  3CD6 3;  2KF4 A;  4JF8 A;  1UGH I;  3VF1 A;  5IG5 A;  2W0Q A;  1EEJ A;  3D4A A;  1W02 A;  1UUV B;  3WR2 A;  1W2Z A;  5IEO A;  1PU4 A;  2W03 A;  2HMK B;  5JPP A;  1QMA A;  1RNT A;  2YFJ B;  3NQY A;  1SJW A;  3LT8 A;  1I3F A;  1GOV A;  1SAR A;  2XFT A;  4O8S A;  1JKG B;  1T5Y A;  2GXF A;  1VZZ A;  4X2H A;  1BSB A;  3EC9 A;  2CFL A;  2XF3 A;  2ZDJ A;  3SX1 A;  5KP4 A;  3NM7 A;  2W9Q A;  1A2K A;  3KFQ C;  1WNH A;  3NQZ A;  1M1K 4;  4XBX A;  3WOF B;  1VQO 3;  1B3S A;  2RFR A;  1JB5 A;  4HM2 B;  1KSI A;  4KFD A;  3KKG A;  4CJN A;  3DGO A;  5AI1 A;  3BIR A;  4K1V A;  2KF3 A;  1VQL 3;  4FMC A;  2OTL 3;  1DYU A;  3HK4 A;  4ORL A;  4BTX A;  1RRL A;  2V1L A;  3NUV A;  3CNX A;  1RGG A;  2RSX A;  2YFI B;  3FKA A;  1RKY A;  1US1 A;  2GBW B;  4XDW A;  3B7C A;  1Q7H A;  2CFG A;  5FW5 A;  4WFO A;  1SIH A;  4RNZ A;  1FW7 A;  1T2I A;  3FG3 A;  4HM5 B;  2L4V A;  1LNH A;  2GU3 A;  1O7G B;  2FNQ A;  1RSN A;  3EHC A;  1W2B 2;  1V74 A;  1M9G A;  5BIR A;  1NNV A;  1UCI A;  1BSA A;  1BSD A;  3MPH A;  1B2Z A;  2R41 A;  1GMQ A;  3CCE 3;  1ASK A;  3CCU 3;  1YJN 3;  1O7W B; 
#chains in the Genus database with same CATH homology
 1N9J A;  3X3X A;  1W01 A;  2WOF A;  1OGZ A;  3CCS 3;  1RN7 A;  2IUK A;  3BLZ A;  8CHO A;  1M90 4;  3SLU A;  5CXO A;  4GL6 A;  1WMO A;  3O8Y A;  4MEI A;  2XSO B;  3WA2 X;  1A90 A;  4XBY A;  1W5Z A;  3FF2 A;  3N9H A;  3J7Y d;  4N6M A;  5KP3 A;  3V98 A;  4R1K A;  3X3Y A;  2CFK A;  4N6O B;  1STF I;  2BMR B;  3JUN A;  1TFO A;  3ALA A;  3LML A;  2W9P A;  1Q86 4;  1G96 A;  1QVF 2;  3OV4 A;  1RJO A;  3T0U A;  5ELU A;  4HVN A;  1IVX A;  5AIG A;  1E3R A;  4N6T A;  3MG2 A;  3F8H A;  4FR9 A;  2F98 A;  1Z1S A;  4N3V A;  2YX9 A;  3H3H A;  3X3Z A;  1YGE A;  3LXU X;  4HM0 B;  1GYB A;  4KZ1 A;  1FGR A;  2XR8 B;  5AYS C;  1OH0 A;  4FMA A;  1LVN A;  2D1W A;  1K73 4;  3K63 A;  1OCV A;  2E2T A;  5EVH A;  2CK3 H;  1J2B A;  3STD A;  1CEW I;  3OX9 A;  3G6E 3;  3X42 A;  4H3U A;  2BO9 B;  4EV2 A;  3HIG A;  3PCS A;  4I4K A;  3LTD A;  4H61 A;  2BHM A;  1ULJ B;  3L0R A;  2JDI H;  1E97 A;  2WGQ A;  3IMA B;  3IPT A;  3ROB A;  1W6G A;  1K9M 4;  2BMO B;  1QAL A;  2PNC A;  3EE1 A;  3CCM 3;  1EA2 A;  1AR0 A;  3KSP A;  1OF5 B;  4K90 B;  4XBT A;  3FLJ A;  3Q2P A;  5IG0 A;  5IW9 A;  3S27 A;  3AMO A;  4HM1 B;  1ISK A;  5D81 A;  3IJE B;  1TFK A;  2B1X B;  1DVC A;  3SXX A;  1W6C A;  2MF7 A;  2O3O A;  1CYV A;  2QEX 3;  1ROV A;  4MMX B;  1VQ8 3;  3M8C A;  2CHC A;  3KE7 A;  3DUK A;  2P38 A;  3HZP A;  3MKI A;  1TU5 A;  2Z76 A;  4WHA A;  2INX A;  3KZT A;  3JUO A;  2C10 A;  3PXM A;  3MYT A;  3FF0 A;  3F7X A;  3LYG A;  3CC4 3;  3MG1 A;  3OW2 2;  2CH9 A;  5BVB A;  3BNE A;  3WOE B;  3G8Z A;  4HM3 B;  5IG4 A;  1U5O A;  3I56 3;  3LT9 A;  2ZL8 A;  4HM6 B;  3S28 A;  1SQW A;  4L7K A;  2CG1 A;  2LYX A;  3ECF A;  3JUP A;  2K54 A;  2XGN A;  4NHF A;  3NBJ A;  4NRE A;  5JPU A;  3F14 A;  4AKZ A;  3LZA A;  3EX9 A;  5CF1 A;  2QA4 3;  2HML B;  3B4O A;  1QVG 2;  1PFP A;  1ULI B;  5AIF A;  2OCT A;  3CCQ 3;  4EV5 A;  3CPO A;  2W04 A;  1O7M B;  3MSO A;  3NXJ A;  3PYJ A;  3B8L A;  2OWP A;  4Q53 A;  2CWU A;  1OAC A;  2FGT A;  1MOL A;  2ML6 A;  2CFW A;  3KN4 A;  4LGQ A;  1STD A;  2Z7A A;  2IMJ A;  3N54 B;  3FCS B;  4TX4 A;  5IEP A;  4CDL A;  1W6Y A;  5CK6 A;  1TP6 A;  2P0X A;  1O7H B;  4L8P A;  1IT8 A;  1Y4K A;  3F40 A;  3UB1 A;  1FGO A;  1GS3 A;  1OF5 A;  3BB9 A;  3K0Z A;  1VQN 3;  1ZO2 A;  3WDG B;  3N8B A;  2CWT A;  3EJV A;  4JRF A;  3FGY A;  1DVD A;  1E3V A;  5I97 A;  2M7O A;  1QJG A;  1IDP A;  1FGQ A;  5A0O B;  3FSD A;  3CC2 3;  1YI2 3;  2OOV C;  2JQ5 A;  3SVA A;  2YFL B;  3ER7 A;  1NDO B;  2W6J H;  3FG1 A;  1JN5 B;  4STD A;  1IQ8 A;  3NV0 A;  3V99 A;  5DRE A;  3WA3 A;  2XGL A;  4WYK A;  3CXC 2;  5CF2 A;  3CCJ 3;  1IVU A;  1NO3 A;  1IT7 A;  4K61 A;  2GBX B;  3LTA A;  2OQE A;  3U1W A;  1NWW A;  3G16 A;  1D6Z A;  1ZX2 A;  1GY7 A;  3V92 A;  6STD A;  3SOA A;  3EN8 A;  5LC7 A;  4J8T A;  3I0Y A;  2RGQ A;  1WQL B;  2WOH A;  1OHP A;  3OWY A;  3MWZ A;  1EG9 B;  2OTJ 3;  3HI7 A;  3TDG A;  1DMQ A;  3CCR 3;  3AMO B;  1YIT 3;  3K9M C;  3PCR A;  2D42 A;  1CYU A;  4FMB A;  4HYZ A;  3GZB A;  4HM7 B;  4IPB A;  1U8C B;  3GAX A;  3DXO A;  4HBR A;  1GY5 A;  4WWU C;  1W00 A;  1IQY A;  1OGX A;  1AVL A;  2W56 B;  1FGM A;  1N5P A;  1OHS A;  5AEW B;  1SPU A;  2LQV A;  4X2O A;  3LTC A;  3QRD A;  1EKM A;  2CIU A;  3HX8 A;  1QAK A;  3UL5 A;  3KII A;  2IUJ A;  2STD A;  2UX0 A;  5STD A;  2KCD A;  4KVH A;  5AIH A;  1IK3 A;  4WP5 A;  3MG3 A;  4R9K A;  3CPW 2;  1IV7 A;  1AVK A;  2KXG A;  3U97 A;  4FCJ A;  1O7N B;  1A67 A;  1N9E A;  1JN5 A;  2BNG A;  3FH1 A;  2OQE C;  4IIA A;  3DGL A;  2FXT A;  1HU9 A;  3NM2 A;  3DGM A;  1GD3 A;  1RRH A;  2A15 A;  1L5G B;  4EYC A;  1M1X B;  3S67 A;  1D6U A;  3NBB A;  4RBN A;  3X40 A;  1D6Y A;  3PGB A;  4CCV A;  3DY5 A;  3DMC A;  2O9U X;  1KWI A;  2ML5 A;  1VQM 3;  1JV2 B;  5HGR A;  3MHE A;  1Q81 4;  5CLK A;  2C11 A;  1HKX A;  4MMY B;  1WMN A;  4FCM A;  1C7H A;  1K8A 4;  4O2H A;  4LZI A;  4OVM A;  1JB4 A;  3SED A;  3VGN A;  4IT7 A;  4RZM A;  3X41 A;  4BTW A;  4FCZ A;  1TIJ A;  4N6N B;  2CKF B;  4QWT A;  3F9S A;  2R4I A;  2W56 A;  3QK9 A;  4R4K A;  1NB5 I;  2XH9 A;  3NV0 B;  5IG3 A;  4WYK B;  3KSE D;  5IEN A;  1CQS A;  3D3L A;  3BND A;  2WO0 A;  5JBS A;  1IVW A;  1IQX A;  5IF6 A;  1WMP A;  2XFS A;  2CC3 A;  4AEQ A;  4HM4 B;  1FGT A;  3OWU A;  4HJL B;  1VQ4 3;  1OHO A;  3PS8 A;  3K7C A;  1VQP 3;  1LOX A;  1VQ7 3;  4OUQ A;  2GU1 A;  2I9W A;  3DGN A;  2F99 A;  4XDV A;  3WOD G;  1FUW A;  2P09 A;  4KFE A;  3UJM A;  5G2G A;  3RGA A;  1KC8 4;  4XB5 A;  1YJ9 3;  3S29 A;  2XSH B;  2Y73 A;  1JJ2 2;  3WMD A;  4EC6 A;  1KQS 2;  3GZY B;  2HMN B;  5D82 A;  1JB2 A;  1W7C A;  1UW1 A;  3H51 A;  5EQL A;  3K5T A;  2IA7 A;  4R9L A;  1OUN A;  2GEY A;  3I55 3;  1SII A;  2CFD A;  3B4P A;  1Q82 4;  2P05 A;  3D9R A;  4U13 A;  2RCD A;  4R80 A;  2W2C A;  4HZB B;  4N6V 0;  1LXE A;  5AII A;  1BUQ A;  3EBT A;  3JUM A;  1JNQ A;  3S5C A;  3NBR A;  5TGN A;  3CCV 3;  2HMM B;  5AEU B;  3SOY A;  2BT3 A;  4EBG A;  5LC6 A;  3PZW A;  3G4S 3;  1NU3 A;  2CWV A;  3EQQ B;  3NX0 A;  4O3V A;  4GB5 A;  2Q07 A;  1DMM A;  5FGO A;  3E99 A;  1VQK 3;  1FA3 A;  1N5H A;  3CC7 3;  2CG0 A;  1K28 A;  3BNB A;  3CCL 3;  3CNM A;  1Q42 A;  2B24 B;  4LEH A;  3A76 A;  1IU7 A;  1YVB I;  4N6L A;  5AYR B;  2MC8 A;  1W4N A;  2HMJ B;  3DZL A;  5BXQ A;  3RGR A;  1Q40 A;  2QGU A;  4HM8 B;  4BTY A;  3EBY A;  1IV9 A;  3G0K A;  1GD4 A;  2GEX A;  3F8X A;  1UUW B;  1UI8 A;  1O7P B;  3GWR A;  3HII A;  3Q1C A;  2CW9 A;  5D83 A;  5IER A;  3EB8 A;  3RDE A;  3T8N A;  1A2V A;  1TUH A;  4XM4 A;  1DMN A;  1VQ6 3;  1YIJ 3;  1K41 A;  7STD A;  3EF8 A;  1JKG A;  1R4C A;  2QIY A;  4LMI A;  2Z77 A;  4FMD A;  2KRT A;  2BMQ B;  3EN1 B;  1ROA A;  3FG4 A;  2F86 B;  4AKY A;  1YHQ 3;  1S72 3;  5ELJ A;  3NHX A;  1MNL A;  4N6U A;  1KD1 4;  1VQ5 3;  2PZV A;  3OXA A;  3FZW A;  3DM8 A;  1WTH A;  4RNY A;  2WGO A;  3UNL A;  4HKV B;  4EXR A;  3CMA 3;  2SBL A;  4O02 B;  3F7S A;  3LTB A;  3G71 3;  4OK0 A;  3LH4 A;  1VQ9 3;  2OOV A;  3CU3 A;  3GZX B;  3OWS A;  1N8Q A;  3BNC A;  3LOY A;  2XRX B;  4HZ9 B;  1EQK A;  1JRQ A;  3GZR A;  3UL6 A;  5KP1 A;  3JVC A;  2Z6B A;  3JUQ A;  1IVV A;  1Q7Y 4;  2P0M A;  1QAF A;  4MJD A;  2E2V A;  5DRV A;  1NJI 4;  2Y74 A;  4J9A A;  3T8U A;  4MMZ B;  1YJW 3;  3VSY A;  4L8O A;  3GRD A;  1UI7 A;  2E2U A;  1NB3 I;  3Q90 A;  1GY6 A;  3CME 3;  2HMO B;  4LSO A;  1S5A A;  2XEP A;  1F8N A;  2K0M A;  4KFF A;  4G1M B;  1N8R 4;  1Q40 B;  5EEO A;  1AV4 A;  1OPY A;  4PEJ A;  4ZM8 A;  3CD6 3;  4JF8 A;  3VF1 A;  5IG5 A;  2W0Q A;  1W02 A;  1UUV B;  1W2Z A;  5IEO A;  1PU4 A;  2W03 A;  2HMK B;  5JPP A;  1QMA A;  2YFJ B;  3NQY A;  1SJW A;  3LT8 A;  2XFT A;  4O8S A;  1JKG B;  1T5Y A;  2GXF A;  1VZZ A;  4X2H A;  3EC9 A;  2CFL A;  2XF3 A;  2ZDJ A;  3SX1 A;  5KP4 A;  3NM7 A;  2W9Q A;  1A2K A;  3KFQ C;  1WNH A;  3NQZ A;  1M1K 4;  4XBX A;  3WOF B;  1VQO 3;  2RFR A;  1JB5 A;  4HM2 B;  1KSI A;  4KFD A;  3KKG A;  3DGO A;  5AI1 A;  4K1V A;  1VQL 3;  4FMC A;  2OTL 3;  1DYU A;  3HK4 A;  4ORL A;  4BTX A;  1RRL A;  2V1L A;  3NUV A;  3CNX A;  2YFI B;  2RSX A;  3FKA A;  1RKY A;  1US1 A;  2GBW B;  4XDW A;  3B7C A;  2CFG A;  5FW5 A;  4WFO A;  1SIH A;  4RNZ A;  3FG3 A;  4HM5 B;  2L4V A;  1LNH A;  2GU3 A;  3EHC A;  1O7G B;  2FNQ A;  1W2B 2;  1V74 A;  1M9G A;  3MPH A;  3CCU 3;  3CCE 3;  4K1U A;  1ASK A;  1YJN 3;  1O7W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...