3CCE3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cce300
1VQ43 1K734 3CCU3 1YIT3 3OW22 1NJI4 1M904 3CCL3 1YI23 1VQ53 3G713 1Q7Y4 1KC84 3CCS3 1YJW3 3I563 1K9M4 3CCQ3 3CCV3 1W2B2 1KD14 3CMA3 3CC73 1M1K4 1QVG2 1QVF2 1VQK3 1Q864 1YJ93 1YHQ3 1VQ73 1VQ83 1YIJ3 1VQL3 1VQ63 1Q814 1VQN3 1VQ93 3CPW2 1N8R4 1K8A4 1Q824 3CCR3 1VQO3 3CC23 3CCE3 2QEX3 3CXC2 2OTL3 3CD63 3I553 3G6E3 3G4S3 1S723 3CME3 1JJ22 3CC43 2OTJ3 1VQM3 1VQP3 1KQS2 2QA43 3CCJ3 3CCM3 1YJN3
chains in the Genus database with same CATH superfamily
3FSDA 4N6TA 3T8UA 3CCU3 2IUKA 2JDIH 3SEDA 3VGNA 2W6JH 1Q7HA 4WYKA 2CFLA 1KC84 1UW1A 1W7CA 1NO3A 1Z1SA 2XSOB 5AIGA 4FCZA 3MKIA 1X1XA 1RGKA 4WFOA 4EC6A 3PS8A 2I9WA 2XRXB 3K5TA 7RNTA 1AVLA 1QJGA 4FMAA 4N6UA 3FF2A 1GD3A 1YVBI 4N6OB 1RDSA 1JB2A 1U8CB 1VQ63 3NM7A 2PNCA 3FH1A 3CPW2 3HOHA 5CK6A 1O7GB 1TFKA 4FCMA 3Q3FA 1EUIC 1BSEA 4XBXA 1GYBA 1FW7A 1IQYA 3GZXB 3CPOA 3CME3 3MSOA 1NWWA 2GU1A 1BNEA 3Q1CA 4R80A 3ROBA 1FUSA 2WGOA 4PEJA 1WMPA 2W56B 3F7XA 3VSYA 1YJN3 1LXEA 1K41A 3DH2A 1GY5A 2CC3A 3FCSB 4L7KA 1QALA 5D83A 2GBXB 1F8NA 1UCKA 3D5GA 4LMIA 4QWTA 2XF3A 5HOHA 3GRDA 2ZL8A 1BNFA 1GOYA 1UI8A 2P0MA 2XR8B 3DMCA 3V98A 2STDA 2CW9A 2W9QA 4CCVA 1TRQA 3RNTA 3SYUA 1T2HA 1QMAA 4LGQA 3FG3A 1VQ83 3D9RA 3SLUA 3UL6A 3WDGB 4WHAA 1NB3I 1O7NB 1N8R4 2GU3A 1VQO3 2IMJA 1MWUA 1UUGB 6STDA 1JBTA 1IYYA 1S723 2R4IA 1LOYA 1BNGA 1JJ22 1RGGA 4ZM8A 3U1WA 3AMOB 4XB5A 2QA43 1IQXA 2OTJ3 1GMPA 4N6LA 2YFJB 5D81A 4HM7B 1OGXA 5I97A 1A90A 5HGRA 5IF6A 2Q07A 3AGOA 3UL5A 4XDVA 3FLJA 1EG9B 4O2HA 4GHOA 5A0OB 2L1SA 4FMDA 3NQZA 2OQEC 1QVG2 2CG1A 6RNTA 2ML5A 1VQK3 2KF3A 3UJMA 1VQ73 1N5HA 1SIIA 3LT9A 4EXRA 3CNMA 2B24B 2OOVC 1RN1A 3V92A 4KFFA 4LEHA 5AIHA 2BNGA 2E2VA 3G6E3 1RGHA 3MHEA 5AEUB 2HMOB 2SARA 1JB4A 3S29A 1I3IA 1W6YA 2GSPA 3PCRA 1TJDA 3BNBA 3KIIA 2BMOB 3OW22 5G2GA 1UDII 1M904 3SVAA 5M18A 3BNCA 5FGOA 4CPKA 4HBRA 3O8YA 4MJDA 3SX1A 1BRHA 3N9HA 2BU4A 1B2SA 1UUVB 3K7CA 4AKZA 3LH4A 3X41A 3D5IA 3WMDA 1B2MA 1PY3A 1OHPA 3F8HA 1HKXA 4KZ1A 9RNTA 1UCIA 5AYSC 3KN4A 3BIRA 1FGRA 3CCE3 1V58A 5IG0A 1OF5B 1PYLA 3DGYA 4WYKB 4O8SA 4HM5B 1RCKA 3OV4A 1RNTA 3CCJ3 3BNDA 4EW5A 2RGQA 1O7MB 3ALAA 1JV2B 3OXAA 2C11A 4XDWA 1BANA 1RLSA 3EB8A 2W03A 1Q40B 5STDA 1FGTA 4IPBA 3CNXA 1IVUA 1RTUA 1TU5A 4GSPA 1KD14 2Z7AA 4IT7A 3STDA 1QVF2 1LQGC 5CF2A 3FKAA 1VQN3 2Z77A 1J2BA 2KXGA 4CDLA 1SJWA 3DZLA 3LTCA 4CJNA 5CXOA 1EKMA 1OGZA 1LVNA 1RGAA 2BIRA 1OHOA 2QIYA 3F8XA 1PU4A 2CFDA 2LQVA 3EBTA 3FF0A 3G8ZA 1NU3A 2W2CA 3I0YA 2F98A 2Z76A 4IIAA 3SXXA 1WQLB 1RHLA 3PYJA 1YGWA 3G713 2XFSA 2BHMA 3EBYA 4FR9A 4RZMA 5AIFA 3DY5A 5M1AA 3NM2A 1BRNL 4L8OA 1BRSA 5IEOA 1UGIA 1BSDA 1D6UA 1FUTA 2CFWA 1GY6A 1ZS7A 4JF8A 4BU4A 3B4PA 3BB9A 5RNTA 1GD4A 3JUPA 3NBJA 1B2ZA 1UCLA 1N8QA 3GZYB 4X2OA 5EQLA 3NQYA 1GOVA 4K90B 3FG4A 1AVKA 3B7CA 4JRFA 1QAKA 4MMYB 1OH0A 3PZWA 2HMKB 1B2XA 2W04A 1JB5A 2Y73A 4O3VA 1O7WB 1S5AA 1RGLA 4HOHA 3EHCA 3F14A 4NREA 4N6MA 2O9UX 4H3UA 3DGLA 1JKGB 3Q90A 4EV5A 5KP4A 3T0UA 2IY2A 1FUWA 3J7Yd 3CCS3 3QRDA 3NV0B 4K1UA 2WO0A 4HJLB 1JNQA 2RBIA 2YFLB 4J9AA 4R9KA 3I563 3EC9A 1BNIA 4BTYA 4HM3B 1YGEA 4BL2A 3X42A 2XGLA 1TFOA 3JUOA 3LMLA 3K9MC 3WA2X 1Q824 2KCDA 3KSPA 1ZGXA 1BAOA 3CD63 3GZRA 3I553 4OVMA 2K0MA 3G4S3 3DGOA 2D1WA 1SPUA 1BNSA 2F5WA 3K63A 4U13A 1VQM3 2IYJA 2IUJA 2KF4A 4EV2A 3JUMA 1RN4A 1BRGA 5IERA 3CCL3 2GXFA 1YI23 1DETA 3EE1A 1OHSA 4J5GA 1DE3A 3G16A 3T8NA 2YX9A 4HAAA 1AQZA 5ELUA 3S27A 3KSED 3N8BA 2XFTA 4RNZA 3RGAA 3F9SA 5EEOA 1Q814 3CCR3 1MNLA 1BGSA 1RMSA 1OACA 4HM4B 1FGMA 3NXJA 5GSPA 4BIRA 4BTWA 4HYZA 1LNIA 3LZAA 4N6V0 1SQWA 4BL3A 3URPA 3CC43 1NNVA 4OK0A 2XSHB 3H51A 2CFGA 1KQS2 3X3YA 3LTAA 4STDA 1AY7A 1VQ43 2AADA 2V1LA 4I4KA 4LZIA 2CKFB 1FZUA 1WTHA 4R4KA 8RNTA 1LNHA 1VQ53 4HM2B 3KE7A 1B2UA 1O7HB 3A5EA 3M8CA 2RCDA 1E97A 2W56A 5IENA 5IG5A 5M19A 1FGOA 4FMBA 2ML6A 1BNJA 1M1XB 3KZTA 3CCQ3 2ZDJA 1IQ8A 1X1WA 3OWSA 4GB5A 1ROAA 1BUJA 1R4CA 2KF6A 1I2GA 1YIJ3 3H3HA 1I2FA 2KAAA 1ULIB 1W2ZA 2J8XB 1B3SA 1YNVX 1BVIA 2OOVA 5AEWB 1MOLA 1JZDA 2M7OA 2XEPA 3DGNA 1LRAA 1IK3A 2OTL3 3FZWA 1QAFA 5IG4A 1NB5I 2F5MA 2KF5A 3DXOA 3L0RA 1JBRA 1K734 1GMQA 3BNEA 1NDOB 1RGCA 5CF1A 1IVXA 3AHSA 4AKYA 1A2KA 2CH9A 1Q7Y4 3AMOA 7GSPA 3WHOA 3D4AA 4XM4A 1BOXA 1UI7A 2E2UA 2YFIB 1IU7A 1I2EA 2P09A 1CH0A 1B20A 3WOEB 2UGIA 1SARA 1Q864 3EX9A 1I8VA 2KRTA 3N54B 4BTXA 2WGQA 2C10A 3TDGA 3X40A 3JUQA 1A67A 2HMMB 1I0VA 3KKGA 1I3FA 3ZFZA 5JPPA 3D79A 2CWVA 1G96A 1MWTA 1BSBA 1VQP3 5AYRB 2ZA4A 3K0ZA 3VF1A 2CK3H 2MF7A 3FGYA 1RCLA 3GWRA 4O02B 1RKYA 2HMLB 3WOFB 2CHCA 2UX0A 3MPHA 4KFEA 1YJW3 3HZPA 3BLZA 3HI7A 3CCV3 3WR2A 1KSIA 1W2B2 3CMA3 1DVCA 3NHXA 4MMXB 3NX0A 1CYUA 3PXMA 3ER7A 1Q9EA 3NBRA 1MGRA 1L5GB 1YHQ3 1US1A 3HK4A 4N3VA 1JZOA 1G02A 1TP6A 2RNTA 3LXUX 4H61A 4LYLB 3WA3A 2Z6BA 1T5YA 3OX9A 4J8TA 1DMNA 1E3VA 5KP3A 1IV7A 1BSCA 3JVCA 2HOHA 3MWZA 3RGRA 1BUQA 3AGNA 2CIUA 1IVWA 1G0TA 3V99A 1YIT3 2GEXA 1TUHA 1LOWA 2O3OA 1OF5A 4FMCA 5IW9A 1IT7A 1STFI 1LQMB 3ECFA 1NJI4 1MWRA 3KFQC 5TGNA 1EA2A 2HMJB 3WODG 2ZHXB 3MG1A 3JUNA 1EEJA 4WP5A 3B8LA 3OWUA 2CX0A 1V57A 2W9PA 1HZ1A 4HZBB 4I5QA 1EQKA 1BIRA 1WMOA 4LSOA 4EBGA 3CC73 1W4NA 1JN5A 1U5OA 1Q40A 1WMNA 3LYGA 3GSPA 1SIHA 3HIGA 4HM0B 1RSNA 3S67A 1VQL3 1VQQA 1T3BA 3F40A 3IPTA 3EN8A 1K28A 3D3LA 4ORLA 2BT3A 2GEYA 2LYXA 5JPUA 1X1YA 2H0GA 2K3DA 2QGUA 3NUVA 1IVVA 1BRKA 4KT3B 1ASKA 1BNRA 4HM1B 1DMQA 2H0HA 1C7HA 3MG2A 4R9LA 1RJOA 1FA3A 2D42A 2B1XB 1GSPA 4X2HA 2H0IA 3G0KA 3DUKA 5JBSA 3DGMA 2W0QA 6GSPA 4OUQA 3SOAA 2HMNB 3SOYA 4EYCA 1N9JA 3X3ZA 1MGWA 4MEIA 1RRLA 1YJ93 2AAEA 1W6CA 1B21A 3EQQB 4KVHA 4XBTA 2JQ5A 4DKIA 1VQ93 1W00A 3OWYA 1UCJA 4K61A 4N6NB 1CQSA 5BXQA 1M9GA 4FCJA 1D6ZA 3DM8A 1GMRA 4ILFA 2QEX3 4GL6A 4K1VA 1HYFA 4AEQA 3IJEB 2INXA 5AIIA 5BVBA 1V74A 1YVSA 1LOVA 4RBNA 2R41A 1ROVA 3A76A 2F4YA 3CCM3 1DVDA 2P38A 1OUNA 3LTDA 1Y4KA 2F99A 3BU4A 5LC6A 1IV9A 7STDA 4G1MB 5IEPA 1W02A 1ZO2A 2CX1A 2F86B 4MMZB 3UB1A 1HU9A 3MG3A 2CWTA 1GS3A 3IMAB 5ELJA 1RGFA 1JKGA 1TRPA 2L4VA 5LC7A 1LOXA 1X1UA 1BRJA 1R4YA 2P05A 5CLKA 5G1LA 3ZG5A 2C4BA 3NV0A 2OQEA 2FGTA 3EF8A 1OPYA 1VZZA 1K8A4 1GY7A 1N9EA 2K54A 3E99A 3CC23 2E2TA 3CU3A 1BSAA 4WWUC 1AV4A 2CWUA 2XGNA 1BU4A 1ISKA 3ZG0A 2MC8A 1BRIA 2A15A 1IT8A 2IA7A 3X3XA 1B27A 1A2PA 2FNQA 1C54A 1TTOA 2CG0A 1STDA 4NPBA 4L8PA 1IDPA 1K9M4 1RNBA 3LT8A 1UGHI 1RN7A 1ULJB 1DMMA 4XBYA 4RNTA 1M1K4 1OCVA 1W6GA 1PFPA 3QK9A 1W5ZA 1N5PA 1I0XA 2BMQB 5BU4A 3B4OA 1D6YA 1FYSA 3UNLA 1RRHA 5IG3A 2RSXA 1MWSA 1RGEA 1UUWB 1ZX2A 5EVHA 1T2IA 4HM8B 3EN1B 2PZVA 2FXTA 1AR0A 1Q42A 8CHOA 1JRQA 3S28A 2P0XA 2BMRB 5KP1A 2BO9B 1DYUA 1JN5B 2SBLA 4KFDA 3GAXA 4Q53A 5G1KA 5BIRA 3PCSA 1W01A 2XH9A 1O7PB 1CYVA 1TIJA 3FG1A 3LTBA 1E3RA 5DREA 2CFKA 2GBWB 3PGBA 5FW5A 2UUGC 2WOHA 3MYTA 3GZBA 2RFRA 3S5CA 3AHWA 4J5KA 1GOUA 3EJVA 4HZ9B 2OCTA 4NHFA 2Y74A 4TX4A 3HIIA 4HKVB 3RDEA 3Q2PA 3LOYA 1A2VA 3U97A 1FGQA 5DRVA 3HX8A 3F7SA 3NBBA 3CXC2 5D82A 4R1KA 3KCHA 1KWIA 1CEWI 2F56A 5AI1A 1WNHA 4HVNA 4RNYA 1JBSA 2OWPA 1I70A 4HM6B 2WOFA
chains in the Genus database with same CATH topology
3FSDA 4N6TA 3T8UA 3CCU3 2IUKA 2JDIH 3SEDA 3VGNA 2W6JH 4WYKA 2CFLA 1KC84 1UW1A 1W7CA 1NO3A 1Z1SA 2XSOB 5AIGA 4FCZA 3MKIA 4WFOA 4EC6A 3PS8A 2I9WA 2XRXB 3K5TA 1AVLA 1QJGA 4FMAA 4N6UA 3FF2A 1GD3A 1YVBI 4N6OB 1VQ63 1JB2A 1U8CB 3NM7A 2PNCA 3FH1A 3CPW2 5CK6A 1O7GB 1TFKA 4FCMA 4XBXA 1GYBA 1IQYA 3GZXB 3CPOA 3CME3 3MSOA 1NWWA 2GU1A 3ROBA 3Q1CA 4R80A 2WGOA 4PEJA 3VSYA 1WMPA 2W56B 3F7XA 1YJN3 1LXEA 1K41A 1GY5A 2CC3A 3FCSB 4L7KA 1QALA 5D83A 2GBXB 1F8NA 4LMIA 4QWTA 2XF3A 3GRDA 2ZL8A 2P0MA 3V98A 1UI8A 2XR8B 3DMCA 2STDA 2CW9A 2W9QA 4CCVA 1QMAA 4LGQA 3FG3A 1VQ83 3D9RA 3SLUA 3UL6A 3WDGB 4WHAA 1NB3I 1O7NB 1N8R4 2GU3A 1VQO3 2IMJA 6STDA 1S723 2R4IA 1JJ22 4ZM8A 3U1WA 3AMOB 4XB5A 2QA43 1IQXA 2OTJ3 4N6LA 2YFJB 5D81A 4HM7B 1OGXA 5I97A 1A90A 5HGRA 5IF6A 2Q07A 3UL5A 4XDVA 3FLJA 1EG9B 4O2HA 5A0OB 4FMDA 3NQZA 2OQEC 1QVG2 2CG1A 2ML5A 1VQK3 3UJMA 1VQ73 1N5HA 1SIIA 3LT9A 4EXRA 3CNMA 2B24B 2OOVC 3V92A 4KFFA 4LEHA 5AIHA 2BNGA 2E2VA 3G6E3 5AEUB 3MHEA 2HMOB 1JB4A 3S29A 3PCRA 1W6YA 3BNBA 3KIIA 2BMOB 3OW22 5G2GA 1M904 3SVAA 3BNCA 5FGOA 4HBRA 3O8YA 4MJDA 3SX1A 3N9HA 1UUVB 3K7CA 4AKZA 3LH4A 3X41A 3WMDA 1OHPA 3F8HA 1HKXA 4KZ1A 5AYSC 3KN4A 1FGRA 3CCE3 5IG0A 1OF5B 4WYKB 4O8SA 4HM5B 3OV4A 3CCJ3 3BNDA 2RGQA 1O7MB 3ALAA 1JV2B 3OXAA 2C11A 4XDWA 3EB8A 2W03A 1Q40B 5STDA 1FGTA 4IPBA 3CNXA 1IVUA 1TU5A 1KD14 2Z7AA 4IT7A 3STDA 1QVF2 5CF2A 3FKAA 1VQN3 2Z77A 1J2BA 2KXGA 4CDLA 1SJWA 3DZLA 3LTCA 5CXOA 1EKMA 1OGZA 1LVNA 1OHOA 2QIYA 3F8XA 1PU4A 2CFDA 2LQVA 3EBTA 3FF0A 3G8ZA 1NU3A 2W2CA 3I0YA 2F98A 2Z76A 4IIAA 3SXXA 1WQLB 3PYJA 3G713 2XFSA 2BHMA 3EBYA 4FR9A 4RZMA 5AIFA 3DY5A 3NM2A 4L8OA 5IEOA 1D6UA 2CFWA 4JF8A 1GY6A 3B4PA 3BB9A 1GD4A 3JUPA 3NBJA 1N8QA 3GZYB 4X2OA 5EQLA 3NQYA 4K90B 3FG4A 1AVKA 3B7CA 4JRFA 1QAKA 4MMYB 1OH0A 3PZWA 2HMKB 4O3VA 2W04A 1JB5A 2Y73A 1O7WB 1S5AA 3EHCA 3F14A 4NREA 4N6MA 2O9UX 4H3UA 3DGLA 1JKGB 3Q90A 4EV5A 5KP4A 3T0UA 1FUWA 3J7Yd 3CCS3 3QRDA 3NV0B 4K1UA 2WO0A 4HJLB 1JNQA 2YFLB 4J9AA 4R9KA 3I563 3EC9A 4BTYA 4HM3B 1YGEA 3X42A 2XGLA 1TFOA 3JUOA 3LMLA 3K9MC 3WA2X 1Q824 2KCDA 3KSPA 3CD63 3GZRA 3I553 4OVMA 2K0MA 3G4S3 3DGOA 2D1WA 1SPUA 4U13A 3K63A 1VQM3 2IUJA 4EV2A 3JUMA 5IERA 3CCL3 2GXFA 1YI23 3EE1A 1OHSA 3G16A 3T8NA 2YX9A 5ELUA 3S27A 3KSED 3N8BA 2XFTA 4RNZA 3RGAA 3F9SA 5EEOA 1Q814 3CCR3 1MNLA 1OACA 4HM4B 1FGMA 3NXJA 4BTWA 4HYZA 3LZAA 4N6V0 1SQWA 3CC43 4OK0A 2XSHB 3H51A 2CFGA 1KQS2 3X3YA 3LTAA 4STDA 1VQ43 4I4KA 2V1LA 4LZIA 4R4KA 2CKFB 1WTHA 1LNHA 1VQ53 4HM2B 3KE7A 1O7HB 3M8CA 2RCDA 1E97A 2W56A 5IENA 5IG5A 1FGOA 4FMBA 2ML6A 1M1XB 3KZTA 3CCQ3 2ZDJA 1IQ8A 3OWSA 4GB5A 1ROAA 1R4CA 1YIJ3 3H3HA 1ULIB 1W2ZA 2OOVA 5AEWB 1MOLA 2M7OA 2XEPA 3DGNA 1IK3A 2OTL3 3FZWA 1QAFA 5IG4A 1NB5I 3DXOA 3L0RA 1K734 3BNEA 1NDOB 5CF1A 1IVXA 4AKYA 1A2KA 2CH9A 1Q7Y4 3AMOA 4XM4A 1UI7A 2E2UA 2YFIB 1IU7A 2P09A 3WOEB 1Q864 3EX9A 2KRTA 3N54B 4BTXA 2WGQA 2C10A 3TDGA 3X40A 3JUQA 1A67A 2HMMB 3KKGA 5JPPA 2CWVA 1G96A 1VQP3 5AYRB 3K0ZA 3VF1A 2CK3H 2MF7A 3FGYA 3GWRA 4O02B 1RKYA 2HMLB 3WOFB 2CHCA 2UX0A 3MPHA 4KFEA 1YJW3 3HZPA 3BLZA 3HI7A 3CCV3 1W2B2 1KSIA 3CMA3 1DVCA 3NHXA 4MMXB 3NX0A 1CYUA 3PXMA 3ER7A 3NBRA 1L5GB 1YHQ3 1US1A 3HK4A 4N3VA 1TP6A 3LXUX 4H61A 3WA3A 2Z6BA 1T5YA 3OX9A 4J8TA 1DMNA 1E3VA 5KP3A 1IV7A 3JVCA 3MWZA 3RGRA 1BUQA 2CIUA 1IVWA 3V99A 1YIT3 2GEXA 1TUHA 2O3OA 5IW9A 1OF5A 4FMCA 1NJI4 1IT7A 1STFI 3ECFA 3KFQC 5TGNA 1EA2A 2HMJB 3WODG 3MG1A 3JUNA 4WP5A 3B8LA 3OWUA 2W9PA 4HZBB 1EQKA 1WMOA 4LSOA 4EBGA 3CC73 1W4NA 1JN5A 1U5OA 1Q40A 1WMNA 3LYGA 1SIHA 3HIGA 4HM0B 3S67A 1VQL3 3IPTA 3F40A 4ORLA 3EN8A 1K28A 3D3LA 2BT3A 2GEYA 2LYXA 5JPUA 2QGUA 3NUVA 1IVVA 1ASKA 4HM1B 1DMQA 1C7HA 3MG2A 4R9LA 1RJOA 1FA3A 2D42A 2B1XB 4X2HA 3G0KA 3DUKA 5JBSA 3DGMA 2W0QA 4OUQA 3SOAA 2HMNB 3SOYA 4EYCA 1N9JA 3X3ZA 4MEIA 1RRLA 1YJ93 3EQQB 1W6CA 4KVHA 4XBTA 2JQ5A 1VQ93 1W00A 3OWYA 4K61A 4N6NB 1CQSA 5BXQA 1M9GA 4FCJA 1D6ZA 3DM8A 2QEX3 4GL6A 4K1VA 4AEQA 3IJEB 2INXA 5AIIA 5BVBA 1V74A 4RBNA 1ROVA 3A76A 3CCM3 1DVDA 2P38A 1OUNA 3LTDA 1Y4KA 2F99A 5LC6A 7STDA 1IV9A 5IEPA 4G1MB 1W02A 1ZO2A 2F86B 4MMZB 3UB1A 1HU9A 3MG3A 2CWTA 1GS3A 3IMAB 5ELJA 1JKGA 2L4VA 5LC7A 1LOXA 2P05A 5CLKA 3NV0A 2OQEA 2FGTA 3EF8A 1OPYA 1VZZA 1K8A4 1GY7A 1N9EA 2K54A 3E99A 3CC23 2E2TA 3CU3A 4WWUC 1AV4A 2CWUA 2XGNA 1ISKA 2MC8A 2A15A 1IT8A 2IA7A 3X3XA 2FNQA 2CG0A 1STDA 4L8PA 1IDPA 1K9M4 3LT8A 1RN7A 1ULJB 1DMMA 4XBYA 1M1K4 1OCVA 1W6GA 1PFPA 3QK9A 1W5ZA 1N5PA 2BMQB 3B4OA 1D6YA 3UNLA 1RRHA 5IG3A 2RSXA 1UUWB 1ZX2A 5EVHA 4HM8B 3EN1B 2PZVA 2FXTA 1AR0A 1Q42A 8CHOA 1JRQA 3S28A 2P0XA 2BMRB 5KP1A 2BO9B 1DYUA 1JN5B 2SBLA 4KFDA 3GAXA 4Q53A 3PCSA 1W01A 2XH9A 1O7PB 1CYVA 1TIJA 3FG1A 3LTBA 1E3RA 5DREA 2CFKA 2GBWB 3PGBA 5FW5A 3MYTA 2WOHA 3GZBA 2RFRA 3S5CA 3EJVA 4HZ9B 2OCTA 4NHFA 2Y74A 4TX4A 3HIIA 4HKVB 3RDEA 3Q2PA 3LOYA 1A2VA 3U97A 1FGQA 5DRVA 3HX8A 3F7SA 3NBBA 3CXC2 5D82A 4R1KA 1KWIA 1CEWI 5AI1A 1WNHA 4HVNA 4RNYA 2OWPA 4HM6B 2WOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 3;  1K73 4;  3CCU 3;  1YIT 3;  3OW2 2;  1NJI 4;  1M90 4;  3CCL 3;  1YI2 3;  1VQ5 3;  3G71 3;  1Q7Y 4;  1KC8 4;  3CCS 3;  1YJW 3;  3I56 3;  1K9M 4;  3CCQ 3;  3CCV 3;  1W2B 2;  1KD1 4;  3CMA 3;  3CC7 3;  1M1K 4;  1QVG 2;  1QVF 2;  1VQK 3;  1Q86 4;  1YJ9 3;  1YHQ 3;  1VQ7 3;  1VQ8 3;  1YIJ 3;  1VQL 3;  1VQ6 3;  1Q81 4;  1VQN 3;  1VQ9 3;  3CPW 2;  1N8R 4;  1K8A 4;  1Q82 4;  3CCR 3;  1VQO 3;  3CC2 3;  3CCE 3;  2QEX 3;  3CXC 2;  2OTL 3;  3CD6 3;  3I55 3;  3G6E 3;  3G4S 3;  1S72 3;  3CME 3;  1JJ2 2;  3CC4 3;  2OTJ 3;  1VQM 3;  1VQP 3;  1KQS 2;  2QA4 3;  3CCJ 3;  3CCM 3;  1YJN 3; 
#chains in the Genus database with same CATH topology
 3FSD A;  4N6T A;  3T8U A;  3CCU 3;  2IUK A;  2JDI H;  3SED A;  3VGN A;  2W6J H;  1Q7H A;  4WYK A;  2CFL A;  1KC8 4;  1UW1 A;  1W7C A;  1NO3 A;  1Z1S A;  2XSO B;  5AIG A;  4FCZ A;  3MKI A;  1X1X A;  1RGK A;  4WFO A;  4EC6 A;  3PS8 A;  2I9W A;  2XRX B;  3K5T A;  7RNT A;  1AVL A;  1QJG A;  4FMA A;  4N6U A;  3FF2 A;  1GD3 A;  1YVB I;  4N6O B;  1RDS A;  1JB2 A;  1U8C B;  1VQ6 3;  3NM7 A;  2PNC A;  3FH1 A;  3CPW 2;  3HOH A;  5CK6 A;  1O7G B;  1TFK A;  4FCM A;  3Q3F A;  1EUI C;  1BSE A;  4XBX A;  1GYB A;  1FW7 A;  1IQY A;  3GZX B;  3CPO A;  3CME 3;  3MSO A;  1NWW A;  2GU1 A;  1BNE A;  3Q1C A;  4R80 A;  3ROB A;  1FUS A;  2WGO A;  4PEJ A;  1WMP A;  2W56 B;  3F7X A;  3VSY A;  1YJN 3;  1LXE A;  1K41 A;  3DH2 A;  1GY5 A;  2CC3 A;  3FCS B;  4L7K A;  1QAL A;  5D83 A;  2GBX B;  1F8N A;  1UCK A;  3D5G A;  4LMI A;  4QWT A;  2XF3 A;  5HOH A;  3GRD A;  2ZL8 A;  1BNF A;  1GOY A;  1UI8 A;  2P0M A;  2XR8 B;  3DMC A;  3V98 A;  2STD A;  2CW9 A;  2W9Q A;  4CCV A;  1TRQ A;  3RNT A;  3SYU A;  1T2H A;  1QMA A;  4LGQ A;  3FG3 A;  1VQ8 3;  3D9R A;  3SLU A;  3UL6 A;  3WDG B;  4WHA A;  1NB3 I;  1O7N B;  1N8R 4;  2GU3 A;  1VQO 3;  2IMJ A;  1MWU A;  1UUG B;  6STD A;  1JBT A;  1IYY A;  1S72 3;  2R4I A;  1LOY A;  1BNG A;  1JJ2 2;  1RGG A;  4ZM8 A;  3U1W A;  3AMO B;  4XB5 A;  2QA4 3;  1IQX A;  2OTJ 3;  1GMP A;  4N6L A;  2YFJ B;  5D81 A;  4HM7 B;  1OGX A;  5I97 A;  1A90 A;  5HGR A;  5IF6 A;  2Q07 A;  3AGO A;  3UL5 A;  4XDV A;  3FLJ A;  1EG9 B;  4O2H A;  4GHO A;  5A0O B;  2L1S A;  4FMD A;  3NQZ A;  2OQE C;  1QVG 2;  2CG1 A;  6RNT A;  2ML5 A;  1VQK 3;  2KF3 A;  3UJM A;  1VQ7 3;  1N5H A;  1SII A;  3LT9 A;  4EXR A;  3CNM A;  2B24 B;  2OOV C;  1RN1 A;  3V92 A;  4KFF A;  4LEH A;  5AIH A;  2BNG A;  2E2V A;  3G6E 3;  1RGH A;  3MHE A;  5AEU B;  2HMO B;  2SAR A;  1JB4 A;  3S29 A;  1I3I A;  1W6Y A;  2GSP A;  3PCR A;  1TJD A;  3BNB A;  3KII A;  2BMO B;  3OW2 2;  5G2G A;  1UDI I;  1M90 4;  3SVA A;  5M18 A;  3BNC A;  5FGO A;  4CPK A;  4HBR A;  3O8Y A;  4MJD A;  3SX1 A;  1BRH A;  3N9H A;  2BU4 A;  1B2S A;  1UUV B;  3K7C A;  4AKZ A;  3LH4 A;  3X41 A;  3D5I A;  3WMD A;  1B2M A;  1PY3 A;  1OHP A;  3F8H A;  1HKX A;  4KZ1 A;  9RNT A;  1UCI A;  5AYS C;  3KN4 A;  3BIR A;  1FGR A;  3CCE 3;  1V58 A;  5IG0 A;  1OF5 B;  1PYL A;  3DGY A;  4WYK B;  4O8S A;  4HM5 B;  1RCK A;  3OV4 A;  1RNT A;  3CCJ 3;  3BND A;  4EW5 A;  2RGQ A;  1O7M B;  3ALA A;  1JV2 B;  3OXA A;  2C11 A;  4XDW A;  1BAN A;  1RLS A;  3EB8 A;  2W03 A;  1Q40 B;  5STD A;  1FGT A;  4IPB A;  3CNX A;  1IVU A;  1RTU A;  1TU5 A;  4GSP A;  1KD1 4;  2Z7A A;  4IT7 A;  3STD A;  1QVF 2;  1LQG C;  5CF2 A;  3FKA A;  1VQN 3;  2Z77 A;  1J2B A;  2KXG A;  4CDL A;  1SJW A;  3DZL A;  3LTC A;  4CJN A;  5CXO A;  1EKM A;  1OGZ A;  1LVN A;  1RGA A;  2BIR A;  1OHO A;  2QIY A;  3F8X A;  1PU4 A;  2CFD A;  2LQV A;  3EBT A;  3FF0 A;  3G8Z A;  1NU3 A;  2W2C A;  3I0Y A;  2F98 A;  2Z76 A;  4IIA A;  3SXX A;  1WQL B;  1RHL A;  3PYJ A;  1YGW A;  3G71 3;  2XFS A;  2BHM A;  3EBY A;  4FR9 A;  4RZM A;  5AIF A;  3DY5 A;  5M1A A;  3NM2 A;  1BRN L;  4L8O A;  1BRS A;  5IEO A;  1UGI A;  1BSD A;  1D6U A;  1FUT A;  2CFW A;  1GY6 A;  1ZS7 A;  4JF8 A;  4BU4 A;  3B4P A;  3BB9 A;  5RNT A;  1GD4 A;  3JUP A;  3NBJ A;  1B2Z A;  1UCL A;  1N8Q A;  3GZY B;  4X2O A;  5EQL A;  3NQY A;  1GOV A;  4K90 B;  3FG4 A;  1AVK A;  3B7C A;  4JRF A;  1QAK A;  4MMY B;  1OH0 A;  3PZW A;  2HMK B;  1B2X A;  2W04 A;  1JB5 A;  2Y73 A;  4O3V A;  1O7W B;  1S5A A;  1RGL A;  4HOH A;  3EHC A;  3F14 A;  4NRE A;  4N6M A;  2O9U X;  4H3U A;  3DGL A;  1JKG B;  3Q90 A;  4EV5 A;  5KP4 A;  3T0U A;  2IY2 A;  1FUW A;  3J7Y d;  3CCS 3;  3QRD A;  3NV0 B;  4K1U A;  2WO0 A;  4HJL B;  1JNQ A;  2RBI A;  2YFL B;  4J9A A;  4R9K A;  3I56 3;  3EC9 A;  1BNI A;  4BTY A;  4HM3 B;  1YGE A;  4BL2 A;  3X42 A;  2XGL A;  1TFO A;  3JUO A;  3LML A;  3K9M C;  3WA2 X;  1Q82 4;  2KCD A;  3KSP A;  1ZGX A;  1BAO A;  3CD6 3;  3GZR A;  3I55 3;  4OVM A;  2K0M A;  3G4S 3;  3DGO A;  2D1W A;  1SPU A;  1BNS A;  2F5W A;  3K63 A;  4U13 A;  1VQM 3;  2IYJ A;  2IUJ A;  2KF4 A;  4EV2 A;  3JUM A;  1RN4 A;  1BRG A;  5IER A;  3CCL 3;  2GXF A;  1YI2 3;  1DET A;  3EE1 A;  1OHS A;  4J5G A;  1DE3 A;  3G16 A;  3T8N A;  2YX9 A;  4HAA A;  1AQZ A;  5ELU A;  3S27 A;  3KSE D;  3N8B A;  2XFT A;  4RNZ A;  3RGA A;  3F9S A;  5EEO A;  1Q81 4;  3CCR 3;  1MNL A;  1BGS A;  1RMS A;  1OAC A;  4HM4 B;  1FGM A;  3NXJ A;  5GSP A;  4BIR A;  4BTW A;  4HYZ A;  1LNI A;  3LZA A;  4N6V 0;  1SQW A;  4BL3 A;  3URP A;  3CC4 3;  1NNV A;  4OK0 A;  2XSH B;  3H51 A;  2CFG A;  1KQS 2;  3X3Y A;  3LTA A;  4STD A;  1AY7 A;  1VQ4 3;  2AAD A;  2V1L A;  4I4K A;  4LZI A;  2CKF B;  1FZU A;  1WTH A;  4R4K A;  8RNT A;  1LNH A;  1VQ5 3;  4HM2 B;  3KE7 A;  1B2U A;  1O7H B;  3A5E A;  3M8C A;  2RCD A;  1E97 A;  2W56 A;  5IEN A;  5IG5 A;  5M19 A;  1FGO A;  4FMB A;  2ML6 A;  1BNJ A;  1M1X B;  3KZT A;  3CCQ 3;  2ZDJ A;  1IQ8 A;  1X1W A;  3OWS A;  4GB5 A;  1ROA A;  1BUJ A;  1R4C A;  2KF6 A;  1I2G A;  1YIJ 3;  3H3H A;  1I2F A;  2KAA A;  1ULI B;  1W2Z A;  2J8X B;  1B3S A;  1YNV X;  1BVI A;  2OOV A;  5AEW B;  1MOL A;  1JZD A;  2M7O A;  2XEP A;  3DGN A;  1LRA A;  1IK3 A;  2OTL 3;  3FZW A;  1QAF A;  5IG4 A;  1NB5 I;  2F5M A;  2KF5 A;  3DXO A;  3L0R A;  1JBR A;  1K73 4;  1GMQ A;  3BNE A;  1NDO B;  1RGC A;  5CF1 A;  1IVX A;  3AHS A;  4AKY A;  1A2K A;  2CH9 A;  1Q7Y 4;  3AMO A;  7GSP A;  3WHO A;  3D4A A;  4XM4 A;  1BOX A;  1UI7 A;  2E2U A;  2YFI B;  1IU7 A;  1I2E A;  2P09 A;  1CH0 A;  1B20 A;  3WOE B;  2UGI A;  1SAR A;  1Q86 4;  3EX9 A;  1I8V A;  2KRT A;  3N54 B;  4BTX A;  2WGQ A;  2C10 A;  3TDG A;  3X40 A;  3JUQ A;  1A67 A;  2HMM B;  1I0V A;  3KKG A;  1I3F A;  3ZFZ A;  5JPP A;  3D79 A;  2CWV A;  1G96 A;  1MWT A;  1BSB A;  1VQP 3;  5AYR B;  2ZA4 A;  3K0Z A;  3VF1 A;  2CK3 H;  2MF7 A;  3FGY A;  1RCL A;  3GWR A;  4O02 B;  1RKY A;  2HML B;  3WOF B;  2CHC A;  2UX0 A;  3MPH A;  4KFE A;  1YJW 3;  3HZP A;  3BLZ A;  3HI7 A;  3CCV 3;  3WR2 A;  1KSI A;  1W2B 2;  3CMA 3;  1DVC A;  3NHX A;  4MMX B;  3NX0 A;  1CYU A;  3PXM A;  3ER7 A;  1Q9E A;  3NBR A;  1MGR A;  1L5G B;  1YHQ 3;  1US1 A;  3HK4 A;  4N3V A;  1JZO A;  1G02 A;  1TP6 A;  2RNT A;  3LXU X;  4H61 A;  4LYL B;  3WA3 A;  2Z6B A;  1T5Y A;  3OX9 A;  4J8T A;  1DMN A;  1E3V A;  5KP3 A;  1IV7 A;  1BSC A;  3JVC A;  2HOH A;  3MWZ A;  3RGR A;  1BUQ A;  3AGN A;  2CIU A;  1IVW A;  1G0T A;  3V99 A;  1YIT 3;  2GEX A;  1TUH A;  1LOW A;  2O3O A;  1OF5 A;  4FMC A;  5IW9 A;  1IT7 A;  1STF I;  1LQM B;  3ECF A;  1NJI 4;  1MWR A;  3KFQ C;  5TGN A;  1EA2 A;  2HMJ B;  3WOD G;  2ZHX B;  3MG1 A;  3JUN A;  1EEJ A;  4WP5 A;  3B8L A;  3OWU A;  2CX0 A;  1V57 A;  2W9P A;  1HZ1 A;  4HZB B;  4I5Q A;  1EQK A;  1BIR A;  1WMO A;  4LSO A;  4EBG A;  3CC7 3;  1W4N A;  1JN5 A;  1U5O A;  1Q40 A;  1WMN A;  3LYG A;  3GSP A;  1SIH A;  3HIG A;  4HM0 B;  1RSN A;  3S67 A;  1VQL 3;  1VQQ A;  1T3B A;  3F40 A;  3IPT A;  3EN8 A;  1K28 A;  3D3L A;  4ORL A;  2BT3 A;  2GEY A;  2LYX A;  5JPU A;  1X1Y A;  2H0G A;  2K3D A;  2QGU A;  3NUV A;  1IVV A;  1BRK A;  4KT3 B;  1ASK A;  1BNR A;  4HM1 B;  1DMQ A;  2H0H A;  1C7H A;  3MG2 A;  4R9L A;  1RJO A;  1FA3 A;  2D42 A;  2B1X B;  1GSP A;  4X2H A;  2H0I A;  3G0K A;  3DUK A;  5JBS A;  3DGM A;  2W0Q A;  6GSP A;  4OUQ A;  3SOA A;  2HMN B;  3SOY A;  4EYC A;  1N9J A;  3X3Z A;  1MGW A;  4MEI A;  1RRL A;  1YJ9 3;  2AAE A;  1W6C A;  1B21 A;  3EQQ B;  4KVH A;  4XBT A;  2JQ5 A;  4DKI A;  1VQ9 3;  1W00 A;  3OWY A;  1UCJ A;  4K61 A;  4N6N B;  1CQS A;  5BXQ A;  1M9G A;  4FCJ A;  1D6Z A;  3DM8 A;  1GMR A;  4ILF A;  2QEX 3;  4GL6 A;  4K1V A;  1HYF A;  4AEQ A;  3IJE B;  2INX A;  5AII A;  5BVB A;  1V74 A;  1YVS A;  1LOV A;  4RBN A;  2R41 A;  1ROV A;  3A76 A;  2F4Y A;  3CCM 3;  1DVD A;  2P38 A;  1OUN A;  3LTD A;  1Y4K A;  2F99 A;  3BU4 A;  5LC6 A;  1IV9 A;  7STD A;  4G1M B;  5IEP A;  1W02 A;  1ZO2 A;  2CX1 A;  2F86 B;  4MMZ B;  3UB1 A;  1HU9 A;  3MG3 A;  2CWT A;  1GS3 A;  3IMA B;  5ELJ A;  1RGF A;  1JKG A;  1TRP A;  2L4V A;  5LC7 A;  1LOX A;  1X1U A;  1BRJ A;  1R4Y A;  2P05 A;  5CLK A;  5G1L A;  3ZG5 A;  2C4B A;  3NV0 A;  2OQE A;  2FGT A;  3EF8 A;  1OPY A;  1VZZ A;  1K8A 4;  1GY7 A;  1N9E A;  2K54 A;  3E99 A;  3CC2 3;  2E2T A;  3CU3 A;  1BSA A;  4WWU C;  1AV4 A;  2CWU A;  2XGN A;  1BU4 A;  1ISK A;  3ZG0 A;  2MC8 A;  1BRI A;  2A15 A;  1IT8 A;  2IA7 A;  3X3X A;  1B27 A;  1A2P A;  2FNQ A;  1C54 A;  1TTO A;  2CG0 A;  1STD A;  4NPB A;  4L8P A;  1IDP A;  1K9M 4;  1RNB A;  3LT8 A;  1UGH I;  1RN7 A;  1ULJ B;  1DMM A;  4XBY A;  4RNT A;  1M1K 4;  1OCV A;  1W6G A;  1PFP A;  3QK9 A;  1W5Z A;  1N5P A;  1I0X A;  2BMQ B;  5BU4 A;  3B4O A;  1D6Y A;  1FYS A;  3UNL A;  1RRH A;  5IG3 A;  2RSX A;  1MWS A;  1RGE A;  1UUW B;  1ZX2 A;  5EVH A;  1T2I A;  4HM8 B;  3EN1 B;  2PZV A;  2FXT A;  1AR0 A;  1Q42 A;  8CHO A;  1JRQ A;  3S28 A;  2P0X A;  2BMR B;  5KP1 A;  2BO9 B;  1DYU A;  1JN5 B;  2SBL A;  4KFD A;  3GAX A;  4Q53 A;  5G1K A;  5BIR A;  3PCS A;  1W01 A;  2XH9 A;  1O7P B;  1CYV A;  1TIJ A;  3FG1 A;  3LTB A;  1E3R A;  5DRE A;  2CFK A;  2GBW B;  3PGB A;  5FW5 A;  2UUG C;  2WOH A;  3MYT A;  3GZB A;  2RFR A;  3S5C A;  3AHW A;  4J5K A;  1GOU A;  3EJV A;  4HZ9 B;  2OCT A;  4NHF A;  2Y74 A;  4TX4 A;  3HII A;  4HKV B;  3RDE A;  3Q2P A;  3LOY A;  1A2V A;  3U97 A;  1FGQ A;  5DRV A;  3HX8 A;  3F7S A;  3NBB A;  3CXC 2;  5D82 A;  4R1K A;  3KCH A;  1KWI A;  1CEW I;  2F56 A;  5AI1 A;  1WNH A;  4HVN A;  4RNY A;  1JBS A;  2OWP A;  1I70 A;  4HM6 B;  2WOF A; 
#chains in the Genus database with same CATH homology
 3FSD A;  4N6T A;  3T8U A;  3CCU 3;  2IUK A;  2JDI H;  3SED A;  3VGN A;  2W6J H;  4WYK A;  2CFL A;  1KC8 4;  1UW1 A;  1W7C A;  1NO3 A;  1Z1S A;  2XSO B;  5AIG A;  4FCZ A;  3MKI A;  4WFO A;  4EC6 A;  3PS8 A;  2I9W A;  2XRX B;  3K5T A;  1AVL A;  1QJG A;  4FMA A;  4N6U A;  3FF2 A;  1GD3 A;  1YVB I;  4N6O B;  1VQ6 3;  1JB2 A;  1U8C B;  3NM7 A;  2PNC A;  3FH1 A;  3CPW 2;  5CK6 A;  1O7G B;  1TFK A;  4FCM A;  4XBX A;  1GYB A;  1IQY A;  3GZX B;  3CPO A;  3CME 3;  3MSO A;  1NWW A;  2GU1 A;  3ROB A;  3Q1C A;  4R80 A;  2WGO A;  4PEJ A;  3VSY A;  1WMP A;  2W56 B;  3F7X A;  1YJN 3;  1LXE A;  1K41 A;  1GY5 A;  2CC3 A;  3FCS B;  4L7K A;  1QAL A;  5D83 A;  2GBX B;  1F8N A;  4LMI A;  4QWT A;  2XF3 A;  3GRD A;  2ZL8 A;  2P0M A;  3V98 A;  1UI8 A;  2XR8 B;  3DMC A;  2STD A;  2CW9 A;  2W9Q A;  4CCV A;  1QMA A;  4LGQ A;  3FG3 A;  1VQ8 3;  3D9R A;  3SLU A;  3UL6 A;  3WDG B;  4WHA A;  1NB3 I;  1O7N B;  1N8R 4;  2GU3 A;  1VQO 3;  2IMJ A;  6STD A;  1S72 3;  2R4I A;  1JJ2 2;  4ZM8 A;  3U1W A;  3AMO B;  4XB5 A;  2QA4 3;  1IQX A;  2OTJ 3;  4N6L A;  2YFJ B;  5D81 A;  4HM7 B;  1OGX A;  5I97 A;  1A90 A;  5HGR A;  5IF6 A;  2Q07 A;  3UL5 A;  4XDV A;  3FLJ A;  1EG9 B;  4O2H A;  5A0O B;  4FMD A;  3NQZ A;  2OQE C;  1QVG 2;  2CG1 A;  2ML5 A;  1VQK 3;  3UJM A;  1VQ7 3;  1N5H A;  1SII A;  3LT9 A;  4EXR A;  3CNM A;  2B24 B;  2OOV C;  3V92 A;  4KFF A;  4LEH A;  5AIH A;  2BNG A;  2E2V A;  3G6E 3;  5AEU B;  3MHE A;  2HMO B;  1JB4 A;  3S29 A;  3PCR A;  1W6Y A;  3BNB A;  3KII A;  2BMO B;  3OW2 2;  5G2G A;  1M90 4;  3SVA A;  3BNC A;  5FGO A;  4HBR A;  3O8Y A;  4MJD A;  3SX1 A;  3N9H A;  1UUV B;  3K7C A;  4AKZ A;  3LH4 A;  3X41 A;  3WMD A;  1OHP A;  3F8H A;  1HKX A;  4KZ1 A;  5AYS C;  3KN4 A;  1FGR A;  3CCE 3;  5IG0 A;  1OF5 B;  4WYK B;  4O8S A;  4HM5 B;  3OV4 A;  3CCJ 3;  3BND A;  2RGQ A;  1O7M B;  3ALA A;  1JV2 B;  3OXA A;  2C11 A;  4XDW A;  3EB8 A;  2W03 A;  1Q40 B;  5STD A;  1FGT A;  4IPB A;  3CNX A;  1IVU A;  1TU5 A;  1KD1 4;  2Z7A A;  4IT7 A;  3STD A;  1QVF 2;  5CF2 A;  3FKA A;  1VQN 3;  2Z77 A;  1J2B A;  2KXG A;  4CDL A;  1SJW A;  3DZL A;  3LTC A;  5CXO A;  1EKM A;  1OGZ A;  1LVN A;  1OHO A;  2QIY A;  3F8X A;  1PU4 A;  2CFD A;  2LQV A;  3EBT A;  3FF0 A;  3G8Z A;  1NU3 A;  2W2C A;  3I0Y A;  2F98 A;  2Z76 A;  4IIA A;  3SXX A;  1WQL B;  3PYJ A;  3G71 3;  2XFS A;  2BHM A;  3EBY A;  4FR9 A;  4RZM A;  5AIF A;  3DY5 A;  3NM2 A;  4L8O A;  5IEO A;  1D6U A;  2CFW A;  4JF8 A;  1GY6 A;  3B4P A;  3BB9 A;  1GD4 A;  3JUP A;  3NBJ A;  1N8Q A;  3GZY B;  4X2O A;  5EQL A;  3NQY A;  4K90 B;  3FG4 A;  1AVK A;  3B7C A;  4JRF A;  1QAK A;  4MMY B;  1OH0 A;  3PZW A;  2HMK B;  4O3V A;  2W04 A;  1JB5 A;  2Y73 A;  1O7W B;  1S5A A;  3EHC A;  3F14 A;  4NRE A;  4N6M A;  2O9U X;  4H3U A;  3DGL A;  1JKG B;  3Q90 A;  4EV5 A;  5KP4 A;  3T0U A;  1FUW A;  3J7Y d;  3CCS 3;  3QRD A;  3NV0 B;  4K1U A;  2WO0 A;  4HJL B;  1JNQ A;  2YFL B;  4J9A A;  4R9K A;  3I56 3;  3EC9 A;  4BTY A;  4HM3 B;  1YGE A;  3X42 A;  2XGL A;  1TFO A;  3JUO A;  3LML A;  3K9M C;  3WA2 X;  1Q82 4;  2KCD A;  3KSP A;  3CD6 3;  3GZR A;  3I55 3;  4OVM A;  2K0M A;  3G4S 3;  3DGO A;  2D1W A;  1SPU A;  4U13 A;  3K63 A;  1VQM 3;  2IUJ A;  4EV2 A;  3JUM A;  5IER A;  3CCL 3;  2GXF A;  1YI2 3;  3EE1 A;  1OHS A;  3G16 A;  3T8N A;  2YX9 A;  5ELU A;  3S27 A;  3KSE D;  3N8B A;  2XFT A;  4RNZ A;  3RGA A;  3F9S A;  5EEO A;  1Q81 4;  3CCR 3;  1MNL A;  1OAC A;  4HM4 B;  1FGM A;  3NXJ A;  4BTW A;  4HYZ A;  3LZA A;  4N6V 0;  1SQW A;  3CC4 3;  4OK0 A;  2XSH B;  3H51 A;  2CFG A;  1KQS 2;  3X3Y A;  3LTA A;  4STD A;  1VQ4 3;  4I4K A;  2V1L A;  4LZI A;  4R4K A;  2CKF B;  1WTH A;  1LNH A;  1VQ5 3;  4HM2 B;  3KE7 A;  1O7H B;  3M8C A;  2RCD A;  1E97 A;  2W56 A;  5IEN A;  5IG5 A;  1FGO A;  4FMB A;  2ML6 A;  1M1X B;  3KZT A;  3CCQ 3;  2ZDJ A;  1IQ8 A;  3OWS A;  4GB5 A;  1ROA A;  1R4C A;  1YIJ 3;  3H3H A;  1ULI B;  1W2Z A;  2OOV A;  5AEW B;  1MOL A;  2M7O A;  2XEP A;  3DGN A;  1IK3 A;  2OTL 3;  3FZW A;  1QAF A;  5IG4 A;  1NB5 I;  3DXO A;  3L0R A;  1K73 4;  3BNE A;  1NDO B;  5CF1 A;  1IVX A;  4AKY A;  1A2K A;  2CH9 A;  1Q7Y 4;  3AMO A;  4XM4 A;  1UI7 A;  2E2U A;  2YFI B;  1IU7 A;  2P09 A;  3WOE B;  1Q86 4;  3EX9 A;  2KRT A;  3N54 B;  4BTX A;  2WGQ A;  2C10 A;  3TDG A;  3X40 A;  3JUQ A;  1A67 A;  2HMM B;  3KKG A;  5JPP A;  2CWV A;  1G96 A;  1VQP 3;  5AYR B;  3K0Z A;  3VF1 A;  2CK3 H;  2MF7 A;  3FGY A;  3GWR A;  4O02 B;  1RKY A;  2HML B;  3WOF B;  2CHC A;  2UX0 A;  3MPH A;  4KFE A;  1YJW 3;  3HZP A;  3BLZ A;  3HI7 A;  3CCV 3;  1W2B 2;  1KSI A;  3CMA 3;  1DVC A;  3NHX A;  4MMX B;  3NX0 A;  1CYU A;  3PXM A;  3ER7 A;  3NBR A;  1L5G B;  1YHQ 3;  1US1 A;  3HK4 A;  4N3V A;  1TP6 A;  3LXU X;  4H61 A;  3WA3 A;  2Z6B A;  1T5Y A;  3OX9 A;  4J8T A;  1DMN A;  1E3V A;  5KP3 A;  1IV7 A;  3JVC A;  3MWZ A;  3RGR A;  1BUQ A;  2CIU A;  1IVW A;  3V99 A;  1YIT 3;  2GEX A;  1TUH A;  2O3O A;  5IW9 A;  1OF5 A;  4FMC A;  1NJI 4;  1IT7 A;  1STF I;  3ECF A;  3KFQ C;  5TGN A;  1EA2 A;  2HMJ B;  3WOD G;  3MG1 A;  3JUN A;  4WP5 A;  3B8L A;  3OWU A;  2W9P A;  4HZB B;  1EQK A;  1WMO A;  4LSO A;  4EBG A;  3CC7 3;  1W4N A;  1JN5 A;  1U5O A;  1Q40 A;  1WMN A;  3LYG A;  1SIH A;  3HIG A;  4HM0 B;  3S67 A;  1VQL 3;  3IPT A;  3F40 A;  4ORL A;  3EN8 A;  1K28 A;  3D3L A;  2BT3 A;  2GEY A;  2LYX A;  5JPU A;  2QGU A;  3NUV A;  1IVV A;  1ASK A;  4HM1 B;  1DMQ A;  1C7H A;  3MG2 A;  4R9L A;  1RJO A;  1FA3 A;  2D42 A;  2B1X B;  4X2H A;  3G0K A;  3DUK A;  5JBS A;  3DGM A;  2W0Q A;  4OUQ A;  3SOA A;  2HMN B;  3SOY A;  4EYC A;  1N9J A;  3X3Z A;  4MEI A;  1RRL A;  1YJ9 3;  3EQQ B;  1W6C A;  4KVH A;  4XBT A;  2JQ5 A;  1VQ9 3;  1W00 A;  3OWY A;  4K61 A;  4N6N B;  1CQS A;  5BXQ A;  1M9G A;  4FCJ A;  1D6Z A;  3DM8 A;  2QEX 3;  4GL6 A;  4K1V A;  4AEQ A;  3IJE B;  2INX A;  5AII A;  5BVB A;  1V74 A;  4RBN A;  1ROV A;  3A76 A;  3CCM 3;  1DVD A;  2P38 A;  1OUN A;  3LTD A;  1Y4K A;  2F99 A;  5LC6 A;  7STD A;  1IV9 A;  5IEP A;  4G1M B;  1W02 A;  1ZO2 A;  2F86 B;  4MMZ B;  3UB1 A;  1HU9 A;  3MG3 A;  2CWT A;  1GS3 A;  3IMA B;  5ELJ A;  1JKG A;  2L4V A;  5LC7 A;  1LOX A;  2P05 A;  5CLK A;  3NV0 A;  2OQE A;  2FGT A;  3EF8 A;  1OPY A;  1VZZ A;  1K8A 4;  1GY7 A;  1N9E A;  2K54 A;  3E99 A;  3CC2 3;  2E2T A;  3CU3 A;  4WWU C;  1AV4 A;  2CWU A;  2XGN A;  1ISK A;  2MC8 A;  2A15 A;  1IT8 A;  2IA7 A;  3X3X A;  2FNQ A;  2CG0 A;  1STD A;  4L8P A;  1IDP A;  1K9M 4;  3LT8 A;  1RN7 A;  1ULJ B;  1DMM A;  4XBY A;  1M1K 4;  1OCV A;  1W6G A;  1PFP A;  3QK9 A;  1W5Z A;  1N5P A;  2BMQ B;  3B4O A;  1D6Y A;  3UNL A;  1RRH A;  5IG3 A;  2RSX A;  1UUW B;  1ZX2 A;  5EVH A;  4HM8 B;  3EN1 B;  2PZV A;  2FXT A;  1AR0 A;  1Q42 A;  8CHO A;  1JRQ A;  3S28 A;  2P0X A;  2BMR B;  5KP1 A;  2BO9 B;  1DYU A;  1JN5 B;  2SBL A;  4KFD A;  3GAX A;  4Q53 A;  3PCS A;  1W01 A;  2XH9 A;  1O7P B;  1CYV A;  1TIJ A;  3FG1 A;  3LTB A;  1E3R A;  5DRE A;  2CFK A;  2GBW B;  3PGB A;  5FW5 A;  3MYT A;  2WOH A;  3GZB A;  2RFR A;  3S5C A;  3EJV A;  4HZ9 B;  2OCT A;  4NHF A;  2Y74 A;  4TX4 A;  3HII A;  4HKV B;  3RDE A;  3Q2P A;  3LOY A;  1A2V A;  3U97 A;  1FGQ A;  5DRV A;  3HX8 A;  3F7S A;  3NBB A;  3CXC 2;  5D82 A;  4R1K A;  1KWI A;  1CEW I;  5AI1 A;  1WNH A;  4HVN A;  4RNY A;  2OWP A;  4HM6 B;  2WOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...