3CCE3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cce300
1KQS2 1N8R4 1VQM3 1Q7Y4 1JJ22 1VQ83 3CD63 1M904 3CCR3 1YIT3 1QVG2 1VQ53 1VQ63 3OW22 1Q824 2QEX3 1VQN3 2OTL3 3I563 1YJ93 1YJN3 1NJI4 3CMA3 1Q814 1K8A4 3G6E3 1YI23 3G713 1W2B2 1VQL3 3CCE3 1M1K4 3CCS3 1VQK3 1K734 1YJW3 1VQO3 3CCU3 3G4S3 3CME3 1YHQ3 1KC84 3CC43 1Q864 3CCV3 3CXC2 3CC73 3CPW2 3CC23 1QVF2 3I553 2QA43 1VQ73 1VQ93 3CCQ3 1VQP3 1VQ43 2OTJ3 3CCM3 1S723 3CCL3 1K9M4 3CCJ3 1KD14 1YIJ3
chains in the Genus database with same CATH superfamily
2AADA 1KQS2 3EB8A 3PYJA 4HBRA 4WHAA 5M19A 4HM0B 1GOUA 1ZS7A 3EHCA 1QVG2 1Q824 1BRKA 1IVVA 2QEX3 8RNTA 3OWSA 2ZA4A 1MWSA 3AGNA 3BNBA 4HOHA 1L5GB 4MJDA 3F7XA 4J5GA 4Q53A 4LMIA 4FCZA 4BIRA 2GEYA 1OHPA 1W4NA 1ISKA 2F56A 4HVNA 3X42A 2BT3A 1BSCA 2XGNA 1TFOA 2RNTA 3E99A 1F8NA 2CFDA 2HMNB 4JF8A 4MMZB 2P05A 3ROBA 3CCQ3 3F14A 1MGWA 1OPYA 3B4OA 3KZTA 3KCHA 3CNXA 3B4PA 2FXTA 4R4KA 1RTUA 1YNVX 1VQM3 1Q7Y4 1GY6A 5FW5A 1BNJA 1TUHA 4I5QA 4XBYA 1W2ZA 2GEXA 2W04A 3L0RA 4KFFA 5JPUA 2PZVA 4WWUC 4XDVA 4CDLA 1WTHA 2ZHXB 4NPBA 3F40A 5RNTA 1DVDA 2GU1A 1Q9EA 4FCMA 2Z76A 3KN4A 3EN1B 1ZGXA 1I8VA 1OCVA 1PU4A 1BRHA 2KF3A 4FMBA 1GMRA 1WMNA 4EXRA 1BSDA 3OWYA 6GSPA 2K3DA 1GY5A 4WYKB 1VQP3 4K90B 1MWTA 4H3UA 3SYUA 3CCM3 2CFWA 3BNCA 1KD14 2XSOB 4OUQA 2C11A 1A67A 2F5WA 2UGIA 7STDA 3SOYA 1D6ZA 1NB3I 1FUWA 3CCR3 1YIT3 2Z7AA 1VQ53 2STDA 4O3VA 1GOYA 1T3BA 1OHOA 3UJMA 3URPA 3K7CA 1CYUA 1M1XB 1YVSA 3KSED 2ML5A 2K54A 1LOWA 2C10A 2SBLA 1FW7A 5JPPA 1JB5A 1V74A 1W2B2 1RGEA 3CCE3 3BNDA 1K734 3DUKA 2GXFA 5IEPA 2WOFA 4HZ9B 1FYSA 1X1YA 3HIGA 4HM5B 1GD3A 3MPHA 4R9KA 1G02A 2K0MA 3VF1A 1NNVA 3DGYA 1BU4A 2LYXA 1RSNA 2MF7A 2MC8A 1CQSA 1I3FA 1PFPA 1UUWB 1GSPA 2ZL8A 1Q7HA 3CCJ3 3Q2PA 2O9UX 1BRIA 4HKVB 5IG4A 4RNYA 2HMKB 3EX9A 4EC6A 1JJ22 3ECFA 5D83A 1JB2A 3BNEA 2XEPA 5CXOA 3JUQA 1B20A 1EA2A 3EBYA 5CLKA 4J9AA 5HOHA 1IT7A 1LVNA 1V58A 3QK9A 2OOVC 1BNFA 1JZDA 1IQXA 3KE7A 3KKGA 1OHSA 1B3SA 3VSYA 1UCJA 1Q864 3ER7A 5DREA 3EN8A 3I553 3DGMA 2YFLB 1C54A 2HMMB 4HM7B 3KIIA 4RNTA 2XFSA 1D6YA 1QJGA 2Q07A 1VQQA 1I2FA 2RSXA 3DZLA 2H0IA 3MKIA 3N9HA 4N3VA 1LQMB 3JVCA 3PGBA 2QGUA 4HJLB 2BNGA 3A5EA 4KZ1A 1LOVA 4GSPA 3DGNA 5D81A 3DGOA 1BRJA 1ZX2A 3NX0A 2XR8B 4BTXA 2WO0A 3G713 5AYSC 3S5CA 1CYVA 1QAFA 1BIRA 5AI1A 5GSPA 1TU5A 1VQK3 1LXEA 3V98A 3NHXA 1HYFA 3T8NA 4L7KA 5BIRA 1UCKA 3EQQB 1IQYA 4OVMA 1IDPA 1MOLA 3HI7A 2RGQA 4AKZA 4KFEA 5ELJA 1UUGB 4FMAA 1JB4A 2XSHB 3K5TA 5M18A 1TJDA 3LH4A 5AYRB 3G0KA 1N8QA 1E3RA 2CIUA 4QWTA 2F5MA 4N6LA 1RGFA 1YIJ3 1MWRA 5IG3A 3NQYA 4LGQA 1Q40B 3S29A 4DKIA 1VQN3 1FGMA 3PCSA 4GHOA 3EBTA 1RGCA 1YVBI 3NV0A 2KF4A 4MEIA 4TX4A 5EQLA 1FGQA 2OOVA 3SEDA 1NJI4 2XFTA 1LNHA 3STDA 4R80A 7GSPA 4G1MB 2W6JH 2H0HA 3MYTA 3D3LA 2L4VA 3BU4A 3BLZA 3Q3FA 2P38A 1SPUA 3O8YA 3CC43 3KSPA 1SARA 1OF5B 3AMOB 3F9SA 4R9LA 2H0GA 2OCTA 1BNGA 2QA43 3NBRA 2P0MA 3MG3A 3U97A 1N5HA 1LRAA 2FNQA 4RNZA 3DXOA 2W56A 1BAOA 1VQ83 1CH0A 1RGLA 1M904 3CD63 5CF2A 1T2IA 2KF6A 3OX9A 1WQLB 3DMCA 5HGRA 1BNRA 1I2EA 3BIRA 3M8CA 4R1KA 3FG3A 4EV2A 4BU4A 1RNBA 1QAKA 3NM7A 1S5AA 3HK4A 5IF6A 5CF1A 5DRVA 2ZDJA 1YJN3 1Q814 1RHLA 1I2GA 1W01A 3PS8A 1EQKA 1LQGC 4FR9A 5IEOA 2F86B 4FMDA 2W0QA 1O7MB 2F99A 1W5ZA 3G4S3 2HMOB 1R4YA 3EF8A 1UI7A 2CC3A 4RBNA 1ULIB 2O3OA 1JN5A 3IPTA 2CFGA 4NREA 3LTDA 4ORLA 1VQ43 1BRSA 1W6GA 1TP6A 3SXXA 1UI8A 1O7NB 1TFKA 1EKMA 1RJOA 4GB5A 1K41A 3WA3A 2WOHA 3X3XA 4N6V0 3ZG5A 1BGSA 3RGAA 1RMSA 1W7CA 4LYLB 4ZM8A 1RN1A 1IVWA 4NHFA 5BVBA 4HAAA 2HMJB 3B7CA 3LXUX 3GWRA 3WR2A 1X1UA 2RCDA 3U1WA 4N6MA 1SQWA 1CEWI 1BVIA 2OWPA 3CU3A 3F8HA 3H51A 5G1LA 2YX9A 2P0XA 4ILFA 2CWTA 1KC84 3WMDA 3CXC2 1FUSA 1MNLA 3BB9A 1I3IA 3HOHA 4KT3B 3HIIA 1LOXA 1UGHI 3QRDA 3WDGB 3UB1A 4U13A 4BTWA 1QVF2 1UUVB 3X3YA 1AR0A 1TTOA 1B27A 3SLUA 5AEUB 3S28A 1K9M4 1NDOB 3KFQC 3MWZA 1STFI 5IG0A 1BANA 1RDSA 4EW5A 1DYUA 3FKAA 1UCLA 3OW22 3D79A 3Q90A 1GY7A 4HYZA 5KP3A 3MG1A 1HKXA 4L8PA 1D6UA 3JUNA 3AHWA 3FZWA 4RZMA 2IUKA 4HM4B 3FG4A 3G6E3 4PEJA 5I97A 3T8UA 1DE3A 3NBJA 1RCKA 4FCJA 1OGXA 3A76A 5IW9A 3DGLA 1JKGB 4WFOA 3FH1A 5G2GA 1WNHA 3CC73 1G96A 2Y74A 4WYKA 4IPBA 3LTBA 2XF3A 3FF0A 1N5PA 1N9JA 1O7PB 1WMOA 2CWUA 2Z6BA 2J8XB 1IQ8A 3F8XA 1VZZA 1LOYA 3J7Yd 4L8OA 1RGHA 1G0TA 2WGQA 2KRTA 1Z1SA 2BMQB 1BSBA 5G1KA 2UUGC 3ZG0A 6RNTA 3LT8A 1TRPA 5IERA 2BO9B 4O02B 5EEOA 3AGOA 3MHEA 3S67A 4HM6B 1NB5I 1ZO2A 1AVKA 1E97A 3GZXB 1B2UA 3GAXA 1V57A 2UX0A 3PXMA 3CCS3 4N6TA 1BSEA 4N6UA 3WA2X 1K28A 5BU4A 1A2VA 3LTAA 1ASKA 1WMPA 3GZRA 2OQEC 2D42A 4N6OB 2B1XB 1HU9A 1TRQA 3K9MC 1JV2B 4EYCA 1GMQA 4XBXA 2KCDA 1IV7A 3V99A 2IA7A 1IVUA 1RN4A 6STDA 1UGIA 2BHMA 4MMXB 2CX0A 2XGLA 1JRQA 2XH9A 3CCL3 1NWWA 3FF2A 3LYGA 1I0VA 1KWIA 2INXA 5AIFA 1FGTA 3OWUA 2F98A 5AIIA 1BUJA 2CFLA 1U8CB 2JQ5A 3FCSB 3RDEA 1W02A 2HOHA 3PCRA 5AIHA 2GSPA 3DY5A 3LTCA 4HM3B 1ULJB 3OXAA 1UW1A 1VQL3 2AAEA 2CHCA 3DM8A 1YJW3 3X40A 1JBTA 1JNQA 3CCU3 1B2MA 2GU3A 1Q42A 2I9WA 1W6YA 1ROVA 1PY3A 2W9QA 1AY7A 4HM2B 2R4IA 1BSAA 1SJWA 4EBGA 2A15A 1DVCA 1X1WA 2IMJA 2CWVA 3X3ZA 1I70A 3NXJA 4CCVA 1OGZA 3JUOA 2YFIB 3IJEB 1RRLA 1JBSA 1GYBA 1HZ1A 4HZBB 1M9GA 1B2SA 1RRHA 1BRNL 1AV4A 3AHSA 3GRDA 1B21A 3SX1A 1TIJA 3LZAA 1T2HA 1T5YA 3V92A 2RFRA 2SARA 1GOVA 2OQEA 3S27A 3UL5A 4KFDA 5STDA 4XB5A 4BL3A 3WOFB 1BNSA 1BNIA 3SVAA 3JUMA 4O8SA 2W2CA 5CK6A 1RGAA 4AKYA 5TGNA 3CMA3 4N6NB 8CHOA 2KF5A 1GD4A 1MWUA 2F4YA 2JDIH 1SIHA 2RBIA 1O7WB 3WODG 2HMLB 3MSOA 3NBBA 2OTJ3 1OACA 1E3VA 2M7OA 1OH0A 1FGOA 4H61A 3RNTA 1W00A 3B8LA 1N8R4 1Q40A 1DMMA 3EC9A 4I4KA 3F7SA 2C4BA 2CKFB 2OTL3 3NUVA 4CJNA 2CG0A 4XM4A 1IYYA 1YI23 2PNCA 3G16A 3K0ZA 4K1UA 1A2PA 2E2TA 1OF5A 3AMOA 4BL2A 1DMQA 3G8ZA 1YHQ3 9RNTA 2CH9A 1IK3A 3CCV3 1STDA 2CX1A 3D9RA 2V1LA 1B2ZA 3WHOA 3ZFZA 7RNTA 2XRXB 1FA3A 1O7HB 1UDII 2BU4A 3FG1A 1RGGA 2GBWB 4FMCA 3CNMA 2Y73A 4CPKA 4HM8B 1N9EA 3VGNA 3MG2A 1RCLA 4STDA 3UL6A 1RLSA 2W03A 1RGKA 4OK0A 1JBRA 3EE1A 1FZUA 3X41A 3LMLA 4EV5A 3D5IA 2BIRA 1NU3A 5JBSA 5M1AA 1R4CA 1M1K4 1A90A 3ALAA 1VQO3 5D82A 1YGWA 1QMAA 3I0YA 3EJVA 3NQZA 4LSOA 1UCIA 1YGEA 1X1XA 2GBXB 4X2OA 5LC6A 1J2BA 1LNIA 3D4AA 4GL6A 3UNLA 4IIAA 1RKYA 2IY2A 3H3HA 4K61A 2CG1A 1EEJA 5BXQA 2LQVA 4WP5A 1FUTA 1U5OA 5A0OB 2KXGA 4KVHA 1JZOA 5AIGA 3DH2A 3HZPA 3NM2A 1GMPA 2WGOA 3I563 1US1A 1O7GB 3LT9A 1RN7A 3FGYA 3GZYB 3LOYA 5KP4A 1K8A4 3NV0B 1QALA 4O2HA 4MMYB 4LEHA 2B24B 3HX8A 3RGRA 3PZWA 5FGOA 5AEWB 1BOXA 4X2HA 2CFKA 1IU7A 1C7HA 3CME3 5ELUA 4J8TA 4XBTA 4XDWA 1NO3A 5IENA 3FLJA 4JRFA 4IT7A 1OUNA 3K63A 2KAAA 1IVXA 3GSPA 2QIYA 3N54B 2IUJA 1IV9A 2D1WA 1AVLA 1SIIA 1DETA 2W56B 2L1SA 1FGRA 3T0UA 1B2XA 1BNEA 4J5KA 2ML6A 1VQ63 2FGTA 3OV4A 4HM1B 5IG5A 1MGRA 4AEQA 3CPOA 1YJ93 2BMOB 3JUPA 2CK3H 2R41A 5EVHA 1A2KA 4LZIA 3WOEB 2CW9A 1DMNA 3SOAA 1IT8A 1PYLA 5LC7A 1AQZA 4K1VA 1KSIA 1JKGA 3D5GA 1GS3A 5KP1A 1Y4KA 2E2VA 3FSDA 1RNTA 1BUQA 1ROAA 3CPW2 3CC23 2W9PA 1VQ73 1VQ93 2BMRB 3GZBA 2IYJA 1JN5B 1BRGA 1I0XA 2Z77A 4BTYA 1W6CA 3TDGA 3IMAB 2YFJB 3N8BA 2P09A 3Q1CA 1S723 1EG9B 1EUIC 2E2UA
chains in the Genus database with same CATH topology
1KQS2 3EB8A 3PYJA 4HBRA 4WHAA 4HM0B 3EHCA 1QVG2 1Q824 2QEX3 1IVVA 3OWSA 3BNBA 1L5GB 4MJDA 3F7XA 4Q53A 4LMIA 4FCZA 2GEYA 1OHPA 1W4NA 1ISKA 4HVNA 3X42A 2BT3A 2XGNA 1TFOA 3E99A 1F8NA 2CFDA 2HMNB 4JF8A 4MMZB 2P05A 3ROBA 3CCQ3 3F14A 3B4OA 1OPYA 3KZTA 3CNXA 3B4PA 2FXTA 4R4KA 1VQM3 1Q7Y4 1GY6A 5FW5A 1TUHA 4XBYA 1W2ZA 2GEXA 2W04A 3L0RA 4KFFA 5JPUA 2PZVA 4WWUC 4XDVA 4CDLA 1WTHA 3F40A 1DVDA 2GU1A 4FCMA 2Z76A 3KN4A 3EN1B 1OCVA 1PU4A 4FMBA 1WMNA 4EXRA 3OWYA 1GY5A 4WYKB 1VQP3 4K90B 4H3UA 3CCM3 2CFWA 3BNCA 1KD14 2XSOB 4OUQA 2C11A 1A67A 7STDA 3SOYA 1D6ZA 1NB3I 1FUWA 3CCR3 1YIT3 2Z7AA 1VQ53 2STDA 4O3VA 1OHOA 3UJMA 3K7CA 1CYUA 1M1XB 3KSED 2ML5A 2K54A 2C10A 2SBLA 5JPPA 1JB5A 1V74A 1W2B2 3CCE3 3BNDA 1K734 3DUKA 2GXFA 5IEPA 2WOFA 4HZ9B 3HIGA 4HM5B 1GD3A 3MPHA 4R9KA 2K0MA 3VF1A 2LYXA 2MF7A 2MC8A 1CQSA 1PFPA 1UUWB 2ZL8A 3CCJ3 3Q2PA 2O9UX 4HKVB 5IG4A 1JJ22 4RNYA 2HMKB 3EX9A 4EC6A 3ECFA 5D83A 1JB2A 3BNEA 2XEPA 5CXOA 3JUQA 1EA2A 3EBYA 5CLKA 4J9AA 1IT7A 1LVNA 3QK9A 2OOVC 3KKGA 3KE7A 1IQXA 1OHSA 3VSYA 1Q864 3ER7A 5DREA 3EN8A 3I553 3DGMA 2YFLB 2HMMB 4HM7B 3KIIA 2XFSA 1D6YA 2Q07A 1QJGA 3DZLA 2RSXA 3N9HA 4N3VA 3MKIA 3JVCA 3PGBA 2QGUA 4HJLB 2BNGA 4KZ1A 3DGNA 5D81A 3DGOA 1ZX2A 3NX0A 2XR8B 4BTXA 2WO0A 3G713 5AYSC 3S5CA 1CYVA 1QAFA 5AI1A 1TU5A 1VQK3 1LXEA 3V98A 3NHXA 3T8NA 4L7KA 3EQQB 1IQYA 4OVMA 1IDPA 1MOLA 3HI7A 2RGQA 4AKZA 4KFEA 5ELJA 4FMAA 1JB4A 2XSHB 3K5TA 3LH4A 5AYRB 3G0KA 1N8QA 1E3RA 2CIUA 4QWTA 1YIJ3 4N6LA 5IG3A 3NQYA 4LGQA 1Q40B 3S29A 1VQN3 1FGMA 3PCSA 4MEIA 3EBTA 1YVBI 5EQLA 3NV0A 3SEDA 2OOVA 4TX4A 1FGQA 1NJI4 2XFTA 1LNHA 3STDA 4R80A 4G1MB 2W6JH 3MYTA 3D3LA 2L4VA 3BLZA 2P38A 1SPUA 3O8YA 3CC43 3KSPA 1OF5B 3AMOB 3F9SA 4R9LA 2OCTA 2QA43 3NBRA 2P0MA 3MG3A 3U97A 1N5HA 2FNQA 4RNZA 3DXOA 2W56A 1VQ83 1M904 3CD63 5CF2A 3OX9A 1WQLB 3DMCA 5HGRA 3M8CA 4R1KA 4EV2A 3FG3A 1QAKA 3NM7A 1S5AA 3HK4A 5IF6A 5CF1A 5DRVA 2ZDJA 1YJN3 1Q814 1W01A 3PS8A 1EQKA 4FR9A 5IEOA 2F86B 4FMDA 2W0QA 1O7MB 2F99A 1W5ZA 3G4S3 2HMOB 3EF8A 1UI7A 2CC3A 4RBNA 1ULIB 2O3OA 1JN5A 3IPTA 2CFGA 4NREA 3LTDA 4ORLA 1VQ43 1TP6A 1W6GA 3SXXA 1UI8A 1O7NB 1TFKA 1EKMA 1RJOA 4GB5A 1K41A 3WA3A 2WOHA 3X3XA 4N6V0 3RGAA 1W7CA 4ZM8A 1IVWA 4NHFA 5BVBA 2HMJB 3B7CA 3LXUX 3GWRA 2RCDA 3U1WA 4N6MA 1SQWA 1CEWI 2OWPA 3CU3A 3F8HA 3H51A 2YX9A 2P0XA 2CWTA 1KC84 3WMDA 3CXC2 1MNLA 3BB9A 3HIIA 1LOXA 3QRDA 3WDGB 1QVF2 3UB1A 4U13A 4BTWA 1UUVB 3X3YA 1AR0A 3SLUA 5AEUB 3S28A 1K9M4 1NDOB 3KFQC 3MWZA 1STFI 5IG0A 1DYUA 3FKAA 3OW22 3Q90A 1GY7A 4HYZA 5KP3A 3MG1A 1HKXA 4L8PA 1D6UA 3JUNA 3FZWA 4RZMA 2IUKA 4HM4B 3FG4A 3G6E3 4PEJA 5I97A 3T8UA 3NBJA 4FCJA 1OGXA 3A76A 5IW9A 3DGLA 1JKGB 4WFOA 3FH1A 5G2GA 1WNHA 3CC73 1G96A 2Y74A 4WYKA 4IPBA 3LTBA 2XF3A 3FF0A 1N5PA 1N9JA 1O7PB 1WMOA 2CWUA 2Z6BA 1IQ8A 3F8XA 1VZZA 3J7Yd 4L8OA 2WGQA 2KRTA 1Z1SA 2BMQB 3LT8A 5IERA 2BO9B 4O02B 5EEOA 3MHEA 3S67A 1NB5I 4HM6B 1ZO2A 1AVKA 1E97A 3GZXB 3GAXA 2UX0A 3PXMA 3CCS3 4N6TA 4N6UA 3WA2X 1K28A 1A2VA 3LTAA 1ASKA 1WMPA 3GZRA 2OQEC 2D42A 4N6OB 2B1XB 1HU9A 3K9MC 4EYCA 1JV2B 4XBXA 2KCDA 1IV7A 3V99A 2IA7A 1IVUA 6STDA 2BHMA 4MMXB 2XGLA 1JRQA 2XH9A 3CCL3 1NWWA 3FF2A 3LYGA 1KWIA 2INXA 5AIFA 1FGTA 3OWUA 2F98A 5AIIA 2CFLA 1U8CB 2JQ5A 3FCSB 3RDEA 1W02A 3PCRA 5AIHA 3DY5A 3LTCA 4HM3B 1ULJB 3OXAA 1UW1A 1VQL3 2CHCA 3DM8A 1YJW3 3X40A 1JNQA 3CCU3 2GU3A 1Q42A 2I9WA 1W6YA 1ROVA 2W9QA 4HM2B 2R4IA 1SJWA 4EBGA 2IMJA 1DVCA 2A15A 2CWVA 3X3ZA 3NXJA 4CCVA 1OGZA 3JUOA 2YFIB 3IJEB 1RRLA 1GYBA 4HZBB 1M9GA 1RRHA 1AV4A 3GRDA 3SX1A 1TIJA 3LZAA 1T5YA 3V92A 2RFRA 2OQEA 3S27A 3UL5A 4KFDA 5STDA 4XB5A 3WOFB 3SVAA 3JUMA 4O8SA 2W2CA 5CK6A 4AKYA 5TGNA 3CMA3 4N6NB 8CHOA 1GD4A 2JDIH 1SIHA 1O7WB 3WODG 2HMLB 3MSOA 3NBBA 2OTJ3 1OACA 1E3VA 2M7OA 1OH0A 1FGOA 4H61A 1W00A 3B8LA 1N8R4 1Q40A 1DMMA 3EC9A 4I4KA 3F7SA 2CKFB 2OTL3 3NUVA 2CG0A 4XM4A 1YI23 2PNCA 3G16A 3K0ZA 4K1UA 2E2TA 1OF5A 3AMOA 1DMQA 3G8ZA 1YHQ3 2CH9A 1IK3A 3CCV3 1STDA 3D9RA 2V1LA 2XRXB 1FA3A 1O7HB 3FG1A 4FMCA 2GBWB 3CNMA 2Y73A 4HM8B 1N9EA 3VGNA 3MG2A 4STDA 3UL6A 2W03A 4OK0A 3EE1A 3X41A 4EV5A 3LMLA 1NU3A 5JBSA 1R4CA 1M1K4 1A90A 3ALAA 1VQO3 5D82A 1QMAA 3I0YA 3EJVA 3NQZA 4LSOA 1YGEA 2GBXB 4X2OA 5LC6A 1J2BA 4GL6A 3UNLA 4IIAA 1RKYA 3H3HA 4K61A 2CG1A 5BXQA 2LQVA 4WP5A 1U5OA 5A0OB 2KXGA 4KVHA 5AIGA 3HZPA 3NM2A 2WGOA 3I563 1US1A 1O7GB 3LT9A 1RN7A 3FGYA 3GZYB 3LOYA 5KP4A 1K8A4 3NV0B 1QALA 4O2HA 4MMYB 4LEHA 2B24B 3HX8A 3RGRA 3PZWA 5FGOA 5AEWB 4X2HA 2CFKA 1IU7A 1C7HA 3CME3 5ELUA 4J8TA 4XBTA 4XDWA 1NO3A 5IENA 3FLJA 4JRFA 4IT7A 1OUNA 3K63A 1IVXA 2QIYA 3N54B 2IUJA 1IV9A 2D1WA 1AVLA 1SIIA 2W56B 3T0UA 1FGRA 2ML6A 1VQ63 2FGTA 3OV4A 4HM1B 5IG5A 4AEQA 3CPOA 1YJ93 2BMOB 3JUPA 2CK3H 5EVHA 1A2KA 4LZIA 3WOEB 2CW9A 1DMNA 3SOAA 1IT8A 5LC7A 4K1VA 1KSIA 1JKGA 1GS3A 5KP1A 1Y4KA 2E2VA 3FSDA 1BUQA 1ROAA 3CPW2 3CC23 2W9PA 1VQ73 1VQ93 2BMRB 3GZBA 1JN5B 2Z77A 4BTYA 1W6CA 3TDGA 3IMAB 2YFJB 3N8BA 2P09A 3Q1CA 1S723 1EG9B 2E2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS 2;  1N8R 4;  1VQM 3;  1Q7Y 4;  1JJ2 2;  1VQ8 3;  3CD6 3;  1M90 4;  3CCR 3;  1YIT 3;  1QVG 2;  1VQ5 3;  1VQ6 3;  3OW2 2;  1Q82 4;  2QEX 3;  1VQN 3;  2OTL 3;  3I56 3;  1YJ9 3;  1YJN 3;  1NJI 4;  3CMA 3;  1Q81 4;  1K8A 4;  3G6E 3;  1YI2 3;  3G71 3;  1W2B 2;  1VQL 3;  3CCE 3;  1M1K 4;  3CCS 3;  1VQK 3;  1K73 4;  1YJW 3;  1VQO 3;  3CCU 3;  3G4S 3;  3CME 3;  1YHQ 3;  1KC8 4;  3CC4 3;  1Q86 4;  3CCV 3;  3CXC 2;  3CC7 3;  3CPW 2;  3CC2 3;  1QVF 2;  3I55 3;  2QA4 3;  1VQ7 3;  1VQ9 3;  3CCQ 3;  1VQP 3;  1VQ4 3;  2OTJ 3;  3CCM 3;  1S72 3;  3CCL 3;  1K9M 4;  3CCJ 3;  1KD1 4;  1YIJ 3; 
#chains in the Genus database with same CATH topology
 2AAD A;  1KQS 2;  3EB8 A;  3PYJ A;  4HBR A;  4WHA A;  5M19 A;  4HM0 B;  1GOU A;  1ZS7 A;  3EHC A;  1QVG 2;  1Q82 4;  1BRK A;  1IVV A;  2QEX 3;  8RNT A;  3OWS A;  2ZA4 A;  1MWS A;  3AGN A;  3BNB A;  4HOH A;  1L5G B;  4MJD A;  3F7X A;  4J5G A;  4Q53 A;  4LMI A;  4FCZ A;  4BIR A;  2GEY A;  1OHP A;  1W4N A;  1ISK A;  2F56 A;  4HVN A;  3X42 A;  2BT3 A;  1BSC A;  2XGN A;  1TFO A;  2RNT A;  3E99 A;  1F8N A;  2CFD A;  2HMN B;  4JF8 A;  4MMZ B;  2P05 A;  3ROB A;  3CCQ 3;  3F14 A;  1MGW A;  1OPY A;  3B4O A;  3KZT A;  3KCH A;  3CNX A;  3B4P A;  2FXT A;  4R4K A;  1RTU A;  1YNV X;  1VQM 3;  1Q7Y 4;  1GY6 A;  5FW5 A;  1BNJ A;  1TUH A;  4I5Q A;  4XBY A;  1W2Z A;  2GEX A;  2W04 A;  3L0R A;  4KFF A;  5JPU A;  2PZV A;  4WWU C;  4XDV A;  4CDL A;  1WTH A;  2ZHX B;  4NPB A;  3F40 A;  5RNT A;  1DVD A;  2GU1 A;  1Q9E A;  4FCM A;  2Z76 A;  3KN4 A;  3EN1 B;  1ZGX A;  1I8V A;  1OCV A;  1PU4 A;  1BRH A;  2KF3 A;  4FMB A;  1GMR A;  1WMN A;  4EXR A;  1BSD A;  3OWY A;  6GSP A;  2K3D A;  1GY5 A;  4WYK B;  1VQP 3;  4K90 B;  1MWT A;  4H3U A;  3SYU A;  3CCM 3;  2CFW A;  3BNC A;  1KD1 4;  2XSO B;  4OUQ A;  2C11 A;  1A67 A;  2F5W A;  2UGI A;  7STD A;  3SOY A;  1D6Z A;  1NB3 I;  1FUW A;  3CCR 3;  1YIT 3;  2Z7A A;  1VQ5 3;  2STD A;  4O3V A;  1GOY A;  1T3B A;  1OHO A;  3UJM A;  3URP A;  3K7C A;  1CYU A;  1M1X B;  1YVS A;  3KSE D;  2ML5 A;  2K54 A;  1LOW A;  2C10 A;  2SBL A;  1FW7 A;  5JPP A;  1JB5 A;  1V74 A;  1W2B 2;  1RGE A;  3CCE 3;  3BND A;  1K73 4;  3DUK A;  2GXF A;  5IEP A;  2WOF A;  4HZ9 B;  1FYS A;  1X1Y A;  3HIG A;  4HM5 B;  1GD3 A;  3MPH A;  4R9K A;  1G02 A;  2K0M A;  3VF1 A;  1NNV A;  3DGY A;  1BU4 A;  2LYX A;  1RSN A;  2MF7 A;  2MC8 A;  1CQS A;  1I3F A;  1PFP A;  1UUW B;  1GSP A;  2ZL8 A;  1Q7H A;  3CCJ 3;  3Q2P A;  2O9U X;  1BRI A;  4HKV B;  5IG4 A;  4RNY A;  2HMK B;  3EX9 A;  4EC6 A;  1JJ2 2;  3ECF A;  5D83 A;  1JB2 A;  3BNE A;  2XEP A;  5CXO A;  3JUQ A;  1B20 A;  1EA2 A;  3EBY A;  5CLK A;  4J9A A;  5HOH A;  1IT7 A;  1LVN A;  1V58 A;  3QK9 A;  2OOV C;  1BNF A;  1JZD A;  1IQX A;  3KE7 A;  3KKG A;  1OHS A;  1B3S A;  3VSY A;  1UCJ A;  1Q86 4;  3ER7 A;  5DRE A;  3EN8 A;  3I55 3;  3DGM A;  2YFL B;  1C54 A;  2HMM B;  4HM7 B;  3KII A;  4RNT A;  2XFS A;  1D6Y A;  1QJG A;  2Q07 A;  1VQQ A;  1I2F A;  2RSX A;  3DZL A;  2H0I A;  3MKI A;  3N9H A;  4N3V A;  1LQM B;  3JVC A;  3PGB A;  2QGU A;  4HJL B;  2BNG A;  3A5E A;  4KZ1 A;  1LOV A;  4GSP A;  3DGN A;  5D81 A;  3DGO A;  1BRJ A;  1ZX2 A;  3NX0 A;  2XR8 B;  4BTX A;  2WO0 A;  3G71 3;  5AYS C;  3S5C A;  1CYV A;  1QAF A;  1BIR A;  5AI1 A;  5GSP A;  1TU5 A;  1VQK 3;  1LXE A;  3V98 A;  3NHX A;  1HYF A;  3T8N A;  4L7K A;  5BIR A;  1UCK A;  3EQQ B;  1IQY A;  4OVM A;  1IDP A;  1MOL A;  3HI7 A;  2RGQ A;  4AKZ A;  4KFE A;  5ELJ A;  1UUG B;  4FMA A;  1JB4 A;  2XSH B;  3K5T A;  5M18 A;  1TJD A;  3LH4 A;  5AYR B;  3G0K A;  1N8Q A;  1E3R A;  2CIU A;  4QWT A;  2F5M A;  4N6L A;  1RGF A;  1YIJ 3;  1MWR A;  5IG3 A;  3NQY A;  4LGQ A;  1Q40 B;  3S29 A;  4DKI A;  1VQN 3;  1FGM A;  3PCS A;  4GHO A;  3EBT A;  1RGC A;  1YVB I;  3NV0 A;  2KF4 A;  4MEI A;  4TX4 A;  5EQL A;  1FGQ A;  2OOV A;  3SED A;  1NJI 4;  2XFT A;  1LNH A;  3STD A;  4R80 A;  7GSP A;  4G1M B;  2W6J H;  2H0H A;  3MYT A;  3D3L A;  2L4V A;  3BU4 A;  3BLZ A;  3Q3F A;  2P38 A;  1SPU A;  3O8Y A;  3CC4 3;  3KSP A;  1SAR A;  1OF5 B;  3AMO B;  3F9S A;  4R9L A;  2H0G A;  2OCT A;  1BNG A;  2QA4 3;  3NBR A;  2P0M A;  3MG3 A;  3U97 A;  1N5H A;  1LRA A;  2FNQ A;  4RNZ A;  3DXO A;  2W56 A;  1BAO A;  1VQ8 3;  1CH0 A;  1RGL A;  1M90 4;  3CD6 3;  5CF2 A;  1T2I A;  2KF6 A;  3OX9 A;  1WQL B;  3DMC A;  5HGR A;  1BNR A;  1I2E A;  3BIR A;  3M8C A;  4R1K A;  3FG3 A;  4EV2 A;  4BU4 A;  1RNB A;  1QAK A;  3NM7 A;  1S5A A;  3HK4 A;  5IF6 A;  5CF1 A;  5DRV A;  2ZDJ A;  1YJN 3;  1Q81 4;  1RHL A;  1I2G A;  1W01 A;  3PS8 A;  1EQK A;  1LQG C;  4FR9 A;  5IEO A;  2F86 B;  4FMD A;  2W0Q A;  1O7M B;  2F99 A;  1W5Z A;  3G4S 3;  2HMO B;  1R4Y A;  3EF8 A;  1UI7 A;  2CC3 A;  4RBN A;  1ULI B;  2O3O A;  1JN5 A;  3IPT A;  2CFG A;  4NRE A;  3LTD A;  4ORL A;  1VQ4 3;  1BRS A;  1W6G A;  1TP6 A;  3SXX A;  1UI8 A;  1O7N B;  1TFK A;  1EKM A;  1RJO A;  4GB5 A;  1K41 A;  3WA3 A;  2WOH A;  3X3X A;  4N6V 0;  3ZG5 A;  1BGS A;  3RGA A;  1RMS A;  1W7C A;  4LYL B;  4ZM8 A;  1RN1 A;  1IVW A;  4NHF A;  5BVB A;  4HAA A;  2HMJ B;  3B7C A;  3LXU X;  3GWR A;  3WR2 A;  1X1U A;  2RCD A;  3U1W A;  4N6M A;  1SQW A;  1CEW I;  1BVI A;  2OWP A;  3CU3 A;  3F8H A;  3H51 A;  5G1L A;  2YX9 A;  2P0X A;  4ILF A;  2CWT A;  1KC8 4;  3WMD A;  3CXC 2;  1FUS A;  1MNL A;  3BB9 A;  1I3I A;  3HOH A;  4KT3 B;  3HII A;  1LOX A;  1UGH I;  3QRD A;  3WDG B;  3UB1 A;  4U13 A;  4BTW A;  1QVF 2;  1UUV B;  3X3Y A;  1AR0 A;  1TTO A;  1B27 A;  3SLU A;  5AEU B;  3S28 A;  1K9M 4;  1NDO B;  3KFQ C;  3MWZ A;  1STF I;  5IG0 A;  1BAN A;  1RDS A;  4EW5 A;  1DYU A;  3FKA A;  1UCL A;  3OW2 2;  3D79 A;  3Q90 A;  1GY7 A;  4HYZ A;  5KP3 A;  3MG1 A;  1HKX A;  4L8P A;  1D6U A;  3JUN A;  3AHW A;  3FZW A;  4RZM A;  2IUK A;  4HM4 B;  3FG4 A;  3G6E 3;  4PEJ A;  5I97 A;  3T8U A;  1DE3 A;  3NBJ A;  1RCK A;  4FCJ A;  1OGX A;  3A76 A;  5IW9 A;  3DGL A;  1JKG B;  4WFO A;  3FH1 A;  5G2G A;  1WNH A;  3CC7 3;  1G96 A;  2Y74 A;  4WYK A;  4IPB A;  3LTB A;  2XF3 A;  3FF0 A;  1N5P A;  1N9J A;  1O7P B;  1WMO A;  2CWU A;  2Z6B A;  2J8X B;  1IQ8 A;  3F8X A;  1VZZ A;  1LOY A;  3J7Y d;  4L8O A;  1RGH A;  1G0T A;  2WGQ A;  2KRT A;  1Z1S A;  2BMQ B;  1BSB A;  5G1K A;  2UUG C;  3ZG0 A;  6RNT A;  3LT8 A;  1TRP A;  5IER A;  2BO9 B;  4O02 B;  5EEO A;  3AGO A;  3MHE A;  3S67 A;  4HM6 B;  1NB5 I;  1ZO2 A;  1AVK A;  1E97 A;  3GZX B;  1B2U A;  3GAX A;  1V57 A;  2UX0 A;  3PXM A;  3CCS 3;  4N6T A;  1BSE A;  4N6U A;  3WA2 X;  1K28 A;  5BU4 A;  1A2V A;  3LTA A;  1ASK A;  1WMP A;  3GZR A;  2OQE C;  2D42 A;  4N6O B;  2B1X B;  1HU9 A;  1TRQ A;  3K9M C;  1JV2 B;  4EYC A;  1GMQ A;  4XBX A;  2KCD A;  1IV7 A;  3V99 A;  2IA7 A;  1IVU A;  1RN4 A;  6STD A;  1UGI A;  2BHM A;  4MMX B;  2CX0 A;  2XGL A;  1JRQ A;  2XH9 A;  3CCL 3;  1NWW A;  3FF2 A;  3LYG A;  1I0V A;  1KWI A;  2INX A;  5AIF A;  1FGT A;  3OWU A;  2F98 A;  5AII A;  1BUJ A;  2CFL A;  1U8C B;  2JQ5 A;  3FCS B;  3RDE A;  1W02 A;  2HOH A;  3PCR A;  5AIH A;  2GSP A;  3DY5 A;  3LTC A;  4HM3 B;  1ULJ B;  3OXA A;  1UW1 A;  1VQL 3;  2AAE A;  2CHC A;  3DM8 A;  1YJW 3;  3X40 A;  1JBT A;  1JNQ A;  3CCU 3;  1B2M A;  2GU3 A;  1Q42 A;  2I9W A;  1W6Y A;  1ROV A;  1PY3 A;  2W9Q A;  1AY7 A;  4HM2 B;  2R4I A;  1BSA A;  1SJW A;  4EBG A;  2A15 A;  1DVC A;  1X1W A;  2IMJ A;  2CWV A;  3X3Z A;  1I70 A;  3NXJ A;  4CCV A;  1OGZ A;  3JUO A;  2YFI B;  3IJE B;  1RRL A;  1JBS A;  1GYB A;  1HZ1 A;  4HZB B;  1M9G A;  1B2S A;  1RRH A;  1BRN L;  1AV4 A;  3AHS A;  3GRD A;  1B21 A;  3SX1 A;  1TIJ A;  3LZA A;  1T2H A;  1T5Y A;  3V92 A;  2RFR A;  2SAR A;  1GOV A;  2OQE A;  3S27 A;  3UL5 A;  4KFD A;  5STD A;  4XB5 A;  4BL3 A;  3WOF B;  1BNS A;  1BNI A;  3SVA A;  3JUM A;  4O8S A;  2W2C A;  5CK6 A;  1RGA A;  4AKY A;  5TGN A;  3CMA 3;  4N6N B;  8CHO A;  2KF5 A;  1GD4 A;  1MWU A;  2F4Y A;  2JDI H;  1SIH A;  2RBI A;  1O7W B;  3WOD G;  2HML B;  3MSO A;  3NBB A;  2OTJ 3;  1OAC A;  1E3V A;  2M7O A;  1OH0 A;  1FGO A;  4H61 A;  3RNT A;  1W00 A;  3B8L A;  1N8R 4;  1Q40 A;  1DMM A;  3EC9 A;  4I4K A;  3F7S A;  2C4B A;  2CKF B;  2OTL 3;  3NUV A;  4CJN A;  2CG0 A;  4XM4 A;  1IYY A;  1YI2 3;  2PNC A;  3G16 A;  3K0Z A;  4K1U A;  1A2P A;  2E2T A;  1OF5 A;  3AMO A;  4BL2 A;  1DMQ A;  3G8Z A;  1YHQ 3;  9RNT A;  2CH9 A;  1IK3 A;  3CCV 3;  1STD A;  2CX1 A;  3D9R A;  2V1L A;  1B2Z A;  3WHO A;  3ZFZ A;  7RNT A;  2XRX B;  1FA3 A;  1O7H B;  1UDI I;  2BU4 A;  3FG1 A;  1RGG A;  2GBW B;  4FMC A;  3CNM A;  2Y73 A;  4CPK A;  4HM8 B;  1N9E A;  3VGN A;  3MG2 A;  1RCL A;  4STD A;  3UL6 A;  1RLS A;  2W03 A;  1RGK A;  4OK0 A;  1JBR A;  3EE1 A;  1FZU A;  3X41 A;  3LML A;  4EV5 A;  3D5I A;  2BIR A;  1NU3 A;  5JBS A;  5M1A A;  1R4C A;  1M1K 4;  1A90 A;  3ALA A;  1VQO 3;  5D82 A;  1YGW A;  1QMA A;  3I0Y A;  3EJV A;  3NQZ A;  4LSO A;  1UCI A;  1YGE A;  1X1X A;  2GBX B;  4X2O A;  5LC6 A;  1J2B A;  1LNI A;  3D4A A;  4GL6 A;  3UNL A;  4IIA A;  1RKY A;  2IY2 A;  3H3H A;  4K61 A;  2CG1 A;  1EEJ A;  5BXQ A;  2LQV A;  4WP5 A;  1FUT A;  1U5O A;  5A0O B;  2KXG A;  4KVH A;  1JZO A;  5AIG A;  3DH2 A;  3HZP A;  3NM2 A;  1GMP A;  2WGO A;  3I56 3;  1US1 A;  1O7G B;  3LT9 A;  1RN7 A;  3FGY A;  3GZY B;  3LOY A;  5KP4 A;  1K8A 4;  3NV0 B;  1QAL A;  4O2H A;  4MMY B;  4LEH A;  2B24 B;  3HX8 A;  3RGR A;  3PZW A;  5FGO A;  5AEW B;  1BOX A;  4X2H A;  2CFK A;  1IU7 A;  1C7H A;  3CME 3;  5ELU A;  4J8T A;  4XBT A;  4XDW A;  1NO3 A;  5IEN A;  3FLJ A;  4JRF A;  4IT7 A;  1OUN A;  3K63 A;  2KAA A;  1IVX A;  3GSP A;  2QIY A;  3N54 B;  2IUJ A;  1IV9 A;  2D1W A;  1AVL A;  1SII A;  1DET A;  2W56 B;  2L1S A;  1FGR A;  3T0U A;  1B2X A;  1BNE A;  4J5K A;  2ML6 A;  1VQ6 3;  2FGT A;  3OV4 A;  4HM1 B;  5IG5 A;  1MGR A;  4AEQ A;  3CPO A;  1YJ9 3;  2BMO B;  3JUP A;  2CK3 H;  2R41 A;  5EVH A;  1A2K A;  4LZI A;  3WOE B;  2CW9 A;  1DMN A;  3SOA A;  1IT8 A;  1PYL A;  5LC7 A;  1AQZ A;  4K1V A;  1KSI A;  1JKG A;  3D5G A;  1GS3 A;  5KP1 A;  1Y4K A;  2E2V A;  3FSD A;  1RNT A;  1BUQ A;  1ROA A;  3CPW 2;  3CC2 3;  2W9P A;  1VQ7 3;  1VQ9 3;  2BMR B;  3GZB A;  2IYJ A;  1JN5 B;  1BRG A;  1I0X A;  2Z77 A;  4BTY A;  1W6C A;  3TDG A;  3IMA B;  2YFJ B;  3N8B A;  2P09 A;  3Q1C A;  1S72 3;  1EG9 B;  1EUI C;  2E2U A; 
#chains in the Genus database with same CATH homology
 1KQS 2;  3EB8 A;  3PYJ A;  4HBR A;  4WHA A;  4HM0 B;  3EHC A;  1QVG 2;  1Q82 4;  2QEX 3;  1IVV A;  3OWS A;  3BNB A;  1L5G B;  4MJD A;  3F7X A;  4Q53 A;  4LMI A;  4FCZ A;  2GEY A;  1OHP A;  1W4N A;  1ISK A;  4HVN A;  3X42 A;  2BT3 A;  2XGN A;  1TFO A;  3E99 A;  1F8N A;  2CFD A;  2HMN B;  4JF8 A;  4MMZ B;  2P05 A;  3ROB A;  3CCQ 3;  3F14 A;  3B4O A;  1OPY A;  3KZT A;  3CNX A;  3B4P A;  2FXT A;  4R4K A;  1VQM 3;  1Q7Y 4;  1GY6 A;  5FW5 A;  1TUH A;  4XBY A;  1W2Z A;  2GEX A;  2W04 A;  3L0R A;  4KFF A;  5JPU A;  2PZV A;  4WWU C;  4XDV A;  4CDL A;  1WTH A;  3F40 A;  1DVD A;  2GU1 A;  4FCM A;  2Z76 A;  3KN4 A;  3EN1 B;  1OCV A;  1PU4 A;  4FMB A;  1WMN A;  4EXR A;  3OWY A;  1GY5 A;  4WYK B;  1VQP 3;  4K90 B;  4H3U A;  3CCM 3;  2CFW A;  3BNC A;  1KD1 4;  2XSO B;  4OUQ A;  2C11 A;  1A67 A;  7STD A;  3SOY A;  1D6Z A;  1NB3 I;  1FUW A;  3CCR 3;  1YIT 3;  2Z7A A;  1VQ5 3;  2STD A;  4O3V A;  1OHO A;  3UJM A;  3K7C A;  1CYU A;  1M1X B;  3KSE D;  2ML5 A;  2K54 A;  2C10 A;  2SBL A;  5JPP A;  1JB5 A;  1V74 A;  1W2B 2;  3CCE 3;  3BND A;  1K73 4;  3DUK A;  2GXF A;  5IEP A;  2WOF A;  4HZ9 B;  3HIG A;  4HM5 B;  1GD3 A;  3MPH A;  4R9K A;  2K0M A;  3VF1 A;  2LYX A;  2MF7 A;  2MC8 A;  1CQS A;  1PFP A;  1UUW B;  2ZL8 A;  3CCJ 3;  3Q2P A;  2O9U X;  4HKV B;  5IG4 A;  1JJ2 2;  4RNY A;  2HMK B;  3EX9 A;  4EC6 A;  3ECF A;  5D83 A;  1JB2 A;  3BNE A;  2XEP A;  5CXO A;  3JUQ A;  1EA2 A;  3EBY A;  5CLK A;  4J9A A;  1IT7 A;  1LVN A;  3QK9 A;  2OOV C;  3KKG A;  3KE7 A;  1IQX A;  1OHS A;  3VSY A;  1Q86 4;  3ER7 A;  5DRE A;  3EN8 A;  3I55 3;  3DGM A;  2YFL B;  2HMM B;  4HM7 B;  3KII A;  2XFS A;  1D6Y A;  2Q07 A;  1QJG A;  3DZL A;  2RSX A;  3N9H A;  4N3V A;  3MKI A;  3JVC A;  3PGB A;  2QGU A;  4HJL B;  2BNG A;  4KZ1 A;  3DGN A;  5D81 A;  3DGO A;  1ZX2 A;  3NX0 A;  2XR8 B;  4BTX A;  2WO0 A;  3G71 3;  5AYS C;  3S5C A;  1CYV A;  1QAF A;  5AI1 A;  1TU5 A;  1VQK 3;  1LXE A;  3V98 A;  3NHX A;  3T8N A;  4L7K A;  3EQQ B;  1IQY A;  4OVM A;  1IDP A;  1MOL A;  3HI7 A;  2RGQ A;  4AKZ A;  4KFE A;  5ELJ A;  4FMA A;  1JB4 A;  2XSH B;  3K5T A;  3LH4 A;  5AYR B;  3G0K A;  1N8Q A;  1E3R A;  2CIU A;  4QWT A;  1YIJ 3;  4N6L A;  5IG3 A;  3NQY A;  4LGQ A;  1Q40 B;  3S29 A;  1VQN 3;  1FGM A;  3PCS A;  4MEI A;  3EBT A;  1YVB I;  5EQL A;  3NV0 A;  3SED A;  2OOV A;  4TX4 A;  1FGQ A;  1NJI 4;  2XFT A;  1LNH A;  3STD A;  4R80 A;  4G1M B;  2W6J H;  3MYT A;  3D3L A;  2L4V A;  3BLZ A;  2P38 A;  1SPU A;  3O8Y A;  3CC4 3;  3KSP A;  1OF5 B;  3AMO B;  3F9S A;  4R9L A;  2OCT A;  2QA4 3;  3NBR A;  2P0M A;  3MG3 A;  3U97 A;  1N5H A;  2FNQ A;  4RNZ A;  3DXO A;  2W56 A;  1VQ8 3;  1M90 4;  3CD6 3;  5CF2 A;  3OX9 A;  1WQL B;  3DMC A;  5HGR A;  3M8C A;  4R1K A;  4EV2 A;  3FG3 A;  1QAK A;  3NM7 A;  1S5A A;  3HK4 A;  5IF6 A;  5CF1 A;  5DRV A;  2ZDJ A;  1YJN 3;  1Q81 4;  1W01 A;  3PS8 A;  1EQK A;  4FR9 A;  5IEO A;  2F86 B;  4FMD A;  2W0Q A;  1O7M B;  2F99 A;  1W5Z A;  3G4S 3;  2HMO B;  3EF8 A;  1UI7 A;  2CC3 A;  4RBN A;  1ULI B;  2O3O A;  1JN5 A;  3IPT A;  2CFG A;  4NRE A;  3LTD A;  4ORL A;  1VQ4 3;  1TP6 A;  1W6G A;  3SXX A;  1UI8 A;  1O7N B;  1TFK A;  1EKM A;  1RJO A;  4GB5 A;  1K41 A;  3WA3 A;  2WOH A;  3X3X A;  4N6V 0;  3RGA A;  1W7C A;  4ZM8 A;  1IVW A;  4NHF A;  5BVB A;  2HMJ B;  3B7C A;  3LXU X;  3GWR A;  2RCD A;  3U1W A;  4N6M A;  1SQW A;  1CEW I;  2OWP A;  3CU3 A;  3F8H A;  3H51 A;  2YX9 A;  2P0X A;  2CWT A;  1KC8 4;  3WMD A;  3CXC 2;  1MNL A;  3BB9 A;  3HII A;  1LOX A;  3QRD A;  3WDG B;  1QVF 2;  3UB1 A;  4U13 A;  4BTW A;  1UUV B;  3X3Y A;  1AR0 A;  3SLU A;  5AEU B;  3S28 A;  1K9M 4;  1NDO B;  3KFQ C;  3MWZ A;  1STF I;  5IG0 A;  1DYU A;  3FKA A;  3OW2 2;  3Q90 A;  1GY7 A;  4HYZ A;  5KP3 A;  3MG1 A;  1HKX A;  4L8P A;  1D6U A;  3JUN A;  3FZW A;  4RZM A;  2IUK A;  4HM4 B;  3FG4 A;  3G6E 3;  4PEJ A;  5I97 A;  3T8U A;  3NBJ A;  4FCJ A;  1OGX A;  3A76 A;  5IW9 A;  3DGL A;  1JKG B;  4WFO A;  3FH1 A;  5G2G A;  1WNH A;  3CC7 3;  1G96 A;  2Y74 A;  4WYK A;  4IPB A;  3LTB A;  2XF3 A;  3FF0 A;  1N5P A;  1N9J A;  1O7P B;  1WMO A;  2CWU A;  2Z6B A;  1IQ8 A;  3F8X A;  1VZZ A;  3J7Y d;  4L8O A;  2WGQ A;  2KRT A;  1Z1S A;  2BMQ B;  3LT8 A;  5IER A;  2BO9 B;  4O02 B;  5EEO A;  3MHE A;  3S67 A;  1NB5 I;  4HM6 B;  1ZO2 A;  1AVK A;  1E97 A;  3GZX B;  3GAX A;  2UX0 A;  3PXM A;  3CCS 3;  4N6T A;  4N6U A;  3WA2 X;  1K28 A;  1A2V A;  3LTA A;  1ASK A;  1WMP A;  3GZR A;  2OQE C;  2D42 A;  4N6O B;  2B1X B;  1HU9 A;  3K9M C;  4EYC A;  1JV2 B;  4XBX A;  2KCD A;  1IV7 A;  3V99 A;  2IA7 A;  1IVU A;  6STD A;  2BHM A;  4MMX B;  2XGL A;  1JRQ A;  2XH9 A;  3CCL 3;  1NWW A;  3FF2 A;  3LYG A;  1KWI A;  2INX A;  5AIF A;  1FGT A;  3OWU A;  2F98 A;  5AII A;  2CFL A;  1U8C B;  2JQ5 A;  3FCS B;  3RDE A;  1W02 A;  3PCR A;  5AIH A;  3DY5 A;  3LTC A;  4HM3 B;  1ULJ B;  3OXA A;  1UW1 A;  1VQL 3;  2CHC A;  3DM8 A;  1YJW 3;  3X40 A;  1JNQ A;  3CCU 3;  2GU3 A;  1Q42 A;  2I9W A;  1W6Y A;  1ROV A;  2W9Q A;  4HM2 B;  2R4I A;  1SJW A;  4EBG A;  2IMJ A;  1DVC A;  2A15 A;  2CWV A;  3X3Z A;  3NXJ A;  4CCV A;  1OGZ A;  3JUO A;  2YFI B;  3IJE B;  1RRL A;  1GYB A;  4HZB B;  1M9G A;  1RRH A;  1AV4 A;  3GRD A;  3SX1 A;  1TIJ A;  3LZA A;  1T5Y A;  3V92 A;  2RFR A;  2OQE A;  3S27 A;  3UL5 A;  4KFD A;  5STD A;  4XB5 A;  3WOF B;  3SVA A;  3JUM A;  4O8S A;  2W2C A;  5CK6 A;  4AKY A;  5TGN A;  3CMA 3;  4N6N B;  8CHO A;  1GD4 A;  2JDI H;  1SIH A;  1O7W B;  3WOD G;  2HML B;  3MSO A;  3NBB A;  2OTJ 3;  1OAC A;  1E3V A;  2M7O A;  1OH0 A;  1FGO A;  4H61 A;  1W00 A;  3B8L A;  1N8R 4;  1Q40 A;  1DMM A;  3EC9 A;  4I4K A;  3F7S A;  2CKF B;  2OTL 3;  3NUV A;  2CG0 A;  4XM4 A;  1YI2 3;  2PNC A;  3G16 A;  3K0Z A;  4K1U A;  2E2T A;  1OF5 A;  3AMO A;  1DMQ A;  3G8Z A;  1YHQ 3;  2CH9 A;  1IK3 A;  3CCV 3;  1STD A;  3D9R A;  2V1L A;  2XRX B;  1FA3 A;  1O7H B;  3FG1 A;  4FMC A;  2GBW B;  3CNM A;  2Y73 A;  4HM8 B;  1N9E A;  3VGN A;  3MG2 A;  4STD A;  3UL6 A;  2W03 A;  4OK0 A;  3EE1 A;  3X41 A;  4EV5 A;  3LML A;  1NU3 A;  5JBS A;  1R4C A;  1M1K 4;  1A90 A;  3ALA A;  1VQO 3;  5D82 A;  1QMA A;  3I0Y A;  3EJV A;  3NQZ A;  4LSO A;  1YGE A;  2GBX B;  4X2O A;  5LC6 A;  1J2B A;  4GL6 A;  3UNL A;  4IIA A;  1RKY A;  3H3H A;  4K61 A;  2CG1 A;  5BXQ A;  2LQV A;  4WP5 A;  1U5O A;  5A0O B;  2KXG A;  4KVH A;  5AIG A;  3HZP A;  3NM2 A;  2WGO A;  3I56 3;  1US1 A;  1O7G B;  3LT9 A;  1RN7 A;  3FGY A;  3GZY B;  3LOY A;  5KP4 A;  1K8A 4;  3NV0 B;  1QAL A;  4O2H A;  4MMY B;  4LEH A;  2B24 B;  3HX8 A;  3RGR A;  3PZW A;  5FGO A;  5AEW B;  4X2H A;  2CFK A;  1IU7 A;  1C7H A;  3CME 3;  5ELU A;  4J8T A;  4XBT A;  4XDW A;  1NO3 A;  5IEN A;  3FLJ A;  4JRF A;  4IT7 A;  1OUN A;  3K63 A;  1IVX A;  2QIY A;  3N54 B;  2IUJ A;  1IV9 A;  2D1W A;  1AVL A;  1SII A;  2W56 B;  3T0U A;  1FGR A;  2ML6 A;  1VQ6 3;  2FGT A;  3OV4 A;  4HM1 B;  5IG5 A;  4AEQ A;  3CPO A;  1YJ9 3;  2BMO B;  3JUP A;  2CK3 H;  5EVH A;  1A2K A;  4LZI A;  3WOE B;  2CW9 A;  1DMN A;  3SOA A;  1IT8 A;  5LC7 A;  4K1V A;  1KSI A;  1JKG A;  1GS3 A;  5KP1 A;  1Y4K A;  2E2V A;  3FSD A;  1BUQ A;  1ROA A;  3CPW 2;  3CC2 3;  2W9P A;  1VQ7 3;  1VQ9 3;  2BMR B;  3GZB A;  1JN5 B;  2Z77 A;  4BTY A;  1W6C A;  3TDG A;  3IMA B;  2YFJ B;  3N8B A;  2P09 A;  3Q1C A;  1S72 3;  1EG9 B;  2E2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...