3CCE3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cce300
1YI23 1S723 3CCM3 3CCV3 3CPW2 3CD63 3CCS3 1Q864 2QEX3 1VQ73 1Q7Y4 1VQ83 1QVG2 1YJW3 3I563 1YIT3 1K9M4 1VQL3 1VQK3 3CCQ3 3CCJ3 1M904 3G6E3 1N8R4 2OTJ3 3CCE3 1Q814 3OW22 3CMA3 1VQO3 3CCL3 1YJ93 1VQN3 1K734 1QVF2 1JJ22 1VQ93 1YIJ3 3I553 1VQ63 2OTL3 1KQS2 1VQ43 3CC23 3CCR3 1KD14 1NJI4 1VQP3 1YHQ3 3G4S3 1Q824 3CME3 1YJN3 1VQ53 3CCU3 3CC43 1W2B2 3G713 3CXC2 3CC73 2QA43 1VQM3 1M1K4 1K8A4 1KC84
chains in the Genus database with same CATH superfamily
2BMOB 3WA3A 1TP6A 3CPW2 2BIRA 1VZZA 4CPKA 4O02B 4LYLB 1X1WA 1LXEA 3IJEB 4O8SA 2P38A 1YGEA 1RGGA 1IU7A 1BOXA 3DGLA 1UUVB 3LT9A 2A15A 1WMPA 2OCTA 1L5GB 3EE1A 1JJ22 4BTYA 1R4YA 1MGRA 4LMIA 2YX9A 2O3OA 4J5KA 3NXJA 3Q90A 2RCDA 1O7NB 5GSPA 3JUPA 3MG1A 4R80A 2YFLB 1GMRA 4EXRA 3HZPA 1GS3A 3LOYA 3QRDA 3K63A 4XBXA 1A2VA 1W00A 1OPYA 3DGYA 2Z76A 3AGNA 3KSED 3X42A 7RNTA 1RTUA 1M1XB 1SQWA 4WFOA 1Y4KA 2L4VA 2AADA 2CG0A 3DH2A 4RNZA 2XH9A 3N54B 5CXOA 5HGRA 3NM7A 2BO9B 1QJGA 1TU5A 3DGNA 1VQ63 4LZIA 4R1KA 1G96A 2WOHA 1LQMB 4ILFA 1LNHA 3K9MC 1BNSA 4MMXB 1BVIA 1BRJA 1Q824 3DGOA 2XRXB 2KCDA 1RDSA 4CCVA 4NPBA 2Z7AA 1JV2B 5IF6A 1FGTA 3B4PA 3EF8A 3F8XA 1B2ZA 4HM7B 1IT7A 2FXTA 2CFWA 2O9UX 2W9QA 4PEJA 2I9WA 1BRKA 5IEPA 2R4IA 1JN5B 5EVHA 3S67A 1YJW3 5CF1A 1BUJA 4K1UA 5AYRB 3DY5A 4KVHA 3UB1A 3FLJA 3F9SA 1LVNA 1RGAA 4LSOA 1I70A 4HM5B 1QAKA 4KZ1A 1W5ZA 1BSCA 3I553 1CEWI 1ULIB 1N5HA 1OGZA 2UUGC 3MPHA 3SOAA 1VQP3 4L7KA 4GL6A 1IQYA 1YVSA 1V58A 1TIJA 2RSXA 3CNMA 3PYJA 4HAAA 5G1KA 5IERA 2OTJ3 3BNDA 1OF5B 1JB4A 1LOYA 2W04A 2IA7A 1LNIA 3BB9A 5AIGA 5ELUA 1B2UA 1VQQA 1EG9B 2OQEC 3X41A 5IG3A 5M19A 2WO0A 1B27A 1GMPA 3IPTA 3N9HA 1YIT3 1D6UA 1TTOA 1BIRA 3EX9A 1UGIA 3GZYB 1ISKA 1RN7A 3V98A 4EV2A 2GU3A 3LMLA 1RGLA 3T8UA 3NV0B 1RKYA 4I4KA 3RNTA 4MEIA 4TX4A 4RNTA 4RZMA 2CFGA 2CFKA 2GBXB 1RGCA 3GSPA 4J5GA 3FG1A 1UW1A 2GU1A 1UCJA 2HMKB 3WDGB 4AKYA 1T3BA 4JRFA 5AYSC 3SXXA 2W56B 1UDII 2WGQA 1W2B2 4BTXA 2WGOA 3LXUX 3T8NA 1IV9A 1JB5A 2K0MA 3NBRA 4JF8A 2CWVA 2CFLA 4MMZB 3D5GA 4R9LA 1TRPA 1MWTA 3EC9A 1I3FA 1V74A 3SOYA 1OUNA 3ALAA 3DUKA 1VQ73 4EW5A 3F40A 1K9M4 1CYUA 1UGHI 1B2XA 4GB5A 3CCQ3 5TGNA 1KWIA 1CH0A 4FR9A 5I97A 4BTWA 4OUQA 2GSPA 3PXMA 4KT3B 1HYFA 3BU4A 3NHXA 3KZTA 2JQ5A 4AEQA 1TUHA 1FW7A 1FGRA 5AEWB 1I2EA 1LRAA 2XGNA 1BSDA 1KSIA 2D1WA 3F7XA 3FZWA 1N9EA 1PFPA 3G0KA 3G4S3 3F14A 1YJN3 2H0HA 1NO3A 3K5TA 3OXAA 1YNVX 2Y74A 4FMAA 1AY7A 1JRQA 3RGRA 3JUQA 1KC84 1X1YA 1STFI 1OHSA 2HMJB 2XSOB 3MG3A 1ZX2A 1NWWA 1RN1A 3AHSA 1M9GA 3DXOA 1B2MA 1BNGA 1J2BA 3VF1A 3LTCA 4MJDA 1UCKA 5IW9A 6RNTA 1GY7A 3LTDA 4QWTA 2STDA 1VQK3 1ROAA 4BL3A 3CU3A 4R4KA 1I2FA 1IYYA 1O7GB 1DMNA 1C7HA 1QAFA 5DRVA 5JBSA 4FCJA 3FH1A 1SARA 3G16A 3JUOA 1IV7A 2C10A 4MMYB 1RSNA 3HIIA 1T5YA 2CH9A 4L8OA 4K90B 3HX8A 1VQ53 3FF0A 1RGKA 1FGOA 1MGWA 1T2IA 1E97A 1Q7HA 4N6NB 1B3SA 4HVNA 6STDA 1SIIA 2ZA4A 3EJVA 1JZDA 3HK4A 4NREA 4NHFA 4EYCA 2C4BA 1BRIA 3D5IA 4HOHA 5BXQA 1FUSA 4XDVA 3KSPA 1BRGA 1VQL3 2CK3H 2QIYA 1MOLA 3FF2A 3NQYA 3WMDA 2D42A 1GY6A 3FSDA 1BAOA 1VQN3 4K1VA 4N6OB 4HM4B 1YIJ3 1X1XA 1JNQA 2W0QA 5RNTA 2KF3A 3DMCA 3JUMA 4H61A 5EQLA 4WYKA 4CDLA 5IENA 1EQKA 3LH4A 5KP1A 1BNJA 1GOYA 3CXC2 1RGFA 1UI7A 2IYJA 2LYXA 1RCLA 1FUWA 2W2CA 2YFIB 1STDA 2C11A 1Q864 1BSBA 5JPPA 3KE7A 1ZO2A 1A2PA 4N6MA 3TDGA 3X3YA 3QK9A 3A5EA 3SYUA 1M904 1LQGC 1B2SA 1I2GA 3H3HA 1A2KA 5G1LA 3AMOA 3HOHA 4XM4A 2JDIH 3SX1A 1QVF2 1RRLA 1MWSA 4HM6B 2OTL3 4CJNA 3B4OA 4GHOA 3STDA 3SLUA 4EBGA 3FGYA 9RNTA 2W03A 1K28A 1HZ1A 2H0IA 4RBNA 1JKGA 1YHQ3 3O8YA 3X3ZA 3CME3 1FYSA 3S29A 2V1LA 3CC43 2H0GA 1OACA 1G02A 1UCLA 3ECFA 3EBYA 1JBRA 4N6TA 1B20A 1PY3A 3AHWA 3OX9A 3CCM3 1PYLA 1QMAA 4J9AA 4GSPA 2F5MA 3CNXA 1OHOA 3FKAA 1BRHA 3LTAA 5HOHA 3FG3A 1RNBA 1O7HB 1OCVA 3UJMA 3PS8A 4OK0A 3ROBA 3IMAB 1N8QA 3CMA3 3NBJA 5CLKA 3OW22 4EC6A 5BIRA 3CCL3 2AAEA 3BIRA 1SJWA 2CX0A 1IDPA 4X2OA 7STDA 2XEPA 4HZBB 4Q53A 1U5OA 1MWRA 1TRQA 1GY5A 1T2HA 2BMQB 2PNCA 2RNTA 4BL2A 1BRSA 2K54A 3OWYA 3M8CA 4H3UA 4HM1B 2OQEA 3SVAA 1ROVA 2KF5A 2CX1A 1Z1SA 4HKVB 4BU4A 1NDOB 3NM2A 1Q9EA 1X1UA 1VQM3 1Q40A 3WODG 2UGIA 1DE3A 3D9RA 1GMQA 2Z77A 1IQ8A 1W4NA 1RHLA 1RMSA 1GSPA 3EQQB 1AVKA 3NUVA 2OOVA 1GYBA 1Q42A 3X3XA 4N6V0 1IK3A 3Q2PA 5D82A 1TFKA 2SARA 3PCSA 4WP5A 2MC8A 1MWUA 5BU4A 2E2VA 3BNEA 3GWRA 3I0YA 2P0MA 3NQZA 3RDEA 4LEHA 2M7OA 3H51A 1UUGB 4J8TA 5KP4A 1DMMA 1E3VA 3F8HA 1BRNL 2HMMB 3KCHA 3GZBA 4O3VA 3KKGA 2WOFA 3KN4A 2ML6A 3CD63 3DZLA 3N8BA 3WHOA 5AIFA 4ZM8A 1IVWA 1LOVA 1RGEA 1JBTA 1DMQA 1UCIA 2XF3A 4FMCA 5CF2A 2QA43 2L1SA 4HJLB 4KFFA 2E2UA 3DGMA 3EN1B 1LOXA 5AIIA 3UL5A 1JN5A 3EN8A 4FCMA 1R4CA 2QEX3 1Q7Y4 4WWUC 3A76A 4STDA 1CYVA 5BVBA 1WMOA 3LT8A 4R9KA 3G6E3 4IIAA 1PU4A 3K0ZA 5AIHA 2BU4A 1K734 1I8VA 1F8NA 2ZL8A 3FG4A 4IPBA 1TJDA 3GRDA 3PCRA 3NX0A 3CCR3 5STDA 3EBTA 4IT7A 5A0OB 1B21A 1O7WB 1OF5A 1WMNA 2PZVA 2XSHB 2IUKA 4N6LA 3G713 1K8A4 1TFOA 3F7SA 2P0XA 1A90A 1CQSA 2P05A 2CWUA 1RNTA 3D79A 1ZS7A 2FNQA 1WQLB 3LYGA 1BNRA 1JZOA 1EEJA 3NV0A 1IVVA 2RFRA 1SIHA 3OWSA 3B7CA 2SBLA 3PZWA 1RRHA 4ORLA 3I563 3U1WA 3CCJ3 3V92A 5M18A 2BHMA 5M1AA 3U97A 2LQVA 1AR0A 1VQO3 2CC3A 2W6JH 4XDWA 2Z6BA 1JBSA 2CW9A 4KFDA 1BU4A 2XFTA 5AI1A 4HZ9B 2INXA 1VQ43 1AVLA 2W56A 4OVMA 3SEDA 3BNCA 1A67A 2KRTA 1DETA 2B24B 1ZGXA 2IY2A 2K3DA 5ELJA 1W02A 3DM8A 3Q3FA 3MKIA 3EB8A 5FGOA 3WA2X 3RGAA 3EHCA 1Q40B 2Y73A 2KAAA 2Q07A 1AQZA 1UI8A 2BNGA 1V57A 2BT3A 1BNEA 1OH0A 1DYUA 1D6ZA 2CWTA 2HMNB 3D4AA 3OV4A 4K61A 2E2TA 1NB3I 3S5CA 1C54A 1OGXA 2RGQA 3JUNA 3CPOA 1RJOA 2CHCA 4FMBA 2R41A 1W6CA 2F99A 1BNIA 2KXGA 3ER7A 3KFQC 4N3VA 1KQS2 1EUIC 4HM0B 1D6YA 3CC23 1NJI4 2XFSA 1HKXA 3BNBA 1FZUA 3WOFB 1E3RA 1IT8A 3Q1CA 5DREA 3LTBA 4RNYA 3CC73 5AEUB 2HMOB 1BANA 8CHOA 3NBBA 3MG2A 3LZAA 4O2HA 1YI23 4XBYA 3WOEB 2P09A 3MYTA 4U13A 1K41A 1UUWB 3D3LA 1O7PB 2XR8B 3OWUA 2ML5A 1FUTA 3K7CA 2F5WA 1NB5I 3ZG0A 1VQ83 1NNVA 3T0UA 1QVG2 3ZG5A 1BNFA 1BGSA 1EA2A 1N9JA 4WHAA 1WNHA 1US1A 1Q814 1FGQA 1W7CA 2GBWB 2F56A 4HM8B 3L0RA 1RCKA 2KF6A 4L8PA 1JB2A 5IG5A 1IVUA 3S27A 1DVCA 1MNLA 3S28A 1KD14 2GEYA 2ZDJA 3ZFZA 1I3IA 7GSPA 1N5PA 2GXFA 6GSPA 1W2ZA 5IG4A 1BUQA 1SPUA 3UNLA 2YFJB 3B8LA 5D83A 1M1K4 1IVXA 2CFDA 2F98A 4I5QA 1RN4A 3CCV3 3CCS3 3MSOA 5D81A 1W01A 1YGWA 2CIUA 1GOVA 3VSYA 3HI7A 1EKMA 1U8CB 4KFEA 4HM3B 1BSEA 2OOVC 5FW5A 5LC6A 2F86B 3X40A 1O7MB 2J8XB 2XGLA 4BIRA 4DKIA 3J7Yd 3CCE3 2CKFB 1RGHA 2UX0A 3VGNA 3V99A 1VQ93 2W9PA 4X2HA 2QGUA 1YVBI 2KF4A 1ASKA 3BLZA 3HIGA 3URPA 1NU3A 8RNTA 2F4YA 1DVDA 2FGTA 4WYKB 1IQXA 4HYZA 4XBTA 1FGMA 4AKZA 3KIIA 2RBIA 1LOWA 4HM2B 1S723 4FCZA 4G1MB 1GOUA 1HU9A 4N6UA 1RLSA 4EV5A 2B1XB 2MF7A 2BMRB 1I0XA 3GAXA 3G8ZA 5CK6A 3FCSB 4HBRA 1AV4A 2GEXA 3WR2A 1N8R4 1BSAA 3AGOA 1I0VA 1S5AA 1WTHA 3MWZA 2CG1A 1YJ93 3JVCA 5LC7A 5G2GA 1W6YA 1QALA 3GZXB 2HMLB 4XB5A 2OWPA 3AMOB 3MHEA 5IG0A 5IEOA 1G0TA 5KP3A 5EEOA 1GD3A 1OHPA 2IUJA 2IMJA 1GD4A 3CCU3 5JPUA 2HOHA 3GZRA 3PGBA 1JKGB 4FMDA 4LGQA 1FA3A 1W6GA 2ZHXB 1ULJB 3E99A 3UL6A
chains in the Genus database with same CATH topology
2BMOB 3WA3A 1TP6A 3CPW2 1VZZA 4O02B 3IJEB 1LXEA 4O8SA 2P38A 1YGEA 1IU7A 3DGLA 1UUVB 3LT9A 2A15A 1WMPA 2OCTA 1L5GB 3EE1A 1JJ22 4BTYA 4LMIA 2YX9A 2O3OA 3NXJA 3Q90A 2RCDA 1O7NB 3JUPA 3MG1A 4R80A 2YFLB 4EXRA 3HZPA 1GS3A 3LOYA 3QRDA 3K63A 4XBXA 1A2VA 1W00A 1OPYA 2Z76A 3KSED 3X42A 1SQWA 1M1XB 4WFOA 1Y4KA 2L4VA 2CG0A 4RNZA 2XH9A 3N54B 5CXOA 5HGRA 3NM7A 2BO9B 1QJGA 1TU5A 3DGNA 1VQ63 4LZIA 4R1KA 1G96A 2WOHA 1LNHA 3K9MC 4MMXB 1Q824 3DGOA 2XRXB 2KCDA 4CCVA 2Z7AA 1JV2B 5IF6A 1FGTA 3B4PA 3EF8A 3F8XA 4HM7B 1IT7A 2FXTA 2CFWA 2O9UX 2W9QA 4PEJA 2I9WA 5IEPA 2R4IA 1JN5B 5EVHA 3S67A 1YJW3 5CF1A 4K1UA 5AYRB 3DY5A 4KVHA 3UB1A 3FLJA 3F9SA 1LVNA 4LSOA 4HM5B 1QAKA 4KZ1A 1W5ZA 3I553 1CEWI 1ULIB 1N5HA 1OGZA 3MPHA 3SOAA 1VQP3 4L7KA 4GL6A 1IQYA 2RSXA 1TIJA 3CNMA 3PYJA 5IERA 2OTJ3 3BNDA 1OF5B 1JB4A 5AIGA 2W04A 2IA7A 3BB9A 5ELUA 1EG9B 2OQEC 3X41A 5IG3A 2WO0A 3IPTA 3N9HA 1YIT3 1D6UA 3EX9A 3GZYB 1ISKA 1RN7A 3V98A 4EV2A 2GU3A 3LMLA 3T8UA 3NV0B 1RKYA 4I4KA 4MEIA 4TX4A 4RZMA 2CFGA 2CFKA 2GBXB 4AKYA 3FG1A 1UW1A 2GU1A 2HMKB 3WDGB 4JRFA 5AYSC 3SXXA 2W56B 2WGQA 1W2B2 4BTXA 2WGOA 3LXUX 3T8NA 2K0MA 1IV9A 1JB5A 3NBRA 4JF8A 2CWVA 2CFLA 4MMZB 4R9LA 3EC9A 1V74A 3SOYA 1OUNA 3ALAA 3DUKA 1VQ73 3F40A 1K9M4 1CYUA 4GB5A 3CCQ3 5TGNA 1KWIA 4FR9A 5I97A 4BTWA 4OUQA 3PXMA 3NHXA 4AEQA 3KZTA 2JQ5A 1TUHA 1FGRA 5AEWB 2XGNA 1KSIA 2D1WA 3F7XA 3FZWA 1N9EA 1PFPA 3G0KA 3G4S3 3F14A 1YJN3 1NO3A 3K5TA 3OXAA 2Y74A 4FMAA 1JRQA 3RGRA 3JUQA 1KC84 1STFI 1OHSA 2HMJB 2XSOB 3MG3A 1ZX2A 1NWWA 1M9GA 3DXOA 1J2BA 3VF1A 3LTCA 4MJDA 5IW9A 1GY7A 3LTDA 4QWTA 2STDA 1VQK3 1ROAA 3CU3A 4R4KA 1O7GB 1DMNA 1C7HA 1QAFA 5DRVA 5JBSA 4FCJA 3FH1A 3G16A 3JUOA 1IV7A 2C10A 4MMYB 3HIIA 1T5YA 2CH9A 4L8OA 4K90B 3HX8A 1VQ53 3FF0A 1FGOA 1E97A 4N6NB 4HVNA 6STDA 1SIIA 3EJVA 3HK4A 4EYCA 4NREA 4NHFA 5BXQA 4XDVA 3KSPA 1VQL3 2CK3H 2QIYA 1MOLA 3FF2A 3NQYA 3WMDA 2D42A 1GY6A 3FSDA 1VQN3 4K1VA 4N6OB 4HM4B 1YIJ3 1JNQA 2W0QA 4H61A 3DMCA 3JUMA 5EQLA 4CDLA 4WYKA 5IENA 1EQKA 3LH4A 5KP1A 3CXC2 1UI7A 2LYXA 1FUWA 2W2CA 2YFIB 1STDA 2C11A 1Q864 5JPPA 3KE7A 1ZO2A 4N6MA 3TDGA 3X3YA 3QK9A 1M904 3H3HA 1A2KA 3AMOA 4XM4A 2JDIH 3SX1A 1QVF2 1RRLA 4HM6B 2OTL3 3B4OA 3STDA 4EBGA 3SLUA 3FGYA 2W03A 1K28A 4RBNA 1JKGA 1YHQ3 3O8YA 3X3ZA 3CME3 3S29A 3CC43 2V1LA 1OACA 3ECFA 3EBYA 4N6TA 3OX9A 3CCM3 1QMAA 4J9AA 3CNXA 1OHOA 3FKAA 3LTAA 3FG3A 1O7HB 1OCVA 3UJMA 3PS8A 4OK0A 3ROBA 3IMAB 1N8QA 3CMA3 3NBJA 5CLKA 3OW22 4EC6A 3CCL3 1SJWA 1IDPA 4X2OA 7STDA 2XEPA 4HZBB 4Q53A 1U5OA 1GY5A 2BMQB 2PNCA 2K54A 3SVAA 3OWYA 3M8CA 4H3UA 4HM1B 2OQEA 1ROVA 1Z1SA 4HKVB 1NDOB 3NM2A 1VQM3 1Q40A 3WODG 3D9RA 2Z77A 1IQ8A 1W4NA 2OOVA 3CD63 3EQQB 3NUVA 1AVKA 3X3XA 1IK3A 1GYBA 1Q42A 4N6V0 3Q2PA 5D82A 1TFKA 3PCSA 4WP5A 2MC8A 2E2VA 3BNEA 3GWRA 3I0YA 2P0MA 3NQZA 3RDEA 4LEHA 2M7OA 3H51A 4J8TA 5KP4A 1DMMA 1E3VA 3F8HA 2HMMB 3GZBA 4O3VA 3KKGA 2WOFA 3KN4A 2ML6A 3DZLA 3N8BA 5AIFA 4ZM8A 1IVWA 1DMQA 2XF3A 4FMCA 5CF2A 2QA43 4HJLB 4KFFA 2E2UA 3DGMA 3EN1B 1LOXA 5AIIA 3UL5A 1JN5A 3EN8A 4FCMA 1R4CA 2QEX3 1Q7Y4 4WWUC 3A76A 4STDA 1CYVA 5BVBA 1WMOA 3LT8A 4R9KA 3G6E3 4IIAA 1PU4A 3K0ZA 5AIHA 1K734 2ZL8A 1F8NA 3FG4A 4IPBA 3GRDA 3PCRA 3NX0A 3CCR3 5STDA 3EBTA 4IT7A 5A0OB 1O7WB 1OF5A 1WMNA 2PZVA 2XSHB 2IUKA 4N6LA 3G713 1K8A4 1TFOA 3F7SA 2P0XA 1A90A 1CQSA 2P05A 2CWUA 2FNQA 1WQLB 3LYGA 3NV0A 1IVVA 2RFRA 1SIHA 3OWSA 3B7CA 2SBLA 3PZWA 1RRHA 4ORLA 3I563 3U1WA 3CCJ3 3V92A 2BHMA 3U97A 2LQVA 1AR0A 1VQO3 2CC3A 2W6JH 4XDWA 2Z6BA 2CW9A 4KFDA 2XFTA 5AI1A 4HZ9B 2INXA 1VQ43 1AVLA 2W56A 4OVMA 3SEDA 3BNCA 1A67A 2KRTA 2B24B 5ELJA 1W02A 3DM8A 3WA2X 3MKIA 3EB8A 5FGOA 3RGAA 3EHCA 1Q40B 2Y73A 2Q07A 1UI8A 2BNGA 2BT3A 1OH0A 2CWTA 1DYUA 1D6ZA 2HMNB 3OV4A 4K61A 2E2TA 1NB3I 3S5CA 1OGXA 2RGQA 3JUNA 3CPOA 1RJOA 2CHCA 4FMBA 1W6CA 2F99A 2KXGA 3ER7A 3KFQC 4N3VA 1KQS2 4HM0B 3CC23 1D6YA 1NJI4 2XFSA 1HKXA 3BNBA 3WOFB 1E3RA 1IT8A 3Q1CA 5DREA 3LTBA 4RNYA 3CC73 5AEUB 2HMOB 8CHOA 3NBBA 3MG2A 3LZAA 4O2HA 1YI23 4XBYA 3WOEB 2P09A 3MYTA 4U13A 1K41A 1UUWB 3D3LA 1O7PB 2XR8B 3OWUA 2ML5A 3K7CA 1NB5I 1VQ83 3T0UA 1QVG2 1EA2A 1N9JA 4WHAA 1WNHA 1US1A 1Q814 1FGQA 1W7CA 2GBWB 4HM8B 3L0RA 4L8PA 1JB2A 5IG5A 1IVUA 3S27A 1DVCA 1MNLA 3S28A 1KD14 2GEYA 2ZDJA 1N5PA 2GXFA 5IG4A 1W2ZA 1BUQA 1SPUA 3UNLA 2YFJB 3B8LA 5D83A 1M1K4 1IVXA 2CFDA 2F98A 3CCV3 3CCS3 3MSOA 5D81A 1W01A 2CIUA 3VSYA 3HI7A 1EKMA 1U8CB 4KFEA 4HM3B 2OOVC 5FW5A 5LC6A 2F86B 3X40A 1O7MB 2XGLA 3CCE3 3J7Yd 2CKFB 2UX0A 3VGNA 3V99A 1VQ93 2W9PA 4X2HA 2QGUA 1YVBI 1ASKA 3BLZA 3HIGA 1NU3A 1DVDA 2FGTA 4WYKB 1IQXA 4HYZA 4XBTA 1FGMA 4AKZA 3KIIA 4HM2B 1S723 4FCZA 4G1MB 1HU9A 4N6UA 4EV5A 2B1XB 2MF7A 2BMRB 3GAXA 3G8ZA 5CK6A 3FCSB 4HBRA 1AV4A 2GEXA 1N8R4 1S5AA 1WTHA 3MWZA 2CG1A 1YJ93 3JVCA 5LC7A 5G2GA 1W6YA 1QALA 3GZXB 2HMLB 4XB5A 2OWPA 3AMOB 3MHEA 5IG0A 5IEOA 5KP3A 5EEOA 1GD3A 1OHPA 2IUJA 2IMJA 1GD4A 3CCU3 5JPUA 3GZRA 3PGBA 1JKGB 4FMDA 4LGQA 1FA3A 1W6GA 1ULJB 3E99A 3UL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 3;  1S72 3;  3CCM 3;  3CCV 3;  3CPW 2;  3CD6 3;  3CCS 3;  1Q86 4;  2QEX 3;  1VQ7 3;  1Q7Y 4;  1VQ8 3;  1QVG 2;  1YJW 3;  3I56 3;  1YIT 3;  1K9M 4;  1VQL 3;  1VQK 3;  3CCQ 3;  3CCJ 3;  1M90 4;  3G6E 3;  1N8R 4;  2OTJ 3;  3CCE 3;  1Q81 4;  3OW2 2;  3CMA 3;  1VQO 3;  3CCL 3;  1YJ9 3;  1VQN 3;  1K73 4;  1QVF 2;  1JJ2 2;  1VQ9 3;  1YIJ 3;  3I55 3;  1VQ6 3;  2OTL 3;  1KQS 2;  1VQ4 3;  3CC2 3;  3CCR 3;  1KD1 4;  1NJI 4;  1VQP 3;  1YHQ 3;  3G4S 3;  1Q82 4;  3CME 3;  1YJN 3;  1VQ5 3;  3CCU 3;  3CC4 3;  1W2B 2;  3G71 3;  3CXC 2;  3CC7 3;  2QA4 3;  1VQM 3;  1M1K 4;  1K8A 4;  1KC8 4; 
#chains in the Genus database with same CATH topology
 2BMO B;  3WA3 A;  1TP6 A;  3CPW 2;  2BIR A;  1VZZ A;  4CPK A;  4O02 B;  4LYL B;  1X1W A;  1LXE A;  3IJE B;  4O8S A;  2P38 A;  1YGE A;  1RGG A;  1IU7 A;  1BOX A;  3DGL A;  1UUV B;  3LT9 A;  2A15 A;  1WMP A;  2OCT A;  1L5G B;  3EE1 A;  1JJ2 2;  4BTY A;  1R4Y A;  1MGR A;  4LMI A;  2YX9 A;  2O3O A;  4J5K A;  3NXJ A;  3Q90 A;  2RCD A;  1O7N B;  5GSP A;  3JUP A;  3MG1 A;  4R80 A;  2YFL B;  1GMR A;  4EXR A;  3HZP A;  1GS3 A;  3LOY A;  3QRD A;  3K63 A;  4XBX A;  1A2V A;  1W00 A;  1OPY A;  3DGY A;  2Z76 A;  3AGN A;  3KSE D;  3X42 A;  7RNT A;  1RTU A;  1M1X B;  1SQW A;  4WFO A;  1Y4K A;  2L4V A;  2AAD A;  2CG0 A;  3DH2 A;  4RNZ A;  2XH9 A;  3N54 B;  5CXO A;  5HGR A;  3NM7 A;  2BO9 B;  1QJG A;  1TU5 A;  3DGN A;  1VQ6 3;  4LZI A;  4R1K A;  1G96 A;  2WOH A;  1LQM B;  4ILF A;  1LNH A;  3K9M C;  1BNS A;  4MMX B;  1BVI A;  1BRJ A;  1Q82 4;  3DGO A;  2XRX B;  2KCD A;  1RDS A;  4CCV A;  4NPB A;  2Z7A A;  1JV2 B;  5IF6 A;  1FGT A;  3B4P A;  3EF8 A;  3F8X A;  1B2Z A;  4HM7 B;  1IT7 A;  2FXT A;  2CFW A;  2O9U X;  2W9Q A;  4PEJ A;  2I9W A;  1BRK A;  5IEP A;  2R4I A;  1JN5 B;  5EVH A;  3S67 A;  1YJW 3;  5CF1 A;  1BUJ A;  4K1U A;  5AYR B;  3DY5 A;  4KVH A;  3UB1 A;  3FLJ A;  3F9S A;  1LVN A;  1RGA A;  4LSO A;  1I70 A;  4HM5 B;  1QAK A;  4KZ1 A;  1W5Z A;  1BSC A;  3I55 3;  1CEW I;  1ULI B;  1N5H A;  1OGZ A;  2UUG C;  3MPH A;  3SOA A;  1VQP 3;  4L7K A;  4GL6 A;  1IQY A;  1YVS A;  1V58 A;  1TIJ A;  2RSX A;  3CNM A;  3PYJ A;  4HAA A;  5G1K A;  5IER A;  2OTJ 3;  3BND A;  1OF5 B;  1JB4 A;  1LOY A;  2W04 A;  2IA7 A;  1LNI A;  3BB9 A;  5AIG A;  5ELU A;  1B2U A;  1VQQ A;  1EG9 B;  2OQE C;  3X41 A;  5IG3 A;  5M19 A;  2WO0 A;  1B27 A;  1GMP A;  3IPT A;  3N9H A;  1YIT 3;  1D6U A;  1TTO A;  1BIR A;  3EX9 A;  1UGI A;  3GZY B;  1ISK A;  1RN7 A;  3V98 A;  4EV2 A;  2GU3 A;  3LML A;  1RGL A;  3T8U A;  3NV0 B;  1RKY A;  4I4K A;  3RNT A;  4MEI A;  4TX4 A;  4RNT A;  4RZM A;  2CFG A;  2CFK A;  2GBX B;  1RGC A;  3GSP A;  4J5G A;  3FG1 A;  1UW1 A;  2GU1 A;  1UCJ A;  2HMK B;  3WDG B;  4AKY A;  1T3B A;  4JRF A;  5AYS C;  3SXX A;  2W56 B;  1UDI I;  2WGQ A;  1W2B 2;  4BTX A;  2WGO A;  3LXU X;  3T8N A;  1IV9 A;  1JB5 A;  2K0M A;  3NBR A;  4JF8 A;  2CWV A;  2CFL A;  4MMZ B;  3D5G A;  4R9L A;  1TRP A;  1MWT A;  3EC9 A;  1I3F A;  1V74 A;  3SOY A;  1OUN A;  3ALA A;  3DUK A;  1VQ7 3;  4EW5 A;  3F40 A;  1K9M 4;  1CYU A;  1UGH I;  1B2X A;  4GB5 A;  3CCQ 3;  5TGN A;  1KWI A;  1CH0 A;  4FR9 A;  5I97 A;  4BTW A;  4OUQ A;  2GSP A;  3PXM A;  4KT3 B;  1HYF A;  3BU4 A;  3NHX A;  3KZT A;  2JQ5 A;  4AEQ A;  1TUH A;  1FW7 A;  1FGR A;  5AEW B;  1I2E A;  1LRA A;  2XGN A;  1BSD A;  1KSI A;  2D1W A;  3F7X A;  3FZW A;  1N9E A;  1PFP A;  3G0K A;  3G4S 3;  3F14 A;  1YJN 3;  2H0H A;  1NO3 A;  3K5T A;  3OXA A;  1YNV X;  2Y74 A;  4FMA A;  1AY7 A;  1JRQ A;  3RGR A;  3JUQ A;  1KC8 4;  1X1Y A;  1STF I;  1OHS A;  2HMJ B;  2XSO B;  3MG3 A;  1ZX2 A;  1NWW A;  1RN1 A;  3AHS A;  1M9G A;  3DXO A;  1B2M A;  1BNG A;  1J2B A;  3VF1 A;  3LTC A;  4MJD A;  1UCK A;  5IW9 A;  6RNT A;  1GY7 A;  3LTD A;  4QWT A;  2STD A;  1VQK 3;  1ROA A;  4BL3 A;  3CU3 A;  4R4K A;  1I2F A;  1IYY A;  1O7G B;  1DMN A;  1C7H A;  1QAF A;  5DRV A;  5JBS A;  4FCJ A;  3FH1 A;  1SAR A;  3G16 A;  3JUO A;  1IV7 A;  2C10 A;  4MMY B;  1RSN A;  3HII A;  1T5Y A;  2CH9 A;  4L8O A;  4K90 B;  3HX8 A;  1VQ5 3;  3FF0 A;  1RGK A;  1FGO A;  1MGW A;  1T2I A;  1E97 A;  1Q7H A;  4N6N B;  1B3S A;  4HVN A;  6STD A;  1SII A;  2ZA4 A;  3EJV A;  1JZD A;  3HK4 A;  4NRE A;  4NHF A;  4EYC A;  2C4B A;  1BRI A;  3D5I A;  4HOH A;  5BXQ A;  1FUS A;  4XDV A;  3KSP A;  1BRG A;  1VQL 3;  2CK3 H;  2QIY A;  1MOL A;  3FF2 A;  3NQY A;  3WMD A;  2D42 A;  1GY6 A;  3FSD A;  1BAO A;  1VQN 3;  4K1V A;  4N6O B;  4HM4 B;  1YIJ 3;  1X1X A;  1JNQ A;  2W0Q A;  5RNT A;  2KF3 A;  3DMC A;  3JUM A;  4H61 A;  5EQL A;  4WYK A;  4CDL A;  5IEN A;  1EQK A;  3LH4 A;  5KP1 A;  1BNJ A;  1GOY A;  3CXC 2;  1RGF A;  1UI7 A;  2IYJ A;  2LYX A;  1RCL A;  1FUW A;  2W2C A;  2YFI B;  1STD A;  2C11 A;  1Q86 4;  1BSB A;  5JPP A;  3KE7 A;  1ZO2 A;  1A2P A;  4N6M A;  3TDG A;  3X3Y A;  3QK9 A;  3A5E A;  3SYU A;  1M90 4;  1LQG C;  1B2S A;  1I2G A;  3H3H A;  1A2K A;  5G1L A;  3AMO A;  3HOH A;  4XM4 A;  2JDI H;  3SX1 A;  1QVF 2;  1RRL A;  1MWS A;  4HM6 B;  2OTL 3;  4CJN A;  3B4O A;  4GHO A;  3STD A;  3SLU A;  4EBG A;  3FGY A;  9RNT A;  2W03 A;  1K28 A;  1HZ1 A;  2H0I A;  4RBN A;  1JKG A;  1YHQ 3;  3O8Y A;  3X3Z A;  3CME 3;  1FYS A;  3S29 A;  2V1L A;  3CC4 3;  2H0G A;  1OAC A;  1G02 A;  1UCL A;  3ECF A;  3EBY A;  1JBR A;  4N6T A;  1B20 A;  1PY3 A;  3AHW A;  3OX9 A;  3CCM 3;  1PYL A;  1QMA A;  4J9A A;  4GSP A;  2F5M A;  3CNX A;  1OHO A;  3FKA A;  1BRH A;  3LTA A;  5HOH A;  3FG3 A;  1RNB A;  1O7H B;  1OCV A;  3UJM A;  3PS8 A;  4OK0 A;  3ROB A;  3IMA B;  1N8Q A;  3CMA 3;  3NBJ A;  5CLK A;  3OW2 2;  4EC6 A;  5BIR A;  3CCL 3;  2AAE A;  3BIR A;  1SJW A;  2CX0 A;  1IDP A;  4X2O A;  7STD A;  2XEP A;  4HZB B;  4Q53 A;  1U5O A;  1MWR A;  1TRQ A;  1GY5 A;  1T2H A;  2BMQ B;  2PNC A;  2RNT A;  4BL2 A;  1BRS A;  2K54 A;  3OWY A;  3M8C A;  4H3U A;  4HM1 B;  2OQE A;  3SVA A;  1ROV A;  2KF5 A;  2CX1 A;  1Z1S A;  4HKV B;  4BU4 A;  1NDO B;  3NM2 A;  1Q9E A;  1X1U A;  1VQM 3;  1Q40 A;  3WOD G;  2UGI A;  1DE3 A;  3D9R A;  1GMQ A;  2Z77 A;  1IQ8 A;  1W4N A;  1RHL A;  1RMS A;  1GSP A;  3EQQ B;  1AVK A;  3NUV A;  2OOV A;  1GYB A;  1Q42 A;  3X3X A;  4N6V 0;  1IK3 A;  3Q2P A;  5D82 A;  1TFK A;  2SAR A;  3PCS A;  4WP5 A;  2MC8 A;  1MWU A;  5BU4 A;  2E2V A;  3BNE A;  3GWR A;  3I0Y A;  2P0M A;  3NQZ A;  3RDE A;  4LEH A;  2M7O A;  3H51 A;  1UUG B;  4J8T A;  5KP4 A;  1DMM A;  1E3V A;  3F8H A;  1BRN L;  2HMM B;  3KCH A;  3GZB A;  4O3V A;  3KKG A;  2WOF A;  3KN4 A;  2ML6 A;  3CD6 3;  3DZL A;  3N8B A;  3WHO A;  5AIF A;  4ZM8 A;  1IVW A;  1LOV A;  1RGE A;  1JBT A;  1DMQ A;  1UCI A;  2XF3 A;  4FMC A;  5CF2 A;  2QA4 3;  2L1S A;  4HJL B;  4KFF A;  2E2U A;  3DGM A;  3EN1 B;  1LOX A;  5AII A;  3UL5 A;  1JN5 A;  3EN8 A;  4FCM A;  1R4C A;  2QEX 3;  1Q7Y 4;  4WWU C;  3A76 A;  4STD A;  1CYV A;  5BVB A;  1WMO A;  3LT8 A;  4R9K A;  3G6E 3;  4IIA A;  1PU4 A;  3K0Z A;  5AIH A;  2BU4 A;  1K73 4;  1I8V A;  1F8N A;  2ZL8 A;  3FG4 A;  4IPB A;  1TJD A;  3GRD A;  3PCR A;  3NX0 A;  3CCR 3;  5STD A;  3EBT A;  4IT7 A;  5A0O B;  1B21 A;  1O7W B;  1OF5 A;  1WMN A;  2PZV A;  2XSH B;  2IUK A;  4N6L A;  3G71 3;  1K8A 4;  1TFO A;  3F7S A;  2P0X A;  1A90 A;  1CQS A;  2P05 A;  2CWU A;  1RNT A;  3D79 A;  1ZS7 A;  2FNQ A;  1WQL B;  3LYG A;  1BNR A;  1JZO A;  1EEJ A;  3NV0 A;  1IVV A;  2RFR A;  1SIH A;  3OWS A;  3B7C A;  2SBL A;  3PZW A;  1RRH A;  4ORL A;  3I56 3;  3U1W A;  3CCJ 3;  3V92 A;  5M18 A;  2BHM A;  5M1A A;  3U97 A;  2LQV A;  1AR0 A;  1VQO 3;  2CC3 A;  2W6J H;  4XDW A;  2Z6B A;  1JBS A;  2CW9 A;  4KFD A;  1BU4 A;  2XFT A;  5AI1 A;  4HZ9 B;  2INX A;  1VQ4 3;  1AVL A;  2W56 A;  4OVM A;  3SED A;  3BNC A;  1A67 A;  2KRT A;  1DET A;  2B24 B;  1ZGX A;  2IY2 A;  2K3D A;  5ELJ A;  1W02 A;  3DM8 A;  3Q3F A;  3MKI A;  3EB8 A;  5FGO A;  3WA2 X;  3RGA A;  3EHC A;  1Q40 B;  2Y73 A;  2KAA A;  2Q07 A;  1AQZ A;  1UI8 A;  2BNG A;  1V57 A;  2BT3 A;  1BNE A;  1OH0 A;  1DYU A;  1D6Z A;  2CWT A;  2HMN B;  3D4A A;  3OV4 A;  4K61 A;  2E2T A;  1NB3 I;  3S5C A;  1C54 A;  1OGX A;  2RGQ A;  3JUN A;  3CPO A;  1RJO A;  2CHC A;  4FMB A;  2R41 A;  1W6C A;  2F99 A;  1BNI A;  2KXG A;  3ER7 A;  3KFQ C;  4N3V A;  1KQS 2;  1EUI C;  4HM0 B;  1D6Y A;  3CC2 3;  1NJI 4;  2XFS A;  1HKX A;  3BNB A;  1FZU A;  3WOF B;  1E3R A;  1IT8 A;  3Q1C A;  5DRE A;  3LTB A;  4RNY A;  3CC7 3;  5AEU B;  2HMO B;  1BAN A;  8CHO A;  3NBB A;  3MG2 A;  3LZA A;  4O2H A;  1YI2 3;  4XBY A;  3WOE B;  2P09 A;  3MYT A;  4U13 A;  1K41 A;  1UUW B;  3D3L A;  1O7P B;  2XR8 B;  3OWU A;  2ML5 A;  1FUT A;  3K7C A;  2F5W A;  1NB5 I;  3ZG0 A;  1VQ8 3;  1NNV A;  3T0U A;  1QVG 2;  3ZG5 A;  1BNF A;  1BGS A;  1EA2 A;  1N9J A;  4WHA A;  1WNH A;  1US1 A;  1Q81 4;  1FGQ A;  1W7C A;  2GBW B;  2F56 A;  4HM8 B;  3L0R A;  1RCK A;  2KF6 A;  4L8P A;  1JB2 A;  5IG5 A;  1IVU A;  3S27 A;  1DVC A;  1MNL A;  3S28 A;  1KD1 4;  2GEY A;  2ZDJ A;  3ZFZ A;  1I3I A;  7GSP A;  1N5P A;  2GXF A;  6GSP A;  1W2Z A;  5IG4 A;  1BUQ A;  1SPU A;  3UNL A;  2YFJ B;  3B8L A;  5D83 A;  1M1K 4;  1IVX A;  2CFD A;  2F98 A;  4I5Q A;  1RN4 A;  3CCV 3;  3CCS 3;  3MSO A;  5D81 A;  1W01 A;  1YGW A;  2CIU A;  1GOV A;  3VSY A;  3HI7 A;  1EKM A;  1U8C B;  4KFE A;  4HM3 B;  1BSE A;  2OOV C;  5FW5 A;  5LC6 A;  2F86 B;  3X40 A;  1O7M B;  2J8X B;  2XGL A;  4BIR A;  4DKI A;  3J7Y d;  3CCE 3;  2CKF B;  1RGH A;  2UX0 A;  3VGN A;  3V99 A;  1VQ9 3;  2W9P A;  4X2H A;  2QGU A;  1YVB I;  2KF4 A;  1ASK A;  3BLZ A;  3HIG A;  3URP A;  1NU3 A;  8RNT A;  2F4Y A;  1DVD A;  2FGT A;  4WYK B;  1IQX A;  4HYZ A;  4XBT A;  1FGM A;  4AKZ A;  3KII A;  2RBI A;  1LOW A;  4HM2 B;  1S72 3;  4FCZ A;  4G1M B;  1GOU A;  1HU9 A;  4N6U A;  1RLS A;  4EV5 A;  2B1X B;  2MF7 A;  2BMR B;  1I0X A;  3GAX A;  3G8Z A;  5CK6 A;  3FCS B;  4HBR A;  1AV4 A;  2GEX A;  3WR2 A;  1N8R 4;  1BSA A;  3AGO A;  1I0V A;  1S5A A;  1WTH A;  3MWZ A;  2CG1 A;  1YJ9 3;  3JVC A;  5LC7 A;  5G2G A;  1W6Y A;  1QAL A;  3GZX B;  2HML B;  4XB5 A;  2OWP A;  3AMO B;  3MHE A;  5IG0 A;  5IEO A;  1G0T A;  5KP3 A;  5EEO A;  1GD3 A;  1OHP A;  2IUJ A;  2IMJ A;  1GD4 A;  3CCU 3;  5JPU A;  2HOH A;  3GZR A;  3PGB A;  1JKG B;  4FMD A;  4LGQ A;  1FA3 A;  1W6G A;  2ZHX B;  1ULJ B;  3E99 A;  3UL6 A; 
#chains in the Genus database with same CATH homology
 2BMO B;  3WA3 A;  1TP6 A;  3CPW 2;  1VZZ A;  4O02 B;  3IJE B;  1LXE A;  4O8S A;  2P38 A;  1YGE A;  1IU7 A;  3DGL A;  1UUV B;  3LT9 A;  2A15 A;  1WMP A;  2OCT A;  1L5G B;  3EE1 A;  1JJ2 2;  4BTY A;  4LMI A;  2YX9 A;  2O3O A;  3NXJ A;  3Q90 A;  2RCD A;  1O7N B;  3JUP A;  3MG1 A;  4R80 A;  2YFL B;  4EXR A;  3HZP A;  1GS3 A;  3LOY A;  3QRD A;  3K63 A;  4XBX A;  1A2V A;  1W00 A;  1OPY A;  2Z76 A;  3KSE D;  3X42 A;  1SQW A;  1M1X B;  4WFO A;  1Y4K A;  2L4V A;  2CG0 A;  4RNZ A;  2XH9 A;  3N54 B;  5CXO A;  5HGR A;  3NM7 A;  2BO9 B;  1QJG A;  1TU5 A;  3DGN A;  1VQ6 3;  4LZI A;  4R1K A;  1G96 A;  2WOH A;  1LNH A;  3K9M C;  4MMX B;  1Q82 4;  3DGO A;  2XRX B;  2KCD A;  4CCV A;  2Z7A A;  1JV2 B;  5IF6 A;  1FGT A;  3B4P A;  3EF8 A;  3F8X A;  4HM7 B;  1IT7 A;  2FXT A;  2CFW A;  2O9U X;  2W9Q A;  4PEJ A;  2I9W A;  5IEP A;  2R4I A;  1JN5 B;  5EVH A;  3S67 A;  1YJW 3;  5CF1 A;  4K1U A;  5AYR B;  3DY5 A;  4KVH A;  3UB1 A;  3FLJ A;  3F9S A;  1LVN A;  4LSO A;  4HM5 B;  1QAK A;  4KZ1 A;  1W5Z A;  3I55 3;  1CEW I;  1ULI B;  1N5H A;  1OGZ A;  3MPH A;  3SOA A;  1VQP 3;  4L7K A;  4GL6 A;  1IQY A;  2RSX A;  1TIJ A;  3CNM A;  3PYJ A;  5IER A;  2OTJ 3;  3BND A;  1OF5 B;  1JB4 A;  5AIG A;  2W04 A;  2IA7 A;  3BB9 A;  5ELU A;  1EG9 B;  2OQE C;  3X41 A;  5IG3 A;  2WO0 A;  3IPT A;  3N9H A;  1YIT 3;  1D6U A;  3EX9 A;  3GZY B;  1ISK A;  1RN7 A;  3V98 A;  4EV2 A;  2GU3 A;  3LML A;  3T8U A;  3NV0 B;  1RKY A;  4I4K A;  4MEI A;  4TX4 A;  4RZM A;  2CFG A;  2CFK A;  2GBX B;  4AKY A;  3FG1 A;  1UW1 A;  2GU1 A;  2HMK B;  3WDG B;  4JRF A;  5AYS C;  3SXX A;  2W56 B;  2WGQ A;  1W2B 2;  4BTX A;  2WGO A;  3LXU X;  3T8N A;  2K0M A;  1IV9 A;  1JB5 A;  3NBR A;  4JF8 A;  2CWV A;  2CFL A;  4MMZ B;  4R9L A;  3EC9 A;  1V74 A;  3SOY A;  1OUN A;  3ALA A;  3DUK A;  1VQ7 3;  3F40 A;  1K9M 4;  1CYU A;  4GB5 A;  3CCQ 3;  5TGN A;  1KWI A;  4FR9 A;  5I97 A;  4BTW A;  4OUQ A;  3PXM A;  3NHX A;  4AEQ A;  3KZT A;  2JQ5 A;  1TUH A;  1FGR A;  5AEW B;  2XGN A;  1KSI A;  2D1W A;  3F7X A;  3FZW A;  1N9E A;  1PFP A;  3G0K A;  3G4S 3;  3F14 A;  1YJN 3;  1NO3 A;  3K5T A;  3OXA A;  2Y74 A;  4FMA A;  1JRQ A;  3RGR A;  3JUQ A;  1KC8 4;  1STF I;  1OHS A;  2HMJ B;  2XSO B;  3MG3 A;  1ZX2 A;  1NWW A;  1M9G A;  3DXO A;  1J2B A;  3VF1 A;  3LTC A;  4MJD A;  5IW9 A;  1GY7 A;  3LTD A;  4QWT A;  2STD A;  1VQK 3;  1ROA A;  3CU3 A;  4R4K A;  1O7G B;  1DMN A;  1C7H A;  1QAF A;  5DRV A;  5JBS A;  4FCJ A;  3FH1 A;  3G16 A;  3JUO A;  1IV7 A;  2C10 A;  4MMY B;  3HII A;  1T5Y A;  2CH9 A;  4L8O A;  4K90 B;  3HX8 A;  1VQ5 3;  3FF0 A;  1FGO A;  1E97 A;  4N6N B;  4HVN A;  6STD A;  1SII A;  3EJV A;  3HK4 A;  4EYC A;  4NRE A;  4NHF A;  5BXQ A;  4XDV A;  3KSP A;  1VQL 3;  2CK3 H;  2QIY A;  1MOL A;  3FF2 A;  3NQY A;  3WMD A;  2D42 A;  1GY6 A;  3FSD A;  1VQN 3;  4K1V A;  4N6O B;  4HM4 B;  1YIJ 3;  1JNQ A;  2W0Q A;  4H61 A;  3DMC A;  3JUM A;  5EQL A;  4CDL A;  4WYK A;  5IEN A;  1EQK A;  3LH4 A;  5KP1 A;  3CXC 2;  1UI7 A;  2LYX A;  1FUW A;  2W2C A;  2YFI B;  1STD A;  2C11 A;  1Q86 4;  5JPP A;  3KE7 A;  1ZO2 A;  4N6M A;  3TDG A;  3X3Y A;  3QK9 A;  1M90 4;  3H3H A;  1A2K A;  3AMO A;  4XM4 A;  2JDI H;  3SX1 A;  1QVF 2;  1RRL A;  4HM6 B;  2OTL 3;  3B4O A;  3STD A;  4EBG A;  3SLU A;  3FGY A;  2W03 A;  1K28 A;  4RBN A;  1JKG A;  1YHQ 3;  3O8Y A;  3X3Z A;  3CME 3;  3S29 A;  3CC4 3;  2V1L A;  1OAC A;  3ECF A;  3EBY A;  4N6T A;  3OX9 A;  3CCM 3;  1QMA A;  4J9A A;  3CNX A;  1OHO A;  3FKA A;  3LTA A;  3FG3 A;  1O7H B;  1OCV A;  3UJM A;  3PS8 A;  4OK0 A;  3ROB A;  3IMA B;  1N8Q A;  3CMA 3;  3NBJ A;  5CLK A;  3OW2 2;  4EC6 A;  3CCL 3;  1SJW A;  1IDP A;  4X2O A;  7STD A;  2XEP A;  4HZB B;  4Q53 A;  1U5O A;  1GY5 A;  2BMQ B;  2PNC A;  2K54 A;  3SVA A;  3OWY A;  3M8C A;  4H3U A;  4HM1 B;  2OQE A;  1ROV A;  1Z1S A;  4HKV B;  1NDO B;  3NM2 A;  1VQM 3;  1Q40 A;  3WOD G;  3D9R A;  2Z77 A;  1IQ8 A;  1W4N A;  2OOV A;  3CD6 3;  3EQQ B;  3NUV A;  1AVK A;  3X3X A;  1IK3 A;  1GYB A;  1Q42 A;  4N6V 0;  3Q2P A;  5D82 A;  1TFK A;  3PCS A;  4WP5 A;  2MC8 A;  2E2V A;  3BNE A;  3GWR A;  3I0Y A;  2P0M A;  3NQZ A;  3RDE A;  4LEH A;  2M7O A;  3H51 A;  4J8T A;  5KP4 A;  1DMM A;  1E3V A;  3F8H A;  2HMM B;  3GZB A;  4O3V A;  3KKG A;  2WOF A;  3KN4 A;  2ML6 A;  3DZL A;  3N8B A;  5AIF A;  4ZM8 A;  1IVW A;  1DMQ A;  2XF3 A;  4FMC A;  5CF2 A;  2QA4 3;  4HJL B;  4KFF A;  2E2U A;  3DGM A;  3EN1 B;  1LOX A;  5AII A;  3UL5 A;  1JN5 A;  3EN8 A;  4FCM A;  1R4C A;  2QEX 3;  1Q7Y 4;  4WWU C;  3A76 A;  4STD A;  1CYV A;  5BVB A;  1WMO A;  3LT8 A;  4R9K A;  3G6E 3;  4IIA A;  1PU4 A;  3K0Z A;  5AIH A;  1K73 4;  2ZL8 A;  1F8N A;  3FG4 A;  4IPB A;  3GRD A;  3PCR A;  3NX0 A;  3CCR 3;  5STD A;  3EBT A;  4IT7 A;  5A0O B;  1O7W B;  1OF5 A;  1WMN A;  2PZV A;  2XSH B;  2IUK A;  4N6L A;  3G71 3;  1K8A 4;  1TFO A;  3F7S A;  2P0X A;  1A90 A;  1CQS A;  2P05 A;  2CWU A;  2FNQ A;  1WQL B;  3LYG A;  3NV0 A;  1IVV A;  2RFR A;  1SIH A;  3OWS A;  3B7C A;  2SBL A;  3PZW A;  1RRH A;  4ORL A;  3I56 3;  3U1W A;  3CCJ 3;  3V92 A;  2BHM A;  3U97 A;  2LQV A;  1AR0 A;  1VQO 3;  2CC3 A;  2W6J H;  4XDW A;  2Z6B A;  2CW9 A;  4KFD A;  2XFT A;  5AI1 A;  4HZ9 B;  2INX A;  1VQ4 3;  1AVL A;  2W56 A;  4OVM A;  3SED A;  3BNC A;  1A67 A;  2KRT A;  2B24 B;  5ELJ A;  1W02 A;  3DM8 A;  3WA2 X;  3MKI A;  3EB8 A;  5FGO A;  3RGA A;  3EHC A;  1Q40 B;  2Y73 A;  2Q07 A;  1UI8 A;  2BNG A;  2BT3 A;  1OH0 A;  2CWT A;  1DYU A;  1D6Z A;  2HMN B;  3OV4 A;  4K61 A;  2E2T A;  1NB3 I;  3S5C A;  1OGX A;  2RGQ A;  3JUN A;  3CPO A;  1RJO A;  2CHC A;  4FMB A;  1W6C A;  2F99 A;  2KXG A;  3ER7 A;  3KFQ C;  4N3V A;  1KQS 2;  4HM0 B;  3CC2 3;  1D6Y A;  1NJI 4;  2XFS A;  1HKX A;  3BNB A;  3WOF B;  1E3R A;  1IT8 A;  3Q1C A;  5DRE A;  3LTB A;  4RNY A;  3CC7 3;  5AEU B;  2HMO B;  8CHO A;  3NBB A;  3MG2 A;  3LZA A;  4O2H A;  1YI2 3;  4XBY A;  3WOE B;  2P09 A;  3MYT A;  4U13 A;  1K41 A;  1UUW B;  3D3L A;  1O7P B;  2XR8 B;  3OWU A;  2ML5 A;  3K7C A;  1NB5 I;  1VQ8 3;  3T0U A;  1QVG 2;  1EA2 A;  1N9J A;  4WHA A;  1WNH A;  1US1 A;  1Q81 4;  1FGQ A;  1W7C A;  2GBW B;  4HM8 B;  3L0R A;  4L8P A;  1JB2 A;  5IG5 A;  1IVU A;  3S27 A;  1DVC A;  1MNL A;  3S28 A;  1KD1 4;  2GEY A;  2ZDJ A;  1N5P A;  2GXF A;  5IG4 A;  1W2Z A;  1BUQ A;  1SPU A;  3UNL A;  2YFJ B;  3B8L A;  5D83 A;  1M1K 4;  1IVX A;  2CFD A;  2F98 A;  3CCV 3;  3CCS 3;  3MSO A;  5D81 A;  1W01 A;  2CIU A;  3VSY A;  3HI7 A;  1EKM A;  1U8C B;  4KFE A;  4HM3 B;  2OOV C;  5FW5 A;  5LC6 A;  2F86 B;  3X40 A;  1O7M B;  2XGL A;  3CCE 3;  3J7Y d;  2CKF B;  2UX0 A;  3VGN A;  3V99 A;  1VQ9 3;  2W9P A;  4X2H A;  2QGU A;  1YVB I;  1ASK A;  3BLZ A;  3HIG A;  1NU3 A;  1DVD A;  2FGT A;  4WYK B;  1IQX A;  4HYZ A;  4XBT A;  1FGM A;  4AKZ A;  3KII A;  4HM2 B;  1S72 3;  4FCZ A;  4G1M B;  1HU9 A;  4N6U A;  4EV5 A;  2B1X B;  2MF7 A;  2BMR B;  3GAX A;  3G8Z A;  5CK6 A;  3FCS B;  4HBR A;  1AV4 A;  2GEX A;  1N8R 4;  1S5A A;  1WTH A;  3MWZ A;  2CG1 A;  1YJ9 3;  3JVC A;  5LC7 A;  5G2G A;  1W6Y A;  1QAL A;  3GZX B;  2HML B;  4XB5 A;  2OWP A;  3AMO B;  3MHE A;  5IG0 A;  5IEO A;  5KP3 A;  5EEO A;  1GD3 A;  1OHP A;  2IUJ A;  2IMJ A;  1GD4 A;  3CCU 3;  5JPU A;  3GZR A;  3PGB A;  1JKG B;  4FMD A;  4LGQ A;  1FA3 A;  1W6G A;  1ULJ B;  3E99 A;  3UL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...