8RNTA

Structure of ribonuclease t1 complexed with zinc(ii) at 1.8 angstroms resolution: a zn2+.6h2o.carboxylate clathrate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Structure of ribonuclease T1 complexed with zinc(II) at 1.8 A resolution: a Zn2+.6H2O.carboxylate clathrate.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 8rntA00
1RNBA 1FZUA 1LOYA 1BRHA 1BNFA 1UCIA 1BUJA 2GSPA 2F4YA 1T2IA 1TTOA 1T2HA 1RGFA 1BRNL 1BRGA 1GOVA 1LNIA 1RCLA 1RGHA 1TRPA 1X1YA 1RMSA 1GMRA 1JBSA 1BVIA 5HOHA 3BIRA 3Q3FA 4BU4A 2C4BA 1Q9EA 1UCKA 3DH2A 9RNTA 1DE3A 1BSDA 1JBTA 1MGWA 1RGCA 1YGWA 1BOXA 1FUTA 1GMPA 2F5WA 3SYUA 4GHOA 1BSCA 1MGRA 1BU4A 5GSPA 1RGEA 1B27A 2KF4A 5RNTA 1HYFA 1CH0A 1RDSA 1BIRA 1B2SA 5BIRA 3DGYA 8RNTA 1I0VA 1BNEA 1BRSA 4HAAA 1LOWA 3BU4A 1PYLA 1C54A 2AAEA 1I3FA 2HOHA 1BSAA 1RGKA 1BNRA 3D5IA 3AGOA 1B20A 1BSEA 1BNGA 1BAOA 1RN1A 3HOHA 1R4YA 1X1UA 1I8VA 1X1WA 1FUSA 2SARA 1RN4A 1FW7A 1YNVX 4RNTA 1BNJA 1I3IA 3KCHA 3URPA 1UCLA 1BNIA 3A5EA 1GMQA 1JBRA 1UCJA 4BIRA 1IYYA 4GSPA 1BRKA 1BNSA 2KF3A 1BSBA 1BGSA 1LOVA 2KF6A 2RBIA 1B2MA 1B2XA 2BU4A 1B2ZA 1TRQA 1RTUA 2KAAA 1RSNA 6RNTA 5BU4A 1BRIA 1SARA 2BIRA 2F5MA 1GOYA 4HOHA 3AHSA 1BANA 1RGAA 1RHLA 2F56A 2AADA 2KF5A 4J5KA 1HZ1A 1I2EA 1PY3A 2ZA4A 1I70A 3RNTA 1GOUA 1RCKA 1AY7A 1BRJA 2RNTA 3D5GA 6GSPA 3WHOA 1I0XA 1B21A 7GSPA 1X1XA 1RNTA 3AGNA 1RGGA 1RGLA 3AHWA 1AQZA 1RLSA 1FYSA 1I2GA 1B3SA 4J5GA 1YVSA 1B2UA 1DETA 3D4AA 3GSPA 1GSPA 1G02A 3WR2A 1A2PA 7RNTA 1ZGXA 1I2FA 1LRAA
chains in the Genus database with same CATH superfamily
3NQYA 1JB5A 4R80A 1LNHA 3LOYA 1T5YA 1A2KA 1UUVB 1WQLB 2OCTA 3BB9A 1FZUA 3NV0B 3X3ZA 1YIJ3 3MG1A 5CF1A 2GSPA 2QGUA 3LYGA 4BTWA 3FSDA 2ML6A 5IEOA 1ULIB 1AR0A 1RCLA 1EUIC 2BMRB 1RGHA 2W56B 3I563 2W6JH 1JZOA 2BNGA 3V98A 3CXC2 2CHCA 2CG1A 3NBRA 4FMBA 3N9HA 1K9M4 5HOHA 3GZBA 4ILFA 1U8CB 1VQ53 1PU4A 3CPW2 1QALA 3DM8A 1VQO3 1ZS7A 1O7WB 1KWIA 1S5AA 5ELUA 2B24B 2GU3A 2W9QA 1GMPA 2ZHXB 1UI7A 4XDWA 5KP1A 3MKIA 1QVG2 2WO0A 3F7SA 4CJNA 2KF4A 5RNTA 4HM4B 2HMOB 1VZZA 2KXGA 3LTCA 2IA7A 1BIRA 3MPHA 4L7KA 4TX4A 2JQ5A 1WMPA 1B2SA 4EBGA 1EA2A 4FMCA 1BNEA 1BRSA 1LOWA 3BU4A 2Y74A 1PYLA 2XF3A 5AYSC 1NB3I 1GY6A 2LQVA 3EJVA 4LYLB 2H0IA 3G16A 3RDEA 4G1MB 1YHQ3 1DVDA 1RGKA 2K54A 5EVHA 3Q1CA 5HGRA 4LZIA 1JKGB 1MWTA 1KD14 4HM5B 2BO9B 2YFLB 1RN1A 2CFLA 2Q07A 3G6E3 1C7HA 1X1UA 3LMLA 1I8VA 3CU3A 1X1WA 3DGOA 3FLJA 3KSED 2SARA 1CQSA 3JVCA 1N5PA 1GD3A 1QAFA 1IVUA 1I3IA 3KCHA 5IW9A 3CPOA 2KCDA 1W4NA 3CCV3 1K734 2CIUA 1BGSA 2WGQA 3K5TA 2BU4A 4CDLA 4AKYA 2P05A 5CXOA 1LXEA 4NHFA 3ROBA 3F14A 2HMNB 2E2TA 3N54B 2F98A 5BU4A 1BRIA 3CMA3 5D81A 1GOYA 3ZG0A 3DGNA 4WYKA 3CC73 3AHSA 5IG5A 2IYJA 1VQP3 2KF5A 2AADA 1Q824 3KSPA 2W9PA 1HZ1A 5EEOA 1F8NA 1VQ93 1PY3A 3KKGA 1STFI 2ZA4A 4LGQA 5IERA 5IG0A 1OUNA 1RCKA 1RRLA 2FXTA 3LT8A 2HMKB 3LXUX 4O8SA 1D6ZA 2W0QA 1NU3A 3KE7A 7GSPA 3I553 3AGNA 3T8UA 4FCJA 1RGGA 1E3VA 2CFKA 2H0HA 1RGLA 1MNLA 2HMMB 3X42A 1AQZA 3OX9A 1FYSA 4FCMA 2OOVC 1DMMA 1B3SA 1FGRA 2HMLB 3FG1A 1YVSA 1DETA 3CCQ3 1AVLA 3EBTA 4MMZB 1ROAA 2GU1A 3EQQB 5BXQA 1SJWA 2CC3A 3EHCA 3B8LA 4K1UA 1M1K4 1JN5A 4XDVA 3CME3 2C10A 1A90A 5D82A 1LRAA 2CG0A 2W2CA 2CWVA 2M7OA 1IQXA 4IT7A 2BMOB 1G96A 3MG3A 5G1LA 5AEWB 1RNBA 2GBXB 1SQWA 1HKXA 3ECFA 1BNFA 1ZX2A 1FGTA 4Q53A 2CH9A 2F4YA 3NBBA 1TTOA 4N6OB 3JUOA 3D79A 1BRGA 4K90B 4O3VA 1GOVA 1LNIA 3NXJA 2L4VA 4N6UA 5G2GA 4KT3B 1LVNA 3UJMA 1W02A 3HIIA 1TRPA 1OCVA 1TJDA 3GZXB 3NV0A 1GMRA 1W00A 3TDGA 1YJW3 1JBSA 1UUWB 1W2ZA 1BVIA 5CK6A 2P0XA 2C4BA 1Q9EA 1LQGC 3DH2A 1HU9A 2I9WA 1BSDA 1IV9A 1BUQA 1RGCA 2GXFA 3GAXA 4CCVA 1YGWA 1BOXA 1UI8A 4AKZA 2F5WA 3HIGA 3AMOA 4FMDA 1M904 5JPUA 2STDA 3FF2A 1HYFA 1N9JA 2UGIA 1CH0A 3L0RA 2P09A 3PYJA 5KP4A 1N8R4 2HMJB 3QRDA 5BIRA 3NM7A 4X2OA 1CEWI 3DY5A 8RNTA 1Q814 4HAAA 5AEUB 1U5OA 2WOFA 1V57A 2W03A 3WOEB 3WA3A 3FKAA 3CCJ3 5IENA 2A15A 5AIHA 2XFTA 4KFFA 2WGOA 1WNHA 1UGIA 3DUKA 3I0YA 3Q90A 4K61A 3H51A 4R4KA 3WMDA 1PFPA 2PZVA 2RCDA 3DMCA 1R4YA 7STDA 4HZ9B 4WP5A 3STDA 1QAKA 2IUJA 3N8BA 1FW7A 1YNVX 4MEIA 1BNJA 2XRXB 1BNIA 1WMOA 1MWRA 1GMQA 3A5EA 3MYTA 4XBTA 1UCJA 1STDA 1EG9B 1BRKA 1UGHI 1TFKA 2KF6A 1B2XA 1FUWA 2YFIB 4GB5A 2KAAA 1OH0A 2Y73A 3KFQC 1RSNA 1FA3A 5ELJA 2RFRA 1IDPA 4KFDA 3X40A 2F5MA 2OQEC 1N5HA 1IVXA 2WOHA 3JUQA 4HOHA 1IU7A 3CCS3 2CFGA 1J2BA 1YI23 1Q40A 3F40A 1GD4A 5M19A 1MWUA 1FGQA 4JRFA 1I2EA 5AYRB 3S29A 2GEXA 4I4KA 1Q7Y4 3EB8A 3HX8A 1NO3A 1AY7A 2RNTA 4MJDA 4L8PA 1NNVA 1TP6A 5D83A 1OPYA 3PXMA 4QWTA 3MWZA 4EYCA 1D6YA 1OHPA 3FG4A 2P0MA 3AHWA 4EW5A 5I97A 1A67A 1I2GA 5IEPA 2OTJ3 1SIIA 1YVBI 3JUPA 3LTBA 4XB5A 3BLZA 5IG4A 1VQ73 3PCRA 3EF8A 3GSPA 1G02A 3CNMA 3WR2A 7RNTA 2CK3H 1ZGXA 4H61A 1RN7A 3K9MC 1W6YA 2XEPA 2BMQB 2XGNA 3EN1B 1KSIA 3GWRA 4R9KA 2SBLA 1WTHA 1GYBA 3LTDA 1W6CA 1BRHA 3B4OA 4LSOA 4I5QA 1D6UA 1UCIA 5CLKA 1EQKA 3OWYA 2R4IA 4N6TA 1WMNA 3WODG 1JJ22 2R41A 3G0KA 4NREA 2ZL8A 3A76A 1O7MB 1V58A 4DKIA 4N6LA 4HJLB 3HI7A 2XSHB 4RNYA 1FGMA 5LC7A 4N6NB 3T8NA 1OF5B 2CWTA 3HK4A 3Q3FA 4BU4A 4EV2A 2CX0A 4XBXA 3QK9A 1TIJA 3BNBA 3T0UA 4J9AA 3RGRA 2O3OA 3CCE3 4HM0B 1DMQA 1IT8A 3D3LA 3KZTA 1IQ8A 1IVWA 2QIYA 3LZAA 1BSCA 4GHOA 1MGRA 2ZDJA 1VQQA 2CX1A 1BU4A 1Q7HA 1RGEA 4HM8B 1B27A 5GSPA 1IV7A 1DVCA 3CCL3 1KQS2 3OWSA 2K0MA 3E99A 3FZWA 2V1LA 3Q2PA 1G0TA 4FCZA 1JV2B 4MMYB 1UW1A 3DGLA 1K28A 4BTYA 1I0VA 1Q42A 1EEJA 3IMAB 4L8OA 5AIGA 4KVHA 3ER7A 2AAEA 3MHEA 1JZDA 1N8QA 3NQZA 2HOHA 1BSAA 1EKMA 3S28A 8CHOA 1VQK3 5IF6A 5LC6A 4HM7B 1B20A 1TFOA 2F86B 3H3HA 3FH1A 4R9LA 1W01A 4JF8A 5M1AA 2B1XB 3V99A 1BAOA 1ULJB 4EXRA 2O9UX 3HOHA 2D42A 2UUGC 2W56A 3U97A 3HZPA 3B7CA 2OOVA 3SXXA 1VQ43 1IT7A 4WHAA 1O7NB 2RGQA 1CYUA 3SEDA 1TUHA 2XR8B 1GY5A 4RNTA 3SOYA 3ZG5A 1SPUA 1O7PB 1JN5B 2E2UA 3ALAA 3JUNA 5DRVA 1VQ83 1VQN3 3KN4A 1Z1SA 1LQMB 4HVNA 1OHSA 4BIRA 1IYYA 2W04A 3LT9A 1O7GB 3BNDA 3O8YA 4RZMA 4EV5A 1B2MA 2RBIA 4ORLA 1W7CA 1B2ZA 1TRQA 4XM4A 6RNTA 3SX1A 2BIRA 2INXA 4N6V0 1E3RA 2RSXA 1BANA 2F56A 1ISKA 3F9SA 4FMAA 4HYZA 4J5KA 2JDIH 3PZWA 3FCSB 4HM1B 1AVKA 3RNTA 1I70A 3CD63 3D5GA 5FW5A 1OHOA 3LTAA 1I0XA 1B21A 1K8A4 1X1XA 1V74A 1QMAA 5IG3A 2BT3A 4OUQA 4BTXA 1L5GB 1UUGB 1JKGA 2UX0A 2OWPA 3AMOB 1NDOB 4HM6B 1GY7A 2GEYA 5A0OB 4J5GA 4HKVB 3CCU3 1B2UA 3GZRA 3WA2X 1MOLA 3D4AA 5G1KA 3UL5A 1GSPA 3K0ZA 1NJI4 2FGTA 2QA43 2OTL3 3VGNA 5AI1A 3RGAA 5AIIA 1JB4A 3BIRA 4GL6A 4X2HA 1NB5I 1N9EA 1W5ZA 1RJOA 5KP3A 4O02B 1LOYA 1K41A 3FF0A 1BUJA 2YX9A 2Z6BA 1T2IA 5STDA 2IY2A 1T2HA 1RGFA 1BRNL 3LH4A 4HM3B 1UDII 4STDA 3CCM3 4BL2A 3NX0A 2L1SA 1KC84 1S723 2YFJB 3MG2A 1RKYA 1X1YA 1RMSA 1QJGA 3M8CA 3J7Yd 2J8XB 2P38A 3FG3A 1YIT3 2XH9A 3G8ZA 1UCKA 3IPTA 4HBRA 2E2VA 4N3VA 9RNTA 1DE3A 1RRHA 1M9GA 1O7HB 2XFSA 2XSOB 1JBTA 1MGWA 2CKFB 3EE1A 3K7CA 1ASKA 4HM2B 4OK0A 4R1KA 3WOFB 1A2VA 4AEQA 1YJN3 2KRTA 3MSOA 1FUTA 2FNQA 1AV4A 3PGBA 5AIFA 2Z77A 3SYUA 3OW22 1YJ93 2ML5A 4RBNA 1OACA 2QEX3 1OF5A 4K1VA 1RDSA 4KFEA 4XBYA 2OQEA 4FR9A 4KZ1A 3DGYA 4LEHA 1IVVA 1Q40B 3DZLA 3GZYB 1C54A 1T3BA 5JBSA 3B4PA 1CYVA 2IUKA 2D1WA 1I3FA 2IMJA 3F8XA 1VQL3 1JB2A 1E97A 1BNRA 1NWWA 3AGOA 3D5IA 3CNXA 3OV4A 1Y4KA 3NM2A 3OWUA 4IPBA 4LMIA 1YGEA 3WDGB 1BSEA 3ZFZA 3CC43 1BNGA 3X3YA 1DYUA 1US1A 1JNQA 3D9RA 4O2HA 1VQ63 3F7XA 4OVMA 3EBYA 3EN8A 3EX9A 3X3XA 5DREA 2K3DA 3K63A 4HZBB 3CCR3 3UL6A 1FUSA 3BNCA 2XGLA 2CWUA 1RN4A 3URPA 1FGOA 4N6MA 4MMXB 4WWUC 1UCLA 3NUVA 1JBRA 3CC23 4WYKB 2BHMA 4GSPA 3F8HA 1BNSA 2KF3A 3V92A 4WFOA 5M18A 1BSBA 1QVF2 5BVBA 1LOVA 2LYXA 3PS8A 6STDA 3G713 2CFWA 3SOAA 3UNLA 1RTUA 3PCSA 1W6GA 3U1WA 2CFDA 3S67A 3VSYA 1ZO2A 1SARA 5EQLA 2Z7AA 3KIIA 4RNZA 1VQM3 2F99A 4H3UA 4J8TA 4BL3A 4EC6A 4U13A 1SIHA 1Q864 1RGAA 1RHLA 1M1XB 4ZM8A 3NBJA 1W2B2 2C11A 2MC8A 1IK3A 3EC9A 3JUMA 3BNEA 4IIAA 2CW9A 2H0GA 3GRDA 1LOXA 1DMNA 1ROVA 5FGOA 1GOUA 3UB1A 6GSPA 1BRJA 1OGZA 1R4CA 3WHOA 3IJEB 5TGNA 1RNTA 2GBWB 1TU5A 3G4S3 3S5CA 3FGYA 4CPKA 1IQYA 4PEJA 3SVAA 1RLSA 5JPPA 3NHXA 1MWSA 2MF7A 2Z76A 3X41A 3S27A 3DGMA 1JRQA 1OGXA 1GS3A 4NPBA 3VF1A 3DXOA 3SLUA 2PNCA 5CF2A 1A2PA 1I2FA 3OXAA
chains in the Genus database with same CATH topology
1RNBA 1FZUA 1LOYA 1BRHA 1BNFA 1UCIA 1BUJA 2GSPA 2F4YA 1T2IA 1TTOA 1T2HA 1RGFA 1BRNL 1BRGA 1GOVA 1LNIA 1RCLA 1RGHA 1TRPA 1X1YA 1RMSA 1GMRA 1JBSA 1BVIA 5HOHA 3BIRA 3Q3FA 4BU4A 2C4BA 1Q9EA 1UCKA 3DH2A 9RNTA 1DE3A 1BSDA 1JBTA 1MGWA 1RGCA 1YGWA 1BOXA 1FUTA 1GMPA 2F5WA 3SYUA 4GHOA 1BSCA 1MGRA 1BU4A 5GSPA 1RGEA 1B27A 2KF4A 5RNTA 1HYFA 1CH0A 1RDSA 1BIRA 1B2SA 5BIRA 3DGYA 8RNTA 1I0VA 1BNEA 1BRSA 4HAAA 1LOWA 3BU4A 1PYLA 1C54A 2AAEA 1I3FA 2HOHA 1BSAA 1RGKA 1BNRA 3D5IA 3AGOA 1B20A 1BSEA 1BNGA 1BAOA 1RN1A 3HOHA 1R4YA 1X1UA 1I8VA 1X1WA 1FUSA 2SARA 1RN4A 1FW7A 1YNVX 4RNTA 1BNJA 1I3IA 3KCHA 3URPA 1UCLA 1BNIA 3A5EA 1GMQA 1JBRA 1UCJA 4BIRA 1IYYA 4GSPA 1BRKA 1BNSA 2KF3A 1BSBA 1BGSA 1LOVA 2KF6A 2RBIA 1B2MA 1B2XA 2BU4A 1B2ZA 1TRQA 1RTUA 2KAAA 1RSNA 6RNTA 5BU4A 1BRIA 1SARA 2BIRA 2F5MA 1GOYA 4HOHA 3AHSA 1BANA 1RGAA 1RHLA 2F56A 2AADA 2KF5A 4J5KA 1HZ1A 1I2EA 1PY3A 2ZA4A 1I70A 3RNTA 1GOUA 1RCKA 1AY7A 1BRJA 2RNTA 3D5GA 6GSPA 3WHOA 1I0XA 1B21A 7GSPA 1X1XA 1RNTA 3AGNA 1RGGA 1RGLA 3AHWA 1AQZA 1RLSA 1FYSA 1I2GA 1B3SA 4J5GA 1YVSA 1B2UA 1DETA 3D4AA 3GSPA 1GSPA 1G02A 3WR2A 1A2PA 7RNTA 1ZGXA 1I2FA 1LRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNB A;  1FZU A;  1LOY A;  1BRH A;  1BNF A;  1UCI A;  1BUJ A;  2GSP A;  2F4Y A;  1T2I A;  1TTO A;  1T2H A;  1RGF A;  1BRN L;  1BRG A;  1GOV A;  1LNI A;  1RCL A;  1RGH A;  1TRP A;  1X1Y A;  1RMS A;  1GMR A;  1JBS A;  1BVI A;  5HOH A;  3BIR A;  3Q3F A;  4BU4 A;  2C4B A;  1Q9E A;  1UCK A;  3DH2 A;  9RNT A;  1DE3 A;  1BSD A;  1JBT A;  1MGW A;  1RGC A;  1YGW A;  1BOX A;  1FUT A;  1GMP A;  2F5W A;  3SYU A;  4GHO A;  1BSC A;  1MGR A;  1BU4 A;  5GSP A;  1RGE A;  1B27 A;  2KF4 A;  5RNT A;  1HYF A;  1CH0 A;  1RDS A;  1BIR A;  1B2S A;  5BIR A;  3DGY A;  8RNT A;  1I0V A;  1BNE A;  1BRS A;  4HAA A;  1LOW A;  3BU4 A;  1PYL A;  1C54 A;  2AAE A;  1I3F A;  2HOH A;  1BSA A;  1RGK A;  1BNR A;  3D5I A;  3AGO A;  1B20 A;  1BSE A;  1BNG A;  1BAO A;  1RN1 A;  3HOH A;  1R4Y A;  1X1U A;  1I8V A;  1X1W A;  1FUS A;  2SAR A;  1RN4 A;  1FW7 A;  1YNV X;  4RNT A;  1BNJ A;  1I3I A;  3KCH A;  3URP A;  1UCL A;  1BNI A;  3A5E A;  1GMQ A;  1JBR A;  1UCJ A;  4BIR A;  1IYY A;  4GSP A;  1BRK A;  1BNS A;  2KF3 A;  1BSB A;  1BGS A;  1LOV A;  2KF6 A;  2RBI A;  1B2M A;  1B2X A;  2BU4 A;  1B2Z A;  1TRQ A;  1RTU A;  2KAA A;  1RSN A;  6RNT A;  5BU4 A;  1BRI A;  1SAR A;  2BIR A;  2F5M A;  1GOY A;  4HOH A;  3AHS A;  1BAN A;  1RGA A;  1RHL A;  2F56 A;  2AAD A;  2KF5 A;  4J5K A;  1HZ1 A;  1I2E A;  1PY3 A;  2ZA4 A;  1I70 A;  3RNT A;  1GOU A;  1RCK A;  1AY7 A;  1BRJ A;  2RNT A;  3D5G A;  6GSP A;  3WHO A;  1I0X A;  1B21 A;  7GSP A;  1X1X A;  1RNT A;  3AGN A;  1RGG A;  1RGL A;  3AHW A;  1AQZ A;  1RLS A;  1FYS A;  1I2G A;  1B3S A;  4J5G A;  1YVS A;  1B2U A;  1DET A;  3D4A A;  3GSP A;  1GSP A;  1G02 A;  3WR2 A;  1A2P A;  7RNT A;  1ZGX A;  1I2F A;  1LRA A; 
#chains in the Genus database with same CATH topology
 3NQY A;  1JB5 A;  4R80 A;  1LNH A;  3LOY A;  1T5Y A;  1A2K A;  1UUV B;  1WQL B;  2OCT A;  3BB9 A;  1FZU A;  3NV0 B;  3X3Z A;  1YIJ 3;  3MG1 A;  5CF1 A;  2GSP A;  2QGU A;  3LYG A;  4BTW A;  3FSD A;  2ML6 A;  5IEO A;  1ULI B;  1AR0 A;  1RCL A;  1EUI C;  2BMR B;  1RGH A;  2W56 B;  3I56 3;  2W6J H;  1JZO A;  2BNG A;  3V98 A;  3CXC 2;  2CHC A;  2CG1 A;  3NBR A;  4FMB A;  3N9H A;  1K9M 4;  5HOH A;  3GZB A;  4ILF A;  1U8C B;  1VQ5 3;  1PU4 A;  3CPW 2;  1QAL A;  3DM8 A;  1VQO 3;  1ZS7 A;  1O7W B;  1KWI A;  1S5A A;  5ELU A;  2B24 B;  2GU3 A;  2W9Q A;  1GMP A;  2ZHX B;  1UI7 A;  4XDW A;  5KP1 A;  3MKI A;  1QVG 2;  2WO0 A;  3F7S A;  4CJN A;  2KF4 A;  5RNT A;  4HM4 B;  2HMO B;  1VZZ A;  2KXG A;  3LTC A;  2IA7 A;  1BIR A;  3MPH A;  4L7K A;  4TX4 A;  2JQ5 A;  1WMP A;  1B2S A;  4EBG A;  1EA2 A;  4FMC A;  1BNE A;  1BRS A;  1LOW A;  3BU4 A;  2Y74 A;  1PYL A;  2XF3 A;  5AYS C;  1NB3 I;  1GY6 A;  2LQV A;  3EJV A;  4LYL B;  2H0I A;  3G16 A;  3RDE A;  4G1M B;  1YHQ 3;  1DVD A;  1RGK A;  2K54 A;  5EVH A;  3Q1C A;  5HGR A;  4LZI A;  1JKG B;  1MWT A;  1KD1 4;  4HM5 B;  2BO9 B;  2YFL B;  1RN1 A;  2CFL A;  2Q07 A;  3G6E 3;  1C7H A;  1X1U A;  3LML A;  1I8V A;  3CU3 A;  1X1W A;  3DGO A;  3FLJ A;  3KSE D;  2SAR A;  1CQS A;  3JVC A;  1N5P A;  1GD3 A;  1QAF A;  1IVU A;  1I3I A;  3KCH A;  5IW9 A;  3CPO A;  2KCD A;  1W4N A;  3CCV 3;  1K73 4;  2CIU A;  1BGS A;  2WGQ A;  3K5T A;  2BU4 A;  4CDL A;  4AKY A;  2P05 A;  5CXO A;  1LXE A;  4NHF A;  3ROB A;  3F14 A;  2HMN B;  2E2T A;  3N54 B;  2F98 A;  5BU4 A;  1BRI A;  3CMA 3;  5D81 A;  1GOY A;  3ZG0 A;  3DGN A;  4WYK A;  3CC7 3;  3AHS A;  5IG5 A;  2IYJ A;  1VQP 3;  2KF5 A;  2AAD A;  1Q82 4;  3KSP A;  2W9P A;  1HZ1 A;  5EEO A;  1F8N A;  1VQ9 3;  1PY3 A;  3KKG A;  1STF I;  2ZA4 A;  4LGQ A;  5IER A;  5IG0 A;  1OUN A;  1RCK A;  1RRL A;  2FXT A;  3LT8 A;  2HMK B;  3LXU X;  4O8S A;  1D6Z A;  2W0Q A;  1NU3 A;  3KE7 A;  7GSP A;  3I55 3;  3AGN A;  3T8U A;  4FCJ A;  1RGG A;  1E3V A;  2CFK A;  2H0H A;  1RGL A;  1MNL A;  2HMM B;  3X42 A;  1AQZ A;  3OX9 A;  1FYS A;  4FCM A;  2OOV C;  1DMM A;  1B3S A;  1FGR A;  2HML B;  3FG1 A;  1YVS A;  1DET A;  3CCQ 3;  1AVL A;  3EBT A;  4MMZ B;  1ROA A;  2GU1 A;  3EQQ B;  5BXQ A;  1SJW A;  2CC3 A;  3EHC A;  3B8L A;  4K1U A;  1M1K 4;  1JN5 A;  4XDV A;  3CME 3;  2C10 A;  1A90 A;  5D82 A;  1LRA A;  2CG0 A;  2W2C A;  2CWV A;  2M7O A;  1IQX A;  4IT7 A;  2BMO B;  1G96 A;  3MG3 A;  5G1L A;  5AEW B;  1RNB A;  2GBX B;  1SQW A;  1HKX A;  3ECF A;  1BNF A;  1ZX2 A;  1FGT A;  4Q53 A;  2CH9 A;  2F4Y A;  3NBB A;  1TTO A;  4N6O B;  3JUO A;  3D79 A;  1BRG A;  4K90 B;  4O3V A;  1GOV A;  1LNI A;  3NXJ A;  2L4V A;  4N6U A;  5G2G A;  4KT3 B;  1LVN A;  3UJM A;  1W02 A;  3HII A;  1TRP A;  1OCV A;  1TJD A;  3GZX B;  3NV0 A;  1GMR A;  1W00 A;  3TDG A;  1YJW 3;  1JBS A;  1UUW B;  1W2Z A;  1BVI A;  5CK6 A;  2P0X A;  2C4B A;  1Q9E A;  1LQG C;  3DH2 A;  1HU9 A;  2I9W A;  1BSD A;  1IV9 A;  1BUQ A;  1RGC A;  2GXF A;  3GAX A;  4CCV A;  1YGW A;  1BOX A;  1UI8 A;  4AKZ A;  2F5W A;  3HIG A;  3AMO A;  4FMD A;  1M90 4;  5JPU A;  2STD A;  3FF2 A;  1HYF A;  1N9J A;  2UGI A;  1CH0 A;  3L0R A;  2P09 A;  3PYJ A;  5KP4 A;  1N8R 4;  2HMJ B;  3QRD A;  5BIR A;  3NM7 A;  4X2O A;  1CEW I;  3DY5 A;  8RNT A;  1Q81 4;  4HAA A;  5AEU B;  1U5O A;  2WOF A;  1V57 A;  2W03 A;  3WOE B;  3WA3 A;  3FKA A;  3CCJ 3;  5IEN A;  2A15 A;  5AIH A;  2XFT A;  4KFF A;  2WGO A;  1WNH A;  1UGI A;  3DUK A;  3I0Y A;  3Q90 A;  4K61 A;  3H51 A;  4R4K A;  3WMD A;  1PFP A;  2PZV A;  2RCD A;  3DMC A;  1R4Y A;  7STD A;  4HZ9 B;  4WP5 A;  3STD A;  1QAK A;  2IUJ A;  3N8B A;  1FW7 A;  1YNV X;  4MEI A;  1BNJ A;  2XRX B;  1BNI A;  1WMO A;  1MWR A;  1GMQ A;  3A5E A;  3MYT A;  4XBT A;  1UCJ A;  1STD A;  1EG9 B;  1BRK A;  1UGH I;  1TFK A;  2KF6 A;  1B2X A;  1FUW A;  2YFI B;  4GB5 A;  2KAA A;  1OH0 A;  2Y73 A;  3KFQ C;  1RSN A;  1FA3 A;  5ELJ A;  2RFR A;  1IDP A;  4KFD A;  3X40 A;  2F5M A;  2OQE C;  1N5H A;  1IVX A;  2WOH A;  3JUQ A;  4HOH A;  1IU7 A;  3CCS 3;  2CFG A;  1J2B A;  1YI2 3;  1Q40 A;  3F40 A;  1GD4 A;  5M19 A;  1MWU A;  1FGQ A;  4JRF A;  1I2E A;  5AYR B;  3S29 A;  2GEX A;  4I4K A;  1Q7Y 4;  3EB8 A;  3HX8 A;  1NO3 A;  1AY7 A;  2RNT A;  4MJD A;  4L8P A;  1NNV A;  1TP6 A;  5D83 A;  1OPY A;  3PXM A;  4QWT A;  3MWZ A;  4EYC A;  1D6Y A;  1OHP A;  3FG4 A;  2P0M A;  3AHW A;  4EW5 A;  5I97 A;  1A67 A;  1I2G A;  5IEP A;  2OTJ 3;  1SII A;  1YVB I;  3JUP A;  3LTB A;  4XB5 A;  3BLZ A;  5IG4 A;  1VQ7 3;  3PCR A;  3EF8 A;  3GSP A;  1G02 A;  3CNM A;  3WR2 A;  7RNT A;  2CK3 H;  1ZGX A;  4H61 A;  1RN7 A;  3K9M C;  1W6Y A;  2XEP A;  2BMQ B;  2XGN A;  3EN1 B;  1KSI A;  3GWR A;  4R9K A;  2SBL A;  1WTH A;  1GYB A;  3LTD A;  1W6C A;  1BRH A;  3B4O A;  4LSO A;  4I5Q A;  1D6U A;  1UCI A;  5CLK A;  1EQK A;  3OWY A;  2R4I A;  4N6T A;  1WMN A;  3WOD G;  1JJ2 2;  2R41 A;  3G0K A;  4NRE A;  2ZL8 A;  3A76 A;  1O7M B;  1V58 A;  4DKI A;  4N6L A;  4HJL B;  3HI7 A;  2XSH B;  4RNY A;  1FGM A;  5LC7 A;  4N6N B;  3T8N A;  1OF5 B;  2CWT A;  3HK4 A;  3Q3F A;  4BU4 A;  4EV2 A;  2CX0 A;  4XBX A;  3QK9 A;  1TIJ A;  3BNB A;  3T0U A;  4J9A A;  3RGR A;  2O3O A;  3CCE 3;  4HM0 B;  1DMQ A;  1IT8 A;  3D3L A;  3KZT A;  1IQ8 A;  1IVW A;  2QIY A;  3LZA A;  1BSC A;  4GHO A;  1MGR A;  2ZDJ A;  1VQQ A;  2CX1 A;  1BU4 A;  1Q7H A;  1RGE A;  4HM8 B;  1B27 A;  5GSP A;  1IV7 A;  1DVC A;  3CCL 3;  1KQS 2;  3OWS A;  2K0M A;  3E99 A;  3FZW A;  2V1L A;  3Q2P A;  1G0T A;  4FCZ A;  1JV2 B;  4MMY B;  1UW1 A;  3DGL A;  1K28 A;  4BTY A;  1I0V A;  1Q42 A;  1EEJ A;  3IMA B;  4L8O A;  5AIG A;  4KVH A;  3ER7 A;  2AAE A;  3MHE A;  1JZD A;  1N8Q A;  3NQZ A;  2HOH A;  1BSA A;  1EKM A;  3S28 A;  8CHO A;  1VQK 3;  5IF6 A;  5LC6 A;  4HM7 B;  1B20 A;  1TFO A;  2F86 B;  3H3H A;  3FH1 A;  4R9L A;  1W01 A;  4JF8 A;  5M1A A;  2B1X B;  3V99 A;  1BAO A;  1ULJ B;  4EXR A;  2O9U X;  3HOH A;  2D42 A;  2UUG C;  2W56 A;  3U97 A;  3HZP A;  3B7C A;  2OOV A;  3SXX A;  1VQ4 3;  1IT7 A;  4WHA A;  1O7N B;  2RGQ A;  1CYU A;  3SED A;  1TUH A;  2XR8 B;  1GY5 A;  4RNT A;  3SOY A;  3ZG5 A;  1SPU A;  1O7P B;  1JN5 B;  2E2U A;  3ALA A;  3JUN A;  5DRV A;  1VQ8 3;  1VQN 3;  3KN4 A;  1Z1S A;  1LQM B;  4HVN A;  1OHS A;  4BIR A;  1IYY A;  2W04 A;  3LT9 A;  1O7G B;  3BND A;  3O8Y A;  4RZM A;  4EV5 A;  1B2M A;  2RBI A;  4ORL A;  1W7C A;  1B2Z A;  1TRQ A;  4XM4 A;  6RNT A;  3SX1 A;  2BIR A;  2INX A;  4N6V 0;  1E3R A;  2RSX A;  1BAN A;  2F56 A;  1ISK A;  3F9S A;  4FMA A;  4HYZ A;  4J5K A;  2JDI H;  3PZW A;  3FCS B;  4HM1 B;  1AVK A;  3RNT A;  1I70 A;  3CD6 3;  3D5G A;  5FW5 A;  1OHO A;  3LTA A;  1I0X A;  1B21 A;  1K8A 4;  1X1X A;  1V74 A;  1QMA A;  5IG3 A;  2BT3 A;  4OUQ A;  4BTX A;  1L5G B;  1UUG B;  1JKG A;  2UX0 A;  2OWP A;  3AMO B;  1NDO B;  4HM6 B;  1GY7 A;  2GEY A;  5A0O B;  4J5G A;  4HKV B;  3CCU 3;  1B2U A;  3GZR A;  3WA2 X;  1MOL A;  3D4A A;  5G1K A;  3UL5 A;  1GSP A;  3K0Z A;  1NJI 4;  2FGT A;  2QA4 3;  2OTL 3;  3VGN A;  5AI1 A;  3RGA A;  5AII A;  1JB4 A;  3BIR A;  4GL6 A;  4X2H A;  1NB5 I;  1N9E A;  1W5Z A;  1RJO A;  5KP3 A;  4O02 B;  1LOY A;  1K41 A;  3FF0 A;  1BUJ A;  2YX9 A;  2Z6B A;  1T2I A;  5STD A;  2IY2 A;  1T2H A;  1RGF A;  1BRN L;  3LH4 A;  4HM3 B;  1UDI I;  4STD A;  3CCM 3;  4BL2 A;  3NX0 A;  2L1S A;  1KC8 4;  1S72 3;  2YFJ B;  3MG2 A;  1RKY A;  1X1Y A;  1RMS A;  1QJG A;  3M8C A;  3J7Y d;  2J8X B;  2P38 A;  3FG3 A;  1YIT 3;  2XH9 A;  3G8Z A;  1UCK A;  3IPT A;  4HBR A;  2E2V A;  4N3V A;  9RNT A;  1DE3 A;  1RRH A;  1M9G A;  1O7H B;  2XFS A;  2XSO B;  1JBT A;  1MGW A;  2CKF B;  3EE1 A;  3K7C A;  1ASK A;  4HM2 B;  4OK0 A;  4R1K A;  3WOF B;  1A2V A;  4AEQ A;  1YJN 3;  2KRT A;  3MSO A;  1FUT A;  2FNQ A;  1AV4 A;  3PGB A;  5AIF A;  2Z77 A;  3SYU A;  3OW2 2;  1YJ9 3;  2ML5 A;  4RBN A;  1OAC A;  2QEX 3;  1OF5 A;  4K1V A;  1RDS A;  4KFE A;  4XBY A;  2OQE A;  4FR9 A;  4KZ1 A;  3DGY A;  4LEH A;  1IVV A;  1Q40 B;  3DZL A;  3GZY B;  1C54 A;  1T3B A;  5JBS A;  3B4P A;  1CYV A;  2IUK A;  2D1W A;  1I3F A;  2IMJ A;  3F8X A;  1VQL 3;  1JB2 A;  1E97 A;  1BNR A;  1NWW A;  3AGO A;  3D5I A;  3CNX A;  3OV4 A;  1Y4K A;  3NM2 A;  3OWU A;  4IPB A;  4LMI A;  1YGE A;  3WDG B;  1BSE A;  3ZFZ A;  3CC4 3;  1BNG A;  3X3Y A;  1DYU A;  1US1 A;  1JNQ A;  3D9R A;  4O2H A;  1VQ6 3;  3F7X A;  4OVM A;  3EBY A;  3EN8 A;  3EX9 A;  3X3X A;  5DRE A;  2K3D A;  3K63 A;  4HZB B;  3CCR 3;  3UL6 A;  1FUS A;  3BNC A;  2XGL A;  2CWU A;  1RN4 A;  3URP A;  1FGO A;  4N6M A;  4MMX B;  4WWU C;  1UCL A;  3NUV A;  1JBR A;  3CC2 3;  4WYK B;  2BHM A;  4GSP A;  3F8H A;  1BNS A;  2KF3 A;  3V92 A;  4WFO A;  5M18 A;  1BSB A;  1QVF 2;  5BVB A;  1LOV A;  2LYX A;  3PS8 A;  6STD A;  3G71 3;  2CFW A;  3SOA A;  3UNL A;  1RTU A;  3PCS A;  1W6G A;  3U1W A;  2CFD A;  3S67 A;  3VSY A;  1ZO2 A;  1SAR A;  5EQL A;  2Z7A A;  3KII A;  4RNZ A;  1VQM 3;  2F99 A;  4H3U A;  4J8T A;  4BL3 A;  4EC6 A;  4U13 A;  1SIH A;  1Q86 4;  1RGA A;  1RHL A;  1M1X B;  4ZM8 A;  3NBJ A;  1W2B 2;  2C11 A;  2MC8 A;  1IK3 A;  3EC9 A;  3JUM A;  3BNE A;  4IIA A;  2CW9 A;  2H0G A;  3GRD A;  1LOX A;  1DMN A;  1ROV A;  5FGO A;  1GOU A;  3UB1 A;  6GSP A;  1BRJ A;  1OGZ A;  1R4C A;  3WHO A;  3IJE B;  5TGN A;  1RNT A;  2GBW B;  1TU5 A;  3G4S 3;  3S5C A;  3FGY A;  4CPK A;  1IQY A;  4PEJ A;  3SVA A;  1RLS A;  5JPP A;  3NHX A;  1MWS A;  2MF7 A;  2Z76 A;  3X41 A;  3S27 A;  3DGM A;  1JRQ A;  1OGX A;  1GS3 A;  4NPB A;  3VF1 A;  3DXO A;  3SLU A;  2PNC A;  5CF2 A;  1A2P A;  1I2F A;  3OXA A; 
#chains in the Genus database with same CATH homology
 1RNB A;  1FZU A;  1LOY A;  1BRH A;  1BNF A;  1UCI A;  1BUJ A;  2GSP A;  2F4Y A;  1T2I A;  1TTO A;  1T2H A;  1RGF A;  1BRN L;  1BRG A;  1GOV A;  1LNI A;  1RCL A;  1RGH A;  1TRP A;  1X1Y A;  1RMS A;  1GMR A;  1JBS A;  1BVI A;  5HOH A;  3BIR A;  3Q3F A;  4BU4 A;  2C4B A;  1Q9E A;  1UCK A;  3DH2 A;  9RNT A;  1DE3 A;  1BSD A;  1JBT A;  1MGW A;  1RGC A;  1YGW A;  1BOX A;  1FUT A;  1GMP A;  2F5W A;  3SYU A;  4GHO A;  1BSC A;  1MGR A;  1BU4 A;  5GSP A;  1RGE A;  1B27 A;  2KF4 A;  5RNT A;  1HYF A;  1CH0 A;  1RDS A;  1BIR A;  1B2S A;  5BIR A;  3DGY A;  8RNT A;  1I0V A;  1BNE A;  1BRS A;  4HAA A;  1LOW A;  3BU4 A;  1PYL A;  1C54 A;  2AAE A;  1I3F A;  2HOH A;  1BSA A;  1RGK A;  1BNR A;  3D5I A;  3AGO A;  1B20 A;  1BSE A;  1BNG A;  1BAO A;  1RN1 A;  3HOH A;  1R4Y A;  1X1U A;  1I8V A;  1X1W A;  1FUS A;  2SAR A;  1RN4 A;  1FW7 A;  1YNV X;  4RNT A;  1BNJ A;  1I3I A;  3KCH A;  3URP A;  1UCL A;  1BNI A;  3A5E A;  1GMQ A;  1JBR A;  1UCJ A;  4BIR A;  1IYY A;  4GSP A;  1BRK A;  1BNS A;  2KF3 A;  1BSB A;  1BGS A;  1LOV A;  2KF6 A;  2RBI A;  1B2M A;  1B2X A;  2BU4 A;  1B2Z A;  1TRQ A;  1RTU A;  2KAA A;  1RSN A;  6RNT A;  5BU4 A;  1BRI A;  1SAR A;  2BIR A;  2F5M A;  1GOY A;  4HOH A;  3AHS A;  1BAN A;  1RGA A;  1RHL A;  2F56 A;  2AAD A;  2KF5 A;  4J5K A;  1HZ1 A;  1I2E A;  1PY3 A;  2ZA4 A;  1I70 A;  3RNT A;  1GOU A;  1RCK A;  1AY7 A;  1BRJ A;  2RNT A;  3D5G A;  6GSP A;  3WHO A;  1I0X A;  1B21 A;  7GSP A;  1X1X A;  1RNT A;  3AGN A;  1RGG A;  1RGL A;  3AHW A;  1AQZ A;  1RLS A;  1FYS A;  1I2G A;  1B3S A;  4J5G A;  1YVS A;  1B2U A;  1DET A;  3D4A A;  3GSP A;  1GSP A;  1G02 A;  3WR2 A;  1A2P A;  7RNT A;  1ZGX A;  1I2F A;  1LRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...