8RNTA

Structure of ribonuclease t1 complexed with zinc(ii) at 1.8 angstroms resolution: a zn2+.6h2o.carboxylate clathrate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title Structure of ribonuclease T1 complexed with zinc(II) at 1.8 A resolution: a Zn2+.6H2O.carboxylate clathrate.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 8rntA00
1B2MA 1BRHA 2RNTA 1RGHA 3URPA 1BAOA 3WR2A 3AHWA 3KCHA 1BNIA 4BU4A 1I2GA 1I2EA 1UCIA 1BSDA 1BIRA 1RDSA 1BRKA 2KAAA 1BANA 1FZUA 7RNTA 4J5KA 1RHLA 1AQZA 1HYFA 1YVSA 2BU4A 3D4AA 1R4YA 2SARA 3SYUA 1RGFA 2ZA4A 8RNTA 1BNRA 7GSPA 2C4BA 1X1WA 1GOVA 3WHOA 1RGEA 1GMPA 3AGOA 3RNTA 3GSPA 2HOHA 3HOHA 2KF3A 1TTOA 5GSPA 1LNIA 1RNTA 1RN1A 1PYLA 3AHSA 1I70A 1MGWA 1B21A 1BRJA 1PY3A 1BSEA 1YNVX 1GSPA 1BOXA 1X1XA 1X1YA 1BRNL 3BU4A 1BRSA 1BGSA 1BSAA 1FUSA 1JBRA 1LOYA 5BU4A 4GSPA 1I8VA 1BRIA 9RNTA 1TRQA 4HAAA 1BSCA 1I3IA 3BIRA 2AAEA 4GHOA 1BNSA 2KF5A 4HOHA 1BSBA 1BNGA 1RGCA 2RBIA 1GOYA 1RCLA 1G02A 1CH0A 1X1UA 2KF6A 1BRGA 1RCKA 1RTUA 1UCKA 1BUJA 1BNJA 1GMQA 4J5GA 1RGKA 1RSNA 1DE3A 1C54A 2F4YA 1YGWA 1HZ1A 3DGYA 1RGLA 1FYSA 2KF4A 1T2HA 1LOWA 2BIRA 3A5EA 3Q3FA 1FUTA 2F5MA 1DETA 1B3SA 3D5IA 1IYYA 2F5WA 1B2ZA 1BNFA 1I2FA 1AY7A 1I3FA 1UCLA 6RNTA 1B27A 4BIRA 1B2UA 1RLSA 1T2IA 1UCJA 3D5GA 1LOVA 1B2SA 1ZGXA 1B20A 1I0XA 4RNTA 2AADA 1JBTA 1BNEA 1RN4A 3DH2A 5BIRA 1TRPA 6GSPA 1JBSA 1Q9EA 1GOUA 2GSPA 1A2PA 1BVIA 5RNTA 5HOHA 1FW7A 1SARA 1RNBA 1I0VA 1B2XA 1RMSA 1LRAA 1RGGA 1GMRA 1BU4A 1RGAA 3AGNA 1MGRA 2F56A
chains in the Genus database with same CATH superfamily
1BRHA 2RNTA 4R9KA 1RGHA 5TGNA 3CCR3 2W56A 5AIIA 4R80A 3T8NA 1BNIA 1A67A 4L8PA 1RN7A 1TJDA 4HM2B 5DREA 1TP6A 3MWZA 1L5GB 1IQ8A 1MWUA 3FF0A 1K28A 3JUQA 1VQM3 4G1MB 1ZX2A 1W6CA 2Y73A 1DMNA 2CWTA 3ECFA 1OACA 4J5KA 1CQSA 3LTAA 4QWTA 2SARA 1KSIA 3I0YA 1RGFA 2ZA4A 1W6YA 5CXOA 4N6V0 4LZIA 4AEQA 2CG0A 2V1LA 4O3VA 3WDGB 6STDA 3D3LA 7GSPA 5KP4A 3LH4A 1X1WA 3M8CA 4I4KA 1OHPA 1RGEA 3AGOA 4PEJA 4EYCA 2ZHXB 1VQQA 4L7KA 3RNTA 3X3YA 1UGIA 3UL5A 1IV7A 1OF5B 2W2CA 3BNEA 3BNDA 4IIAA 5GSPA 4R1KA 1DVDA 3WODG 5DRVA 1I70A 1IT8A 3H3HA 1YJW3 1K41A 1X1XA 4HM3B 1IVXA 3BU4A 3VGNA 1VZZA 2XSHB 1BGSA 1BSAA 3D79A 2KXGA 3J7Yd 3GWRA 2CX0A 2FGTA 1BRIA 3CME3 5CLKA 1E3RA 1JN5A 3CD63 3NX0A 2OOVA 4XBTA 4WFOA 3ALAA 3F7SA 4J9AA 2L1SA 3B4OA 2W56B 1V74A 3WA2X 1AVKA 2RBIA 2XSOB 1RCLA 3EBYA 3IJEB 4K61A 2XR8B 1W02A 4XBXA 1RTUA 3HX8A 3DGLA 3PZWA 3HZPA 2CW9A 3ZG5A 1VQ63 3SX1A 2CFKA 2INXA 5IF6A 5KP1A 1N9EA 1N8R4 1JB2A 2A15A 2XF3A 1FGTA 3X42A 4J5GA 2CX1A 3QRDA 1OGZA 4L8OA 4GL6A 1O7PB 4O2HA 3LZAA 1UI8A 4XDVA 2CFGA 1Q864 1E3VA 4R9LA 3VSYA 2H0HA 4CDLA 4NREA 2IY2A 1T2HA 2BIRA 1HKXA 3A5EA 3IPTA 3Q3FA 1Q7Y4 1FUTA 5CF2A 1G0TA 1ZS7A 1K8A4 1O7NB 4WWUC 1DMQA 1NWWA 3EJVA 1STDA 2UUGC 2Z77A 3FH1A 3CCS3 2XEPA 2BO9B 2CK3H 3O8YA 1UCJA 4BIRA 1Q814 3FG3A 2M7OA 4XBYA 4XDWA 4AKYA 1RN4A 3LXUX 1V57A 3DH2A 2OQEC 3FF2A 3HK4A 4N6MA 3STDA 1Q42A 2CH9A 1VQO3 3MKIA 2GSPA 2ML6A 4O8SA 2BHMA 1IVUA 3MHEA 4Q53A 1LNHA 3VF1A 5RNTA 1YIT3 1KC84 1FW7A 1SARA 3T0UA 1KWIA 1WMNA 1LRAA 3PCSA 1BU4A 3AGNA 2MC8A 1M1XB 2GEYA 2CWUA 3URPA 3N54B 4HM7B 4LSOA 1UUVB 4LGQA 1SJWA 3JUMA 2RGQA 3WOFB 3LOYA 4KVHA 2Q07A 3CC73 3K7CA 4H61A 3EHCA 2QEX3 2PZVA 2HMOB 2CIUA 1BIRA 3NUVA 4LYLB 1BRKA 3AMOA 1BANA 2E2UA 1OH0A 2E2VA 4J8TA 7RNTA 1QVG2 2OTL3 1IQXA 3Q2PA 1T5YA 4JRFA 1G96A 2BU4A 1R4YA 4HZBB 1TFKA 3NQYA 3E99A 1YHQ3 1VQP3 4EXRA 2OWPA 5G1LA 3CPOA 3PCRA 3X40A 2GU3A 3GSPA 1QMAA 1W01A 5BVBA 1PFPA 4OVMA 1VQK3 2CG1A 2IMJA 1NB3I 4FR9A 3RGAA 1LVNA 3FGYA 3UL6A 1BUQA 3MYTA 2I9WA 3OV4A 4I5QA 2YFIB 4N6NB 1BOXA 3F7XA 3MG2A 3KKGA 1SIHA 1O7HB 1JZOA 3PGBA 1GS3A 5ELUA 5EEOA 1K9M4 2FNQA 1LOYA 2UGIA 3EB8A 3K63A 1VQ83 4GSPA 9RNTA 3FCSB 1TRQA 3DMCA 2XGLA 2GU1A 4HAAA 1I3IA 1IU7A 5M18A 2IUKA 3BIRA 2J8XB 3DY5A 1SQWA 2Z7AA 4MJDA 4XB5A 1BNSA 3QK9A 1SIIA 2KF5A 4HM8B 4HOHA 2W6JH 1CYUA 1DVCA 1EA2A 3RDEA 1DMMA 1RGCA 1O7MB 3LMLA 4H3UA 2KF6A 5STDA 1RCKA 3K9MC 4OK0A 3CCV3 2GBWB 2E2TA 3AMOB 4N6TA 2W9PA 2BMRB 1MOLA 1MNLA 1EG9B 3G16A 1S723 3N8BA 3MG3A 3Q90A 1JB5A 1TFOA 3KSPA 4KZ1A 1C54A 1IQYA 5AIHA 2F4YA 3U97A 3G0KA 1YGWA 3GZRA 1U8CB 2OTJ3 2ZDJA 3DZLA 1JZDA 2B1XB 3KE7A 3OXAA 4FMAA 7STDA 1D6UA 1GYBA 1AV4A 3EQQB 3GZBA 3KFQC 3S27A 4R4KA 1B3SA 3CCQ3 2F98A 1IYYA 4EV2A 4KFEA 1BNFA 1EQKA 1IVWA 1I3FA 2D42A 4O02B 5IG5A 4BTWA 6RNTA 3D5GA 1LOVA 4BL2A 3OW22 1V58A 3X3XA 1ZGXA 4RNTA 3PS8A 1JBTA 4KFFA 1EEJA 1W5ZA 3EC9A 5AIFA 5BIRA 1TRPA 2FXTA 2ZL8A 6GSPA 1ROVA 3KN4A 1Q9EA 1MWSA 1BVIA 2SBLA 3OWUA 3RGRA 2YFJB 3IMAB 3CMA3 2YFLB 1RMSA 3F9SA 3MG1A 1GMRA 3D9RA 1RGAA 1NJI4 1WQLB 1MGRA 2W9QA 3UNLA 5IEOA 1B2MA 2CFDA 2H0GA 1ULJB 4MEIA 3SLUA 3WR2A 3AHWA 2W03A 3G713 5EVHA 1M904 1I2GA 1EKMA 1CYVA 1I2EA 1UCIA 1BSDA 4K1VA 4STDA 1RDSA 4NHFA 2KAAA 3CCE3 3LTCA 2HMKB 1FZUA 3WA3A 3OX9A 1W4NA 5HGRA 1RHLA 1AQZA 1VQ43 3N9HA 4N6UA 1YVBI 3NXJA 3SYUA 3JUPA 1LQMB 1Q40A 1QVF2 3LT8A 4X2HA 3V98A 2C4BA 3WHOA 1GOVA 3LT9A 1A2KA 1GMPA 4ORLA 2BNGA 4TX4A 3ROBA 3BNCA 1LQGC 4WP5A 2JDIH 5D81A 3NBRA 1TTOA 2XH9A 4FCZA 3G4S3 2GEXA 1Q824 5G1KA 1LNIA 1R4CA 1RN1A 2B24B 2F99A 3KIIA 1STFI 4JF8A 3WMDA 3NM2A 4KFDA 5CF1A 1BRJA 1PY3A 4HBRA 1BSEA 1D6ZA 4FMBA 2OOVC 3LTBA 1ZO2A 4LMIA 3GAXA 1RRLA 1W00A 3GZYB 8CHOA 1GY5A 1FUSA 4RNYA 1A2VA 1QAFA 1N5PA 3DGMA 5AEWB 1ULIB 3LYGA 1GY7A 2LYXA 5BU4A 5IERA 1I8VA 3MPHA 2WOHA 3HIIA 4FCMA 1IV9A 4WYKA 3V99A 4BTXA 1LOXA 3GZXB 1N9JA 4FMDA 1U5OA 4CPKA 4GHOA 1W6GA 5AYSC 2WGQA 5M1AA 1MWRA 3X3ZA 1MWTA 1NNVA 1G02A 1RJOA 3BB9A 4NPBA 4AKZA 1HU9A 1BRGA 3Q1CA 4K1UA 2O9UX 2P0XA 3H51A 5KP3A 3WOEB 5LC6A 4BTYA 1VQ53 3OWYA 3BLZA 5IG0A 1GMQA 1N5HA 1OPYA 3MSOA 4HM6B 5BXQA 1DYUA 3X41A 1QAKA 3CU3A 4CJNA 5IEPA 2IUJA 2QA43 1IK3A 1Q40B 3S29A 4BL3A 1Z1SA 1RGKA 4HM5B 3F8XA 1DE3A 5AIGA 2BMQB 1K734 5I97A 1JKGA 1FGRA 1HZ1A 3DGYA 2IYJA 1RGLA 3DGOA 2HMMB 2WGOA 3EN1B 2Y74A 3PYJA 2K3DA 3JVCA 1FGOA 2K54A 4N3VA 3S5CA 5IG3A 1T3BA 1FA3A 1DETA 3FG4A 2XRXB 1B2ZA 2L4VA 5JBSA 2MF7A 1A90A 4N6OB 1AY7A 5A0OB 1UCLA 3NM7A 1WTHA 1IT7A 3EF8A 1B2UA 1OCVA 1T2IA 2Z76A 3F8HA 3PXMA 5FGOA 1KQS2 1UI7A 3EBTA 1B20A 1I0XA 1O7GB 2AADA 2O3OA 3SXXA 2C11A 2P05A 2RCDA 1JBSA 1NO3A 1WMOA 3EX9A 1GD4A 4WYKB 4RZMA 1A2PA 1OHOA 1SPUA 5AI1A 4HM4B 3ZG0A 1NDOB 1TUHA 3NV0B 5LC7A 5HOHA 2RFRA 1RNBA 1I0VA 4HVNA 1B2XA 1VQ73 1RGGA 3DGNA 5EQLA 2F5MA 4WHAA 2GBXB 1UUGB 4IPBA 3UJMA 1JRQA 4HYZA 2OQEA 2STDA 3B7CA 1JV2B 1BAOA 3G6E3 1EUIC 3KCHA 2CHCA 4EC6A 5D82A 3CC43 2C10A 3FG1A 4HM1B 4BU4A 1JNQA 3FSDA 2QGUA 2HMLB 4U13A 2KCDA 1N8QA 1YI23 2PNCA 3SEDA 3SVAA 2H0IA 3F14A 3NQZA 4LEHA 4ZM8A 1HYFA 1O7WB 4IT7A 5FW5A 1YVSA 3CCJ3 3D4AA 3CC23 2UX0A 5IW9A 1JKGB 4XM4A 3F40A 8RNTA 2OCTA 1UGHI 2CKFB 4HJLB 1BNRA 2KRTA 1IDPA 1YIJ3 3KSED 4HZ9B 3NBBA 3EN8A 1RKYA 2HOHA 2WO0A 3HOHA 1ASKA 2KF3A 3G8ZA 4MMXB 5M19A 2W04A 2XGNA 3NHXA 1RNTA 2CWVA 1PYLA 1Q7HA 3AHSA 4HKVB 1MGWA 1B21A 5D83A 4EBGA 4ILFA 1NU3A 2JQ5A 3S28A 4RBNA 5AEUB 1YNVX 2D1WA 1GSPA 2QIYA 1X1YA 2Z6BA 1BRNL 1CEWI 4EW5A 1BRSA 3CCU3 2CC3A 1FUWA 3V92A 3KZTA 3CNXA 3EE1A 4OUQA 1OGXA 2CFLA 1WMPA 1VQL3 3OWSA 2ML5A 5JPPA 1JBRA 4EV5A 1QALA 1YGEA 3JUNA 3BNBA 3L0RA 1PU4A 3DUKA 3DXOA 1YJ93 1M1K4 3FKAA 2R41A 3CXC2 1BSCA 2HMJB 1GD3A 3UB1A 2XFSA 2AAEA 3A76A 2BMOB 2P0MA 3FLJA 2WOFA 4K90B 3CCM3 3DM8A 3K5TA 3B4PA 3I563 1BSBA 5ELJA 1BNGA 1C7HA 1GOYA 1CH0A 1GY6A 1X1UA 3CPW2 1LXEA 1JB4A 3K0ZA 5CK6A 1UDII 2F86B 1ROAA 1AR0A 3ZFZA 1UCKA 4MMZB 1S5AA 4MMYB 1D6YA 1US1A 1BUJA 1BNJA 3CCL3 3U1WA 1FGQA 4RNZA 1RRHA 1JN5B 3I553 4FCJA 1W7CA 5G2GA 1WNHA 1IVVA 1JJ22 1RSNA 3NBJA 3TDGA 1QJGA 1KD14 4GB5A 1E97A 3HIGA 3B8LA 2RSXA 1VQN3 4DKIA 2CFWA 3S67A 1YJN3 1FYSA 2KF4A 1TU5A 3NV0A 1VQ93 1LOWA 2YX9A 1F8NA 1W2B2 3D5IA 4FMCA 1TIJA 2F5WA 3SOYA 1UW1A 1I2FA 5JPUA 1OF5A 3JUOA 2IA7A 2XFTA 4N6LA 2LQVA 1OHSA 1B27A 1RLSA 2W0QA 1NB5I 1B2SA 4KT3B 1AVLA 2R4IA 3CNMA 1J2BA 3FZWA 1BNEA 4X2OA 4CCVA 2K0MA 1ISKA 1FGMA 1OUNA 1UUWB 2P09A 3GRDA 3HI7A 1GOUA 3SOAA 1Y4KA 5IENA 4HM0B 1W2ZA 1M9GA 3T8UA 2P38A 5AYRB 2HMNB 5IG4A 3ER7A 2BT3A 2GXFA 2F56A 3LTDA
chains in the Genus database with same CATH topology
1B2MA 1BRHA 2RNTA 1RGHA 3URPA 1BAOA 3WR2A 3AHWA 3KCHA 1BNIA 4BU4A 1I2GA 1I2EA 1UCIA 1BSDA 1BIRA 1RDSA 1BRKA 2KAAA 1BANA 1FZUA 7RNTA 4J5KA 1RHLA 1AQZA 1HYFA 1YVSA 2BU4A 3D4AA 1R4YA 2SARA 3SYUA 1RGFA 2ZA4A 8RNTA 1BNRA 7GSPA 2C4BA 1X1WA 1GOVA 3WHOA 1RGEA 1GMPA 3AGOA 3RNTA 3GSPA 2HOHA 3HOHA 2KF3A 1TTOA 5GSPA 1LNIA 1RNTA 1RN1A 1PYLA 3AHSA 1I70A 1MGWA 1B21A 1BRJA 1PY3A 1BSEA 1YNVX 1GSPA 1BOXA 1X1XA 1X1YA 1BRNL 3BU4A 1BRSA 1BGSA 1BSAA 1FUSA 1JBRA 1LOYA 5BU4A 4GSPA 1I8VA 1BRIA 9RNTA 1TRQA 4HAAA 1BSCA 1I3IA 3BIRA 2AAEA 4GHOA 1BNSA 2KF5A 4HOHA 1BSBA 1BNGA 1RGCA 2RBIA 1GOYA 1RCLA 1G02A 1CH0A 1X1UA 2KF6A 1BRGA 1RCKA 1RTUA 1UCKA 1BUJA 1BNJA 1GMQA 4J5GA 1RGKA 1RSNA 1DE3A 1C54A 2F4YA 1YGWA 1HZ1A 3DGYA 1RGLA 1FYSA 2KF4A 1T2HA 1LOWA 2BIRA 3A5EA 3Q3FA 1FUTA 2F5MA 1DETA 1B3SA 3D5IA 1IYYA 2F5WA 1B2ZA 1BNFA 1I2FA 1AY7A 1I3FA 1UCLA 6RNTA 1B27A 4BIRA 1B2UA 1RLSA 1T2IA 1UCJA 3D5GA 1LOVA 1B2SA 1ZGXA 1B20A 1I0XA 4RNTA 2AADA 1JBTA 1BNEA 1RN4A 3DH2A 5BIRA 1TRPA 6GSPA 1JBSA 1Q9EA 1GOUA 2GSPA 1A2PA 1BVIA 5RNTA 5HOHA 1FW7A 1SARA 1RNBA 1I0VA 1B2XA 1RMSA 1LRAA 1RGGA 1GMRA 1BU4A 1RGAA 3AGNA 1MGRA 2F56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2M A;  1BRH A;  2RNT A;  1RGH A;  3URP A;  1BAO A;  3WR2 A;  3AHW A;  3KCH A;  1BNI A;  4BU4 A;  1I2G A;  1I2E A;  1UCI A;  1BSD A;  1BIR A;  1RDS A;  1BRK A;  2KAA A;  1BAN A;  1FZU A;  7RNT A;  4J5K A;  1RHL A;  1AQZ A;  1HYF A;  1YVS A;  2BU4 A;  3D4A A;  1R4Y A;  2SAR A;  3SYU A;  1RGF A;  2ZA4 A;  8RNT A;  1BNR A;  7GSP A;  2C4B A;  1X1W A;  1GOV A;  3WHO A;  1RGE A;  1GMP A;  3AGO A;  3RNT A;  3GSP A;  2HOH A;  3HOH A;  2KF3 A;  1TTO A;  5GSP A;  1LNI A;  1RNT A;  1RN1 A;  1PYL A;  3AHS A;  1I70 A;  1MGW A;  1B21 A;  1BRJ A;  1PY3 A;  1BSE A;  1YNV X;  1GSP A;  1BOX A;  1X1X A;  1X1Y A;  1BRN L;  3BU4 A;  1BRS A;  1BGS A;  1BSA A;  1FUS A;  1JBR A;  1LOY A;  5BU4 A;  4GSP A;  1I8V A;  1BRI A;  9RNT A;  1TRQ A;  4HAA A;  1BSC A;  1I3I A;  3BIR A;  2AAE A;  4GHO A;  1BNS A;  2KF5 A;  4HOH A;  1BSB A;  1BNG A;  1RGC A;  2RBI A;  1GOY A;  1RCL A;  1G02 A;  1CH0 A;  1X1U A;  2KF6 A;  1BRG A;  1RCK A;  1RTU A;  1UCK A;  1BUJ A;  1BNJ A;  1GMQ A;  4J5G A;  1RGK A;  1RSN A;  1DE3 A;  1C54 A;  2F4Y A;  1YGW A;  1HZ1 A;  3DGY A;  1RGL A;  1FYS A;  2KF4 A;  1T2H A;  1LOW A;  2BIR A;  3A5E A;  3Q3F A;  1FUT A;  2F5M A;  1DET A;  1B3S A;  3D5I A;  1IYY A;  2F5W A;  1B2Z A;  1BNF A;  1I2F A;  1AY7 A;  1I3F A;  1UCL A;  6RNT A;  1B27 A;  4BIR A;  1B2U A;  1RLS A;  1T2I A;  1UCJ A;  3D5G A;  1LOV A;  1B2S A;  1ZGX A;  1B20 A;  1I0X A;  4RNT A;  2AAD A;  1JBT A;  1BNE A;  1RN4 A;  3DH2 A;  5BIR A;  1TRP A;  6GSP A;  1JBS A;  1Q9E A;  1GOU A;  2GSP A;  1A2P A;  1BVI A;  5RNT A;  5HOH A;  1FW7 A;  1SAR A;  1RNB A;  1I0V A;  1B2X A;  1RMS A;  1LRA A;  1RGG A;  1GMR A;  1BU4 A;  1RGA A;  3AGN A;  1MGR A;  2F56 A; 
#chains in the Genus database with same CATH topology
 1BRH A;  2RNT A;  4R9K A;  1RGH A;  5TGN A;  3CCR 3;  2W56 A;  5AII A;  4R80 A;  3T8N A;  1BNI A;  1A67 A;  4L8P A;  1RN7 A;  1TJD A;  4HM2 B;  5DRE A;  1TP6 A;  3MWZ A;  1L5G B;  1IQ8 A;  1MWU A;  3FF0 A;  1K28 A;  3JUQ A;  1VQM 3;  4G1M B;  1ZX2 A;  1W6C A;  2Y73 A;  1DMN A;  2CWT A;  3ECF A;  1OAC A;  4J5K A;  1CQS A;  3LTA A;  4QWT A;  2SAR A;  1KSI A;  3I0Y A;  1RGF A;  2ZA4 A;  1W6Y A;  5CXO A;  4N6V 0;  4LZI A;  4AEQ A;  2CG0 A;  2V1L A;  4O3V A;  3WDG B;  6STD A;  3D3L A;  7GSP A;  5KP4 A;  3LH4 A;  1X1W A;  3M8C A;  4I4K A;  1OHP A;  1RGE A;  3AGO A;  4PEJ A;  4EYC A;  2ZHX B;  1VQQ A;  4L7K A;  3RNT A;  3X3Y A;  1UGI A;  3UL5 A;  1IV7 A;  1OF5 B;  2W2C A;  3BNE A;  3BND A;  4IIA A;  5GSP A;  4R1K A;  1DVD A;  3WOD G;  5DRV A;  1I70 A;  1IT8 A;  3H3H A;  1YJW 3;  1K41 A;  1X1X A;  4HM3 B;  1IVX A;  3BU4 A;  3VGN A;  1VZZ A;  2XSH B;  1BGS A;  1BSA A;  3D79 A;  2KXG A;  3J7Y d;  3GWR A;  2CX0 A;  2FGT A;  1BRI A;  3CME 3;  5CLK A;  1E3R A;  1JN5 A;  3CD6 3;  3NX0 A;  2OOV A;  4XBT A;  4WFO A;  3ALA A;  3F7S A;  4J9A A;  2L1S A;  3B4O A;  2W56 B;  1V74 A;  3WA2 X;  1AVK A;  2RBI A;  2XSO B;  1RCL A;  3EBY A;  3IJE B;  4K61 A;  2XR8 B;  1W02 A;  4XBX A;  1RTU A;  3HX8 A;  3DGL A;  3PZW A;  3HZP A;  2CW9 A;  3ZG5 A;  1VQ6 3;  3SX1 A;  2CFK A;  2INX A;  5IF6 A;  5KP1 A;  1N9E A;  1N8R 4;  1JB2 A;  2A15 A;  2XF3 A;  1FGT A;  3X42 A;  4J5G A;  2CX1 A;  3QRD A;  1OGZ A;  4L8O A;  4GL6 A;  1O7P B;  4O2H A;  3LZA A;  1UI8 A;  4XDV A;  2CFG A;  1Q86 4;  1E3V A;  4R9L A;  3VSY A;  2H0H A;  4CDL A;  4NRE A;  2IY2 A;  1T2H A;  2BIR A;  1HKX A;  3A5E A;  3IPT A;  3Q3F A;  1Q7Y 4;  1FUT A;  5CF2 A;  1G0T A;  1ZS7 A;  1K8A 4;  1O7N B;  4WWU C;  1DMQ A;  1NWW A;  3EJV A;  1STD A;  2UUG C;  2Z77 A;  3FH1 A;  3CCS 3;  2XEP A;  2BO9 B;  2CK3 H;  3O8Y A;  1UCJ A;  4BIR A;  1Q81 4;  3FG3 A;  2M7O A;  4XBY A;  4XDW A;  4AKY A;  1RN4 A;  3LXU X;  1V57 A;  3DH2 A;  2OQE C;  3FF2 A;  3HK4 A;  4N6M A;  3STD A;  1Q42 A;  2CH9 A;  1VQO 3;  3MKI A;  2GSP A;  2ML6 A;  4O8S A;  2BHM A;  1IVU A;  3MHE A;  4Q53 A;  1LNH A;  3VF1 A;  5RNT A;  1YIT 3;  1KC8 4;  1FW7 A;  1SAR A;  3T0U A;  1KWI A;  1WMN A;  1LRA A;  3PCS A;  1BU4 A;  3AGN A;  2MC8 A;  1M1X B;  2GEY A;  2CWU A;  3URP A;  3N54 B;  4HM7 B;  4LSO A;  1UUV B;  4LGQ A;  1SJW A;  3JUM A;  2RGQ A;  3WOF B;  3LOY A;  4KVH A;  2Q07 A;  3CC7 3;  3K7C A;  4H61 A;  3EHC A;  2QEX 3;  2PZV A;  2HMO B;  2CIU A;  1BIR A;  3NUV A;  4LYL B;  1BRK A;  3AMO A;  1BAN A;  2E2U A;  1OH0 A;  2E2V A;  4J8T A;  7RNT A;  1QVG 2;  2OTL 3;  1IQX A;  3Q2P A;  1T5Y A;  4JRF A;  1G96 A;  2BU4 A;  1R4Y A;  4HZB B;  1TFK A;  3NQY A;  3E99 A;  1YHQ 3;  1VQP 3;  4EXR A;  2OWP A;  5G1L A;  3CPO A;  3PCR A;  3X40 A;  2GU3 A;  3GSP A;  1QMA A;  1W01 A;  5BVB A;  1PFP A;  4OVM A;  1VQK 3;  2CG1 A;  2IMJ A;  1NB3 I;  4FR9 A;  3RGA A;  1LVN A;  3FGY A;  3UL6 A;  1BUQ A;  3MYT A;  2I9W A;  3OV4 A;  4I5Q A;  2YFI B;  4N6N B;  1BOX A;  3F7X A;  3MG2 A;  3KKG A;  1SIH A;  1O7H B;  1JZO A;  3PGB A;  1GS3 A;  5ELU A;  5EEO A;  1K9M 4;  2FNQ A;  1LOY A;  2UGI A;  3EB8 A;  3K63 A;  1VQ8 3;  4GSP A;  9RNT A;  3FCS B;  1TRQ A;  3DMC A;  2XGL A;  2GU1 A;  4HAA A;  1I3I A;  1IU7 A;  5M18 A;  2IUK A;  3BIR A;  2J8X B;  3DY5 A;  1SQW A;  2Z7A A;  4MJD A;  4XB5 A;  1BNS A;  3QK9 A;  1SII A;  2KF5 A;  4HM8 B;  4HOH A;  2W6J H;  1CYU A;  1DVC A;  1EA2 A;  3RDE A;  1DMM A;  1RGC A;  1O7M B;  3LML A;  4H3U A;  2KF6 A;  5STD A;  1RCK A;  3K9M C;  4OK0 A;  3CCV 3;  2GBW B;  2E2T A;  3AMO B;  4N6T A;  2W9P A;  2BMR B;  1MOL A;  1MNL A;  1EG9 B;  3G16 A;  1S72 3;  3N8B A;  3MG3 A;  3Q90 A;  1JB5 A;  1TFO A;  3KSP A;  4KZ1 A;  1C54 A;  1IQY A;  5AIH A;  2F4Y A;  3U97 A;  3G0K A;  1YGW A;  3GZR A;  1U8C B;  2OTJ 3;  2ZDJ A;  3DZL A;  1JZD A;  2B1X B;  3KE7 A;  3OXA A;  4FMA A;  7STD A;  1D6U A;  1GYB A;  1AV4 A;  3EQQ B;  3GZB A;  3KFQ C;  3S27 A;  4R4K A;  1B3S A;  3CCQ 3;  2F98 A;  1IYY A;  4EV2 A;  4KFE A;  1BNF A;  1EQK A;  1IVW A;  1I3F A;  2D42 A;  4O02 B;  5IG5 A;  4BTW A;  6RNT A;  3D5G A;  1LOV A;  4BL2 A;  3OW2 2;  1V58 A;  3X3X A;  1ZGX A;  4RNT A;  3PS8 A;  1JBT A;  4KFF A;  1EEJ A;  1W5Z A;  3EC9 A;  5AIF A;  5BIR A;  1TRP A;  2FXT A;  2ZL8 A;  6GSP A;  1ROV A;  3KN4 A;  1Q9E A;  1MWS A;  1BVI A;  2SBL A;  3OWU A;  3RGR A;  2YFJ B;  3IMA B;  3CMA 3;  2YFL B;  1RMS A;  3F9S A;  3MG1 A;  1GMR A;  3D9R A;  1RGA A;  1NJI 4;  1WQL B;  1MGR A;  2W9Q A;  3UNL A;  5IEO A;  1B2M A;  2CFD A;  2H0G A;  1ULJ B;  4MEI A;  3SLU A;  3WR2 A;  3AHW A;  2W03 A;  3G71 3;  5EVH A;  1M90 4;  1I2G A;  1EKM A;  1CYV A;  1I2E A;  1UCI A;  1BSD A;  4K1V A;  4STD A;  1RDS A;  4NHF A;  2KAA A;  3CCE 3;  3LTC A;  2HMK B;  1FZU A;  3WA3 A;  3OX9 A;  1W4N A;  5HGR A;  1RHL A;  1AQZ A;  1VQ4 3;  3N9H A;  4N6U A;  1YVB I;  3NXJ A;  3SYU A;  3JUP A;  1LQM B;  1Q40 A;  1QVF 2;  3LT8 A;  4X2H A;  3V98 A;  2C4B A;  3WHO A;  1GOV A;  3LT9 A;  1A2K A;  1GMP A;  4ORL A;  2BNG A;  4TX4 A;  3ROB A;  3BNC A;  1LQG C;  4WP5 A;  2JDI H;  5D81 A;  3NBR A;  1TTO A;  2XH9 A;  4FCZ A;  3G4S 3;  2GEX A;  1Q82 4;  5G1K A;  1LNI A;  1R4C A;  1RN1 A;  2B24 B;  2F99 A;  3KII A;  1STF I;  4JF8 A;  3WMD A;  3NM2 A;  4KFD A;  5CF1 A;  1BRJ A;  1PY3 A;  4HBR A;  1BSE A;  1D6Z A;  4FMB A;  2OOV C;  3LTB A;  1ZO2 A;  4LMI A;  3GAX A;  1RRL A;  1W00 A;  3GZY B;  8CHO A;  1GY5 A;  1FUS A;  4RNY A;  1A2V A;  1QAF A;  1N5P A;  3DGM A;  5AEW B;  1ULI B;  3LYG A;  1GY7 A;  2LYX A;  5BU4 A;  5IER A;  1I8V A;  3MPH A;  2WOH A;  3HII A;  4FCM A;  1IV9 A;  4WYK A;  3V99 A;  4BTX A;  1LOX A;  3GZX B;  1N9J A;  4FMD A;  1U5O A;  4CPK A;  4GHO A;  1W6G A;  5AYS C;  2WGQ A;  5M1A A;  1MWR A;  3X3Z A;  1MWT A;  1NNV A;  1G02 A;  1RJO A;  3BB9 A;  4NPB A;  4AKZ A;  1HU9 A;  1BRG A;  3Q1C A;  4K1U A;  2O9U X;  2P0X A;  3H51 A;  5KP3 A;  3WOE B;  5LC6 A;  4BTY A;  1VQ5 3;  3OWY A;  3BLZ A;  5IG0 A;  1GMQ A;  1N5H A;  1OPY A;  3MSO A;  4HM6 B;  5BXQ A;  1DYU A;  3X41 A;  1QAK A;  3CU3 A;  4CJN A;  5IEP A;  2IUJ A;  2QA4 3;  1IK3 A;  1Q40 B;  3S29 A;  4BL3 A;  1Z1S A;  1RGK A;  4HM5 B;  3F8X A;  1DE3 A;  5AIG A;  2BMQ B;  1K73 4;  5I97 A;  1JKG A;  1FGR A;  1HZ1 A;  3DGY A;  2IYJ A;  1RGL A;  3DGO A;  2HMM B;  2WGO A;  3EN1 B;  2Y74 A;  3PYJ A;  2K3D A;  3JVC A;  1FGO A;  2K54 A;  4N3V A;  3S5C A;  5IG3 A;  1T3B A;  1FA3 A;  1DET A;  3FG4 A;  2XRX B;  1B2Z A;  2L4V A;  5JBS A;  2MF7 A;  1A90 A;  4N6O B;  1AY7 A;  5A0O B;  1UCL A;  3NM7 A;  1WTH A;  1IT7 A;  3EF8 A;  1B2U A;  1OCV A;  1T2I A;  2Z76 A;  3F8H A;  3PXM A;  5FGO A;  1KQS 2;  1UI7 A;  3EBT A;  1B20 A;  1I0X A;  1O7G B;  2AAD A;  2O3O A;  3SXX A;  2C11 A;  2P05 A;  2RCD A;  1JBS A;  1NO3 A;  1WMO A;  3EX9 A;  1GD4 A;  4WYK B;  4RZM A;  1A2P A;  1OHO A;  1SPU A;  5AI1 A;  4HM4 B;  3ZG0 A;  1NDO B;  1TUH A;  3NV0 B;  5LC7 A;  5HOH A;  2RFR A;  1RNB A;  1I0V A;  4HVN A;  1B2X A;  1VQ7 3;  1RGG A;  3DGN A;  5EQL A;  2F5M A;  4WHA A;  2GBX B;  1UUG B;  4IPB A;  3UJM A;  1JRQ A;  4HYZ A;  2OQE A;  2STD A;  3B7C A;  1JV2 B;  1BAO A;  3G6E 3;  1EUI C;  3KCH A;  2CHC A;  4EC6 A;  5D82 A;  3CC4 3;  2C10 A;  3FG1 A;  4HM1 B;  4BU4 A;  1JNQ A;  3FSD A;  2QGU A;  2HML B;  4U13 A;  2KCD A;  1N8Q A;  1YI2 3;  2PNC A;  3SED A;  3SVA A;  2H0I A;  3F14 A;  3NQZ A;  4LEH A;  4ZM8 A;  1HYF A;  1O7W B;  4IT7 A;  5FW5 A;  1YVS A;  3CCJ 3;  3D4A A;  3CC2 3;  2UX0 A;  5IW9 A;  1JKG B;  4XM4 A;  3F40 A;  8RNT A;  2OCT A;  1UGH I;  2CKF B;  4HJL B;  1BNR A;  2KRT A;  1IDP A;  1YIJ 3;  3KSE D;  4HZ9 B;  3NBB A;  3EN8 A;  1RKY A;  2HOH A;  2WO0 A;  3HOH A;  1ASK A;  2KF3 A;  3G8Z A;  4MMX B;  5M19 A;  2W04 A;  2XGN A;  3NHX A;  1RNT A;  2CWV A;  1PYL A;  1Q7H A;  3AHS A;  4HKV B;  1MGW A;  1B21 A;  5D83 A;  4EBG A;  4ILF A;  1NU3 A;  2JQ5 A;  3S28 A;  4RBN A;  5AEU B;  1YNV X;  2D1W A;  1GSP A;  2QIY A;  1X1Y A;  2Z6B A;  1BRN L;  1CEW I;  4EW5 A;  1BRS A;  3CCU 3;  2CC3 A;  1FUW A;  3V92 A;  3KZT A;  3CNX A;  3EE1 A;  4OUQ A;  1OGX A;  2CFL A;  1WMP A;  1VQL 3;  3OWS A;  2ML5 A;  5JPP A;  1JBR A;  4EV5 A;  1QAL A;  1YGE A;  3JUN A;  3BNB A;  3L0R A;  1PU4 A;  3DUK A;  3DXO A;  1YJ9 3;  1M1K 4;  3FKA A;  2R41 A;  3CXC 2;  1BSC A;  2HMJ B;  1GD3 A;  3UB1 A;  2XFS A;  2AAE A;  3A76 A;  2BMO B;  2P0M A;  3FLJ A;  2WOF A;  4K90 B;  3CCM 3;  3DM8 A;  3K5T A;  3B4P A;  3I56 3;  1BSB A;  5ELJ A;  1BNG A;  1C7H A;  1GOY A;  1CH0 A;  1GY6 A;  1X1U A;  3CPW 2;  1LXE A;  1JB4 A;  3K0Z A;  5CK6 A;  1UDI I;  2F86 B;  1ROA A;  1AR0 A;  3ZFZ A;  1UCK A;  4MMZ B;  1S5A A;  4MMY B;  1D6Y A;  1US1 A;  1BUJ A;  1BNJ A;  3CCL 3;  3U1W A;  1FGQ A;  4RNZ A;  1RRH A;  1JN5 B;  3I55 3;  4FCJ A;  1W7C A;  5G2G A;  1WNH A;  1IVV A;  1JJ2 2;  1RSN A;  3NBJ A;  3TDG A;  1QJG A;  1KD1 4;  4GB5 A;  1E97 A;  3HIG A;  3B8L A;  2RSX A;  1VQN 3;  4DKI A;  2CFW A;  3S67 A;  1YJN 3;  1FYS A;  2KF4 A;  1TU5 A;  3NV0 A;  1VQ9 3;  1LOW A;  2YX9 A;  1F8N A;  1W2B 2;  3D5I A;  4FMC A;  1TIJ A;  2F5W A;  3SOY A;  1UW1 A;  1I2F A;  5JPU A;  1OF5 A;  3JUO A;  2IA7 A;  2XFT A;  4N6L A;  2LQV A;  1OHS A;  1B27 A;  1RLS A;  2W0Q A;  1NB5 I;  1B2S A;  4KT3 B;  1AVL A;  2R4I A;  3CNM A;  1J2B A;  3FZW A;  1BNE A;  4X2O A;  4CCV A;  2K0M A;  1ISK A;  1FGM A;  1OUN A;  1UUW B;  2P09 A;  3GRD A;  3HI7 A;  1GOU A;  3SOA A;  1Y4K A;  5IEN A;  4HM0 B;  1W2Z A;  1M9G A;  3T8U A;  2P38 A;  5AYR B;  2HMN B;  5IG4 A;  3ER7 A;  2BT3 A;  2GXF A;  2F56 A;  3LTD A; 
#chains in the Genus database with same CATH homology
 1B2M A;  1BRH A;  2RNT A;  1RGH A;  3URP A;  1BAO A;  3WR2 A;  3AHW A;  3KCH A;  1BNI A;  4BU4 A;  1I2G A;  1I2E A;  1UCI A;  1BSD A;  1BIR A;  1RDS A;  1BRK A;  2KAA A;  1BAN A;  1FZU A;  7RNT A;  4J5K A;  1RHL A;  1AQZ A;  1HYF A;  1YVS A;  2BU4 A;  3D4A A;  1R4Y A;  2SAR A;  3SYU A;  1RGF A;  2ZA4 A;  8RNT A;  1BNR A;  7GSP A;  2C4B A;  1X1W A;  1GOV A;  3WHO A;  1RGE A;  1GMP A;  3AGO A;  3RNT A;  3GSP A;  2HOH A;  3HOH A;  2KF3 A;  1TTO A;  5GSP A;  1LNI A;  1RNT A;  1RN1 A;  1PYL A;  3AHS A;  1I70 A;  1MGW A;  1B21 A;  1BRJ A;  1PY3 A;  1BSE A;  1YNV X;  1GSP A;  1BOX A;  1X1X A;  1X1Y A;  1BRN L;  3BU4 A;  1BRS A;  1BGS A;  1BSA A;  1FUS A;  1JBR A;  1LOY A;  5BU4 A;  4GSP A;  1I8V A;  1BRI A;  9RNT A;  1TRQ A;  4HAA A;  1BSC A;  1I3I A;  3BIR A;  2AAE A;  4GHO A;  1BNS A;  2KF5 A;  4HOH A;  1BSB A;  1BNG A;  1RGC A;  2RBI A;  1GOY A;  1RCL A;  1G02 A;  1CH0 A;  1X1U A;  2KF6 A;  1BRG A;  1RCK A;  1RTU A;  1UCK A;  1BUJ A;  1BNJ A;  1GMQ A;  4J5G A;  1RGK A;  1RSN A;  1DE3 A;  1C54 A;  2F4Y A;  1YGW A;  1HZ1 A;  3DGY A;  1RGL A;  1FYS A;  2KF4 A;  1T2H A;  1LOW A;  2BIR A;  3A5E A;  3Q3F A;  1FUT A;  2F5M A;  1DET A;  1B3S A;  3D5I A;  1IYY A;  2F5W A;  1B2Z A;  1BNF A;  1I2F A;  1AY7 A;  1I3F A;  1UCL A;  6RNT A;  1B27 A;  4BIR A;  1B2U A;  1RLS A;  1T2I A;  1UCJ A;  3D5G A;  1LOV A;  1B2S A;  1ZGX A;  1B20 A;  1I0X A;  4RNT A;  2AAD A;  1JBT A;  1BNE A;  1RN4 A;  3DH2 A;  5BIR A;  1TRP A;  6GSP A;  1JBS A;  1Q9E A;  1GOU A;  2GSP A;  1A2P A;  1BVI A;  5RNT A;  5HOH A;  1FW7 A;  1SAR A;  1RNB A;  1I0V A;  1B2X A;  1RMS A;  1LRA A;  1RGG A;  1GMR A;  1BU4 A;  1RGA A;  3AGN A;  1MGR A;  2F56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...