5IEOA

Structure of cdl2.3a, a computationally designed vitamin-d3 binder
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
118
Chain Sequence
LPTAHEAIEAALADFVKVYNSKDAAGVASKYMDDAVIFPLDMARVDGRQNIQKLWQGLMDMGVSEPKFTTLNVQESGDFAFESGSFSLKGPVDIAGIYVEVWRKGGWKLYRTIANLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords CDL2.3a
publication title Structure of CDL2.3a, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
total genus 37
structure length 118
sequence length 127
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ieoA00
5AIFA 4HJLB 2HMOB 5DREA 1TUHA 3F14A 1GY6A 1O7PB 1S5AA 3G0KA 4HM8B 5D82A 3GWRA 3OWYA 4IIAA 3WMDA 4HM1B 1ASKA 2JQ5A 3HZPA 2GBXB 1C7HA 2INXA 3JUNA 3G8ZA 3FF0A 3K7CA 1O7MB 3JUPA 3MYTA 2HMLB 4HM0B 4U13A 4STDA 4XM4A 3EJVA 1OUNA 2HMKB 2OWPA 1HKXA 1UUWB 2QIYA 4GB5A 3EN1B 1ZO2A 3JUOA 4L8PA 3F7XA 4R9KA 3FH1A 1O7GB 1VZZA 3K0ZA 3FKAA 5BVBA 3KSPA 4J8TA 3G16A 3HX8A 4XDWA 1W6YA 1NWWA 4FCJA 3FSDA 3OX9A 3F8HA 3EBYA 8CHOA 4WYKB 1W02A 5CF1A 3KKGA 3CPOA 3MSOA 1O7NB 2A15A 3F7SA 3RGRA 2F86B 4WYKA 4LGQA 4XDVA 2HMNB 4H3UA 1ISKA 3MKIA 3VGNA 2B1XB 1GS3A 5BXQA 3F40A 3F9SA 4HZBB 5KP1A 5DRVA 2Z7AA 4HM7B 3VSYA 4HM4B 2PZVA 3LZAA 1OPYA 4L8OA 4R9LA 2RFRA 3BB9A 4HM2B 4WP5A 3SOAA 2XR8B 1E3VA 1JN5B 4XBYA 3HK4A 2QGUA 1Q40B 5AEUB 1JN5A 2RGQA 1NU3A 7STDA 1OF5A 1OHOA 2CKFB 3NM2A 1E3RA 1JKGA 3FZWA 1Q40A 3A76A 5IENA 2YFJB 4CDLA 3M8CA 1ULJB 4XBTA 3DXOA 3CU3A 4KVHA 4L7KA 5D81A 6STDA 1OGXA 2F99A 5FW5A 1OH0A 3NXJA 5D83A 5IERA 4J9AA 5AIIA 3FLJA 2HMMB 1TP6A 1CQSA 4LMIA 5AIHA 1QJGA 4HM5B 3JUMA 2IMJA 4XBXA 4HVNA 3FGYA 3EX9A 2R4IA 4OUQA 3UNLA 3STDA 1Z1SA 2XSHB 1JB2A 4HM6B 3CNMA 3MG1A 2I9WA 2B24B 5HGRA 4XB5A 5CXOA 1Q42A 1GYBA 3OWUA 4FCMA 4HM3B 2Z77A 3GZRA 3IPTA 3ECFA 3KE7A 4PEJA 3NUVA 1JB5A 2BMRB 2Z76A 5TGNA 1EG9B 5IG4A 5G2GA 5STDA 3DUKA 3GZBA 4X2OA 2XSOB 1OCVA 3NV0B 1OGZA 4RZMA 3UJMA 2K54A 5IG3A 4MJDA 4HZ9B 5AEWB 1DMNA 3D9RA 3OWSA 5AIGA 3MHEA 4HKVB 1OHPA 3NV0A 2BMOB 3EF8A 1W00A 1GY7A 3H3HA 3ROBA 3NHXA 1OF5B 2UX0A 3SEDA 1A2KA 3DM8A 3EN8A 1JKGB 1E97A 2STDA 5IEPA 1EA2A 3JUQA 2CHCA 1K41A 1OHSA 3B8LA 3I0YA 2BNGA 3KZTA 5KP3A 5JPUA 3GZYB 3ER7A 2BMQB 1UUVB 4R1KA 1JB4A 1O7HB 3E99A 4I4KA 2GBWB 3LYGA 3DZLA 2F98A 3B4PA 1DMMA 1ULIB 3GRDA 1QMAA 3DMCA 2RCDA 4LEHA 3T8NA 1W01A 5IG5A 1U5OA 1BUQA 3EHCA 5EVHA 1IDPA 2GEXA 5CK6A 1O7WB 2YFLB 5AI1A 3EQQB 2GEYA 3OXAA 3MG3A 4WWUC 5IEOA 1AR0A 3H51A 3OV4A 3GZXB 1NDOB 4N3VA 4K1UA 3FF2A 4X2HA 3EC9A 2HMJB 5CF2A 4ORLA 1DMQA 4OVMA 3Q90A 3EBTA 1ZX2A 5KP4A 1GY5A 2W2CA 1WQLB 5IF6A 1STDA 3S5CA 4Q53A 3B7CA 3BLZA 4K1VA 3B4OA 5IG0A 1SJWA 2YFIB 2GXFA 3F8XA 3SOYA 5JPPA 3RGAA 3MG2A 3NBRA 2XRXB 5CLKA 3CNXA 3T8UA
chains in the Genus database with same CATH superfamily
6RNTA 3QRDA 5AIFA 1N5HA 4HJLB 1VQ63 2HMOB 5DREA 1TUHA 1U8CB 2F56A 1FGMA 2V1LA 3CCR3 1STFI 2WOHA 4O02B 1RN1A 3FG3A 1BNJA 3F14A 1GY6A 3GSPA 2KAAA 1FGTA 1O7PB 2CC3A 3DH2A 1S5AA 4OK0A 1Q824 3QK9A 3G0KA 3U97A 4HM8B 5D82A 2KXGA 2XGLA 3GWRA 3UL5A 3LOYA 3G4S3 3OWYA 1MOLA 1V57A 1MWUA 3HIIA 2CWUA 3L0RA 4IIAA 3WMDA 4MMZB 2ML6A 1RNTA 4HM1B 1ASKA 2JQ5A 3HZPA 3X40A 2GBXB 3AMOB 2D42A 3PCSA 4FCZA 2SBLA 5JBSA 3DGOA 5G1KA 1C7HA 1KSIA 1OACA 3PCRA 2INXA 2Y74A 3JUNA 4BL2A 3G8ZA 1K8A4 1UCKA 3BNBA 2QEX3 1BVIA 3FF0A 2O9UX 3K7CA 1YGEA 1G96A 1O7MB 1SIIA 3JUPA 1YJW3 2BO9B 3MYTA 1RJOA 3O8YA 4NHFA 1JRQA 2W56B 4O2HA 3WHOA 3WR2A 4AKZA 4TX4A 2HMLB 2K0MA 4HM0B 1AVLA 4U13A 1A90A 3MPHA 4STDA 4XM4A 1I3FA 1LOVA 1A2VA 4JRFA 3EJVA 3DGLA 1LRAA 3URPA 1G0TA 3X3YA 2M7OA 2W56A 1OUNA 1MNLA 1I0VA 2HMKB 2OWPA 1HKXA 1UUWB 2QIYA 5EQLA 1MWTA 1BNGA 4GB5A 4KT3B 3EN1B 1ZO2A 1GD3A 4J5KA 3JUOA 2E2VA 4BIRA 1EUIC 2IUKA 4L8PA 1BNSA 3F7XA 5M18A 4R9KA 3FH1A 1BANA 1S723 1O7GB 1TIJA 4FR9A 1UW1A 1WNHA 1N5PA 1Q9EA 1VZZA 1W7CA 2C4BA 3BNDA 1X1XA 1Y4KA 2P0MA 3DGYA 3K0ZA 4EV2A 8RNTA 5RNTA 1YIT3 1I70A 3FKAA 3GAXA 2MC8A 3KFQC 4LSOA 5BVBA 1FUTA 7GSPA 2FGTA 1NB5I 2E2TA 2CFDA 3KSPA 4J8TA 3G16A 4N6NB 4GSPA 3HX8A 4XDWA 1W6YA 4BTXA 1NWWA 1MGWA 3D5IA 4FCJA 3FSDA 3OX9A 1AQZA 1BSBA 1I3IA 3F8HA 1RGEA 2J8XB 4HOHA 3AGNA 4N6MA 2WGOA 3UL6A 1N8R4 3EBYA 8CHOA 3BNCA 3PYJA 1K28A 3I553 4WYKB 1NNVA 1W02A 3KSED 3LXUX 1VQQA 4AEQA 3G6E3 1B3SA 2XH9A 3OW22 1R4CA 3LT9A 4BTWA 1JBTA 4BU4A 5CF1A 3KKGA 3CPOA 3MSOA 2IYJA 1O7NB 4O8SA 1J2BA 2A15A 3F7SA 1RRLA 3PS8A 3RGRA 1UGHI 4MEIA 3ZG5A 1GSPA 2F86B 2OOVA 4WYKA 5GSPA 4LGQA 1TFOA 1RCLA 3S29A 1VQ43 1M1K4 1LNIA 4XDVA 1YGWA 2HMNB 1ZGXA 1LOXA 4H3UA 1ISKA 1US1A 3LMLA 3MKIA 3I563 2CG1A 1T3BA 3VGNA 1KQS2 2B1XB 2XF3A 1GS3A 5BXQA 3F40A 3F9SA 3CCL3 4HZBB 2Y73A 5KP1A 4ILFA 5DRVA 2L4VA 2W03A 1ROVA 2Z7AA 1UGIA 3JVCA 4K90B 2BIRA 5EEOA 1VQ93 4HM7B 5ELJA 3VSYA 1W2ZA 4HM4B 3S28A 3D3LA 3D5GA 2OTL3 1EQKA 1YVSA 4IPBA 1CH0A 3Q3FA 2PZVA 3LZAA 1JJ22 2C11A 1D6YA 2CH9A 2L1SA 2R41A 1B27A 1OPYA 3KCHA 4L8OA 4R4KA 1W5ZA 3BU4A 4R9LA 2RFRA 2LQVA 1YNVX 3BB9A 2D1WA 3HIGA 2BU4A 4G1MB 2IA7A 3EE1A 1FGQA 4HM2B 4WP5A 3SOAA 7RNTA 4LYLB 3IJEB 4KFDA 2XR8B 3WOEB 1E3VA 3K63A 1UUGB 2MF7A 4GHOA 2O3OA 1JN5B 4XBYA 1BRNL 1T2IA 1X1WA 3HK4A 2QGUA 5AYRB 4KZ1A 3UB1A 1RGFA 1VQ53 1VQL3 1RGHA 3CCM3 1Q40B 2WGQA 4CCVA 5AEUB 2BT3A 1BRKA 1BNRA 1JN5A 2UGIA 2RGQA 1GMQA 1BU4A 1NU3A 7STDA 3LTAA 1OF5A 1OHOA 2CKFB 2OOVC 5M1AA 1N9JA 1SQWA 1W6GA 3NM2A 3HOHA 2QA43 1A67A 1B2SA 1E3RA 1JKGA 1IQ8A 1LOWA 1RGCA 1ROAA 3FZWA 1Q40A 3A76A 5IENA 2YFJB 3NQZA 3RNTA 1PU4A 1T2HA 4CDLA 1YI23 3M8CA 1ULJB 4XBTA 1B2UA 4RBNA 3DXOA 3SLUA 1D6UA 3CU3A 2KRTA 1VQN3 3N9HA 3D79A 1BSEA 4EC6A 4KVHA 2CIUA 4L7KA 5HOHA 1IQYA 3BNEA 1HU9A 2RBIA 5D81A 1TRQA 6STDA 1JNQA 1OGXA 2F99A 1BRJA 1FUSA 1BUJA 5FW5A 1LVNA 1UDII 1OH0A 3CC43 3NXJA 5D83A 5IERA 2OCTA 4J9AA 1NO3A 5AIIA 1RHLA 1SPUA 3N54B 1BOXA 2XFTA 2RSXA 2HMMB 1TP6A 2UUGC 3FLJA 4KFEA 1CQSA 4LMIA 5AIHA 1MGRA 4JF8A 1VQ73 1QJGA 4HM5B 3FCSB 1RRHA 1I2GA 2CG0A 1BSAA 3Q1CA 1RMSA 3JUMA 3Q2PA 2IMJA 5LC7A 4XBXA 2FXTA 1IQXA 4HVNA 5I97A 3FGYA 3V99A 1TJDA 2WO0A 3EX9A 4AKYA 1IV9A 2CFWA 2R4IA 4OUQA 3UNLA 3S67A 3STDA 1PY3A 1LNHA 1Z1SA 4EW5A 2XSHB 1RGLA 2KF3A 1MWRA 4EV5A 2OTJ3 1FUWA 3DGNA 1JB2A 4HM6B 1DE3A 1UCLA 1AV4A 1UCIA 3PGBA 3CNMA 1RTUA 3MG1A 4K61A 2I9WA 2B24B 2Q07A 5HGRA 1BIRA 2LYXA 5AYSC 4XB5A 3CD63 5CXOA 1Q42A 3U1WA 1EKMA 3HI7A 6GSPA 1RN4A 4N6OB 1JBSA 1GYBA 3OWUA 1RGKA 3V92A 1PYLA 1CYUA 1LQMB 1B21A 3FG4A 3FG1A 3WA3A 4FCMA 3LTDA 4HM3B 3AHWA 3DGMA 5M19A 2Z77A 3GZRA 1X1UA 3IPTA 3ECFA 1HZ1A 1SIHA 3CCS3 3KE7A 2YX9A 2PNCA 2E2UA 1IT7A 4PEJA 3NUVA 1Q864 4EBGA 1JB5A 2P09A 2H0IA 2BMRB 2Z76A 5TGNA 1L5GB 1EG9B 1K734 5IG4A 3ZFZA 1B2MA 1UCJA 1FGOA 1RLSA 2AAEA 1B2ZA 2CW9A 5G2GA 3NM7A 3K9MC 4HBRA 5STDA 1WMNA 3DUKA 1RCKA 3GZBA 4X2OA 2XSOB 1QVG2 1OCVA 1JZOA 3NV0B 1IU7A 1OGZA 4RZMA 3UJMA 2K54A 5IG3A 4MJDA 2GSPA 3CXC2 1JBRA 4HZ9B 5AEWB 2F5WA 1BAOA 1BRIA 1IVXA 1DMNA 3D9RA 4FMBA 3OWSA 2IUJA 3CCU3 1TTOA 5AIGA 1UI7A 2KCDA 4MMYB 3MHEA 4HKVB 2CX0A 1OHPA 5ELUA 3SYUA 3NV0A 1GD4A 4LZIA 3PXMA 2BMOB 4KFFA 1LOYA 3EF8A 2GU1A 1DETA 3NQYA 1PFPA 1W00A 2W6JH 1YVBI 3IMAB 1TRPA 1VQ83 1GY7A 1JV2B 1NB3I 3H3HA 3ROBA 3NHXA 4N6V0 1HYFA 1WMPA 1OF5B 3CCV3 1YIJ3 2UX0A 1Q7Y4 1C54A 3SEDA 1A2KA 3DM8A 1LQGC 3EN8A 1JKGB 1BSCA 1E97A 1BGSA 2STDA 5IEPA 1N8QA 3SX1A 4MMXB 1FW7A 4I5QA 2ZA4A 1K9M4 1EA2A 3X41A 1B2XA 3JUQA 1YJ93 2CHCA 1BRGA 1K41A 3LTBA 4EXRA 1OHSA 3B8LA 1T5YA 2ZDJA 3I0YA 4RNZA 4RNYA 3SVAA 2BNGA 1M904 1BRHA 3KZTA 1GOUA 5KP3A 5JPUA 3GZYB 1IVWA 3ER7A 1GMRA 2BMQB 3PZWA 1UUVB 4R1KA 1WMOA 1V74A 2W9QA 1JB4A 3K5TA 1O7HB 2OQEA 4BL3A 3ZG0A 2XFSA 3E99A 2RNTA 4I4KA 3NBBA 2GBWB 3LYGA 4N6TA 3DZLA 2CX1A 3CMA3 2F98A 4N6UA 3B4PA 2C10A 1FGRA 3DY5A 3J7Yd 1DMMA 1ULIB 3GRDA 4FMCA 1QMAA 4HAAA 1B20A 1QAFA 1CEWI 3DMCA 3WODG 3WOFB 2RCDA 2K3DA 4LEHA 4BTYA 2BHMA 1VQP3 3AGOA 2XEPA 2KF5A 3T8NA 1IVVA 1W01A 1WTHA 5IG5A 1I8VA 1Q7HA 3NBJA 1U5OA 1BUQA 4FMAA 3AMOA 3EHCA 1M1XB 1JZDA 2W9PA 5EVHA 1Q814 4EYCA 1IDPA 1I2FA 3X3XA 2GEXA 5CK6A 1O7WB 2YFLB 5AI1A 2SARA 1X1YA 5IW9A 1BNIA 1DVDA 1KD14 2KF4A 3EQQB 4CJNA 3KIIA 2H0HA 2CWVA 2GEYA 3KN4A 3OXAA 3LH4A 3SXXA 1CYVA 3ALAA 3MG3A 4WWUC 2HOHA 1NJI4 4CPKA 3X3ZA 3TDGA 2P0XA 1G02A 1W2B2 1GOYA 3X42A 4WFOA 5IEOA 1IVUA 1AR0A 1DYUA 1ZS7A 5BU4A 1F8NA 4HYZA 3H51A 4DKIA 1VQM3 2CWTA 1AVKA 3OV4A 3GZXB 1R4YA 5FGOA 2F4YA 1YHQ3 2XGNA 1DVCA 2GU3A 3VF1A 1NDOB 2ML5A 2ZL8A 4IT7A 4N3VA 3NX0A 1RNBA 2WOFA 1BNEA 5LC6A 4K1UA 3FF2A 4ZM8A 4GL6A 1QVF2 3LT8A 1QALA 2H0GA 3V98A 1BNFA 3CME3 2F5MA 1N9EA 1W6CA 2KF6A 4X2HA 3EC9A 1A2PA 1I0XA 2CFKA 1KC84 2OQEC 2HMJB 4NPBA 4WHAA 5CF2A 1AY7A 3WDGB 4ORLA 3CCQ3 1I2EA 1DMQA 4OVMA 3Q90A 4J5GA 5A0OB 3EBTA 1ZX2A 5KP4A 4RNTA 1GY5A 2W2CA 3N8BA 1MWSA 1WQLB 3MWZA 1IK3A 1KWIA 1SARA 3RDEA 1GMPA 5IF6A 1STDA 3S5CA 4N6LA 1EEJA 3D4AA 4Q53A 4QWTA 3CPW2 3BIRA 1FA3A 3WA2X 1LXEA 1IV7A 3AHSA 2FNQA 3B7CA 2AADA 1GOVA 2IY2A 3BLZA 1RGGA 1RN7A 2W0QA 3A5EA 3EB8A 1FYSA 4R80A 4K1VA 1TU5A 1VQO3 3B4OA 3LTCA 5G1LA 5IG0A 1SJWA 1M9GA 2GXFA 2YFIB 1BSDA 1RDSA 1UI8A 3F8XA 2Z6BA 3CC23 4FMDA 1TFKA 3CCJ3 1YJN3 1FZUA 1VQK3 1IT8A 2W04A 3SOYA 5JPPA 3RGAA 2CFGA 2P05A 3MG2A 3NBRA 3S27A 1D6ZA 2ZHXB 9RNTA 3T0UA 1BRSA 4H61A 2JDIH 1RKYA 1V58A 4O3VA 1W4NA 2XRXB 1QAKA 2CFLA 5CLKA 2CK3H 3CNXA 1IYYA 1RSNA 1RGAA 3CCE3 2P38A 3T8UA 5BIRA 3G713 4NREA 3CC73
chains in the Genus database with same CATH topology
1VQ63 3QRDA 5AIFA 1N5HA 4HJLB 2HMOB 5DREA 1TUHA 1U8CB 1FGMA 2V1LA 3CCR3 1STFI 2WOHA 4O02B 3FG3A 3F14A 1GY6A 1FGTA 1O7PB 2CC3A 1S5AA 4OK0A 1Q824 3QK9A 3G0KA 3U97A 4HM8B 5D82A 2KXGA 2XGLA 3GWRA 3UL5A 3LOYA 3G4S3 3OWYA 1MOLA 3HIIA 2CWUA 3L0RA 4IIAA 3WMDA 4MMZB 2ML6A 4HM1B 1ASKA 2JQ5A 3HZPA 3X40A 2GBXB 3AMOB 2D42A 3PCSA 4FCZA 2SBLA 5JBSA 3DGOA 1C7HA 1KSIA 1OACA 3PCRA 2INXA 2Y74A 3JUNA 1K8A4 3G8ZA 2QEX3 3BNBA 3FF0A 2O9UX 3K7CA 1YGEA 1G96A 1O7MB 1SIIA 3JUPA 1YJW3 2BO9B 3MYTA 1RJOA 3O8YA 4NHFA 1JRQA 2W56B 4O2HA 4AKZA 4TX4A 2HMLB 2K0MA 4HM0B 1AVLA 4U13A 1A90A 3MPHA 4STDA 4XM4A 1A2VA 4JRFA 3EJVA 3DGLA 3X3YA 2M7OA 2W56A 1OUNA 1MNLA 2HMKB 2OWPA 1HKXA 1UUWB 2QIYA 5EQLA 4GB5A 3EN1B 1ZO2A 1GD3A 3JUOA 2E2VA 2IUKA 4L8PA 3F7XA 4R9KA 3FH1A 1S723 1O7GB 1TIJA 4FR9A 1UW1A 1WNHA 1N5PA 1W7CA 1VZZA 3BNDA 1YIT3 1Y4KA 2P0MA 3K0ZA 4EV2A 3GAXA 3FKAA 2MC8A 3KFQC 4LSOA 5BVBA 2FGTA 1NB5I 2E2TA 2CFDA 3KSPA 4J8TA 3G16A 4N6NB 3HX8A 4XDWA 1W6YA 4BTXA 1NWWA 4FCJA 3FSDA 3OX9A 3F8HA 3UL6A 1N8R4 4N6MA 2WGOA 3EBYA 8CHOA 3BNCA 3PYJA 1K28A 3I553 4WYKB 1W02A 3KSED 3LXUX 4AEQA 3G6E3 2XH9A 3OW22 1R4CA 3LT9A 4BTWA 5CF1A 3KKGA 3CPOA 3MSOA 1O7NB 4O8SA 1J2BA 2A15A 3F7SA 1RRLA 3PS8A 3RGRA 4MEIA 2F86B 2OOVA 4WYKA 4LGQA 1TFOA 3S29A 1VQ43 1M1K4 4XDVA 2HMNB 1LOXA 4H3UA 1ISKA 1US1A 3LMLA 3MKIA 3I563 2CG1A 3VGNA 1KQS2 2B1XB 2XF3A 1GS3A 5BXQA 3F40A 3F9SA 3CCL3 4HZBB 2Y73A 5KP1A 5DRVA 2L4VA 2W03A 1ROVA 2Z7AA 3JVCA 4K90B 5EEOA 1VQ93 4HM7B 5ELJA 3VSYA 1W2ZA 4HM4B 3S28A 3D3LA 1EQKA 4IPBA 2PZVA 3LZAA 1JJ22 2C11A 1D6YA 2CH9A 1OPYA 4L8OA 4R4KA 1W5ZA 4R9LA 2RFRA 2LQVA 3BB9A 2D1WA 3HIGA 4G1MB 2IA7A 3EE1A 1FGQA 4HM2B 4WP5A 3SOAA 3IJEB 4KFDA 2XR8B 3WOEB 1E3VA 3K63A 2MF7A 2O3OA 1JN5B 4XBYA 3HK4A 2QGUA 5AYRB 4KZ1A 3UB1A 1VQ53 1VQL3 3CCM3 1Q40B 2WGQA 4CCVA 5AEUB 2BT3A 1JN5A 2RGQA 1NU3A 7STDA 3LTAA 1OF5A 1OHOA 2CKFB 2OOVC 1N9JA 1SQWA 1W6GA 3NM2A 2QA43 1A67A 1E3RA 1JKGA 1IQ8A 1ROAA 3FZWA 1Q40A 3A76A 5IENA 2YFJB 3NQZA 1PU4A 4CDLA 1YI23 3M8CA 1ULJB 4XBTA 4RBNA 3DXOA 3SLUA 1D6UA 3CU3A 2KRTA 1VQN3 3N9HA 4EC6A 4KVHA 2CIUA 4L7KA 1IQYA 3BNEA 1HU9A 5D81A 6STDA 1JNQA 1OGXA 2F99A 5FW5A 1LVNA 1OH0A 3CC43 3NXJA 5D83A 5IERA 2OCTA 4J9AA 1NO3A 5AIIA 1SPUA 3N54B 3FLJA 2XFTA 2RSXA 2HMMB 1TP6A 4KFEA 1CQSA 4LMIA 5AIHA 4JF8A 1VQ73 1QJGA 4HM5B 3FCSB 1RRHA 2CG0A 3Q1CA 3JUMA 3Q2PA 2IMJA 5LC7A 4XBXA 2FXTA 1IQXA 4HVNA 5I97A 3FGYA 3V99A 2WO0A 3EX9A 4AKYA 2CFWA 1IV9A 2R4IA 4OUQA 3UNLA 3S67A 3STDA 1LNHA 1Z1SA 2XSHB 2OTJ3 4EV5A 1FUWA 3DGNA 1JB2A 4HM6B 1AV4A 3PGBA 3CNMA 3MG1A 4K61A 2I9WA 2B24B 2Q07A 5HGRA 2LYXA 5AYSC 4XB5A 3CD63 5CXOA 1Q42A 3U1WA 1EKMA 3HI7A 4N6OB 1GYBA 3OWUA 3V92A 1CYUA 3FG4A 3FG1A 3WA3A 4FCMA 3LTDA 4HM3B 3DGMA 2Z77A 3GZRA 3IPTA 3ECFA 1SIHA 3CCS3 3KE7A 2YX9A 2PNCA 2E2UA 1IT7A 4PEJA 3NUVA 1Q864 4EBGA 1JB5A 2P09A 2BMRB 2Z76A 5TGNA 1L5GB 1EG9B 1K734 5IG4A 1FGOA 2CW9A 5G2GA 3NM7A 3K9MC 4HBRA 5STDA 1WMNA 3DUKA 3GZBA 4X2OA 2XSOB 1QVG2 1OCVA 3NV0B 1IU7A 1OGZA 4RZMA 3UJMA 2K54A 5IG3A 4MJDA 3CXC2 4HZ9B 5AEWB 1IVXA 4FMBA 1DMNA 3D9RA 3OWSA 2IUJA 3CCU3 5AIGA 1UI7A 2KCDA 4MMYB 3MHEA 4HKVB 1OHPA 5ELUA 3NV0A 1GD4A 4LZIA 3PXMA 2BMOB 4KFFA 3EF8A 2GU1A 3NQYA 1PFPA 1W00A 2W6JH 1YVBI 3IMAB 1VQ83 1GY7A 1JV2B 1NB3I 3H3HA 3ROBA 3NHXA 4N6V0 3CCV3 1WMPA 1OF5B 1Q7Y4 1YIJ3 2UX0A 3SEDA 1A2KA 3DM8A 3EN8A 1JKGB 1E97A 2STDA 5IEPA 1N8QA 3SX1A 4MMXB 1K9M4 1EA2A 3X41A 3JUQA 1YJ93 2CHCA 1K41A 3LTBA 4EXRA 1OHSA 3B8LA 1T5YA 2ZDJA 3I0YA 4RNZA 4RNYA 3SVAA 2BNGA 1M904 3KZTA 5KP3A 5JPUA 3GZYB 1IVWA 3ER7A 2BMQB 3PZWA 1UUVB 4R1KA 1WMOA 1V74A 2W9QA 1JB4A 3K5TA 1O7HB 2OQEA 2XFSA 3E99A 4I4KA 4N6TA 3NBBA 2GBWB 3LYGA 3DZLA 3CMA3 2F98A 4N6UA 3B4PA 2C10A 1FGRA 3DY5A 3J7Yd 1DMMA 1ULIB 3GRDA 4FMCA 1QMAA 3WODG 1QAFA 1CEWI 3DMCA 3WOFB 2RCDA 4LEHA 4BTYA 2BHMA 1VQP3 2XEPA 3T8NA 1IVVA 1W01A 1WTHA 5IG5A 3NBJA 1U5OA 1BUQA 4FMAA 3AMOA 3EHCA 1M1XB 2W9PA 5EVHA 1Q814 4EYCA 1IDPA 3X3XA 2GEXA 5CK6A 1O7WB 2YFLB 5AI1A 5IW9A 1DVDA 1KD14 3EQQB 3KIIA 2CWVA 2GEYA 3KN4A 3OXAA 3LH4A 3SXXA 1CYVA 3ALAA 3MG3A 4WWUC 1NJI4 3X3ZA 3TDGA 2P0XA 1W2B2 3X42A 4WFOA 5IEOA 1IVUA 1AR0A 1DYUA 1F8NA 4HYZA 3H51A 1VQM3 2CWTA 1AVKA 3OV4A 3GZXB 5FGOA 1YHQ3 2XGNA 1DVCA 2GU3A 3VF1A 1NDOB 2ML5A 2ZL8A 4IT7A 4N3VA 3NX0A 2OTL3 2WOFA 4ZM8A 5LC6A 4K1UA 3FF2A 1QVF2 4GL6A 3LT8A 1QALA 3V98A 3CME3 1N9EA 1W6CA 4X2HA 3EC9A 2CFKA 1KC84 2OQEC 2HMJB 4WHAA 5CF2A 3CCQ3 3WDGB 4ORLA 1DMQA 4OVMA 3Q90A 5A0OB 3EBTA 1ZX2A 5KP4A 1GY5A 2W2CA 3N8BA 1WQLB 3MWZA 1IK3A 1KWIA 3RDEA 5IF6A 1STDA 3S5CA 4N6LA 4Q53A 4QWTA 3CPW2 1FA3A 3WA2X 1LXEA 1IV7A 2FNQA 3B7CA 3BLZA 1RN7A 2W0QA 3EB8A 4R80A 4K1VA 1TU5A 1VQO3 3B4OA 3LTCA 5IG0A 1SJWA 1M9GA 2GXFA 2YFIB 1UI8A 3F8XA 3CC23 3CCJ3 2Z6BA 4FMDA 1TFKA 1YJN3 1VQK3 1IT8A 2W04A 3SOYA 5JPPA 3RGAA 2CFGA 2P05A 3MG2A 3NBRA 3S27A 1D6ZA 3T0UA 4H61A 2JDIH 1RKYA 4O3VA 1W4NA 2XRXB 1QAKA 2CFLA 5CLKA 2CK3H 3CNXA 3CCE3 2P38A 3T8UA 3G713 4NREA 3CC73
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIF A;  4HJL B;  2HMO B;  5DRE A;  1TUH A;  3F14 A;  1GY6 A;  1O7P B;  1S5A A;  3G0K A;  4HM8 B;  5D82 A;  3GWR A;  3OWY A;  4IIA A;  3WMD A;  4HM1 B;  1ASK A;  2JQ5 A;  3HZP A;  2GBX B;  1C7H A;  2INX A;  3JUN A;  3G8Z A;  3FF0 A;  3K7C A;  1O7M B;  3JUP A;  3MYT A;  2HML B;  4HM0 B;  4U13 A;  4STD A;  4XM4 A;  3EJV A;  1OUN A;  2HMK B;  2OWP A;  1HKX A;  1UUW B;  2QIY A;  4GB5 A;  3EN1 B;  1ZO2 A;  3JUO A;  4L8P A;  3F7X A;  4R9K A;  3FH1 A;  1O7G B;  1VZZ A;  3K0Z A;  3FKA A;  5BVB A;  3KSP A;  4J8T A;  3G16 A;  3HX8 A;  4XDW A;  1W6Y A;  1NWW A;  4FCJ A;  3FSD A;  3OX9 A;  3F8H A;  3EBY A;  8CHO A;  4WYK B;  1W02 A;  5CF1 A;  3KKG A;  3CPO A;  3MSO A;  1O7N B;  2A15 A;  3F7S A;  3RGR A;  2F86 B;  4WYK A;  4LGQ A;  4XDV A;  2HMN B;  4H3U A;  1ISK A;  3MKI A;  3VGN A;  2B1X B;  1GS3 A;  5BXQ A;  3F40 A;  3F9S A;  4HZB B;  5KP1 A;  5DRV A;  2Z7A A;  4HM7 B;  3VSY A;  4HM4 B;  2PZV A;  3LZA A;  1OPY A;  4L8O A;  4R9L A;  2RFR A;  3BB9 A;  4HM2 B;  4WP5 A;  3SOA A;  2XR8 B;  1E3V A;  1JN5 B;  4XBY A;  3HK4 A;  2QGU A;  1Q40 B;  5AEU B;  1JN5 A;  2RGQ A;  1NU3 A;  7STD A;  1OF5 A;  1OHO A;  2CKF B;  3NM2 A;  1E3R A;  1JKG A;  3FZW A;  1Q40 A;  3A76 A;  5IEN A;  2YFJ B;  4CDL A;  3M8C A;  1ULJ B;  4XBT A;  3DXO A;  3CU3 A;  4KVH A;  4L7K A;  5D81 A;  6STD A;  1OGX A;  2F99 A;  5FW5 A;  1OH0 A;  3NXJ A;  5D83 A;  5IER A;  4J9A A;  5AII A;  3FLJ A;  2HMM B;  1TP6 A;  1CQS A;  4LMI A;  5AIH A;  1QJG A;  4HM5 B;  3JUM A;  2IMJ A;  4XBX A;  4HVN A;  3FGY A;  3EX9 A;  2R4I A;  4OUQ A;  3UNL A;  3STD A;  1Z1S A;  2XSH B;  1JB2 A;  4HM6 B;  3CNM A;  3MG1 A;  2I9W A;  2B24 B;  5HGR A;  4XB5 A;  5CXO A;  1Q42 A;  1GYB A;  3OWU A;  4FCM A;  4HM3 B;  2Z77 A;  3GZR A;  3IPT A;  3ECF A;  3KE7 A;  4PEJ A;  3NUV A;  1JB5 A;  2BMR B;  2Z76 A;  5TGN A;  1EG9 B;  5IG4 A;  5G2G A;  5STD A;  3DUK A;  3GZB A;  4X2O A;  2XSO B;  1OCV A;  3NV0 B;  1OGZ A;  4RZM A;  3UJM A;  2K54 A;  5IG3 A;  4MJD A;  4HZ9 B;  5AEW B;  1DMN A;  3D9R A;  3OWS A;  5AIG A;  3MHE A;  4HKV B;  1OHP A;  3NV0 A;  2BMO B;  3EF8 A;  1W00 A;  1GY7 A;  3H3H A;  3ROB A;  3NHX A;  1OF5 B;  2UX0 A;  3SED A;  1A2K A;  3DM8 A;  3EN8 A;  1JKG B;  1E97 A;  2STD A;  5IEP A;  1EA2 A;  3JUQ A;  2CHC A;  1K41 A;  1OHS A;  3B8L A;  3I0Y A;  2BNG A;  3KZT A;  5KP3 A;  5JPU A;  3GZY B;  3ER7 A;  2BMQ B;  1UUV B;  4R1K A;  1JB4 A;  1O7H B;  3E99 A;  4I4K A;  2GBW B;  3LYG A;  3DZL A;  2F98 A;  3B4P A;  1DMM A;  1ULI B;  3GRD A;  1QMA A;  3DMC A;  2RCD A;  4LEH A;  3T8N A;  1W01 A;  5IG5 A;  1U5O A;  1BUQ A;  3EHC A;  5EVH A;  1IDP A;  2GEX A;  5CK6 A;  1O7W B;  2YFL B;  5AI1 A;  3EQQ B;  2GEY A;  3OXA A;  3MG3 A;  4WWU C;  5IEO A;  1AR0 A;  3H51 A;  3OV4 A;  3GZX B;  1NDO B;  4N3V A;  4K1U A;  3FF2 A;  4X2H A;  3EC9 A;  2HMJ B;  5CF2 A;  4ORL A;  1DMQ A;  4OVM A;  3Q90 A;  3EBT A;  1ZX2 A;  5KP4 A;  1GY5 A;  2W2C A;  1WQL B;  5IF6 A;  1STD A;  3S5C A;  4Q53 A;  3B7C A;  3BLZ A;  4K1V A;  3B4O A;  5IG0 A;  1SJW A;  2YFI B;  2GXF A;  3F8X A;  3SOY A;  5JPP A;  3RGA A;  3MG2 A;  3NBR A;  2XRX B;  5CLK A;  3CNX A;  3T8U A; 
#chains in the Genus database with same CATH topology
 6RNT A;  3QRD A;  5AIF A;  1N5H A;  4HJL B;  1VQ6 3;  2HMO B;  5DRE A;  1TUH A;  1U8C B;  2F56 A;  1FGM A;  2V1L A;  3CCR 3;  1STF I;  2WOH A;  4O02 B;  1RN1 A;  3FG3 A;  1BNJ A;  3F14 A;  1GY6 A;  3GSP A;  2KAA A;  1FGT A;  1O7P B;  2CC3 A;  3DH2 A;  1S5A A;  4OK0 A;  1Q82 4;  3QK9 A;  3G0K A;  3U97 A;  4HM8 B;  5D82 A;  2KXG A;  2XGL A;  3GWR A;  3UL5 A;  3LOY A;  3G4S 3;  3OWY A;  1MOL A;  1V57 A;  1MWU A;  3HII A;  2CWU A;  3L0R A;  4IIA A;  3WMD A;  4MMZ B;  2ML6 A;  1RNT A;  4HM1 B;  1ASK A;  2JQ5 A;  3HZP A;  3X40 A;  2GBX B;  3AMO B;  2D42 A;  3PCS A;  4FCZ A;  2SBL A;  5JBS A;  3DGO A;  5G1K A;  1C7H A;  1KSI A;  1OAC A;  3PCR A;  2INX A;  2Y74 A;  3JUN A;  4BL2 A;  3G8Z A;  1K8A 4;  1UCK A;  3BNB A;  2QEX 3;  1BVI A;  3FF0 A;  2O9U X;  3K7C A;  1YGE A;  1G96 A;  1O7M B;  1SII A;  3JUP A;  1YJW 3;  2BO9 B;  3MYT A;  1RJO A;  3O8Y A;  4NHF A;  1JRQ A;  2W56 B;  4O2H A;  3WHO A;  3WR2 A;  4AKZ A;  4TX4 A;  2HML B;  2K0M A;  4HM0 B;  1AVL A;  4U13 A;  1A90 A;  3MPH A;  4STD A;  4XM4 A;  1I3F A;  1LOV A;  1A2V A;  4JRF A;  3EJV A;  3DGL A;  1LRA A;  3URP A;  1G0T A;  3X3Y A;  2M7O A;  2W56 A;  1OUN A;  1MNL A;  1I0V A;  2HMK B;  2OWP A;  1HKX A;  1UUW B;  2QIY A;  5EQL A;  1MWT A;  1BNG A;  4GB5 A;  4KT3 B;  3EN1 B;  1ZO2 A;  1GD3 A;  4J5K A;  3JUO A;  2E2V A;  4BIR A;  1EUI C;  2IUK A;  4L8P A;  1BNS A;  3F7X A;  5M18 A;  4R9K A;  3FH1 A;  1BAN A;  1S72 3;  1O7G B;  1TIJ A;  4FR9 A;  1UW1 A;  1WNH A;  1N5P A;  1Q9E A;  1VZZ A;  1W7C A;  2C4B A;  3BND A;  1X1X A;  1Y4K A;  2P0M A;  3DGY A;  3K0Z A;  4EV2 A;  8RNT A;  5RNT A;  1YIT 3;  1I70 A;  3FKA A;  3GAX A;  2MC8 A;  3KFQ C;  4LSO A;  5BVB A;  1FUT A;  7GSP A;  2FGT A;  1NB5 I;  2E2T A;  2CFD A;  3KSP A;  4J8T A;  3G16 A;  4N6N B;  4GSP A;  3HX8 A;  4XDW A;  1W6Y A;  4BTX A;  1NWW A;  1MGW A;  3D5I A;  4FCJ A;  3FSD A;  3OX9 A;  1AQZ A;  1BSB A;  1I3I A;  3F8H A;  1RGE A;  2J8X B;  4HOH A;  3AGN A;  4N6M A;  2WGO A;  3UL6 A;  1N8R 4;  3EBY A;  8CHO A;  3BNC A;  3PYJ A;  1K28 A;  3I55 3;  4WYK B;  1NNV A;  1W02 A;  3KSE D;  3LXU X;  1VQQ A;  4AEQ A;  3G6E 3;  1B3S A;  2XH9 A;  3OW2 2;  1R4C A;  3LT9 A;  4BTW A;  1JBT A;  4BU4 A;  5CF1 A;  3KKG A;  3CPO A;  3MSO A;  2IYJ A;  1O7N B;  4O8S A;  1J2B A;  2A15 A;  3F7S A;  1RRL A;  3PS8 A;  3RGR A;  1UGH I;  4MEI A;  3ZG5 A;  1GSP A;  2F86 B;  2OOV A;  4WYK A;  5GSP A;  4LGQ A;  1TFO A;  1RCL A;  3S29 A;  1VQ4 3;  1M1K 4;  1LNI A;  4XDV A;  1YGW A;  2HMN B;  1ZGX A;  1LOX A;  4H3U A;  1ISK A;  1US1 A;  3LML A;  3MKI A;  3I56 3;  2CG1 A;  1T3B A;  3VGN A;  1KQS 2;  2B1X B;  2XF3 A;  1GS3 A;  5BXQ A;  3F40 A;  3F9S A;  3CCL 3;  4HZB B;  2Y73 A;  5KP1 A;  4ILF A;  5DRV A;  2L4V A;  2W03 A;  1ROV A;  2Z7A A;  1UGI A;  3JVC A;  4K90 B;  2BIR A;  5EEO A;  1VQ9 3;  4HM7 B;  5ELJ A;  3VSY A;  1W2Z A;  4HM4 B;  3S28 A;  3D3L A;  3D5G A;  2OTL 3;  1EQK A;  1YVS A;  4IPB A;  1CH0 A;  3Q3F A;  2PZV A;  3LZA A;  1JJ2 2;  2C11 A;  1D6Y A;  2CH9 A;  2L1S A;  2R41 A;  1B27 A;  1OPY A;  3KCH A;  4L8O A;  4R4K A;  1W5Z A;  3BU4 A;  4R9L A;  2RFR A;  2LQV A;  1YNV X;  3BB9 A;  2D1W A;  3HIG A;  2BU4 A;  4G1M B;  2IA7 A;  3EE1 A;  1FGQ A;  4HM2 B;  4WP5 A;  3SOA A;  7RNT A;  4LYL B;  3IJE B;  4KFD A;  2XR8 B;  3WOE B;  1E3V A;  3K63 A;  1UUG B;  2MF7 A;  4GHO A;  2O3O A;  1JN5 B;  4XBY A;  1BRN L;  1T2I A;  1X1W A;  3HK4 A;  2QGU A;  5AYR B;  4KZ1 A;  3UB1 A;  1RGF A;  1VQ5 3;  1VQL 3;  1RGH A;  3CCM 3;  1Q40 B;  2WGQ A;  4CCV A;  5AEU B;  2BT3 A;  1BRK A;  1BNR A;  1JN5 A;  2UGI A;  2RGQ A;  1GMQ A;  1BU4 A;  1NU3 A;  7STD A;  3LTA A;  1OF5 A;  1OHO A;  2CKF B;  2OOV C;  5M1A A;  1N9J A;  1SQW A;  1W6G A;  3NM2 A;  3HOH A;  2QA4 3;  1A67 A;  1B2S A;  1E3R A;  1JKG A;  1IQ8 A;  1LOW A;  1RGC A;  1ROA A;  3FZW A;  1Q40 A;  3A76 A;  5IEN A;  2YFJ B;  3NQZ A;  3RNT A;  1PU4 A;  1T2H A;  4CDL A;  1YI2 3;  3M8C A;  1ULJ B;  4XBT A;  1B2U A;  4RBN A;  3DXO A;  3SLU A;  1D6U A;  3CU3 A;  2KRT A;  1VQN 3;  3N9H A;  3D79 A;  1BSE A;  4EC6 A;  4KVH A;  2CIU A;  4L7K A;  5HOH A;  1IQY A;  3BNE A;  1HU9 A;  2RBI A;  5D81 A;  1TRQ A;  6STD A;  1JNQ A;  1OGX A;  2F99 A;  1BRJ A;  1FUS A;  1BUJ A;  5FW5 A;  1LVN A;  1UDI I;  1OH0 A;  3CC4 3;  3NXJ A;  5D83 A;  5IER A;  2OCT A;  4J9A A;  1NO3 A;  5AII A;  1RHL A;  1SPU A;  3N54 B;  1BOX A;  2XFT A;  2RSX A;  2HMM B;  1TP6 A;  2UUG C;  3FLJ A;  4KFE A;  1CQS A;  4LMI A;  5AIH A;  1MGR A;  4JF8 A;  1VQ7 3;  1QJG A;  4HM5 B;  3FCS B;  1RRH A;  1I2G A;  2CG0 A;  1BSA A;  3Q1C A;  1RMS A;  3JUM A;  3Q2P A;  2IMJ A;  5LC7 A;  4XBX A;  2FXT A;  1IQX A;  4HVN A;  5I97 A;  3FGY A;  3V99 A;  1TJD A;  2WO0 A;  3EX9 A;  4AKY A;  1IV9 A;  2CFW A;  2R4I A;  4OUQ A;  3UNL A;  3S67 A;  3STD A;  1PY3 A;  1LNH A;  1Z1S A;  4EW5 A;  2XSH B;  1RGL A;  2KF3 A;  1MWR A;  4EV5 A;  2OTJ 3;  1FUW A;  3DGN A;  1JB2 A;  4HM6 B;  1DE3 A;  1UCL A;  1AV4 A;  1UCI A;  3PGB A;  3CNM A;  1RTU A;  3MG1 A;  4K61 A;  2I9W A;  2B24 B;  2Q07 A;  5HGR A;  1BIR A;  2LYX A;  5AYS C;  4XB5 A;  3CD6 3;  5CXO A;  1Q42 A;  3U1W A;  1EKM A;  3HI7 A;  6GSP A;  1RN4 A;  4N6O B;  1JBS A;  1GYB A;  3OWU A;  1RGK A;  3V92 A;  1PYL A;  1CYU A;  1LQM B;  1B21 A;  3FG4 A;  3FG1 A;  3WA3 A;  4FCM A;  3LTD A;  4HM3 B;  3AHW A;  3DGM A;  5M19 A;  2Z77 A;  3GZR A;  1X1U A;  3IPT A;  3ECF A;  1HZ1 A;  1SIH A;  3CCS 3;  3KE7 A;  2YX9 A;  2PNC A;  2E2U A;  1IT7 A;  4PEJ A;  3NUV A;  1Q86 4;  4EBG A;  1JB5 A;  2P09 A;  2H0I A;  2BMR B;  2Z76 A;  5TGN A;  1L5G B;  1EG9 B;  1K73 4;  5IG4 A;  3ZFZ A;  1B2M A;  1UCJ A;  1FGO A;  1RLS A;  2AAE A;  1B2Z A;  2CW9 A;  5G2G A;  3NM7 A;  3K9M C;  4HBR A;  5STD A;  1WMN A;  3DUK A;  1RCK A;  3GZB A;  4X2O A;  2XSO B;  1QVG 2;  1OCV A;  1JZO A;  3NV0 B;  1IU7 A;  1OGZ A;  4RZM A;  3UJM A;  2K54 A;  5IG3 A;  4MJD A;  2GSP A;  3CXC 2;  1JBR A;  4HZ9 B;  5AEW B;  2F5W A;  1BAO A;  1BRI A;  1IVX A;  1DMN A;  3D9R A;  4FMB A;  3OWS A;  2IUJ A;  3CCU 3;  1TTO A;  5AIG A;  1UI7 A;  2KCD A;  4MMY B;  3MHE A;  4HKV B;  2CX0 A;  1OHP A;  5ELU A;  3SYU A;  3NV0 A;  1GD4 A;  4LZI A;  3PXM A;  2BMO B;  4KFF A;  1LOY A;  3EF8 A;  2GU1 A;  1DET A;  3NQY A;  1PFP A;  1W00 A;  2W6J H;  1YVB I;  3IMA B;  1TRP A;  1VQ8 3;  1GY7 A;  1JV2 B;  1NB3 I;  3H3H A;  3ROB A;  3NHX A;  4N6V 0;  1HYF A;  1WMP A;  1OF5 B;  3CCV 3;  1YIJ 3;  2UX0 A;  1Q7Y 4;  1C54 A;  3SED A;  1A2K A;  3DM8 A;  1LQG C;  3EN8 A;  1JKG B;  1BSC A;  1E97 A;  1BGS A;  2STD A;  5IEP A;  1N8Q A;  3SX1 A;  4MMX B;  1FW7 A;  4I5Q A;  2ZA4 A;  1K9M 4;  1EA2 A;  3X41 A;  1B2X A;  3JUQ A;  1YJ9 3;  2CHC A;  1BRG A;  1K41 A;  3LTB A;  4EXR A;  1OHS A;  3B8L A;  1T5Y A;  2ZDJ A;  3I0Y A;  4RNZ A;  4RNY A;  3SVA A;  2BNG A;  1M90 4;  1BRH A;  3KZT A;  1GOU A;  5KP3 A;  5JPU A;  3GZY B;  1IVW A;  3ER7 A;  1GMR A;  2BMQ B;  3PZW A;  1UUV B;  4R1K A;  1WMO A;  1V74 A;  2W9Q A;  1JB4 A;  3K5T A;  1O7H B;  2OQE A;  4BL3 A;  3ZG0 A;  2XFS A;  3E99 A;  2RNT A;  4I4K A;  3NBB A;  2GBW B;  3LYG A;  4N6T A;  3DZL A;  2CX1 A;  3CMA 3;  2F98 A;  4N6U A;  3B4P A;  2C10 A;  1FGR A;  3DY5 A;  3J7Y d;  1DMM A;  1ULI B;  3GRD A;  4FMC A;  1QMA A;  4HAA A;  1B20 A;  1QAF A;  1CEW I;  3DMC A;  3WOD G;  3WOF B;  2RCD A;  2K3D A;  4LEH A;  4BTY A;  2BHM A;  1VQP 3;  3AGO A;  2XEP A;  2KF5 A;  3T8N A;  1IVV A;  1W01 A;  1WTH A;  5IG5 A;  1I8V A;  1Q7H A;  3NBJ A;  1U5O A;  1BUQ A;  4FMA A;  3AMO A;  3EHC A;  1M1X B;  1JZD A;  2W9P A;  5EVH A;  1Q81 4;  4EYC A;  1IDP A;  1I2F A;  3X3X A;  2GEX A;  5CK6 A;  1O7W B;  2YFL B;  5AI1 A;  2SAR A;  1X1Y A;  5IW9 A;  1BNI A;  1DVD A;  1KD1 4;  2KF4 A;  3EQQ B;  4CJN A;  3KII A;  2H0H A;  2CWV A;  2GEY A;  3KN4 A;  3OXA A;  3LH4 A;  3SXX A;  1CYV A;  3ALA A;  3MG3 A;  4WWU C;  2HOH A;  1NJI 4;  4CPK A;  3X3Z A;  3TDG A;  2P0X A;  1G02 A;  1W2B 2;  1GOY A;  3X42 A;  4WFO A;  5IEO A;  1IVU A;  1AR0 A;  1DYU A;  1ZS7 A;  5BU4 A;  1F8N A;  4HYZ A;  3H51 A;  4DKI A;  1VQM 3;  2CWT A;  1AVK A;  3OV4 A;  3GZX B;  1R4Y A;  5FGO A;  2F4Y A;  1YHQ 3;  2XGN A;  1DVC A;  2GU3 A;  3VF1 A;  1NDO B;  2ML5 A;  2ZL8 A;  4IT7 A;  4N3V A;  3NX0 A;  1RNB A;  2WOF A;  1BNE A;  5LC6 A;  4K1U A;  3FF2 A;  4ZM8 A;  4GL6 A;  1QVF 2;  3LT8 A;  1QAL A;  2H0G A;  3V98 A;  1BNF A;  3CME 3;  2F5M A;  1N9E A;  1W6C A;  2KF6 A;  4X2H A;  3EC9 A;  1A2P A;  1I0X A;  2CFK A;  1KC8 4;  2OQE C;  2HMJ B;  4NPB A;  4WHA A;  5CF2 A;  1AY7 A;  3WDG B;  4ORL A;  3CCQ 3;  1I2E A;  1DMQ A;  4OVM A;  3Q90 A;  4J5G A;  5A0O B;  3EBT A;  1ZX2 A;  5KP4 A;  4RNT A;  1GY5 A;  2W2C A;  3N8B A;  1MWS A;  1WQL B;  3MWZ A;  1IK3 A;  1KWI A;  1SAR A;  3RDE A;  1GMP A;  5IF6 A;  1STD A;  3S5C A;  4N6L A;  1EEJ A;  3D4A A;  4Q53 A;  4QWT A;  3CPW 2;  3BIR A;  1FA3 A;  3WA2 X;  1LXE A;  1IV7 A;  3AHS A;  2FNQ A;  3B7C A;  2AAD A;  1GOV A;  2IY2 A;  3BLZ A;  1RGG A;  1RN7 A;  2W0Q A;  3A5E A;  3EB8 A;  1FYS A;  4R80 A;  4K1V A;  1TU5 A;  1VQO 3;  3B4O A;  3LTC A;  5G1L A;  5IG0 A;  1SJW A;  1M9G A;  2GXF A;  2YFI B;  1BSD A;  1RDS A;  1UI8 A;  3F8X A;  2Z6B A;  3CC2 3;  4FMD A;  1TFK A;  3CCJ 3;  1YJN 3;  1FZU A;  1VQK 3;  1IT8 A;  2W04 A;  3SOY A;  5JPP A;  3RGA A;  2CFG A;  2P05 A;  3MG2 A;  3NBR A;  3S27 A;  1D6Z A;  2ZHX B;  9RNT A;  3T0U A;  1BRS A;  4H61 A;  2JDI H;  1RKY A;  1V58 A;  4O3V A;  1W4N A;  2XRX B;  1QAK A;  2CFL A;  5CLK A;  2CK3 H;  3CNX A;  1IYY A;  1RSN A;  1RGA A;  3CCE 3;  2P38 A;  3T8U A;  5BIR A;  3G71 3;  4NRE A;  3CC7 3; 
#chains in the Genus database with same CATH homology
 1VQ6 3;  3QRD A;  5AIF A;  1N5H A;  4HJL B;  2HMO B;  5DRE A;  1TUH A;  1U8C B;  1FGM A;  2V1L A;  3CCR 3;  1STF I;  2WOH A;  4O02 B;  3FG3 A;  3F14 A;  1GY6 A;  1FGT A;  1O7P B;  2CC3 A;  1S5A A;  4OK0 A;  1Q82 4;  3QK9 A;  3G0K A;  3U97 A;  4HM8 B;  5D82 A;  2KXG A;  2XGL A;  3GWR A;  3UL5 A;  3LOY A;  3G4S 3;  3OWY A;  1MOL A;  3HII A;  2CWU A;  3L0R A;  4IIA A;  3WMD A;  4MMZ B;  2ML6 A;  4HM1 B;  1ASK A;  2JQ5 A;  3HZP A;  3X40 A;  2GBX B;  3AMO B;  2D42 A;  3PCS A;  4FCZ A;  2SBL A;  5JBS A;  3DGO A;  1C7H A;  1KSI A;  1OAC A;  3PCR A;  2INX A;  2Y74 A;  3JUN A;  1K8A 4;  3G8Z A;  2QEX 3;  3BNB A;  3FF0 A;  2O9U X;  3K7C A;  1YGE A;  1G96 A;  1O7M B;  1SII A;  3JUP A;  1YJW 3;  2BO9 B;  3MYT A;  1RJO A;  3O8Y A;  4NHF A;  1JRQ A;  2W56 B;  4O2H A;  4AKZ A;  4TX4 A;  2HML B;  2K0M A;  4HM0 B;  1AVL A;  4U13 A;  1A90 A;  3MPH A;  4STD A;  4XM4 A;  1A2V A;  4JRF A;  3EJV A;  3DGL A;  3X3Y A;  2M7O A;  2W56 A;  1OUN A;  1MNL A;  2HMK B;  2OWP A;  1HKX A;  1UUW B;  2QIY A;  5EQL A;  4GB5 A;  3EN1 B;  1ZO2 A;  1GD3 A;  3JUO A;  2E2V A;  2IUK A;  4L8P A;  3F7X A;  4R9K A;  3FH1 A;  1S72 3;  1O7G B;  1TIJ A;  4FR9 A;  1UW1 A;  1WNH A;  1N5P A;  1W7C A;  1VZZ A;  3BND A;  1YIT 3;  1Y4K A;  2P0M A;  3K0Z A;  4EV2 A;  3GAX A;  3FKA A;  2MC8 A;  3KFQ C;  4LSO A;  5BVB A;  2FGT A;  1NB5 I;  2E2T A;  2CFD A;  3KSP A;  4J8T A;  3G16 A;  4N6N B;  3HX8 A;  4XDW A;  1W6Y A;  4BTX A;  1NWW A;  4FCJ A;  3FSD A;  3OX9 A;  3F8H A;  3UL6 A;  1N8R 4;  4N6M A;  2WGO A;  3EBY A;  8CHO A;  3BNC A;  3PYJ A;  1K28 A;  3I55 3;  4WYK B;  1W02 A;  3KSE D;  3LXU X;  4AEQ A;  3G6E 3;  2XH9 A;  3OW2 2;  1R4C A;  3LT9 A;  4BTW A;  5CF1 A;  3KKG A;  3CPO A;  3MSO A;  1O7N B;  4O8S A;  1J2B A;  2A15 A;  3F7S A;  1RRL A;  3PS8 A;  3RGR A;  4MEI A;  2F86 B;  2OOV A;  4WYK A;  4LGQ A;  1TFO A;  3S29 A;  1VQ4 3;  1M1K 4;  4XDV A;  2HMN B;  1LOX A;  4H3U A;  1ISK A;  1US1 A;  3LML A;  3MKI A;  3I56 3;  2CG1 A;  3VGN A;  1KQS 2;  2B1X B;  2XF3 A;  1GS3 A;  5BXQ A;  3F40 A;  3F9S A;  3CCL 3;  4HZB B;  2Y73 A;  5KP1 A;  5DRV A;  2L4V A;  2W03 A;  1ROV A;  2Z7A A;  3JVC A;  4K90 B;  5EEO A;  1VQ9 3;  4HM7 B;  5ELJ A;  3VSY A;  1W2Z A;  4HM4 B;  3S28 A;  3D3L A;  1EQK A;  4IPB A;  2PZV A;  3LZA A;  1JJ2 2;  2C11 A;  1D6Y A;  2CH9 A;  1OPY A;  4L8O A;  4R4K A;  1W5Z A;  4R9L A;  2RFR A;  2LQV A;  3BB9 A;  2D1W A;  3HIG A;  4G1M B;  2IA7 A;  3EE1 A;  1FGQ A;  4HM2 B;  4WP5 A;  3SOA A;  3IJE B;  4KFD A;  2XR8 B;  3WOE B;  1E3V A;  3K63 A;  2MF7 A;  2O3O A;  1JN5 B;  4XBY A;  3HK4 A;  2QGU A;  5AYR B;  4KZ1 A;  3UB1 A;  1VQ5 3;  1VQL 3;  3CCM 3;  1Q40 B;  2WGQ A;  4CCV A;  5AEU B;  2BT3 A;  1JN5 A;  2RGQ A;  1NU3 A;  7STD A;  3LTA A;  1OF5 A;  1OHO A;  2CKF B;  2OOV C;  1N9J A;  1SQW A;  1W6G A;  3NM2 A;  2QA4 3;  1A67 A;  1E3R A;  1JKG A;  1IQ8 A;  1ROA A;  3FZW A;  1Q40 A;  3A76 A;  5IEN A;  2YFJ B;  3NQZ A;  1PU4 A;  4CDL A;  1YI2 3;  3M8C A;  1ULJ B;  4XBT A;  4RBN A;  3DXO A;  3SLU A;  1D6U A;  3CU3 A;  2KRT A;  1VQN 3;  3N9H A;  4EC6 A;  4KVH A;  2CIU A;  4L7K A;  1IQY A;  3BNE A;  1HU9 A;  5D81 A;  6STD A;  1JNQ A;  1OGX A;  2F99 A;  5FW5 A;  1LVN A;  1OH0 A;  3CC4 3;  3NXJ A;  5D83 A;  5IER A;  2OCT A;  4J9A A;  1NO3 A;  5AII A;  1SPU A;  3N54 B;  3FLJ A;  2XFT A;  2RSX A;  2HMM B;  1TP6 A;  4KFE A;  1CQS A;  4LMI A;  5AIH A;  4JF8 A;  1VQ7 3;  1QJG A;  4HM5 B;  3FCS B;  1RRH A;  2CG0 A;  3Q1C A;  3JUM A;  3Q2P A;  2IMJ A;  5LC7 A;  4XBX A;  2FXT A;  1IQX A;  4HVN A;  5I97 A;  3FGY A;  3V99 A;  2WO0 A;  3EX9 A;  4AKY A;  2CFW A;  1IV9 A;  2R4I A;  4OUQ A;  3UNL A;  3S67 A;  3STD A;  1LNH A;  1Z1S A;  2XSH B;  2OTJ 3;  4EV5 A;  1FUW A;  3DGN A;  1JB2 A;  4HM6 B;  1AV4 A;  3PGB A;  3CNM A;  3MG1 A;  4K61 A;  2I9W A;  2B24 B;  2Q07 A;  5HGR A;  2LYX A;  5AYS C;  4XB5 A;  3CD6 3;  5CXO A;  1Q42 A;  3U1W A;  1EKM A;  3HI7 A;  4N6O B;  1GYB A;  3OWU A;  3V92 A;  1CYU A;  3FG4 A;  3FG1 A;  3WA3 A;  4FCM A;  3LTD A;  4HM3 B;  3DGM A;  2Z77 A;  3GZR A;  3IPT A;  3ECF A;  1SIH A;  3CCS 3;  3KE7 A;  2YX9 A;  2PNC A;  2E2U A;  1IT7 A;  4PEJ A;  3NUV A;  1Q86 4;  4EBG A;  1JB5 A;  2P09 A;  2BMR B;  2Z76 A;  5TGN A;  1L5G B;  1EG9 B;  1K73 4;  5IG4 A;  1FGO A;  2CW9 A;  5G2G A;  3NM7 A;  3K9M C;  4HBR A;  5STD A;  1WMN A;  3DUK A;  3GZB A;  4X2O A;  2XSO B;  1QVG 2;  1OCV A;  3NV0 B;  1IU7 A;  1OGZ A;  4RZM A;  3UJM A;  2K54 A;  5IG3 A;  4MJD A;  3CXC 2;  4HZ9 B;  5AEW B;  1IVX A;  4FMB A;  1DMN A;  3D9R A;  3OWS A;  2IUJ A;  3CCU 3;  5AIG A;  1UI7 A;  2KCD A;  4MMY B;  3MHE A;  4HKV B;  1OHP A;  5ELU A;  3NV0 A;  1GD4 A;  4LZI A;  3PXM A;  2BMO B;  4KFF A;  3EF8 A;  2GU1 A;  3NQY A;  1PFP A;  1W00 A;  2W6J H;  1YVB I;  3IMA B;  1VQ8 3;  1GY7 A;  1JV2 B;  1NB3 I;  3H3H A;  3ROB A;  3NHX A;  4N6V 0;  3CCV 3;  1WMP A;  1OF5 B;  1Q7Y 4;  1YIJ 3;  2UX0 A;  3SED A;  1A2K A;  3DM8 A;  3EN8 A;  1JKG B;  1E97 A;  2STD A;  5IEP A;  1N8Q A;  3SX1 A;  4MMX B;  1K9M 4;  1EA2 A;  3X41 A;  3JUQ A;  1YJ9 3;  2CHC A;  1K41 A;  3LTB A;  4EXR A;  1OHS A;  3B8L A;  1T5Y A;  2ZDJ A;  3I0Y A;  4RNZ A;  4RNY A;  3SVA A;  2BNG A;  1M90 4;  3KZT A;  5KP3 A;  5JPU A;  3GZY B;  1IVW A;  3ER7 A;  2BMQ B;  3PZW A;  1UUV B;  4R1K A;  1WMO A;  1V74 A;  2W9Q A;  1JB4 A;  3K5T A;  1O7H B;  2OQE A;  2XFS A;  3E99 A;  4I4K A;  4N6T A;  3NBB A;  2GBW B;  3LYG A;  3DZL A;  3CMA 3;  2F98 A;  4N6U A;  3B4P A;  2C10 A;  1FGR A;  3DY5 A;  3J7Y d;  1DMM A;  1ULI B;  3GRD A;  4FMC A;  1QMA A;  3WOD G;  1QAF A;  1CEW I;  3DMC A;  3WOF B;  2RCD A;  4LEH A;  4BTY A;  2BHM A;  1VQP 3;  2XEP A;  3T8N A;  1IVV A;  1W01 A;  1WTH A;  5IG5 A;  3NBJ A;  1U5O A;  1BUQ A;  4FMA A;  3AMO A;  3EHC A;  1M1X B;  2W9P A;  5EVH A;  1Q81 4;  4EYC A;  1IDP A;  3X3X A;  2GEX A;  5CK6 A;  1O7W B;  2YFL B;  5AI1 A;  5IW9 A;  1DVD A;  1KD1 4;  3EQQ B;  3KII A;  2CWV A;  2GEY A;  3KN4 A;  3OXA A;  3LH4 A;  3SXX A;  1CYV A;  3ALA A;  3MG3 A;  4WWU C;  1NJI 4;  3X3Z A;  3TDG A;  2P0X A;  1W2B 2;  3X42 A;  4WFO A;  5IEO A;  1IVU A;  1AR0 A;  1DYU A;  1F8N A;  4HYZ A;  3H51 A;  1VQM 3;  2CWT A;  1AVK A;  3OV4 A;  3GZX B;  5FGO A;  1YHQ 3;  2XGN A;  1DVC A;  2GU3 A;  3VF1 A;  1NDO B;  2ML5 A;  2ZL8 A;  4IT7 A;  4N3V A;  3NX0 A;  2OTL 3;  2WOF A;  4ZM8 A;  5LC6 A;  4K1U A;  3FF2 A;  1QVF 2;  4GL6 A;  3LT8 A;  1QAL A;  3V98 A;  3CME 3;  1N9E A;  1W6C A;  4X2H A;  3EC9 A;  2CFK A;  1KC8 4;  2OQE C;  2HMJ B;  4WHA A;  5CF2 A;  3CCQ 3;  3WDG B;  4ORL A;  1DMQ A;  4OVM A;  3Q90 A;  5A0O B;  3EBT A;  1ZX2 A;  5KP4 A;  1GY5 A;  2W2C A;  3N8B A;  1WQL B;  3MWZ A;  1IK3 A;  1KWI A;  3RDE A;  5IF6 A;  1STD A;  3S5C A;  4N6L A;  4Q53 A;  4QWT A;  3CPW 2;  1FA3 A;  3WA2 X;  1LXE A;  1IV7 A;  2FNQ A;  3B7C A;  3BLZ A;  1RN7 A;  2W0Q A;  3EB8 A;  4R80 A;  4K1V A;  1TU5 A;  1VQO 3;  3B4O A;  3LTC A;  5IG0 A;  1SJW A;  1M9G A;  2GXF A;  2YFI B;  1UI8 A;  3F8X A;  3CC2 3;  3CCJ 3;  2Z6B A;  4FMD A;  1TFK A;  1YJN 3;  1VQK 3;  1IT8 A;  2W04 A;  3SOY A;  5JPP A;  3RGA A;  2CFG A;  2P05 A;  3MG2 A;  3NBR A;  3S27 A;  1D6Z A;  3T0U A;  4H61 A;  2JDI H;  1RKY A;  4O3V A;  1W4N A;  2XRX B;  1QAK A;  2CFL A;  5CLK A;  2CK3 H;  3CNX A;  3CCE 3;  2P38 A;  3T8U A;  3G71 3;  4NRE A;  3CC7 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...