5IEOA

Structure of cdl2.3a, a computationally designed vitamin-d3 binder
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
118
Chain Sequence
LPTAHEAIEAALADFVKVYNSKDAAGVASKYMDDAVIFPLDMARVDGRQNIQKLWQGLMDMGVSEPKFTTLNVQESGDFAFESGSFSLKGPVDIAGIYVEVWRKGGWKLYRTIANLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDL2.3a
publication title Structure of CDL2.3a, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 37
structure length 118
sequence length 127
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ieoA00
5G2GA 1E3VA 3SEDA 5D82A 2RGQA 1Q42A 4HM4B 2BMRB 3NUVA 2HMMB 3OWYA 3BLZA 3HX8A 2XR8B 4LEHA 5IG3A 4XBYA 3Q90A 3FKAA 3CNXA 3ER7A 4OUQA 5CF2A 3K0ZA 5BXQA 1IDPA 3S5CA 2QIYA 3B4OA 3I0YA 5HGRA 5IEPA 1OUNA 1SJWA 1O7NB 3UNLA 4IIAA 1Q40B 2HMKB 2K54A 1A2KA 2QGUA 3ECFA 5AIIA 1AR0A 5D83A 2HMNB 3EN1B 3EHCA 2JQ5A 1U5OA 1O7HB 2B24B 1OF5B 5IEOA 4WP5A 1JB2A 3VSYA 1BUQA 1OPYA 2RFRA 3JUOA 1GS3A 1JKGA 4U13A 1O7MB 3FH1A 3DM8A 5AIFA 1W00A 3FLJA 3DZLA 5AI1A 3CPOA 2B1XB 7STDA 2A15A 1OGXA 5AEUB 3KZTA 2BMOB 1UUWB 3NV0B 3ROBA 4K1VA 5IENA 3H51A 3EF8A 4HM6B 1VZZA 1UUVB 5BVBA 1GY6A 1HKXA 5JPPA 2XRXB 4R9KA 4L8PA 3FGYA 2HMOB 3G16A 3MG3A 5CLKA 3CU3A 3G8ZA 1W6YA 3DUKA 1NU3A 3LZAA 4ORLA 4WYKB 1CQSA 4HM7B 1OHOA 4LGQA 4XBXA 1ASKA 1OGZA 4WWUC 3UJMA 1GYBA 4XBTA 1DMNA 1JN5B 3GZBA 3NXJA 3MG1A 3WMDA 1EA2A 4FCMA 1Q40A 3F40A 3JUQA 3OV4A 3F8HA 3HZPA 1QMAA 1STDA 3H3HA 3JUNA 4XDWA 1EG9B 4XB5A 4HM2B 4LMIA 3DXOA 3F7XA 1JB4A 1NWWA 2F86B 1OHPA 5TGNA 4MJDA 1K41A 2BNGA 3STDA 3NBRA 3A76A 3CNMA 4X2HA 2CHCA 3F14A 2CKFB 3SOYA 2XSHB 4HM3B 3KKGA 3M8CA 5DRVA 8CHOA 1E3RA 4Q53A 4XM4A 3F9SA 1O7WB 3MHEA 5D81A 1Z1SA 3B8LA 2GBXB 5STDA 3EX9A 1C7HA 1DMQA 2GBWB 3G0KA 5KP1A 4J9AA 2INXA 3KSPA 1W02A 1E97A 3GZXB 3B7CA 5DREA 3F7SA 2OWPA 2I9WA 4L7KA 4HJLB 3FF0A 5EVHA 3T8UA 3T8NA 4GB5A 5CF1A 2Z7AA 3K7CA 1JN5A 4X2OA 5KP3A 2RCDA 5AEWB 1O7PB 4FCJA 3OWSA 1TUHA 3EN8A 1O7GB 3MSOA 4HM5B 2STDA 3B4PA 1OCVA 1TP6A 4HM0B 2HMLB 2UX0A 2GEYA 2R4IA 4J8TA 3EBTA 2YFLB 3FF2A 1S5AA 3NHXA 5IG4A 6STDA 4RZMA 3FSDA 1GY7A 1OF5A 2F98A 3GZYB 3GWRA 3MKIA 5IG5A 3JUMA 3GRDA 1WQLB 3MYTA 2F99A 3OWUA 2YFJB 5KP4A 3NM2A 5FW5A 2YFIB 5CXOA 3EJVA 4HZ9B 4R1KA 2W2CA 3HK4A 3VGNA 1DMMA 4R9LA 3D9RA 3NV0A 4L8OA 1ZO2A 3LYGA 5AIHA 5IERA 4OVMA 4I4KA 5AIGA 2HMJB 2Z76A 4K1UA 1W01A 5IG0A 1GY5A 3BB9A 4STDA 2IMJA 1ZX2A 4HM8B 1JB5A 5JPUA 2PZVA 3RGRA 2Z77A 3GZRA 1NDOB 4WYKA 5CK6A 4CDLA 3OXAA 1OHSA 2GXFA 3OX9A 1OH0A 4HM1B 3SOAA 4N3VA 1ISKA 2XSOB 3DMCA 4KVHA 3JUPA 3RGAA 3E99A 1JKGB 3EBYA 5IF6A 3KE7A 4HKVB 3EQQB 3EC9A 3MG2A 1QJGA 2GEXA 1ULIB 4PEJA 3FZWA 2BMQB 4H3UA 1ULJB 4HZBB 4HVNA 3F8XA 3IPTA 4XDVA
chains in the Genus database with same CATH superfamily
1JBRA 1UGIA 2IUJA 3AHWA 5G2GA 3D4AA 3CD63 3DGOA 3LXUX 4NHFA 1E3VA 3S27A 3SEDA 5D82A 2RGQA 1Q42A 2E2VA 2H0HA 4HM4B 1WMNA 2BMRB 3NUVA 1JZDA 1RGHA 2HMMB 3OWYA 1K28A 3BLZA 3HX8A 5M19A 4AEQA 2XR8B 1YJN3 1J2BA 1W6GA 1SIIA 1X1WA 3D5IA 4LEHA 5IG3A 2K0MA 4XBYA 1K734 4N6NB 1KWIA 3X40A 1RN7A 4O8SA 3Q90A 1B21A 2OTJ3 6GSPA 1RGEA 2BIRA 2CIUA 3CNXA 3FKAA 4CJNA 2OQEC 3ER7A 3N9HA 4OUQA 1YIT3 1N9EA 2CC3A 4CPKA 1RCLA 1CEWI 3HIGA 5CF2A 4R80A 2F5WA 3K0ZA 5BXQA 1IDPA 3D5GA 3S5CA 2QIYA 3B4OA 2KXGA 1M904 3CCM3 3I0YA 1BNFA 3EE1A 1RHLA 4J5GA 1BIRA 5HGRA 1OUNA 4G1MB 5IEPA 3RDEA 1VQK3 1A2VA 1O7NB 1SJWA 3PYJA 4HVNA 3UNLA 1W2B2 1MWUA 4IIAA 1Q40B 3CC73 2HMKB 2K54A 3UL6A 1A2KA 2PNCA 2QGUA 3ECFA 4R4KA 3G713 2O9UX 5AIIA 1AR0A 5D83A 1SARA 4OK0A 3S67A 3UB1A 1VQQA 1KSIA 2E2TA 2HMNB 2W0QA 3EN1B 5HOHA 4AKYA 3EHCA 2JQ5A 1U5OA 1BNIA 1O7HB 3WDGB 1T3BA 4JRFA 4DKIA 2B24B 4GL6A 1OF5B 3ZG0A 5JBSA 1YJ93 5EQLA 5IEOA 3HOHA 2YX9A 4WP5A 1JB2A 3VSYA 1NB3I 1BNGA 1BUQA 1FUSA 1N5HA 3X42A 2P09A 1OPYA 2RFRA 1VQP3 1R4CA 1BRIA 1LQGC 1GS3A 2FGTA 1JKGA 1T2HA 3JUOA 3VF1A 4U13A 4QWTA 3IMAB 1O7MB 3FH1A 3DM8A 5AIFA 3CC23 1VQ73 1W00A 3URPA 5LC7A 3FLJA 1UCKA 1FGQA 2CG0A 3D3LA 2C11A 3BNCA 4N6OB 1FA3A 3DH2A 3DZLA 1CYUA 5AI1A 1JV2B 3CPOA 1TJDA 2B1XB 7STDA 1W7CA 2A15A 1OGXA 5AEUB 1A67A 3FG4A 1EKMA 1T5YA 4K90B 1KD14 3KZTA 1D6ZA 4O02B 2BMOB 1UUWB 1FGRA 2CFDA 2XFTA 3BNBA 1RGGA 5AYRB 4KFDA 1TTOA 2Y73A 1W4NA 1BUJA 1RRLA 1DVDA 1C54A 3NV0B 3HI7A 3ROBA 4K1VA 5IENA 1BRNL 3H51A 3EF8A 4WHAA 1UI7A 1AQZA 4RNYA 2OCTA 4HM6B 2V1LA 1VZZA 4N6MA 3CXC2 2XH9A 2CWTA 2GU1A 4EC6A 1UCJA 1UUVB 5BVBA 2OOVA 1G0TA 1GY6A 1HKXA 1U8CB 1VQ63 1TRPA 1BSCA 3AHSA 3BNEA 1BNEA 1T2IA 5JPPA 2XRXB 1RDSA 4R9KA 3OW22 1QVG2 4L8PA 4KZ1A 3X3XA 3FGYA 3BU4A 3LTAA 2BU4A 4FR9A 3UL5A 1MGWA 1VQM3 4K61A 2ML6A 3G4S3 1WMOA 2CWVA 2HMOB 3G16A 1RSNA 3MG3A 5G1LA 1GMQA 1HZ1A 1YI23 3MPHA 5CLKA 1AVKA 3AMOB 3CU3A 3G8ZA 1W6YA 1RJOA 3IPTA 3DUKA 1NU3A 3LZAA 4ORLA 4WYKB 1X1XA 3S29A 3SVAA 2W9PA 1CQSA 3PZWA 2WOFA 1JZOA 4HM7B 1OHOA 4LGQA 1M1K4 4XBXA 3X41A 1ASKA 1OGZA 1RTUA 4WWUC 5ELJA 1TRQA 3UJMA 1GYBA 4LYLB 1W2ZA 1X1UA 1STFI 2RBIA 1JBSA 1ZGXA 1YGEA 3KIIA 4FMAA 4XBTA 2LYXA 1IK3A 3CCS3 2KF5A 1DMNA 1JN5B 3GZBA 1B20A 5ELUA 1VQO3 3D79A 2E2UA 2XEPA 4I5QA 4BTXA 3GSPA 3MG1A 1N9JA 3NXJA 3WMDA 3I553 1EA2A 1GD4A 1YVBI 4FCMA 1Q40A 3F40A 1V58A 1BSDA 2XGLA 3KN4A 4N6UA 4TX4A 3JUQA 5EEOA 2LQVA 3OV4A 1FZUA 3PXMA 1FGOA 3F8HA 1ROAA 4CCVA 3K63A 3HZPA 1YIJ3 1QMAA 2CFGA 4AKZA 7GSPA 3Q1CA 5G1KA 1NNVA 1STDA 3H3HA 3JUNA 4XDWA 1K9M4 3DGYA 3O8YA 2Z6BA 2MF7A 4J5KA 1EG9B 4XB5A 1VQ53 4HM2B 1GOYA 3DXOA 4LMIA 1MWSA 3F7XA 1UDII 1LOXA 1JB4A 1WMPA 1NWWA 1OHPA 1W5ZA 2CX0A 2F86B 2WGOA 3NQZA 4KFEA 3V92A 4EV2A 1N8R4 1VQN3 2UGIA 5TGNA 1A90A 2IY2A 4MJDA 2BO9B 2D42A 3MWZA 1K41A 3X3YA 2CK3H 3QRDA 2BNGA 3STDA 3NBRA 3A76A 3CNMA 4X2HA 2R41A 3LT8A 2CHCA 2W04A 3SLUA 1YNVX 1BVIA 3F14A 4BTWA 1MOLA 1Q864 1IT7A 1UGHI 2CKFB 3IJEB 3SOYA 1TFOA 1FW7A 1RN4A 2XSHB 4HM3B 3KKGA 1JJ22 3M8CA 2HOHA 5DRVA 1FUTA 4HBRA 1BNRA 1SIHA 5FGOA 1IQXA 1VQ43 2OQEA 1LOVA 8CHOA 2RNTA 2ML5A 3CCE3 1BNSA 4O3VA 1NB5I 4FMBA 3AGNA 3U97A 1E3RA 4Q53A 1NO3A 4XM4A 3F9SA 2WOHA 1O7WB 1LNIA 1I3FA 1Z1SA 1B2UA 2SBLA 3B8LA 1EUIC 3MHEA 5D81A 2CG1A 3LH4A 4ZM8A 2GBXB 5STDA 3EX9A 1C7HA 3J7Yd 1DMQA 2GBWB 4LZIA 1I2GA 1BSBA 1AY7A 4BTYA 3G0KA 5KP1A 3T0UA 1RLSA 4J9AA 2INXA 1PY3A 3KSPA 3LOYA 4NREA 1QVF2 1W02A 1ZS7A 2BHMA 1E97A 4MEIA 1B2MA 3GZXB 3B7CA 2KRTA 3AMOA 5DREA 1K8A4 2H0GA 1EQKA 4RBNA 4HAAA 3F7SA 2OWPA 3DGMA 3DGNA 2I9WA 1NJI4 2FXTA 1N5PA 2UUGC 1GMPA 3PS8A 2O3OA 1GOVA 4L7KA 4EW5A 1IQ8A 3CCR3 1I0XA 3NBBA 3I563 3K5TA 4HJLB 1M1XB 1UI8A 2Q07A 3FF0A 1MWRA 3PCSA 1B2ZA 3A5EA 4RNZA 2C4BA 5EVHA 3CCL3 2FNQA 3T8UA 3T8NA 4GB5A 2W03A 5CF1A 2AADA 2H0IA 4EXRA 2Z7AA 1RGLA 1A2PA 1JN5A 2CFWA 1UUGB 3K7CA 4N6TA 2CW9A 3DGLA 1YJW3 2GSPA 1LOYA 4X2OA 5KP3A 1BGSA 2OTL3 3SXXA 2ZL8A 3CPW2 2IYJA 2P38A 2RCDA 1BU4A 1UW1A 5AEWB 1Q9EA 4FCZA 2GU3A 2KCDA 1O7PB 1D6YA 4BL3A 4ILFA 3U1WA 4FCJA 3OWSA 1MWTA 3CC43 1TUHA 3EN8A 4O2HA 1DETA 2W56B 1O7GB 3MSOA 1US1A 2IA7A 4WFOA 1WNHA 3LT9A 2L1SA 4HM5B 1B2XA 2STDA 2F5MA 3B4PA 1RNBA 1G96A 7RNTA 1OCVA 5I97A 1I2EA 2F4YA 4BIRA 3V99A 2C10A 3ALAA 1TP6A 4HM0B 2HMLB 2UX0A 2GEYA 2R4IA 1SQWA 3ZFZA 4H61A 3WOFB 1VQ93 4J8TA 3CCJ3 3WODG 3WA2X 3EBTA 5LC6A 2YFLB 1IVWA 2BT3A 3FF2A 2M7OA 1QAFA 1S5AA 2XF3A 1IQYA 6RNTA 3NHXA 3CCV3 4HOHA 5IG4A 3LTDA 1LOWA 2CFLA 6STDA 4RZMA 3FSDA 1EEJA 1Q7Y4 1GY7A 1OF5A 1IVVA 4MMXB 2CFKA 3K9MC 1X1YA 2F98A 1B3SA 1KQS2 1IVUA 3Q3FA 1VQL3 3NM7A 3GZYB 1TFKA 3GWRA 1RRHA 3MKIA 4IPBA 4KFFA 3CMA3 1B27A 5IG5A 3JUMA 1LQMB 3L0RA 3GRDA 1WQLB 1IT8A 1N8QA 2JDIH 2WGQA 3N8BA 3MYTA 2F99A 3OWUA 3NX0A 3KSED 3PGBA 1I8VA 2AAEA 2XGNA 4RNTA 2P05A 2SARA 2YFJB 5KP4A 1B2SA 3NM2A 5FW5A 2CH9A 3V98A 1FUWA 2KF4A 2YFIB 1GD3A 3EJVA 3LTCA 5CXOA 1KC84 4HZ9B 4R1KA 8RNTA 5RNTA 2W2CA 1I70A 4JF8A 1BOXA 9RNTA 1RN1A 3HK4A 3HIIA 3PCRA 3FG1A 4N6LA 1TU5A 3VGNA 1DMMA 1G02A 3TDGA 4R9LA 3D9RA 3NV0A 1BRGA 1IVXA 3WR2A 1RGCA 5GSPA 1YHQ3 4L8OA 1ZO2A 1HU9A 3LYGA 1BSAA 5AIHA 5IERA 4OVMA 3FG3A 1RGAA 1RMSA 4I4KA 5AIGA 1ROVA 2CX1A 2HMJB 3LMLA 5M1AA 4BL2A 1IU7A 1JNQA 1CYVA 4HYZA 4GHOA 2WO0A 2MC8A 1PYLA 3NQYA 5BU4A 2Z76A 1TIJA 4K1UA 1W01A 2QEX3 1GSPA 1BANA 2IUKA 2OOVC 3DY5A 3CCU3 4IT7A 3QK9A 1JBTA 5IG0A 3X3ZA 4EV5A 2ZDJA 1GY5A 3BB9A 4STDA 1AVLA 3ZG5A 3EB8A 3KFQC 2CWUA 4EYCA 2IMJA 3KCHA 1AV4A 3CME3 1ZX2A 1BRHA 4HM8B 1JB5A 4EBGA 1BAOA 5JPUA 2PZVA 1BRSA 2Z77A 3GZRA 1NDOB 4NPBA 3RGRA 2ZA4A 4WYKA 1S723 5CK6A 5A0OB 1RGKA 1DVCA 1DE3A 4CDLA 1YVSA 2W56A 3OXAA 3AGOA 3BNDA 2J8XB 2KF6A 4MMZB 2W9QA 2XFSA 1OHSA 2GXFA 1IYYA 5IW9A 3OX9A 1FGMA 1WTHA 2F56A 5AYSC 5M18A 1OH0A 2KF3A 4HM1B 3SOAA 1LNHA 4N3VA 1ISKA 1RGFA 2KAAA 1BSEA 1D6UA 2XSOB 1QAKA 4MMYB 1LXEA 2D1WA 3NBJA 3FCSB 4GSPA 1LVNA 3DMCA 1FGTA 3RNTA 3SX1A 1Y4KA 4KVHA 3JUPA 1PU4A 3RGAA 1CH0A 1JKGB 1I3IA 3BIRA 3E99A 5BIRA 1IV9A 1F8NA 1RCKA 2Y74A 1V57A 4FMDA 3EBYA 1UCLA 1LRAA 3LTBA 1MNLA 1Q7HA 3GAXA 5IF6A 1V74A 1PFPA 1IV7A 1I0VA 1UCIA 2RSXA 3JVCA 3Q2PA 3KE7A 1RKYA 1GOUA 3SYUA 4HKVB 1R4YA 2P0MA 2ZHXB 3EQQB 2W6JH 3EC9A 3CCQ3 1DYUA 2K3DA 1FYSA 1OACA 3WHOA 2P0XA 3MG2A 3WA3A 1QJGA 2GEXA 1GMRA 1ULIB 1VQ83 1M9GA 1RNTA 3FZWA 3N54B 4PEJA 1L5GB 3WOEB 4N6V0 2QA43 1Q814 2BMQB 3S28A 1BNJA 4LSOA 1SPUA 1YGWA 1HYFA 4H3UA 1W6CA 1BRJA 2L4VA 4FMCA 4KT3B 1QALA 1Q824 1JRQA 4BU4A 1ULJB 4HZBB 3G6E3 1BRKA 1I2FA 3F8XA 1MGRA 4XDVA
chains in the Genus database with same CATH topology
2IUJA 5G2GA 3CD63 3DGOA 3LXUX 4NHFA 1E3VA 3S27A 3SEDA 5D82A 2RGQA 1Q42A 2E2VA 4HM4B 1WMNA 2BMRB 3NUVA 2HMMB 3OWYA 1K28A 3BLZA 3HX8A 4AEQA 2XR8B 1YJN3 1J2BA 1W6GA 1SIIA 4LEHA 1K734 5IG3A 2K0MA 4XBYA 4N6NB 1KWIA 3X40A 1RN7A 4O8SA 3Q90A 2OTJ3 2CIUA 3CNXA 3FKAA 2OQEC 3ER7A 3N9HA 4OUQA 1YIT3 1N9EA 2CC3A 1CEWI 3HIGA 5CF2A 4R80A 3K0ZA 5BXQA 1IDPA 3S5CA 2QIYA 3B4OA 2KXGA 1M904 3CCM3 3I0YA 3EE1A 5HGRA 5IEPA 1OUNA 4G1MB 3RDEA 1VQK3 1A2VA 1O7NB 1SJWA 3PYJA 3UNLA 1W2B2 4IIAA 1Q40B 3CC73 2HMKB 2K54A 3UL6A 1A2KA 2PNCA 2QGUA 3ECFA 4R4KA 3G713 2O9UX 5AIIA 1AR0A 5D83A 4OK0A 3S67A 3UB1A 1KSIA 2E2TA 2HMNB 2W0QA 3EN1B 4AKYA 3EHCA 2JQ5A 1U5OA 1O7HB 3WDGB 4JRFA 2B24B 4GL6A 1OF5B 5JBSA 1YJ93 5EQLA 5IEOA 2YX9A 4WP5A 1JB2A 3VSYA 1NB3I 1BUQA 1N5HA 3X42A 2P09A 1OPYA 2RFRA 1VQP3 1R4CA 3JUOA 1GS3A 2FGTA 1JKGA 3VF1A 4U13A 4QWTA 3IMAB 1O7MB 3FH1A 3DM8A 5AIFA 3CC23 1VQ73 1W00A 5LC7A 3FLJA 1FGQA 2CG0A 3D3LA 2C11A 3BNCA 4N6OB 1FA3A 3DZLA 1CYUA 5AI1A 1JV2B 3CPOA 2B1XB 7STDA 1W7CA 2A15A 1OGXA 5AEUB 1A67A 3FG4A 1EKMA 1T5YA 4K90B 1KD14 3KZTA 1D6ZA 4O02B 2BMOB 1UUWB 1FGRA 2CFDA 2XFTA 3BNBA 5AYRB 4KFDA 2Y73A 1W4NA 1RRLA 1DVDA 3NV0B 3HI7A 3ROBA 4K1VA 5IENA 3H51A 3EF8A 4WHAA 1UI7A 4RNYA 2OCTA 4HM6B 2V1LA 1VZZA 4N6MA 3CXC2 2XH9A 2CWTA 2GU1A 4EC6A 1UUVB 5BVBA 2OOVA 1GY6A 1HKXA 1U8CB 1VQ63 3BNEA 3OW22 5JPPA 2XRXB 4R9KA 1QVG2 4L8PA 4KZ1A 3X3XA 3FGYA 3LTAA 4FR9A 3UL5A 1VQM3 4K61A 2ML6A 3G4S3 1WMOA 2CWVA 2HMOB 3G16A 1YI23 3MG3A 3MPHA 5CLKA 1AVKA 3AMOB 3CU3A 3G8ZA 1W6YA 1RJOA 3IPTA 3DUKA 1NU3A 3LZAA 4ORLA 4WYKB 3S29A 3SVAA 2W9PA 1CQSA 3PZWA 2WOFA 4HM7B 1OHOA 4LGQA 1M1K4 4XBXA 3X41A 1ASKA 1OGZA 4WWUC 5ELJA 3UJMA 1GYBA 1W2ZA 1STFI 1YGEA 3KIIA 4FMAA 4XBTA 2LYXA 1IK3A 3CCS3 1DMNA 1JN5B 3GZBA 5ELUA 1VQO3 2E2UA 2XEPA 4BTXA 3I553 3NXJA 3MG1A 1N9JA 3WMDA 1EA2A 1GD4A 1YVBI 4FCMA 1Q40A 3F40A 2XGLA 4TX4A 3KN4A 4N6UA 3JUQA 5EEOA 2LQVA 3OV4A 3PXMA 1FGOA 3F8HA 1ROAA 4CCVA 3K63A 3HZPA 1YIJ3 1QMAA 2CFGA 4AKZA 3Q1CA 1STDA 3H3HA 3JUNA 4XDWA 1K9M4 3O8YA 2Z6BA 2MF7A 1EG9B 4XB5A 1VQ53 4HM2B 4LMIA 3DXOA 3F7XA 1LOXA 1JB4A 1NWWA 1W5ZA 1OHPA 1WMPA 2F86B 3NQZA 2WGOA 4KFEA 3V92A 4EV2A 1N8R4 1VQN3 5TGNA 1A90A 4MJDA 2BO9B 2D42A 3MWZA 1K41A 3X3YA 2CK3H 3QRDA 2BNGA 3STDA 3NBRA 3A76A 3CNMA 4X2HA 3LT8A 2CHCA 2W04A 3SLUA 3F14A 4BTWA 1MOLA 1Q864 1IT7A 2CKFB 3IJEB 3SOYA 1TFOA 2XSHB 4HM3B 3KKGA 1JJ22 3M8CA 5DRVA 4HBRA 1SIHA 5FGOA 1IQXA 1VQ43 2OQEA 8CHOA 2ML5A 3CCE3 4O3VA 1NB5I 4FMBA 3U97A 1E3RA 4Q53A 1NO3A 4XM4A 3F9SA 2WOHA 2SBLA 1O7WB 1Z1SA 3MHEA 3B8LA 5D81A 2CG1A 2OTL3 3LH4A 4ZM8A 2GBXB 5STDA 3EX9A 1C7HA 3J7Yd 1DMQA 2GBWB 4LZIA 4BTYA 3G0KA 5KP1A 3T0UA 4J9AA 2INXA 3KSPA 3LOYA 4NREA 1QVF2 1W02A 2BHMA 1E97A 4MEIA 3GZXB 3B7CA 2KRTA 3AMOA 5DREA 1K8A4 1EQKA 4RBNA 3F7SA 2OWPA 3DGMA 3DGNA 2I9WA 1NJI4 2FXTA 1N5PA 3PS8A 2O3OA 4L7KA 1IQ8A 3CCR3 3NBBA 3I563 3K5TA 4HJLB 1M1XB 1UI8A 2Q07A 3FF0A 3PCSA 4RNZA 5EVHA 3CCL3 2FNQA 3T8UA 3T8NA 4GB5A 2W03A 5CF1A 4EXRA 2Z7AA 3K7CA 1JN5A 2CFWA 4N6TA 2CW9A 3DGLA 1YJW3 4X2OA 5KP3A 3SXXA 2ZL8A 3CPW2 2P38A 2RCDA 1UW1A 5AEWB 4FCZA 2GU3A 2KCDA 1O7PB 1D6YA 3U1WA 4FCJA 3OWSA 3CC43 1TUHA 3EN8A 4O2HA 2W56B 1O7GB 3MSOA 1US1A 2IA7A 4WFOA 1WNHA 3LT9A 4HM5B 2STDA 3B4PA 1G96A 5I97A 1OCVA 3V99A 2C10A 3ALAA 1TP6A 4HM0B 2HMLB 2UX0A 2GEYA 2R4IA 1SQWA 4H61A 3WOFB 1VQ93 4J8TA 3CCJ3 3WODG 3WA2X 3EBTA 5LC6A 2YFLB 1IVWA 2BT3A 3FF2A 2M7OA 1QAFA 1S5AA 2XF3A 1IQYA 3NHXA 3CCV3 5IG4A 3LTDA 2CFLA 6STDA 4RZMA 3FSDA 1Q7Y4 1GY7A 1OF5A 1IVVA 4MMXB 2CFKA 3K9MC 2F98A 1KQS2 1IVUA 1VQL3 3NM7A 3GZYB 1TFKA 3GWRA 1RRHA 3MKIA 4IPBA 4KFFA 3CMA3 5IG5A 3JUMA 3L0RA 3GRDA 1WQLB 1IT8A 1N8QA 2JDIH 2WGQA 3N8BA 3MYTA 2F99A 3OWUA 3NX0A 3KSED 3PGBA 2XGNA 2P05A 2YFJB 5KP4A 3NM2A 5FW5A 1FUWA 2CH9A 3V98A 2YFIB 3LTCA 1GD3A 3EJVA 5CXOA 1KC84 4HZ9B 4R1KA 2W2CA 4JF8A 3PCRA 3HK4A 3HIIA 3FG1A 4N6LA 1TU5A 3VGNA 1DMMA 3TDGA 4R9LA 3D9RA 3NV0A 1IVXA 1YHQ3 4L8OA 1ZO2A 1HU9A 3LYGA 5AIHA 5IERA 4OVMA 3FG3A 4I4KA 5AIGA 1ROVA 2HMJB 3LMLA 1JNQA 1IU7A 1CYVA 4HYZA 2WO0A 2MC8A 3NQYA 2Z76A 1TIJA 4K1UA 1W01A 2QEX3 2OOVC 2IUKA 3DY5A 3CCU3 4IT7A 3QK9A 5IG0A 3X3ZA 4EV5A 2ZDJA 1GY5A 3BB9A 4STDA 1AVLA 3EB8A 3KFQC 2CWUA 4EYCA 2IMJA 1AV4A 3CME3 1ZX2A 4HM8B 1JB5A 4EBGA 5JPUA 2PZVA 2Z77A 3GZRA 3RGRA 1NDOB 1S723 4WYKA 5CK6A 5A0OB 1DVCA 4CDLA 2W56A 3OXAA 3BNDA 4MMZB 2W9QA 2XFSA 1OHSA 2GXFA 5IW9A 3OX9A 1FGMA 1WTHA 5AYSC 1OH0A 4HM1B 3SOAA 1LNHA 4N3VA 1ISKA 1D6UA 2XSOB 1QAKA 4MMYB 1LXEA 2D1WA 3NBJA 3FCSB 1LVNA 3DMCA 1FGTA 3SX1A 1Y4KA 4KVHA 3JUPA 1PU4A 3RGAA 3E99A 1JKGB 1IV9A 1F8NA 2Y74A 4FMDA 3EBYA 3LTBA 1MNLA 3GAXA 5IF6A 1V74A 1PFPA 1IV7A 2RSXA 3JVCA 3Q2PA 1RKYA 3KE7A 4HKVB 2P0MA 3EQQB 2W6JH 3EC9A 3CCQ3 1DYUA 1OACA 2P0XA 3MG2A 3WA3A 1QJGA 2GEXA 1ULIB 1VQ83 1M9GA 3N54B 3FZWA 4PEJA 2QA43 1L5GB 3WOEB 4N6V0 1Q814 2BMQB 3S28A 4LSOA 1SPUA 4H3UA 1W6CA 4FMCA 1QALA 1Q824 1JRQA 1ULJB 4HZBB 3G6E3 4HVNA 3F8XA 2L4VA 4XDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G2G A;  1E3V A;  3SED A;  5D82 A;  2RGQ A;  1Q42 A;  4HM4 B;  2BMR B;  3NUV A;  2HMM B;  3OWY A;  3BLZ A;  3HX8 A;  2XR8 B;  4LEH A;  5IG3 A;  4XBY A;  3Q90 A;  3FKA A;  3CNX A;  3ER7 A;  4OUQ A;  5CF2 A;  3K0Z A;  5BXQ A;  1IDP A;  3S5C A;  2QIY A;  3B4O A;  3I0Y A;  5HGR A;  5IEP A;  1OUN A;  1SJW A;  1O7N B;  3UNL A;  4IIA A;  1Q40 B;  2HMK B;  2K54 A;  1A2K A;  2QGU A;  3ECF A;  5AII A;  1AR0 A;  5D83 A;  2HMN B;  3EN1 B;  3EHC A;  2JQ5 A;  1U5O A;  1O7H B;  2B24 B;  1OF5 B;  5IEO A;  4WP5 A;  1JB2 A;  3VSY A;  1BUQ A;  1OPY A;  2RFR A;  3JUO A;  1GS3 A;  1JKG A;  4U13 A;  1O7M B;  3FH1 A;  3DM8 A;  5AIF A;  1W00 A;  3FLJ A;  3DZL A;  5AI1 A;  3CPO A;  2B1X B;  7STD A;  2A15 A;  1OGX A;  5AEU B;  3KZT A;  2BMO B;  1UUW B;  3NV0 B;  3ROB A;  4K1V A;  5IEN A;  3H51 A;  3EF8 A;  4HM6 B;  1VZZ A;  1UUV B;  5BVB A;  1GY6 A;  1HKX A;  5JPP A;  2XRX B;  4R9K A;  4L8P A;  3FGY A;  2HMO B;  3G16 A;  3MG3 A;  5CLK A;  3CU3 A;  3G8Z A;  1W6Y A;  3DUK A;  1NU3 A;  3LZA A;  4ORL A;  4WYK B;  1CQS A;  4HM7 B;  1OHO A;  4LGQ A;  4XBX A;  1ASK A;  1OGZ A;  4WWU C;  3UJM A;  1GYB A;  4XBT A;  1DMN A;  1JN5 B;  3GZB A;  3NXJ A;  3MG1 A;  3WMD A;  1EA2 A;  4FCM A;  1Q40 A;  3F40 A;  3JUQ A;  3OV4 A;  3F8H A;  3HZP A;  1QMA A;  1STD A;  3H3H A;  3JUN A;  4XDW A;  1EG9 B;  4XB5 A;  4HM2 B;  4LMI A;  3DXO A;  3F7X A;  1JB4 A;  1NWW A;  2F86 B;  1OHP A;  5TGN A;  4MJD A;  1K41 A;  2BNG A;  3STD A;  3NBR A;  3A76 A;  3CNM A;  4X2H A;  2CHC A;  3F14 A;  2CKF B;  3SOY A;  2XSH B;  4HM3 B;  3KKG A;  3M8C A;  5DRV A;  8CHO A;  1E3R A;  4Q53 A;  4XM4 A;  3F9S A;  1O7W B;  3MHE A;  5D81 A;  1Z1S A;  3B8L A;  2GBX B;  5STD A;  3EX9 A;  1C7H A;  1DMQ A;  2GBW B;  3G0K A;  5KP1 A;  4J9A A;  2INX A;  3KSP A;  1W02 A;  1E97 A;  3GZX B;  3B7C A;  5DRE A;  3F7S A;  2OWP A;  2I9W A;  4L7K A;  4HJL B;  3FF0 A;  5EVH A;  3T8U A;  3T8N A;  4GB5 A;  5CF1 A;  2Z7A A;  3K7C A;  1JN5 A;  4X2O A;  5KP3 A;  2RCD A;  5AEW B;  1O7P B;  4FCJ A;  3OWS A;  1TUH A;  3EN8 A;  1O7G B;  3MSO A;  4HM5 B;  2STD A;  3B4P A;  1OCV A;  1TP6 A;  4HM0 B;  2HML B;  2UX0 A;  2GEY A;  2R4I A;  4J8T A;  3EBT A;  2YFL B;  3FF2 A;  1S5A A;  3NHX A;  5IG4 A;  6STD A;  4RZM A;  3FSD A;  1GY7 A;  1OF5 A;  2F98 A;  3GZY B;  3GWR A;  3MKI A;  5IG5 A;  3JUM A;  3GRD A;  1WQL B;  3MYT A;  2F99 A;  3OWU A;  2YFJ B;  5KP4 A;  3NM2 A;  5FW5 A;  2YFI B;  5CXO A;  3EJV A;  4HZ9 B;  4R1K A;  2W2C A;  3HK4 A;  3VGN A;  1DMM A;  4R9L A;  3D9R A;  3NV0 A;  4L8O A;  1ZO2 A;  3LYG A;  5AIH A;  5IER A;  4OVM A;  4I4K A;  5AIG A;  2HMJ B;  2Z76 A;  4K1U A;  1W01 A;  5IG0 A;  1GY5 A;  3BB9 A;  4STD A;  2IMJ A;  1ZX2 A;  4HM8 B;  1JB5 A;  5JPU A;  2PZV A;  3RGR A;  2Z77 A;  3GZR A;  1NDO B;  4WYK A;  5CK6 A;  4CDL A;  3OXA A;  1OHS A;  2GXF A;  3OX9 A;  1OH0 A;  4HM1 B;  3SOA A;  4N3V A;  1ISK A;  2XSO B;  3DMC A;  4KVH A;  3JUP A;  3RGA A;  3E99 A;  1JKG B;  3EBY A;  5IF6 A;  3KE7 A;  4HKV B;  3EQQ B;  3EC9 A;  3MG2 A;  1QJG A;  2GEX A;  1ULI B;  4PEJ A;  3FZW A;  2BMQ B;  4H3U A;  1ULJ B;  4HZB B;  4HVN A;  3F8X A;  3IPT A;  4XDV A; 
#chains in the Genus database with same CATH topology
 1JBR A;  1UGI A;  2IUJ A;  3AHW A;  5G2G A;  3D4A A;  3CD6 3;  3DGO A;  3LXU X;  4NHF A;  1E3V A;  3S27 A;  3SED A;  5D82 A;  2RGQ A;  1Q42 A;  2E2V A;  2H0H A;  4HM4 B;  1WMN A;  2BMR B;  3NUV A;  1JZD A;  1RGH A;  2HMM B;  3OWY A;  1K28 A;  3BLZ A;  3HX8 A;  5M19 A;  4AEQ A;  2XR8 B;  1YJN 3;  1J2B A;  1W6G A;  1SII A;  1X1W A;  3D5I A;  4LEH A;  5IG3 A;  2K0M A;  4XBY A;  1K73 4;  4N6N B;  1KWI A;  3X40 A;  1RN7 A;  4O8S A;  3Q90 A;  1B21 A;  2OTJ 3;  6GSP A;  1RGE A;  2BIR A;  2CIU A;  3CNX A;  3FKA A;  4CJN A;  2OQE C;  3ER7 A;  3N9H A;  4OUQ A;  1YIT 3;  1N9E A;  2CC3 A;  4CPK A;  1RCL A;  1CEW I;  3HIG A;  5CF2 A;  4R80 A;  2F5W A;  3K0Z A;  5BXQ A;  1IDP A;  3D5G A;  3S5C A;  2QIY A;  3B4O A;  2KXG A;  1M90 4;  3CCM 3;  3I0Y A;  1BNF A;  3EE1 A;  1RHL A;  4J5G A;  1BIR A;  5HGR A;  1OUN A;  4G1M B;  5IEP A;  3RDE A;  1VQK 3;  1A2V A;  1O7N B;  1SJW A;  3PYJ A;  4HVN A;  3UNL A;  1W2B 2;  1MWU A;  4IIA A;  1Q40 B;  3CC7 3;  2HMK B;  2K54 A;  3UL6 A;  1A2K A;  2PNC A;  2QGU A;  3ECF A;  4R4K A;  3G71 3;  2O9U X;  5AII A;  1AR0 A;  5D83 A;  1SAR A;  4OK0 A;  3S67 A;  3UB1 A;  1VQQ A;  1KSI A;  2E2T A;  2HMN B;  2W0Q A;  3EN1 B;  5HOH A;  4AKY A;  3EHC A;  2JQ5 A;  1U5O A;  1BNI A;  1O7H B;  3WDG B;  1T3B A;  4JRF A;  4DKI A;  2B24 B;  4GL6 A;  1OF5 B;  3ZG0 A;  5JBS A;  1YJ9 3;  5EQL A;  5IEO A;  3HOH A;  2YX9 A;  4WP5 A;  1JB2 A;  3VSY A;  1NB3 I;  1BNG A;  1BUQ A;  1FUS A;  1N5H A;  3X42 A;  2P09 A;  1OPY A;  2RFR A;  1VQP 3;  1R4C A;  1BRI A;  1LQG C;  1GS3 A;  2FGT A;  1JKG A;  1T2H A;  3JUO A;  3VF1 A;  4U13 A;  4QWT A;  3IMA B;  1O7M B;  3FH1 A;  3DM8 A;  5AIF A;  3CC2 3;  1VQ7 3;  1W00 A;  3URP A;  5LC7 A;  3FLJ A;  1UCK A;  1FGQ A;  2CG0 A;  3D3L A;  2C11 A;  3BNC A;  4N6O B;  1FA3 A;  3DH2 A;  3DZL A;  1CYU A;  5AI1 A;  1JV2 B;  3CPO A;  1TJD A;  2B1X B;  7STD A;  1W7C A;  2A15 A;  1OGX A;  5AEU B;  1A67 A;  3FG4 A;  1EKM A;  1T5Y A;  4K90 B;  1KD1 4;  3KZT A;  1D6Z A;  4O02 B;  2BMO B;  1UUW B;  1FGR A;  2CFD A;  2XFT A;  3BNB A;  1RGG A;  5AYR B;  4KFD A;  1TTO A;  2Y73 A;  1W4N A;  1BUJ A;  1RRL A;  1DVD A;  1C54 A;  3NV0 B;  3HI7 A;  3ROB A;  4K1V A;  5IEN A;  1BRN L;  3H51 A;  3EF8 A;  4WHA A;  1UI7 A;  1AQZ A;  4RNY A;  2OCT A;  4HM6 B;  2V1L A;  1VZZ A;  4N6M A;  3CXC 2;  2XH9 A;  2CWT A;  2GU1 A;  4EC6 A;  1UCJ A;  1UUV B;  5BVB A;  2OOV A;  1G0T A;  1GY6 A;  1HKX A;  1U8C B;  1VQ6 3;  1TRP A;  1BSC A;  3AHS A;  3BNE A;  1BNE A;  1T2I A;  5JPP A;  2XRX B;  1RDS A;  4R9K A;  3OW2 2;  1QVG 2;  4L8P A;  4KZ1 A;  3X3X A;  3FGY A;  3BU4 A;  3LTA A;  2BU4 A;  4FR9 A;  3UL5 A;  1MGW A;  1VQM 3;  4K61 A;  2ML6 A;  3G4S 3;  1WMO A;  2CWV A;  2HMO B;  3G16 A;  1RSN A;  3MG3 A;  5G1L A;  1GMQ A;  1HZ1 A;  1YI2 3;  3MPH A;  5CLK A;  1AVK A;  3AMO B;  3CU3 A;  3G8Z A;  1W6Y A;  1RJO A;  3IPT A;  3DUK A;  1NU3 A;  3LZA A;  4ORL A;  4WYK B;  1X1X A;  3S29 A;  3SVA A;  2W9P A;  1CQS A;  3PZW A;  2WOF A;  1JZO A;  4HM7 B;  1OHO A;  4LGQ A;  1M1K 4;  4XBX A;  3X41 A;  1ASK A;  1OGZ A;  1RTU A;  4WWU C;  5ELJ A;  1TRQ A;  3UJM A;  1GYB A;  4LYL B;  1W2Z A;  1X1U A;  1STF I;  2RBI A;  1JBS A;  1ZGX A;  1YGE A;  3KII A;  4FMA A;  4XBT A;  2LYX A;  1IK3 A;  3CCS 3;  2KF5 A;  1DMN A;  1JN5 B;  3GZB A;  1B20 A;  5ELU A;  1VQO 3;  3D79 A;  2E2U A;  2XEP A;  4I5Q A;  4BTX A;  3GSP A;  3MG1 A;  1N9J A;  3NXJ A;  3WMD A;  3I55 3;  1EA2 A;  1GD4 A;  1YVB I;  4FCM A;  1Q40 A;  3F40 A;  1V58 A;  1BSD A;  2XGL A;  3KN4 A;  4N6U A;  4TX4 A;  3JUQ A;  5EEO A;  2LQV A;  3OV4 A;  1FZU A;  3PXM A;  1FGO A;  3F8H A;  1ROA A;  4CCV A;  3K63 A;  3HZP A;  1YIJ 3;  1QMA A;  2CFG A;  4AKZ A;  7GSP A;  3Q1C A;  5G1K A;  1NNV A;  1STD A;  3H3H A;  3JUN A;  4XDW A;  1K9M 4;  3DGY A;  3O8Y A;  2Z6B A;  2MF7 A;  4J5K A;  1EG9 B;  4XB5 A;  1VQ5 3;  4HM2 B;  1GOY A;  3DXO A;  4LMI A;  1MWS A;  3F7X A;  1UDI I;  1LOX A;  1JB4 A;  1WMP A;  1NWW A;  1OHP A;  1W5Z A;  2CX0 A;  2F86 B;  2WGO A;  3NQZ A;  4KFE A;  3V92 A;  4EV2 A;  1N8R 4;  1VQN 3;  2UGI A;  5TGN A;  1A90 A;  2IY2 A;  4MJD A;  2BO9 B;  2D42 A;  3MWZ A;  1K41 A;  3X3Y A;  2CK3 H;  3QRD A;  2BNG A;  3STD A;  3NBR A;  3A76 A;  3CNM A;  4X2H A;  2R41 A;  3LT8 A;  2CHC A;  2W04 A;  3SLU A;  1YNV X;  1BVI A;  3F14 A;  4BTW A;  1MOL A;  1Q86 4;  1IT7 A;  1UGH I;  2CKF B;  3IJE B;  3SOY A;  1TFO A;  1FW7 A;  1RN4 A;  2XSH B;  4HM3 B;  3KKG A;  1JJ2 2;  3M8C A;  2HOH A;  5DRV A;  1FUT A;  4HBR A;  1BNR A;  1SIH A;  5FGO A;  1IQX A;  1VQ4 3;  2OQE A;  1LOV A;  8CHO A;  2RNT A;  2ML5 A;  3CCE 3;  1BNS A;  4O3V A;  1NB5 I;  4FMB A;  3AGN A;  3U97 A;  1E3R A;  4Q53 A;  1NO3 A;  4XM4 A;  3F9S A;  2WOH A;  1O7W B;  1LNI A;  1I3F A;  1Z1S A;  1B2U A;  2SBL A;  3B8L A;  1EUI C;  3MHE A;  5D81 A;  2CG1 A;  3LH4 A;  4ZM8 A;  2GBX B;  5STD A;  3EX9 A;  1C7H A;  3J7Y d;  1DMQ A;  2GBW B;  4LZI A;  1I2G A;  1BSB A;  1AY7 A;  4BTY A;  3G0K A;  5KP1 A;  3T0U A;  1RLS A;  4J9A A;  2INX A;  1PY3 A;  3KSP A;  3LOY A;  4NRE A;  1QVF 2;  1W02 A;  1ZS7 A;  2BHM A;  1E97 A;  4MEI A;  1B2M A;  3GZX B;  3B7C A;  2KRT A;  3AMO A;  5DRE A;  1K8A 4;  2H0G A;  1EQK A;  4RBN A;  4HAA A;  3F7S A;  2OWP A;  3DGM A;  3DGN A;  2I9W A;  1NJI 4;  2FXT A;  1N5P A;  2UUG C;  1GMP A;  3PS8 A;  2O3O A;  1GOV A;  4L7K A;  4EW5 A;  1IQ8 A;  3CCR 3;  1I0X A;  3NBB A;  3I56 3;  3K5T A;  4HJL B;  1M1X B;  1UI8 A;  2Q07 A;  3FF0 A;  1MWR A;  3PCS A;  1B2Z A;  3A5E A;  4RNZ A;  2C4B A;  5EVH A;  3CCL 3;  2FNQ A;  3T8U A;  3T8N A;  4GB5 A;  2W03 A;  5CF1 A;  2AAD A;  2H0I A;  4EXR A;  2Z7A A;  1RGL A;  1A2P A;  1JN5 A;  2CFW A;  1UUG B;  3K7C A;  4N6T A;  2CW9 A;  3DGL A;  1YJW 3;  2GSP A;  1LOY A;  4X2O A;  5KP3 A;  1BGS A;  2OTL 3;  3SXX A;  2ZL8 A;  3CPW 2;  2IYJ A;  2P38 A;  2RCD A;  1BU4 A;  1UW1 A;  5AEW B;  1Q9E A;  4FCZ A;  2GU3 A;  2KCD A;  1O7P B;  1D6Y A;  4BL3 A;  4ILF A;  3U1W A;  4FCJ A;  3OWS A;  1MWT A;  3CC4 3;  1TUH A;  3EN8 A;  4O2H A;  1DET A;  2W56 B;  1O7G B;  3MSO A;  1US1 A;  2IA7 A;  4WFO A;  1WNH A;  3LT9 A;  2L1S A;  4HM5 B;  1B2X A;  2STD A;  2F5M A;  3B4P A;  1RNB A;  1G96 A;  7RNT A;  1OCV A;  5I97 A;  1I2E A;  2F4Y A;  4BIR A;  3V99 A;  2C10 A;  3ALA A;  1TP6 A;  4HM0 B;  2HML B;  2UX0 A;  2GEY A;  2R4I A;  1SQW A;  3ZFZ A;  4H61 A;  3WOF B;  1VQ9 3;  4J8T A;  3CCJ 3;  3WOD G;  3WA2 X;  3EBT A;  5LC6 A;  2YFL B;  1IVW A;  2BT3 A;  3FF2 A;  2M7O A;  1QAF A;  1S5A A;  2XF3 A;  1IQY A;  6RNT A;  3NHX A;  3CCV 3;  4HOH A;  5IG4 A;  3LTD A;  1LOW A;  2CFL A;  6STD A;  4RZM A;  3FSD A;  1EEJ A;  1Q7Y 4;  1GY7 A;  1OF5 A;  1IVV A;  4MMX B;  2CFK A;  3K9M C;  1X1Y A;  2F98 A;  1B3S A;  1KQS 2;  1IVU A;  3Q3F A;  1VQL 3;  3NM7 A;  3GZY B;  1TFK A;  3GWR A;  1RRH A;  3MKI A;  4IPB A;  4KFF A;  3CMA 3;  1B27 A;  5IG5 A;  3JUM A;  1LQM B;  3L0R A;  3GRD A;  1WQL B;  1IT8 A;  1N8Q A;  2JDI H;  2WGQ A;  3N8B A;  3MYT A;  2F99 A;  3OWU A;  3NX0 A;  3KSE D;  3PGB A;  1I8V A;  2AAE A;  2XGN A;  4RNT A;  2P05 A;  2SAR A;  2YFJ B;  5KP4 A;  1B2S A;  3NM2 A;  5FW5 A;  2CH9 A;  3V98 A;  1FUW A;  2KF4 A;  2YFI B;  1GD3 A;  3EJV A;  3LTC A;  5CXO A;  1KC8 4;  4HZ9 B;  4R1K A;  8RNT A;  5RNT A;  2W2C A;  1I70 A;  4JF8 A;  1BOX A;  9RNT A;  1RN1 A;  3HK4 A;  3HII A;  3PCR A;  3FG1 A;  4N6L A;  1TU5 A;  3VGN A;  1DMM A;  1G02 A;  3TDG A;  4R9L A;  3D9R A;  3NV0 A;  1BRG A;  1IVX A;  3WR2 A;  1RGC A;  5GSP A;  1YHQ 3;  4L8O A;  1ZO2 A;  1HU9 A;  3LYG A;  1BSA A;  5AIH A;  5IER A;  4OVM A;  3FG3 A;  1RGA A;  1RMS A;  4I4K A;  5AIG A;  1ROV A;  2CX1 A;  2HMJ B;  3LML A;  5M1A A;  4BL2 A;  1IU7 A;  1JNQ A;  1CYV A;  4HYZ A;  4GHO A;  2WO0 A;  2MC8 A;  1PYL A;  3NQY A;  5BU4 A;  2Z76 A;  1TIJ A;  4K1U A;  1W01 A;  2QEX 3;  1GSP A;  1BAN A;  2IUK A;  2OOV C;  3DY5 A;  3CCU 3;  4IT7 A;  3QK9 A;  1JBT A;  5IG0 A;  3X3Z A;  4EV5 A;  2ZDJ A;  1GY5 A;  3BB9 A;  4STD A;  1AVL A;  3ZG5 A;  3EB8 A;  3KFQ C;  2CWU A;  4EYC A;  2IMJ A;  3KCH A;  1AV4 A;  3CME 3;  1ZX2 A;  1BRH A;  4HM8 B;  1JB5 A;  4EBG A;  1BAO A;  5JPU A;  2PZV A;  1BRS A;  2Z77 A;  3GZR A;  1NDO B;  4NPB A;  3RGR A;  2ZA4 A;  4WYK A;  1S72 3;  5CK6 A;  5A0O B;  1RGK A;  1DVC A;  1DE3 A;  4CDL A;  1YVS A;  2W56 A;  3OXA A;  3AGO A;  3BND A;  2J8X B;  2KF6 A;  4MMZ B;  2W9Q A;  2XFS A;  1OHS A;  2GXF A;  1IYY A;  5IW9 A;  3OX9 A;  1FGM A;  1WTH A;  2F56 A;  5AYS C;  5M18 A;  1OH0 A;  2KF3 A;  4HM1 B;  3SOA A;  1LNH A;  4N3V A;  1ISK A;  1RGF A;  2KAA A;  1BSE A;  1D6U A;  2XSO B;  1QAK A;  4MMY B;  1LXE A;  2D1W A;  3NBJ A;  3FCS B;  4GSP A;  1LVN A;  3DMC A;  1FGT A;  3RNT A;  3SX1 A;  1Y4K A;  4KVH A;  3JUP A;  1PU4 A;  3RGA A;  1CH0 A;  1JKG B;  1I3I A;  3BIR A;  3E99 A;  5BIR A;  1IV9 A;  1F8N A;  1RCK A;  2Y74 A;  1V57 A;  4FMD A;  3EBY A;  1UCL A;  1LRA A;  3LTB A;  1MNL A;  1Q7H A;  3GAX A;  5IF6 A;  1V74 A;  1PFP A;  1IV7 A;  1I0V A;  1UCI A;  2RSX A;  3JVC A;  3Q2P A;  3KE7 A;  1RKY A;  1GOU A;  3SYU A;  4HKV B;  1R4Y A;  2P0M A;  2ZHX B;  3EQQ B;  2W6J H;  3EC9 A;  3CCQ 3;  1DYU A;  2K3D A;  1FYS A;  1OAC A;  3WHO A;  2P0X A;  3MG2 A;  3WA3 A;  1QJG A;  2GEX A;  1GMR A;  1ULI B;  1VQ8 3;  1M9G A;  1RNT A;  3FZW A;  3N54 B;  4PEJ A;  1L5G B;  3WOE B;  4N6V 0;  2QA4 3;  1Q81 4;  2BMQ B;  3S28 A;  1BNJ A;  4LSO A;  1SPU A;  1YGW A;  1HYF A;  4H3U A;  1W6C A;  1BRJ A;  2L4V A;  4FMC A;  4KT3 B;  1QAL A;  1Q82 4;  1JRQ A;  4BU4 A;  1ULJ B;  4HZB B;  3G6E 3;  1BRK A;  1I2F A;  3F8X A;  1MGR A;  4XDV A; 
#chains in the Genus database with same CATH homology
 2IUJ A;  5G2G A;  3CD6 3;  3DGO A;  3LXU X;  4NHF A;  1E3V A;  3S27 A;  3SED A;  5D82 A;  2RGQ A;  1Q42 A;  2E2V A;  4HM4 B;  1WMN A;  2BMR B;  3NUV A;  2HMM B;  3OWY A;  1K28 A;  3BLZ A;  3HX8 A;  4AEQ A;  2XR8 B;  1YJN 3;  1J2B A;  1W6G A;  1SII A;  4LEH A;  1K73 4;  5IG3 A;  2K0M A;  4XBY A;  4N6N B;  1KWI A;  3X40 A;  1RN7 A;  4O8S A;  3Q90 A;  2OTJ 3;  2CIU A;  3CNX A;  3FKA A;  2OQE C;  3ER7 A;  3N9H A;  4OUQ A;  1YIT 3;  1N9E A;  2CC3 A;  1CEW I;  3HIG A;  5CF2 A;  4R80 A;  3K0Z A;  5BXQ A;  1IDP A;  3S5C A;  2QIY A;  3B4O A;  2KXG A;  1M90 4;  3CCM 3;  3I0Y A;  3EE1 A;  5HGR A;  5IEP A;  1OUN A;  4G1M B;  3RDE A;  1VQK 3;  1A2V A;  1O7N B;  1SJW A;  3PYJ A;  3UNL A;  1W2B 2;  4IIA A;  1Q40 B;  3CC7 3;  2HMK B;  2K54 A;  3UL6 A;  1A2K A;  2PNC A;  2QGU A;  3ECF A;  4R4K A;  3G71 3;  2O9U X;  5AII A;  1AR0 A;  5D83 A;  4OK0 A;  3S67 A;  3UB1 A;  1KSI A;  2E2T A;  2HMN B;  2W0Q A;  3EN1 B;  4AKY A;  3EHC A;  2JQ5 A;  1U5O A;  1O7H B;  3WDG B;  4JRF A;  2B24 B;  4GL6 A;  1OF5 B;  5JBS A;  1YJ9 3;  5EQL A;  5IEO A;  2YX9 A;  4WP5 A;  1JB2 A;  3VSY A;  1NB3 I;  1BUQ A;  1N5H A;  3X42 A;  2P09 A;  1OPY A;  2RFR A;  1VQP 3;  1R4C A;  3JUO A;  1GS3 A;  2FGT A;  1JKG A;  3VF1 A;  4U13 A;  4QWT A;  3IMA B;  1O7M B;  3FH1 A;  3DM8 A;  5AIF A;  3CC2 3;  1VQ7 3;  1W00 A;  5LC7 A;  3FLJ A;  1FGQ A;  2CG0 A;  3D3L A;  2C11 A;  3BNC A;  4N6O B;  1FA3 A;  3DZL A;  1CYU A;  5AI1 A;  1JV2 B;  3CPO A;  2B1X B;  7STD A;  1W7C A;  2A15 A;  1OGX A;  5AEU B;  1A67 A;  3FG4 A;  1EKM A;  1T5Y A;  4K90 B;  1KD1 4;  3KZT A;  1D6Z A;  4O02 B;  2BMO B;  1UUW B;  1FGR A;  2CFD A;  2XFT A;  3BNB A;  5AYR B;  4KFD A;  2Y73 A;  1W4N A;  1RRL A;  1DVD A;  3NV0 B;  3HI7 A;  3ROB A;  4K1V A;  5IEN A;  3H51 A;  3EF8 A;  4WHA A;  1UI7 A;  4RNY A;  2OCT A;  4HM6 B;  2V1L A;  1VZZ A;  4N6M A;  3CXC 2;  2XH9 A;  2CWT A;  2GU1 A;  4EC6 A;  1UUV B;  5BVB A;  2OOV A;  1GY6 A;  1HKX A;  1U8C B;  1VQ6 3;  3BNE A;  3OW2 2;  5JPP A;  2XRX B;  4R9K A;  1QVG 2;  4L8P A;  4KZ1 A;  3X3X A;  3FGY A;  3LTA A;  4FR9 A;  3UL5 A;  1VQM 3;  4K61 A;  2ML6 A;  3G4S 3;  1WMO A;  2CWV A;  2HMO B;  3G16 A;  1YI2 3;  3MG3 A;  3MPH A;  5CLK A;  1AVK A;  3AMO B;  3CU3 A;  3G8Z A;  1W6Y A;  1RJO A;  3IPT A;  3DUK A;  1NU3 A;  3LZA A;  4ORL A;  4WYK B;  3S29 A;  3SVA A;  2W9P A;  1CQS A;  3PZW A;  2WOF A;  4HM7 B;  1OHO A;  4LGQ A;  1M1K 4;  4XBX A;  3X41 A;  1ASK A;  1OGZ A;  4WWU C;  5ELJ A;  3UJM A;  1GYB A;  1W2Z A;  1STF I;  1YGE A;  3KII A;  4FMA A;  4XBT A;  2LYX A;  1IK3 A;  3CCS 3;  1DMN A;  1JN5 B;  3GZB A;  5ELU A;  1VQO 3;  2E2U A;  2XEP A;  4BTX A;  3I55 3;  3NXJ A;  3MG1 A;  1N9J A;  3WMD A;  1EA2 A;  1GD4 A;  1YVB I;  4FCM A;  1Q40 A;  3F40 A;  2XGL A;  4TX4 A;  3KN4 A;  4N6U A;  3JUQ A;  5EEO A;  2LQV A;  3OV4 A;  3PXM A;  1FGO A;  3F8H A;  1ROA A;  4CCV A;  3K63 A;  3HZP A;  1YIJ 3;  1QMA A;  2CFG A;  4AKZ A;  3Q1C A;  1STD A;  3H3H A;  3JUN A;  4XDW A;  1K9M 4;  3O8Y A;  2Z6B A;  2MF7 A;  1EG9 B;  4XB5 A;  1VQ5 3;  4HM2 B;  4LMI A;  3DXO A;  3F7X A;  1LOX A;  1JB4 A;  1NWW A;  1W5Z A;  1OHP A;  1WMP A;  2F86 B;  3NQZ A;  2WGO A;  4KFE A;  3V92 A;  4EV2 A;  1N8R 4;  1VQN 3;  5TGN A;  1A90 A;  4MJD A;  2BO9 B;  2D42 A;  3MWZ A;  1K41 A;  3X3Y A;  2CK3 H;  3QRD A;  2BNG A;  3STD A;  3NBR A;  3A76 A;  3CNM A;  4X2H A;  3LT8 A;  2CHC A;  2W04 A;  3SLU A;  3F14 A;  4BTW A;  1MOL A;  1Q86 4;  1IT7 A;  2CKF B;  3IJE B;  3SOY A;  1TFO A;  2XSH B;  4HM3 B;  3KKG A;  1JJ2 2;  3M8C A;  5DRV A;  4HBR A;  1SIH A;  5FGO A;  1IQX A;  1VQ4 3;  2OQE A;  8CHO A;  2ML5 A;  3CCE 3;  4O3V A;  1NB5 I;  4FMB A;  3U97 A;  1E3R A;  4Q53 A;  1NO3 A;  4XM4 A;  3F9S A;  2WOH A;  2SBL A;  1O7W B;  1Z1S A;  3MHE A;  3B8L A;  5D81 A;  2CG1 A;  2OTL 3;  3LH4 A;  4ZM8 A;  2GBX B;  5STD A;  3EX9 A;  1C7H A;  3J7Y d;  1DMQ A;  2GBW B;  4LZI A;  4BTY A;  3G0K A;  5KP1 A;  3T0U A;  4J9A A;  2INX A;  3KSP A;  3LOY A;  4NRE A;  1QVF 2;  1W02 A;  2BHM A;  1E97 A;  4MEI A;  3GZX B;  3B7C A;  2KRT A;  3AMO A;  5DRE A;  1K8A 4;  1EQK A;  4RBN A;  3F7S A;  2OWP A;  3DGM A;  3DGN A;  2I9W A;  1NJI 4;  2FXT A;  1N5P A;  3PS8 A;  2O3O A;  4L7K A;  1IQ8 A;  3CCR 3;  3NBB A;  3I56 3;  3K5T A;  4HJL B;  1M1X B;  1UI8 A;  2Q07 A;  3FF0 A;  3PCS A;  4RNZ A;  5EVH A;  3CCL 3;  2FNQ A;  3T8U A;  3T8N A;  4GB5 A;  2W03 A;  5CF1 A;  4EXR A;  2Z7A A;  3K7C A;  1JN5 A;  2CFW A;  4N6T A;  2CW9 A;  3DGL A;  1YJW 3;  4X2O A;  5KP3 A;  3SXX A;  2ZL8 A;  3CPW 2;  2P38 A;  2RCD A;  1UW1 A;  5AEW B;  4FCZ A;  2GU3 A;  2KCD A;  1O7P B;  1D6Y A;  3U1W A;  4FCJ A;  3OWS A;  3CC4 3;  1TUH A;  3EN8 A;  4O2H A;  2W56 B;  1O7G B;  3MSO A;  1US1 A;  2IA7 A;  4WFO A;  1WNH A;  3LT9 A;  4HM5 B;  2STD A;  3B4P A;  1G96 A;  5I97 A;  1OCV A;  3V99 A;  2C10 A;  3ALA A;  1TP6 A;  4HM0 B;  2HML B;  2UX0 A;  2GEY A;  2R4I A;  1SQW A;  4H61 A;  3WOF B;  1VQ9 3;  4J8T A;  3CCJ 3;  3WOD G;  3WA2 X;  3EBT A;  5LC6 A;  2YFL B;  1IVW A;  2BT3 A;  3FF2 A;  2M7O A;  1QAF A;  1S5A A;  2XF3 A;  1IQY A;  3NHX A;  3CCV 3;  5IG4 A;  3LTD A;  2CFL A;  6STD A;  4RZM A;  3FSD A;  1Q7Y 4;  1GY7 A;  1OF5 A;  1IVV A;  4MMX B;  2CFK A;  3K9M C;  2F98 A;  1KQS 2;  1IVU A;  1VQL 3;  3NM7 A;  3GZY B;  1TFK A;  3GWR A;  1RRH A;  3MKI A;  4IPB A;  4KFF A;  3CMA 3;  5IG5 A;  3JUM A;  3L0R A;  3GRD A;  1WQL B;  1IT8 A;  1N8Q A;  2JDI H;  2WGQ A;  3N8B A;  3MYT A;  2F99 A;  3OWU A;  3NX0 A;  3KSE D;  3PGB A;  2XGN A;  2P05 A;  2YFJ B;  5KP4 A;  3NM2 A;  5FW5 A;  1FUW A;  2CH9 A;  3V98 A;  2YFI B;  3LTC A;  1GD3 A;  3EJV A;  5CXO A;  1KC8 4;  4HZ9 B;  4R1K A;  2W2C A;  4JF8 A;  3PCR A;  3HK4 A;  3HII A;  3FG1 A;  4N6L A;  1TU5 A;  3VGN A;  1DMM A;  3TDG A;  4R9L A;  3D9R A;  3NV0 A;  1IVX A;  1YHQ 3;  4L8O A;  1ZO2 A;  1HU9 A;  3LYG A;  5AIH A;  5IER A;  4OVM A;  3FG3 A;  4I4K A;  5AIG A;  1ROV A;  2HMJ B;  3LML A;  1JNQ A;  1IU7 A;  1CYV A;  4HYZ A;  2WO0 A;  2MC8 A;  3NQY A;  2Z76 A;  1TIJ A;  4K1U A;  1W01 A;  2QEX 3;  2OOV C;  2IUK A;  3DY5 A;  3CCU 3;  4IT7 A;  3QK9 A;  5IG0 A;  3X3Z A;  4EV5 A;  2ZDJ A;  1GY5 A;  3BB9 A;  4STD A;  1AVL A;  3EB8 A;  3KFQ C;  2CWU A;  4EYC A;  2IMJ A;  1AV4 A;  3CME 3;  1ZX2 A;  4HM8 B;  1JB5 A;  4EBG A;  5JPU A;  2PZV A;  2Z77 A;  3GZR A;  3RGR A;  1NDO B;  1S72 3;  4WYK A;  5CK6 A;  5A0O B;  1DVC A;  4CDL A;  2W56 A;  3OXA A;  3BND A;  4MMZ B;  2W9Q A;  2XFS A;  1OHS A;  2GXF A;  5IW9 A;  3OX9 A;  1FGM A;  1WTH A;  5AYS C;  1OH0 A;  4HM1 B;  3SOA A;  1LNH A;  4N3V A;  1ISK A;  1D6U A;  2XSO B;  1QAK A;  4MMY B;  1LXE A;  2D1W A;  3NBJ A;  3FCS B;  1LVN A;  3DMC A;  1FGT A;  3SX1 A;  1Y4K A;  4KVH A;  3JUP A;  1PU4 A;  3RGA A;  3E99 A;  1JKG B;  1IV9 A;  1F8N A;  2Y74 A;  4FMD A;  3EBY A;  3LTB A;  1MNL A;  3GAX A;  5IF6 A;  1V74 A;  1PFP A;  1IV7 A;  2RSX A;  3JVC A;  3Q2P A;  1RKY A;  3KE7 A;  4HKV B;  2P0M A;  3EQQ B;  2W6J H;  3EC9 A;  3CCQ 3;  1DYU A;  1OAC A;  2P0X A;  3MG2 A;  3WA3 A;  1QJG A;  2GEX A;  1ULI B;  1VQ8 3;  1M9G A;  3N54 B;  3FZW A;  4PEJ A;  2QA4 3;  1L5G B;  3WOE B;  4N6V 0;  1Q81 4;  2BMQ B;  3S28 A;  4LSO A;  1SPU A;  4H3U A;  1W6C A;  4FMC A;  1QAL A;  1Q82 4;  1JRQ A;  1ULJ B;  4HZB B;  3G6E 3;  4HVN A;  3F8X A;  2L4V A;  4XDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...