5IEOA

Structure of cdl2.3a, a computationally designed vitamin-d3 binder
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
118
Chain Sequence
LPTAHEAIEAALADFVKVYNSKDAAGVASKYMDDAVIFPLDMARVDGRQNIQKLWQGLMDMGVSEPKFTTLNVQESGDFAFESGSFSLKGPVDIAGIYVEVWRKGGWKLYRTIANLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDL2.3a
publication title Structure of CDL2.3a, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 37
structure length 118
sequence length 127
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ieoA00
2INXA 3VGNA 2CHCA 1GYBA 3NHXA 3CNXA 4X2HA 3JUOA 3T8UA 5FW5A 2R4IA 3NXJA 4L8PA 1TP6A 2QIYA 4RZMA 3MHEA 3H51A 2Z77A 2YFLB 4J8TA 5STDA 3LZAA 4XDWA 4Q53A 1DMQA 1Z1SA 4KVHA 5KP1A 3B4PA 1JN5B 5AEWB 4XBXA 3H3HA 3EJVA 3MSOA 1STDA 1GY6A 2UX0A 2GXFA 5AIHA 5JPUA 3G8ZA 4WWUC 5IG5A 2GEYA 3OV4A 3A76A 4WYKA 4X2OA 4HZBB 4L7KA 3VSYA 3EN8A 4MJDA 3FF2A 3GZRA 1K41A 4HM5B 1QMAA 2RFRA 1U5OA 1W01A 2RGQA 5D81A 4XM4A 2B24B 3D9RA 3EHCA 3OX9A 3CNMA 1EA2A 3F40A 1W02A 1A2KA 5IEOA 4J9AA 3MKIA 1E97A 2HMMB 3NM2A 1EG9B 3GZXB 5BVBA 1VZZA 3KE7A 3FSDA 5DRVA 5HGRA 2HMJB 4HM3B 2W2CA 3IPTA 1OHSA 3NBRA 4LMIA 3F9SA 3CU3A 3M8CA 2GBWB 4I4KA 3STDA 1OF5B 4OUQA 5CK6A 1JKGB 1OCVA 1OHPA 3UNLA 1DMMA 1Q40A 2Z76A 5IG4A 4XBYA 3MYTA 3T8NA 2RCDA 3MG2A 1GS3A 4N3VA 2GBXB 4U13A 3NV0B 4ORLA 5AIGA 3SEDA 4IIAA 5IERA 2OWPA 1ASKA 4HZ9B 3F8XA 4K1UA 2PZVA 3K7CA 3EQQB 7STDA 3EC9A 3RGAA 1GY5A 3FH1A 2A15A 2QGUA 1NDOB 3LYGA 4HM6B 1QJGA 4H3UA 3DXOA 3UJMA 5AEUB 2XRXB 4R9LA 3OWSA 3BLZA 4STDA 3FLJA 3E99A 1CQSA 3JUPA 1TUHA 1GY7A 1O7NB 1ZX2A 1ISKA 3EF8A 1O7HB 5D83A 5TGNA 5JPPA 4HM8B 2BMRB 1O7WB 4XDVA 3G16A 1OGZA 3FGYA 5AIFA 4HJLB 3FZWA 5CLKA 5CXOA 3WMDA 1NU3A 3S5CA 5IF6A 1E3VA 1O7MB 1OHOA 4GB5A 3GZYB 3GWRA 1UUVB 1JB2A 3OWUA 3OWYA 3ER7A 2YFIB 1NWWA 3F7XA 1W6YA 3ROBA 2XR8B 1ZO2A 4LGQA 4LEHA 1UUWB 5BXQA 4HM1B 1OH0A 1ULIB 1E3RA 5EVHA 3GZBA 3KSPA 2HMOB 3Q90A 2JQ5A 1JN5A 8CHOA 3SOAA 6STDA 2STDA 4HKVB 5AI1A 1JB5A 1OUNA 5G2GA 2F98A 3EX9A 1JB4A 2Z7AA 3MG1A 3MG3A 1Q40B 4R9KA 3DM8A 4FCJA 4CDLA 1C7HA 2I9WA 1HKXA 3B4OA 3DMCA 1OGXA 2CKFB 3EN1B 1OPYA 2YFJB 3G0KA 3JUQA 5DREA 2BMQB 5AIIA 4WP5A 3HX8A 3B7CA 2BNGA 1IDPA 4R1KA 4PEJA 2BMOB 2IMJA 2GEXA 3DUKA 5KP3A 3JUNA 3NUVA 4OVMA 3ECFA 3JUMA 2HMNB 1AR0A 1S5AA 2K54A 3CPOA 4K1VA 2HMKB 1SJWA 4WYKB 3B8LA 5CF2A 3GRDA 3EBTA 3KKGA 2F86B 5KP4A 2F99A 1WQLB 3HK4A 1Q42A 3I0YA 4HM2B 4L8OA 5CF1A 1DMNA 4XB5A 5IG3A 3OXAA 3EBYA 4FCMA 2HMLB 4HVNA 4HM0B 3BB9A 3RGRA 1W00A 1OF5A 2B1XB 3HZPA 5IG0A 1JKGA 2XSOB 3K0ZA 1O7GB 3KZTA 3DZLA 5IENA 5IEPA 3F14A 1O7PB 1BUQA 4XBTA 5D82A 4HM4B 2XSHB 4HM7B 3SOYA 3F7SA 3NV0A 1ULJB 3FF0A 3F8HA 3FKAA
chains in the Genus database with same CATH superfamily
2GU3A 2INXA 3VGNA 2CHCA 1GYBA 2LQVA 1D6UA 5LC6A 2F56A 3NHXA 1I2GA 3CNXA 4X2HA 1R4CA 1W4NA 3JUOA 1BRKA 1RDSA 2UUGC 3T8UA 3CXC2 2CIUA 5EQLA 2OQEA 4LZIA 5FW5A 1FW7A 2R4IA 3NXJA 1K28A 3CME3 3OW22 4L8PA 2L1SA 2MF7A 3WR2A 4CCVA 1YJ93 1TP6A 1BAOA 2J8XB 2QIYA 3HI7A 3CD63 3LTBA 4RZMA 3MHEA 1HYFA 1I2EA 3UL6A 4EV2A 3PXMA 3H51A 2Z77A 2YFLB 1TU5A 1KC84 4J8TA 3CCQ3 5G1KA 5STDA 3LZAA 4XDWA 4Q53A 2K3DA 2K0MA 1V58A 1DMQA 1OACA 1Z1SA 2IA7A 4KVHA 3ZG5A 3DGLA 1MGWA 2D1WA 1DVDA 1VQL3 5A0OB 5KP1A 3B4PA 4DKIA 2P0MA 3K5TA 1JN5B 2XGNA 2Y74A 4BTXA 5AEWB 1NB5I 1A67A 4XBXA 2XH9A 3H3HA 2CG1A 1A90A 2WGOA 3EJVA 1Q9EA 2XGLA 5IW9A 3MSOA 1I0XA 1B21A 1AV4A 1TTOA 4JRFA 1STDA 1JBRA 1BNRA 1GY6A 2UX0A 6GSPA 2GXFA 5AIHA 1UCIA 5JPUA 3G8ZA 3ZFZA 3N8BA 3KSED 1IQYA 5ELJA 3LXUX 3BNCA 4WWUC 5IG5A 1UCJA 3I563 2E2UA 1BRSA 2GEYA 3OV4A 3A76A 4H61A 1BRHA 4WYKA 4X2OA 1RJOA 4IPBA 4HZBB 1EEJA 1V57A 2OCTA 1VQM3 2CWUA 4L7KA 1YNVX 4RNZA 2W04A 4LSOA 3VSYA 1KQS2 1BANA 1BVIA 3EN8A 4MJDA 3AMOB 3V99A 3LMLA 3FF2A 1NO3A 3WOEB 2C11A 3GZRA 1GD4A 1K41A 4HM5B 1BUJA 1BRGA 1QMAA 2P38A 2RFRA 2CFWA 1U5OA 1N8QA 3FG1A 4KZ1A 2IUJA 1JZOA 1YVBI 5EEOA 1BSCA 1QAFA 1W01A 2RGQA 5D81A 1IVWA 3CC73 4XM4A 2BT3A 2B24B 3D9RA 3EHCA 2XFSA 3OX9A 4GL6A 3CNMA 1EA2A 1NB3I 1W6CA 1RKYA 1RGCA 3F40A 1IQ8A 1EUIC 4GHOA 1W02A 4ZM8A 1WTHA 3LTCA 1RCLA 1A2KA 1TFOA 1FUTA 3X40A 4BIRA 1IK3A 1N9JA 5IEOA 1VQ83 4CPKA 1B2XA 4J9AA 4N6V0 3MKIA 3V98A 1GSPA 1US1A 2Z6BA 1B3SA 2ML5A 4KFDA 1E97A 3T0UA 2HMMB 9RNTA 1I0VA 1X1XA 3NM2A 4AKYA 4CJNA 1EG9B 3GZXB 5BVBA 1VZZA 3KE7A 2CW9A 3FSDA 3SVAA 1WMNA 1V74A 3PZWA 5DRVA 1YIJ3 3J7Yd 1RN4A 2RSXA 5HGRA 2W9PA 1JBSA 1IVVA 1A2VA 4R80A 3UB1A 4TX4A 1ZGXA 2HMJB 2R41A 2CFDA 4HM3B 1I2FA 3CCJ3 3MWZA 4KFEA 1PY3A 2W2CA 4RBNA 3IPTA 1M1XB 1QALA 3CMA3 3CCS3 1QVG2 1OHSA 1QVF2 4O02B 3NBRA 5ELUA 4FMDA 1RNBA 3RNTA 4LMIA 2JDIH 1I70A 1RGAA 1IVXA 1B20A 3F9SA 3WODG 3CU3A 2QA43 1RLSA 1N5PA 3DGOA 3CCE3 3U1WA 4AKZA 2L4VA 3M8CA 3BNBA 2GBWB 4I4KA 1W2B2 1FA3A 1YGWA 4BL3A 1N8R4 1BRNL 3STDA 1OF5B 2C4BA 1LOXA 3BNEA 4OUQA 5CK6A 1Q7HA 2CX0A 1JKGB 1OCVA 1UGIA 1OHPA 3UNLA 2RBIA 4N6OB 1DMMA 3S28A 1W5ZA 1Q40A 5AYRB 2W0QA 1L5GB 2Z76A 1YIT3 4EV5A 2P0XA 1BNEA 3SXXA 5IG4A 2E2TA 4XBYA 1BRJA 1F8NA 1T2HA 2CC3A 1PU4A 2OOVC 1U8CB 3HIIA 1RN7A 3MYTA 4WHAA 1BIRA 3T8NA 3I553 2RCDA 3MG2A 1GS3A 1X1YA 4N3VA 2GBXB 3WOFB 1EQKA 2ZDJA 1RRLA 4U13A 1A2PA 2ZL8A 3NV0B 1N5HA 3S67A 4ORLA 5AIGA 3SEDA 1MWTA 4IIAA 4AEQA 5HOHA 2OWPA 1ASKA 5IERA 2KF3A 1VQ73 3LT9A 3X3XA 1UI8A 4HZ9B 2KRTA 1FUSA 1FYSA 1UDII 3X41A 3LH4A 3F8XA 3KIIA 4K1UA 2PZVA 3K7CA 6RNTA 1X1WA 3NX0A 3EQQB 1W6GA 3EC9A 7STDA 1UUGB 4IT7A 3RGAA 3WA2X 3CCU3 1GY5A 3FH1A 5GSPA 2A15A 2QGUA 1IQXA 1NDOB 1ROVA 4EC6A 2ZA4A 3LYGA 4HM6B 1AY7A 2XFTA 3D5GA 3NQZA 5BU4A 1RGKA 1QJGA 4H3UA 3D5IA 1J2BA 1MWSA 1AQZA 1SPUA 2YX9A 3U97A 1W7CA 3DXOA 4MEIA 3UJMA 4BTYA 5AEUB 3CCL3 2XRXB 1AVLA 1LNHA 1MWRA 1FUWA 4R9LA 3MPHA 1WMOA 2FXTA 3OWSA 4KFFA 1S723 4O3VA 3BLZA 4STDA 1M1K4 4MMZB 1DVCA 3FLJA 1ZS7A 1PYLA 3LTAA 1VQO3 3E99A 3D3LA 1B2SA 1Y4KA 1CQSA 2E2VA 1Q864 2QEX3 2WGQA 3JUPA 4MMXB 1TUHA 1RTUA 1I3FA 1DYUA 1GY7A 1LVNA 2IY2A 1D6YA 1MNLA 3KN4A 3S29A 1O7NB 1ZX2A 1GMPA 1ISKA 1N9EA 1O7HB 3EF8A 2W56A 3Q2PA 4MMYB 5D83A 5TGNA 3KCHA 1AVKA 5AYSC 5JPPA 4HM8B 2GU1A 2BMRB 3ZG0A 5M1AA 1T3BA 1UCKA 1LQMB 3GAXA 3NQYA 1BSEA 1O7WB 1LRAA 4XDVA 1JJ22 2KF6A 1M904 3AHWA 3G16A 3X3YA 1OGZA 2O9UX 3FGYA 3PCSA 5AIFA 5LC7A 1VQ53 2BHMA 4HJLB 3DGYA 1GOUA 4J5KA 3FZWA 5CLKA 5CXOA 3WMDA 1NU3A 1SARA 3PGBA 5M19A 1RGHA 3S27A 3PCRA 3HIGA 2H0HA 2ML6A 1K734 1LXEA 1C54A 3FG4A 2FNQA 1I3IA 3X42A 2WOHA 1MGRA 1RCKA 1TRQA 1B2MA 1RMSA 1STFI 3GSPA 3S5CA 1JNQA 5IF6A 3D4AA 3CCR3 3LTDA 1E3VA 1O7MB 1B27A 3O8YA 4R4KA 1UW1A 2RNTA 1RGGA 4N6TA 1G96A 3G713 4HOHA 2P05A 1GMQA 1OHOA 1TIJA 4GB5A 3GZYB 3GWRA 4RNYA 3CPW2 1UUVB 2D42A 1D6ZA 1JB2A 3BNDA 4NHFA 3OWUA 3QK9A 4O8SA 3UL5A 1BNGA 3OWYA 3ER7A 4J5GA 2YFIB 1NWWA 1RGFA 1M9GA 2AAEA 2W9QA 3A5EA 3AGOA 3F7XA 1W6YA 3HOHA 3ROBA 1BGSA 1RGLA 2XR8B 1FGOA 1VQQA 3CCV3 2BIRA 3BIRA 3VF1A 2FGTA 3PS8A 1ZO2A 3QRDA 4LGQA 4LEHA 1YHQ3 1UUWB 2OQEC 3NBBA 2P09A 2CG0A 2Q07A 4BU4A 2AADA 2O3OA 1FGMA 1BOXA 3IJEB 4HAAA 1W2ZA 5BXQA 2HOHA 4WFOA 4HM1B 2H0GA 4KT3B 1OH0A 1ULIB 1E3RA 5EVHA 2KF5A 4LYLB 3GZBA 3KSPA 3Q3FA 2OTL3 1X1UA 2HMOB 3AHSA 4O2HA 1UI7A 4N6MA 3WDGB 1LNIA 1VQ43 1EKMA 3FKAA 3Q90A 1BNFA 4RNTA 2M7OA 1CEWI 1CH0A 1RNTA 2CH9A 2KXGA 3EB8A 2JQ5A 1JRQA 4GSPA 1JN5A 1RSNA 3EE1A 3LOYA 4I5QA 4NREA 3DGMA 3SOAA 6STDA 2STDA 3ALAA 1K9M4 1JBTA 1B2ZA 4QWTA 3SYUA 2C10A 1B2UA 5M18A 1K8A4 1BNIA 3CCM3 1LOWA 4HKVB 1DE3A 5AI1A 1VQ93 5I97A 3URPA 1JZDA 4BL2A 1JB5A 1VQ63 1OUNA 2OTJ3 1FGTA 5G2GA 2F98A 2IYJA 2CWVA 3L0RA 1KSIA 3EX9A 1JB4A 1GOVA 1T2IA 2Y73A 1R4YA 1UCLA 2Z7AA 3MG1A 3MG3A 3BU4A 4FR9A 4HYZA 1FZUA 1Q40B 2MC8A 3G4S3 1BNSA 4R9KA 3K63A 3NBJA 3DM8A 2ZHXB 1SQWA 1SIIA 3FCSB 4FCJA 1C7HA 3AMOA 4CDLA 2I9WA 1BU4A 1HKXA 3B4OA 3DMCA 2OOVA 4BTWA 1OGXA 3CC43 2GSPA 3IMAB 2CKFB 3EN1B 1G0TA 7GSPA 8CHOA 3AGNA 1JV2B 1OPYA 2YFJB 4K90B 7RNTA 2KAAA 4K61A 1IVUA 4OK0A 3RDEA 3G0KA 3JUQA 5DREA 2WOFA 1RRHA 2IUKA 3DY5A 3SLUA 1YJW3 3N54B 1ROAA 3WHOA 1FGRA 2BMQB 5AIIA 4WP5A 8RNTA 4G1MB 1TRPA 4FMCA 3HX8A 1Q824 3B7CA 2XF3A 1BSDA 1LOYA 3CC23 1Q814 2BNGA 2H0IA 1IDPA 1LOVA 3D79A 4EW5A 4EXRA 1RGEA 4R1KA 4PEJA 2BMOB 2IMJA 3JVCA 1IV9A 1KWIA 2GEXA 2CFGA 1MOLA 3DUKA 5KP3A 3JUNA 3NUVA 1WMPA 4OVMA 1DETA 1NNVA 3ECFA 4FMAA 1VQN3 3LT8A 3JUMA 1HZ1A 2F5WA 2HMNB 2W03A 3G6E3 1AR0A 4EBGA 2SARA 1G02A 3KFQC 1S5AA 1NJI4 4N6UA 3X3ZA 2K54A 2PNCA 3DH2A 1QAKA 3CPOA 4K1VA 2HMKB 1SJWA 3V92A 4WYKB 1PFPA 1BSAA 4N6NB 2F4YA 3B8LA 5CF2A 1GOYA 4JF8A 3WA3A 1VQK3 3TDGA 3GRDA 2BU4A 3EBTA 2F5MA 3KKGA 5JBSA 1CYVA 2F86B 5KP4A 3NM7A 1YI23 3N9HA 2F99A 3PYJA 1T5YA 1WQLB 2CWTA 1TJDA 3DGNA 3HK4A 1SIHA 1Q42A 1GD3A 3SX1A 3I0YA 4HM2B 2SBLA 4L8OA 1IV7A 2W56B 5CF1A 1YJN3 4EYCA 1DMNA 4XB5A 5IG3A 5BIRA 1VQP3 3OXAA 3EBYA 4FCMA 2HMLB 2CFLA 1LQGC 1IYYA 1GMRA 4FMBA 1I8VA 4HVNA 4HM0B 3BB9A 3RGRA 1IU7A 1W00A 4HBRA 1OF5A 2B1XB 3HZPA 5IG0A 1JKGA 1Q7Y4 1CYUA 2XSOB 5RNTA 3K0ZA 1O7GB 1RN1A 3KZTA 3Q1CA 1BNJA 2CK3H 5FGOA 3DZLA 5IENA 1UGHI 1KD14 5IEPA 3F14A 1O7PB 1YVSA 1IT8A 2KF4A 2WO0A 1BUQA 2XEPA 3FG3A 4XBTA 5D82A 1WNHA 2UGIA 4FCZA 4NPBA 1MWUA 1HU9A 2CX1A 4HM4B 5G1LA 2XSHB 2W6JH 2KCDA 2BO9B 2LYXA 2V1LA 4HM7B 2CFKA 3SOYA 3F7SA 1TFKA 3NV0A 1BSBA 1IT7A 1BRIA 1YGEA 1ULJB 1RHLA 3FF0A 3K9MC 4ILFA 3F8HA 1FGQA 4N6LA
chains in the Genus database with same CATH topology
2GU3A 2INXA 3VGNA 2CHCA 1GYBA 2LQVA 1D6UA 5LC6A 3NHXA 3CNXA 4X2HA 1R4CA 1W4NA 3JUOA 3T8UA 3CXC2 2CIUA 5EQLA 2OQEA 4LZIA 5FW5A 2R4IA 3NXJA 1K28A 3CME3 3OW22 4L8PA 1YJ93 2MF7A 4CCVA 1TP6A 2QIYA 3HI7A 3CD63 3LTBA 4RZMA 3MHEA 3UL6A 4EV2A 3PXMA 3H51A 2Z77A 2YFLB 1TU5A 1KC84 4J8TA 3CCQ3 5STDA 3LZAA 4XDWA 4Q53A 2K0MA 1DMQA 1OACA 1Z1SA 2IA7A 4KVHA 3DGLA 2D1WA 1DVDA 1VQL3 5A0OB 5KP1A 3B4PA 2P0MA 3K5TA 1JN5B 2XGNA 2Y74A 4BTXA 5AEWB 1NB5I 1A67A 4XBXA 2XH9A 3H3HA 2CG1A 1A90A 2WGOA 3EJVA 2XGLA 5IW9A 3MSOA 1AV4A 4JRFA 1STDA 1GY6A 2UX0A 2GXFA 5AIHA 5JPUA 3G8ZA 3N8BA 3KSED 1IQYA 5ELJA 3LXUX 3BNCA 4WWUC 5IG5A 3I563 2E2UA 2GEYA 3OV4A 3A76A 4H61A 4WYKA 4X2OA 1RJOA 4IPBA 4HZBB 2OCTA 1VQM3 2CWUA 4L7KA 4RNZA 2W04A 4LSOA 3VSYA 1KQS2 3V99A 3EN8A 4MJDA 3AMOB 3LMLA 3FF2A 1NO3A 3WOEB 2C11A 3GZRA 1GD4A 1K41A 4HM5B 1QMAA 2P38A 2RFRA 2CFWA 1U5OA 1N8QA 3FG1A 4KZ1A 2IUJA 1YVBI 5EEOA 1QAFA 1W01A 2RGQA 5D81A 1IVWA 3CC73 4XM4A 2BT3A 2B24B 3D9RA 3EHCA 2XFSA 3OX9A 4GL6A 3CNMA 1EA2A 1NB3I 1W6CA 1RKYA 3F40A 1IQ8A 1W02A 4ZM8A 1WTHA 3LTCA 1A2KA 1TFOA 3X40A 1IK3A 1N9JA 5IEOA 1VQ83 4J9AA 4N6V0 3MKIA 3V98A 1US1A 2Z6BA 2ML5A 4KFDA 1E97A 3T0UA 2HMMB 3NM2A 4AKYA 1EG9B 3GZXB 5BVBA 1VZZA 3KE7A 2CW9A 3FSDA 3SVAA 1WMNA 1V74A 3PZWA 5DRVA 1YIJ3 3J7Yd 2RSXA 5HGRA 2W9PA 1IVVA 1A2VA 4R80A 3UB1A 4TX4A 2HMJB 2CFDA 4HM3B 3CCJ3 3MWZA 4KFEA 2W2CA 4RBNA 3IPTA 1M1XB 1QALA 3CMA3 3CCS3 1QVG2 1OHSA 1QVF2 4O02B 3NBRA 5ELUA 4FMDA 4LMIA 2JDIH 1IVXA 3F9SA 3WODG 2QA43 3CU3A 1N5PA 3DGOA 3CCE3 3U1WA 4AKZA 2L4VA 3M8CA 3BNBA 2GBWB 4I4KA 1W2B2 1FA3A 1N8R4 3STDA 1OF5B 1LOXA 3BNEA 4OUQA 5CK6A 1JKGB 1OCVA 1OHPA 3UNLA 4N6OB 1DMMA 3S28A 1W5ZA 1Q40A 5AYRB 2W0QA 1L5GB 2Z76A 1YIT3 4EV5A 2P0XA 3SXXA 5IG4A 2E2TA 4XBYA 1F8NA 2CC3A 1PU4A 2OOVC 1U8CB 3HIIA 1RN7A 3MYTA 4WHAA 3T8NA 3I553 2RCDA 3MG2A 1GS3A 4N3VA 2GBXB 3WOFB 1EQKA 2ZDJA 1RRLA 4U13A 2ZL8A 3NV0B 1N5HA 3S67A 4ORLA 5AIGA 3SEDA 4IIAA 4AEQA 5IERA 1VQ73 2OWPA 1ASKA 3LT9A 3X3XA 1UI8A 4HZ9B 2KRTA 3X41A 3LH4A 3F8XA 3KIIA 4K1UA 2PZVA 3K7CA 3NX0A 3EQQB 1W6GA 3EC9A 7STDA 4IT7A 3RGAA 3WA2X 3CCU3 1GY5A 3FH1A 2A15A 2QGUA 1IQXA 1NDOB 1ROVA 4EC6A 3LYGA 4HM6B 2XFTA 3NQZA 1QJGA 4H3UA 1J2BA 1SPUA 2YX9A 3U97A 1W7CA 3DXOA 4MEIA 3UJMA 4BTYA 5AEUB 3CCL3 2XRXB 1AVLA 1LNHA 1FUWA 4R9LA 3MPHA 1WMOA 2FXTA 3OWSA 4KFFA 1S723 4O3VA 3BLZA 4STDA 1M1K4 4MMZB 1DVCA 3FLJA 3LTAA 1VQO3 3E99A 3D3LA 1Y4KA 1CQSA 2E2VA 1Q864 2QEX3 2WGQA 3JUPA 4MMXB 1TUHA 1DYUA 1GY7A 1LVNA 1D6YA 1MNLA 3KN4A 3S29A 1O7NB 1ZX2A 1ISKA 1N9EA 1O7HB 3EF8A 2W56A 3Q2PA 4MMYB 5D83A 5TGNA 1AVKA 5AYSC 5JPPA 4HM8B 2GU1A 2BMRB 3GAXA 3NQYA 1O7WB 4XDVA 1JJ22 1M904 3G16A 3X3YA 1VQ53 1OGZA 2O9UX 3FGYA 3PCSA 5AIFA 5LC7A 2BHMA 4HJLB 3FZWA 5CLKA 5CXOA 3WMDA 1NU3A 3PGBA 3S27A 3PCRA 3HIGA 2ML6A 1K734 1LXEA 3FG4A 2FNQA 3X42A 2WOHA 1STFI 3CCR3 3S5CA 1JNQA 5IF6A 3LTDA 1E3VA 1O7MB 3O8YA 4R4KA 1UW1A 4N6TA 1G96A 3G713 2P05A 1OHOA 4RNYA 1TIJA 4GB5A 3GZYB 3GWRA 3CPW2 1UUVB 2D42A 1D6ZA 1JB2A 3BNDA 4NHFA 3OWUA 3QK9A 4O8SA 3UL5A 3OWYA 3ER7A 2YFIB 1NWWA 1M9GA 2W9QA 3F7XA 1W6YA 3ROBA 2XR8B 1FGOA 3CCV3 3VF1A 2FGTA 3PS8A 1ZO2A 3QRDA 4LGQA 4LEHA 1YHQ3 1UUWB 2OQEC 3NBBA 2P09A 2CG0A 2Q07A 2O3OA 1FGMA 3IJEB 1W2ZA 5BXQA 4WFOA 4HM1B 1OH0A 1ULIB 1E3RA 5EVHA 3GZBA 3KSPA 2OTL3 2HMOB 4O2HA 1UI7A 4N6MA 3WDGB 1VQ43 1EKMA 3FKAA 3Q90A 2M7OA 1CEWI 2KXGA 3EB8A 2CH9A 2JQ5A 1JRQA 1JN5A 3EE1A 8CHOA 3LOYA 4NREA 1K9M4 3DGMA 3SOAA 6STDA 2STDA 3ALAA 4QWTA 1K8A4 2C10A 3CCM3 4HKVB 5AI1A 1VQ93 5I97A 1JB5A 1VQ63 1OUNA 2OTJ3 1FGTA 5G2GA 2F98A 2CWVA 3L0RA 1KSIA 3EX9A 1JB4A 2Y73A 2Z7AA 3MG1A 3MG3A 4FR9A 4HYZA 2MC8A 1Q40B 3G4S3 4R9KA 3K63A 3NBJA 3DM8A 1SQWA 1SIIA 3FCSB 4FCJA 1C7HA 3AMOA 4CDLA 2I9WA 1HKXA 3B4OA 3DMCA 2OOVA 4BTWA 1OGXA 3CC43 3IMAB 2CKFB 3EN1B 1JV2B 1OPYA 2YFJB 4K90B 4K61A 1IVUA 4OK0A 3RDEA 3G0KA 3JUQA 5DREA 2WOFA 1RRHA 2IUKA 3DY5A 3SLUA 1YJW3 3N54B 1ROAA 1FGRA 2BMQB 5AIIA 4WP5A 4G1MB 4FMCA 1Q824 3HX8A 3B7CA 2XF3A 3CC23 1Q814 2BNGA 1IDPA 4EXRA 4R1KA 4PEJA 2BMOB 2IMJA 3JVCA 1IV9A 1KWIA 2GEXA 2CFGA 1MOLA 3DUKA 5KP3A 3JUNA 3NUVA 1WMPA 4OVMA 3ECFA 4FMAA 1VQN3 3LT8A 3JUMA 2W03A 2HMNB 3G6E3 1AR0A 4EBGA 3KFQC 1S5AA 1NJI4 4N6UA 3X3ZA 2K54A 2PNCA 1QAKA 3CPOA 4K1VA 2HMKB 1SJWA 3V92A 4WYKB 1PFPA 4N6NB 3WA3A 3B8LA 5CF2A 4JF8A 1VQK3 3TDGA 3GRDA 3EBTA 3KKGA 5JBSA 1CYVA 2F86B 5KP4A 3NM7A 1YI23 3N9HA 2F99A 3PYJA 1T5YA 1WQLB 2CWTA 3DGNA 3HK4A 1SIHA 1Q42A 1GD3A 3SX1A 3I0YA 4HM2B 2SBLA 4L8OA 1IV7A 2W56B 5CF1A 1YJN3 4EYCA 1DMNA 4XB5A 5IG3A 1VQP3 3OXAA 3EBYA 4FCMA 2HMLB 2CFLA 4FMBA 4HVNA 4HM0B 3BB9A 3RGRA 1IU7A 1W00A 4HBRA 1OF5A 2B1XB 3HZPA 5IG0A 1JKGA 1Q7Y4 1CYUA 2XSOB 3K0ZA 1O7GB 3KZTA 3Q1CA 2CK3H 5FGOA 3DZLA 5IENA 1KD14 5IEPA 3F14A 1O7PB 2WO0A 1IT8A 1BUQA 2XEPA 3FG3A 4XBTA 5D82A 1WNHA 4FCZA 1HU9A 4HM4B 2XSHB 2W6JH 2KCDA 2BO9B 2LYXA 2V1LA 4HM7B 2CFKA 3SOYA 3F7SA 1TFKA 3NV0A 1IT7A 1ULJB 1YGEA 3FF0A 3K9MC 3F8HA 1FGQA 4N6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INX A;  3VGN A;  2CHC A;  1GYB A;  3NHX A;  3CNX A;  4X2H A;  3JUO A;  3T8U A;  5FW5 A;  2R4I A;  3NXJ A;  4L8P A;  1TP6 A;  2QIY A;  4RZM A;  3MHE A;  3H51 A;  2Z77 A;  2YFL B;  4J8T A;  5STD A;  3LZA A;  4XDW A;  4Q53 A;  1DMQ A;  1Z1S A;  4KVH A;  5KP1 A;  3B4P A;  1JN5 B;  5AEW B;  4XBX A;  3H3H A;  3EJV A;  3MSO A;  1STD A;  1GY6 A;  2UX0 A;  2GXF A;  5AIH A;  5JPU A;  3G8Z A;  4WWU C;  5IG5 A;  2GEY A;  3OV4 A;  3A76 A;  4WYK A;  4X2O A;  4HZB B;  4L7K A;  3VSY A;  3EN8 A;  4MJD A;  3FF2 A;  3GZR A;  1K41 A;  4HM5 B;  1QMA A;  2RFR A;  1U5O A;  1W01 A;  2RGQ A;  5D81 A;  4XM4 A;  2B24 B;  3D9R A;  3EHC A;  3OX9 A;  3CNM A;  1EA2 A;  3F40 A;  1W02 A;  1A2K A;  5IEO A;  4J9A A;  3MKI A;  1E97 A;  2HMM B;  3NM2 A;  1EG9 B;  3GZX B;  5BVB A;  1VZZ A;  3KE7 A;  3FSD A;  5DRV A;  5HGR A;  2HMJ B;  4HM3 B;  2W2C A;  3IPT A;  1OHS A;  3NBR A;  4LMI A;  3F9S A;  3CU3 A;  3M8C A;  2GBW B;  4I4K A;  3STD A;  1OF5 B;  4OUQ A;  5CK6 A;  1JKG B;  1OCV A;  1OHP A;  3UNL A;  1DMM A;  1Q40 A;  2Z76 A;  5IG4 A;  4XBY A;  3MYT A;  3T8N A;  2RCD A;  3MG2 A;  1GS3 A;  4N3V A;  2GBX B;  4U13 A;  3NV0 B;  4ORL A;  5AIG A;  3SED A;  4IIA A;  5IER A;  2OWP A;  1ASK A;  4HZ9 B;  3F8X A;  4K1U A;  2PZV A;  3K7C A;  3EQQ B;  7STD A;  3EC9 A;  3RGA A;  1GY5 A;  3FH1 A;  2A15 A;  2QGU A;  1NDO B;  3LYG A;  4HM6 B;  1QJG A;  4H3U A;  3DXO A;  3UJM A;  5AEU B;  2XRX B;  4R9L A;  3OWS A;  3BLZ A;  4STD A;  3FLJ A;  3E99 A;  1CQS A;  3JUP A;  1TUH A;  1GY7 A;  1O7N B;  1ZX2 A;  1ISK A;  3EF8 A;  1O7H B;  5D83 A;  5TGN A;  5JPP A;  4HM8 B;  2BMR B;  1O7W B;  4XDV A;  3G16 A;  1OGZ A;  3FGY A;  5AIF A;  4HJL B;  3FZW A;  5CLK A;  5CXO A;  3WMD A;  1NU3 A;  3S5C A;  5IF6 A;  1E3V A;  1O7M B;  1OHO A;  4GB5 A;  3GZY B;  3GWR A;  1UUV B;  1JB2 A;  3OWU A;  3OWY A;  3ER7 A;  2YFI B;  1NWW A;  3F7X A;  1W6Y A;  3ROB A;  2XR8 B;  1ZO2 A;  4LGQ A;  4LEH A;  1UUW B;  5BXQ A;  4HM1 B;  1OH0 A;  1ULI B;  1E3R A;  5EVH A;  3GZB A;  3KSP A;  2HMO B;  3Q90 A;  2JQ5 A;  1JN5 A;  8CHO A;  3SOA A;  6STD A;  2STD A;  4HKV B;  5AI1 A;  1JB5 A;  1OUN A;  5G2G A;  2F98 A;  3EX9 A;  1JB4 A;  2Z7A A;  3MG1 A;  3MG3 A;  1Q40 B;  4R9K A;  3DM8 A;  4FCJ A;  4CDL A;  1C7H A;  2I9W A;  1HKX A;  3B4O A;  3DMC A;  1OGX A;  2CKF B;  3EN1 B;  1OPY A;  2YFJ B;  3G0K A;  3JUQ A;  5DRE A;  2BMQ B;  5AII A;  4WP5 A;  3HX8 A;  3B7C A;  2BNG A;  1IDP A;  4R1K A;  4PEJ A;  2BMO B;  2IMJ A;  2GEX A;  3DUK A;  5KP3 A;  3JUN A;  3NUV A;  4OVM A;  3ECF A;  3JUM A;  2HMN B;  1AR0 A;  1S5A A;  2K54 A;  3CPO A;  4K1V A;  2HMK B;  1SJW A;  4WYK B;  3B8L A;  5CF2 A;  3GRD A;  3EBT A;  3KKG A;  2F86 B;  5KP4 A;  2F99 A;  1WQL B;  3HK4 A;  1Q42 A;  3I0Y A;  4HM2 B;  4L8O A;  5CF1 A;  1DMN A;  4XB5 A;  5IG3 A;  3OXA A;  3EBY A;  4FCM A;  2HML B;  4HVN A;  4HM0 B;  3BB9 A;  3RGR A;  1W00 A;  1OF5 A;  2B1X B;  3HZP A;  5IG0 A;  1JKG A;  2XSO B;  3K0Z A;  1O7G B;  3KZT A;  3DZL A;  5IEN A;  5IEP A;  3F14 A;  1O7P B;  1BUQ A;  4XBT A;  5D82 A;  4HM4 B;  2XSH B;  4HM7 B;  3SOY A;  3F7S A;  3NV0 A;  1ULJ B;  3FF0 A;  3F8H A;  3FKA A; 
#chains in the Genus database with same CATH topology
 2GU3 A;  2INX A;  3VGN A;  2CHC A;  1GYB A;  2LQV A;  1D6U A;  5LC6 A;  2F56 A;  3NHX A;  1I2G A;  3CNX A;  4X2H A;  1R4C A;  1W4N A;  3JUO A;  1BRK A;  1RDS A;  2UUG C;  3T8U A;  3CXC 2;  2CIU A;  5EQL A;  2OQE A;  4LZI A;  5FW5 A;  1FW7 A;  2R4I A;  3NXJ A;  1K28 A;  3CME 3;  3OW2 2;  4L8P A;  2L1S A;  2MF7 A;  3WR2 A;  4CCV A;  1YJ9 3;  1TP6 A;  1BAO A;  2J8X B;  2QIY A;  3HI7 A;  3CD6 3;  3LTB A;  4RZM A;  3MHE A;  1HYF A;  1I2E A;  3UL6 A;  4EV2 A;  3PXM A;  3H51 A;  2Z77 A;  2YFL B;  1TU5 A;  1KC8 4;  4J8T A;  3CCQ 3;  5G1K A;  5STD A;  3LZA A;  4XDW A;  4Q53 A;  2K3D A;  2K0M A;  1V58 A;  1DMQ A;  1OAC A;  1Z1S A;  2IA7 A;  4KVH A;  3ZG5 A;  3DGL A;  1MGW A;  2D1W A;  1DVD A;  1VQL 3;  5A0O B;  5KP1 A;  3B4P A;  4DKI A;  2P0M A;  3K5T A;  1JN5 B;  2XGN A;  2Y74 A;  4BTX A;  5AEW B;  1NB5 I;  1A67 A;  4XBX A;  2XH9 A;  3H3H A;  2CG1 A;  1A90 A;  2WGO A;  3EJV A;  1Q9E A;  2XGL A;  5IW9 A;  3MSO A;  1I0X A;  1B21 A;  1AV4 A;  1TTO A;  4JRF A;  1STD A;  1JBR A;  1BNR A;  1GY6 A;  2UX0 A;  6GSP A;  2GXF A;  5AIH A;  1UCI A;  5JPU A;  3G8Z A;  3ZFZ A;  3N8B A;  3KSE D;  1IQY A;  5ELJ A;  3LXU X;  3BNC A;  4WWU C;  5IG5 A;  1UCJ A;  3I56 3;  2E2U A;  1BRS A;  2GEY A;  3OV4 A;  3A76 A;  4H61 A;  1BRH A;  4WYK A;  4X2O A;  1RJO A;  4IPB A;  4HZB B;  1EEJ A;  1V57 A;  2OCT A;  1VQM 3;  2CWU A;  4L7K A;  1YNV X;  4RNZ A;  2W04 A;  4LSO A;  3VSY A;  1KQS 2;  1BAN A;  1BVI A;  3EN8 A;  4MJD A;  3AMO B;  3V99 A;  3LML A;  3FF2 A;  1NO3 A;  3WOE B;  2C11 A;  3GZR A;  1GD4 A;  1K41 A;  4HM5 B;  1BUJ A;  1BRG A;  1QMA A;  2P38 A;  2RFR A;  2CFW A;  1U5O A;  1N8Q A;  3FG1 A;  4KZ1 A;  2IUJ A;  1JZO A;  1YVB I;  5EEO A;  1BSC A;  1QAF A;  1W01 A;  2RGQ A;  5D81 A;  1IVW A;  3CC7 3;  4XM4 A;  2BT3 A;  2B24 B;  3D9R A;  3EHC A;  2XFS A;  3OX9 A;  4GL6 A;  3CNM A;  1EA2 A;  1NB3 I;  1W6C A;  1RKY A;  1RGC A;  3F40 A;  1IQ8 A;  1EUI C;  4GHO A;  1W02 A;  4ZM8 A;  1WTH A;  3LTC A;  1RCL A;  1A2K A;  1TFO A;  1FUT A;  3X40 A;  4BIR A;  1IK3 A;  1N9J A;  5IEO A;  1VQ8 3;  4CPK A;  1B2X A;  4J9A A;  4N6V 0;  3MKI A;  3V98 A;  1GSP A;  1US1 A;  2Z6B A;  1B3S A;  2ML5 A;  4KFD A;  1E97 A;  3T0U A;  2HMM B;  9RNT A;  1I0V A;  1X1X A;  3NM2 A;  4AKY A;  4CJN A;  1EG9 B;  3GZX B;  5BVB A;  1VZZ A;  3KE7 A;  2CW9 A;  3FSD A;  3SVA A;  1WMN A;  1V74 A;  3PZW A;  5DRV A;  1YIJ 3;  3J7Y d;  1RN4 A;  2RSX A;  5HGR A;  2W9P A;  1JBS A;  1IVV A;  1A2V A;  4R80 A;  3UB1 A;  4TX4 A;  1ZGX A;  2HMJ B;  2R41 A;  2CFD A;  4HM3 B;  1I2F A;  3CCJ 3;  3MWZ A;  4KFE A;  1PY3 A;  2W2C A;  4RBN A;  3IPT A;  1M1X B;  1QAL A;  3CMA 3;  3CCS 3;  1QVG 2;  1OHS A;  1QVF 2;  4O02 B;  3NBR A;  5ELU A;  4FMD A;  1RNB A;  3RNT A;  4LMI A;  2JDI H;  1I70 A;  1RGA A;  1IVX A;  1B20 A;  3F9S A;  3WOD G;  3CU3 A;  2QA4 3;  1RLS A;  1N5P A;  3DGO A;  3CCE 3;  3U1W A;  4AKZ A;  2L4V A;  3M8C A;  3BNB A;  2GBW B;  4I4K A;  1W2B 2;  1FA3 A;  1YGW A;  4BL3 A;  1N8R 4;  1BRN L;  3STD A;  1OF5 B;  2C4B A;  1LOX A;  3BNE A;  4OUQ A;  5CK6 A;  1Q7H A;  2CX0 A;  1JKG B;  1OCV A;  1UGI A;  1OHP A;  3UNL A;  2RBI A;  4N6O B;  1DMM A;  3S28 A;  1W5Z A;  1Q40 A;  5AYR B;  2W0Q A;  1L5G B;  2Z76 A;  1YIT 3;  4EV5 A;  2P0X A;  1BNE A;  3SXX A;  5IG4 A;  2E2T A;  4XBY A;  1BRJ A;  1F8N A;  1T2H A;  2CC3 A;  1PU4 A;  2OOV C;  1U8C B;  3HII A;  1RN7 A;  3MYT A;  4WHA A;  1BIR A;  3T8N A;  3I55 3;  2RCD A;  3MG2 A;  1GS3 A;  1X1Y A;  4N3V A;  2GBX B;  3WOF B;  1EQK A;  2ZDJ A;  1RRL A;  4U13 A;  1A2P A;  2ZL8 A;  3NV0 B;  1N5H A;  3S67 A;  4ORL A;  5AIG A;  3SED A;  1MWT A;  4IIA A;  4AEQ A;  5HOH A;  2OWP A;  1ASK A;  5IER A;  2KF3 A;  1VQ7 3;  3LT9 A;  3X3X A;  1UI8 A;  4HZ9 B;  2KRT A;  1FUS A;  1FYS A;  1UDI I;  3X41 A;  3LH4 A;  3F8X A;  3KII A;  4K1U A;  2PZV A;  3K7C A;  6RNT A;  1X1W A;  3NX0 A;  3EQQ B;  1W6G A;  3EC9 A;  7STD A;  1UUG B;  4IT7 A;  3RGA A;  3WA2 X;  3CCU 3;  1GY5 A;  3FH1 A;  5GSP A;  2A15 A;  2QGU A;  1IQX A;  1NDO B;  1ROV A;  4EC6 A;  2ZA4 A;  3LYG A;  4HM6 B;  1AY7 A;  2XFT A;  3D5G A;  3NQZ A;  5BU4 A;  1RGK A;  1QJG A;  4H3U A;  3D5I A;  1J2B A;  1MWS A;  1AQZ A;  1SPU A;  2YX9 A;  3U97 A;  1W7C A;  3DXO A;  4MEI A;  3UJM A;  4BTY A;  5AEU B;  3CCL 3;  2XRX B;  1AVL A;  1LNH A;  1MWR A;  1FUW A;  4R9L A;  3MPH A;  1WMO A;  2FXT A;  3OWS A;  4KFF A;  1S72 3;  4O3V A;  3BLZ A;  4STD A;  1M1K 4;  4MMZ B;  1DVC A;  3FLJ A;  1ZS7 A;  1PYL A;  3LTA A;  1VQO 3;  3E99 A;  3D3L A;  1B2S A;  1Y4K A;  1CQS A;  2E2V A;  1Q86 4;  2QEX 3;  2WGQ A;  3JUP A;  4MMX B;  1TUH A;  1RTU A;  1I3F A;  1DYU A;  1GY7 A;  1LVN A;  2IY2 A;  1D6Y A;  1MNL A;  3KN4 A;  3S29 A;  1O7N B;  1ZX2 A;  1GMP A;  1ISK A;  1N9E A;  1O7H B;  3EF8 A;  2W56 A;  3Q2P A;  4MMY B;  5D83 A;  5TGN A;  3KCH A;  1AVK A;  5AYS C;  5JPP A;  4HM8 B;  2GU1 A;  2BMR B;  3ZG0 A;  5M1A A;  1T3B A;  1UCK A;  1LQM B;  3GAX A;  3NQY A;  1BSE A;  1O7W B;  1LRA A;  4XDV A;  1JJ2 2;  2KF6 A;  1M90 4;  3AHW A;  3G16 A;  3X3Y A;  1OGZ A;  2O9U X;  3FGY A;  3PCS A;  5AIF A;  5LC7 A;  1VQ5 3;  2BHM A;  4HJL B;  3DGY A;  1GOU A;  4J5K A;  3FZW A;  5CLK A;  5CXO A;  3WMD A;  1NU3 A;  1SAR A;  3PGB A;  5M19 A;  1RGH A;  3S27 A;  3PCR A;  3HIG A;  2H0H A;  2ML6 A;  1K73 4;  1LXE A;  1C54 A;  3FG4 A;  2FNQ A;  1I3I A;  3X42 A;  2WOH A;  1MGR A;  1RCK A;  1TRQ A;  1B2M A;  1RMS A;  1STF I;  3GSP A;  3S5C A;  1JNQ A;  5IF6 A;  3D4A A;  3CCR 3;  3LTD A;  1E3V A;  1O7M B;  1B27 A;  3O8Y A;  4R4K A;  1UW1 A;  2RNT A;  1RGG A;  4N6T A;  1G96 A;  3G71 3;  4HOH A;  2P05 A;  1GMQ A;  1OHO A;  1TIJ A;  4GB5 A;  3GZY B;  3GWR A;  4RNY A;  3CPW 2;  1UUV B;  2D42 A;  1D6Z A;  1JB2 A;  3BND A;  4NHF A;  3OWU A;  3QK9 A;  4O8S A;  3UL5 A;  1BNG A;  3OWY A;  3ER7 A;  4J5G A;  2YFI B;  1NWW A;  1RGF A;  1M9G A;  2AAE A;  2W9Q A;  3A5E A;  3AGO A;  3F7X A;  1W6Y A;  3HOH A;  3ROB A;  1BGS A;  1RGL A;  2XR8 B;  1FGO A;  1VQQ A;  3CCV 3;  2BIR A;  3BIR A;  3VF1 A;  2FGT A;  3PS8 A;  1ZO2 A;  3QRD A;  4LGQ A;  4LEH A;  1YHQ 3;  1UUW B;  2OQE C;  3NBB A;  2P09 A;  2CG0 A;  2Q07 A;  4BU4 A;  2AAD A;  2O3O A;  1FGM A;  1BOX A;  3IJE B;  4HAA A;  1W2Z A;  5BXQ A;  2HOH A;  4WFO A;  4HM1 B;  2H0G A;  4KT3 B;  1OH0 A;  1ULI B;  1E3R A;  5EVH A;  2KF5 A;  4LYL B;  3GZB A;  3KSP A;  3Q3F A;  2OTL 3;  1X1U A;  2HMO B;  3AHS A;  4O2H A;  1UI7 A;  4N6M A;  3WDG B;  1LNI A;  1VQ4 3;  1EKM A;  3FKA A;  3Q90 A;  1BNF A;  4RNT A;  2M7O A;  1CEW I;  1CH0 A;  1RNT A;  2CH9 A;  2KXG A;  3EB8 A;  2JQ5 A;  1JRQ A;  4GSP A;  1JN5 A;  1RSN A;  3EE1 A;  3LOY A;  4I5Q A;  4NRE A;  3DGM A;  3SOA A;  6STD A;  2STD A;  3ALA A;  1K9M 4;  1JBT A;  1B2Z A;  4QWT A;  3SYU A;  2C10 A;  1B2U A;  5M18 A;  1K8A 4;  1BNI A;  3CCM 3;  1LOW A;  4HKV B;  1DE3 A;  5AI1 A;  1VQ9 3;  5I97 A;  3URP A;  1JZD A;  4BL2 A;  1JB5 A;  1VQ6 3;  1OUN A;  2OTJ 3;  1FGT A;  5G2G A;  2F98 A;  2IYJ A;  2CWV A;  3L0R A;  1KSI A;  3EX9 A;  1JB4 A;  1GOV A;  1T2I A;  2Y73 A;  1R4Y A;  1UCL A;  2Z7A A;  3MG1 A;  3MG3 A;  3BU4 A;  4FR9 A;  4HYZ A;  1FZU A;  1Q40 B;  2MC8 A;  3G4S 3;  1BNS A;  4R9K A;  3K63 A;  3NBJ A;  3DM8 A;  2ZHX B;  1SQW A;  1SII A;  3FCS B;  4FCJ A;  1C7H A;  3AMO A;  4CDL A;  2I9W A;  1BU4 A;  1HKX A;  3B4O A;  3DMC A;  2OOV A;  4BTW A;  1OGX A;  3CC4 3;  2GSP A;  3IMA B;  2CKF B;  3EN1 B;  1G0T A;  7GSP A;  8CHO A;  3AGN A;  1JV2 B;  1OPY A;  2YFJ B;  4K90 B;  7RNT A;  2KAA A;  4K61 A;  1IVU A;  4OK0 A;  3RDE A;  3G0K A;  3JUQ A;  5DRE A;  2WOF A;  1RRH A;  2IUK A;  3DY5 A;  3SLU A;  1YJW 3;  3N54 B;  1ROA A;  3WHO A;  1FGR A;  2BMQ B;  5AII A;  4WP5 A;  8RNT A;  4G1M B;  1TRP A;  4FMC A;  3HX8 A;  1Q82 4;  3B7C A;  2XF3 A;  1BSD A;  1LOY A;  3CC2 3;  1Q81 4;  2BNG A;  2H0I A;  1IDP A;  1LOV A;  3D79 A;  4EW5 A;  4EXR A;  1RGE A;  4R1K A;  4PEJ A;  2BMO B;  2IMJ A;  3JVC A;  1IV9 A;  1KWI A;  2GEX A;  2CFG A;  1MOL A;  3DUK A;  5KP3 A;  3JUN A;  3NUV A;  1WMP A;  4OVM A;  1DET A;  1NNV A;  3ECF A;  4FMA A;  1VQN 3;  3LT8 A;  3JUM A;  1HZ1 A;  2F5W A;  2HMN B;  2W03 A;  3G6E 3;  1AR0 A;  4EBG A;  2SAR A;  1G02 A;  3KFQ C;  1S5A A;  1NJI 4;  4N6U A;  3X3Z A;  2K54 A;  2PNC A;  3DH2 A;  1QAK A;  3CPO A;  4K1V A;  2HMK B;  1SJW A;  3V92 A;  4WYK B;  1PFP A;  1BSA A;  4N6N B;  2F4Y A;  3B8L A;  5CF2 A;  1GOY A;  4JF8 A;  3WA3 A;  1VQK 3;  3TDG A;  3GRD A;  2BU4 A;  3EBT A;  2F5M A;  3KKG A;  5JBS A;  1CYV A;  2F86 B;  5KP4 A;  3NM7 A;  1YI2 3;  3N9H A;  2F99 A;  3PYJ A;  1T5Y A;  1WQL B;  2CWT A;  1TJD A;  3DGN A;  3HK4 A;  1SIH A;  1Q42 A;  1GD3 A;  3SX1 A;  3I0Y A;  4HM2 B;  2SBL A;  4L8O A;  1IV7 A;  2W56 B;  5CF1 A;  1YJN 3;  4EYC A;  1DMN A;  4XB5 A;  5IG3 A;  5BIR A;  1VQP 3;  3OXA A;  3EBY A;  4FCM A;  2HML B;  2CFL A;  1LQG C;  1IYY A;  1GMR A;  4FMB A;  1I8V A;  4HVN A;  4HM0 B;  3BB9 A;  3RGR A;  1IU7 A;  1W00 A;  4HBR A;  1OF5 A;  2B1X B;  3HZP A;  5IG0 A;  1JKG A;  1Q7Y 4;  1CYU A;  2XSO B;  5RNT A;  3K0Z A;  1O7G B;  1RN1 A;  3KZT A;  3Q1C A;  1BNJ A;  2CK3 H;  5FGO A;  3DZL A;  5IEN A;  1UGH I;  1KD1 4;  5IEP A;  3F14 A;  1O7P B;  1YVS A;  1IT8 A;  2KF4 A;  2WO0 A;  1BUQ A;  2XEP A;  3FG3 A;  4XBT A;  5D82 A;  1WNH A;  2UGI A;  4FCZ A;  4NPB A;  1MWU A;  1HU9 A;  2CX1 A;  4HM4 B;  5G1L A;  2XSH B;  2W6J H;  2KCD A;  2BO9 B;  2LYX A;  2V1L A;  4HM7 B;  2CFK A;  3SOY A;  3F7S A;  1TFK A;  3NV0 A;  1BSB A;  1IT7 A;  1BRI A;  1YGE A;  1ULJ B;  1RHL A;  3FF0 A;  3K9M C;  4ILF A;  3F8H A;  1FGQ A;  4N6L A; 
#chains in the Genus database with same CATH homology
 2GU3 A;  2INX A;  3VGN A;  2CHC A;  1GYB A;  2LQV A;  1D6U A;  5LC6 A;  3NHX A;  3CNX A;  4X2H A;  1R4C A;  1W4N A;  3JUO A;  3T8U A;  3CXC 2;  2CIU A;  5EQL A;  2OQE A;  4LZI A;  5FW5 A;  2R4I A;  3NXJ A;  1K28 A;  3CME 3;  3OW2 2;  4L8P A;  1YJ9 3;  2MF7 A;  4CCV A;  1TP6 A;  2QIY A;  3HI7 A;  3CD6 3;  3LTB A;  4RZM A;  3MHE A;  3UL6 A;  4EV2 A;  3PXM A;  3H51 A;  2Z77 A;  2YFL B;  1TU5 A;  1KC8 4;  4J8T A;  3CCQ 3;  5STD A;  3LZA A;  4XDW A;  4Q53 A;  2K0M A;  1DMQ A;  1OAC A;  1Z1S A;  2IA7 A;  4KVH A;  3DGL A;  2D1W A;  1DVD A;  1VQL 3;  5A0O B;  5KP1 A;  3B4P A;  2P0M A;  3K5T A;  1JN5 B;  2XGN A;  2Y74 A;  4BTX A;  5AEW B;  1NB5 I;  1A67 A;  4XBX A;  2XH9 A;  3H3H A;  2CG1 A;  1A90 A;  2WGO A;  3EJV A;  2XGL A;  5IW9 A;  3MSO A;  1AV4 A;  4JRF A;  1STD A;  1GY6 A;  2UX0 A;  2GXF A;  5AIH A;  5JPU A;  3G8Z A;  3N8B A;  3KSE D;  1IQY A;  5ELJ A;  3LXU X;  3BNC A;  4WWU C;  5IG5 A;  3I56 3;  2E2U A;  2GEY A;  3OV4 A;  3A76 A;  4H61 A;  4WYK A;  4X2O A;  1RJO A;  4IPB A;  4HZB B;  2OCT A;  1VQM 3;  2CWU A;  4L7K A;  4RNZ A;  2W04 A;  4LSO A;  3VSY A;  1KQS 2;  3V99 A;  3EN8 A;  4MJD A;  3AMO B;  3LML A;  3FF2 A;  1NO3 A;  3WOE B;  2C11 A;  3GZR A;  1GD4 A;  1K41 A;  4HM5 B;  1QMA A;  2P38 A;  2RFR A;  2CFW A;  1U5O A;  1N8Q A;  3FG1 A;  4KZ1 A;  2IUJ A;  1YVB I;  5EEO A;  1QAF A;  1W01 A;  2RGQ A;  5D81 A;  1IVW A;  3CC7 3;  4XM4 A;  2BT3 A;  2B24 B;  3D9R A;  3EHC A;  2XFS A;  3OX9 A;  4GL6 A;  3CNM A;  1EA2 A;  1NB3 I;  1W6C A;  1RKY A;  3F40 A;  1IQ8 A;  1W02 A;  4ZM8 A;  1WTH A;  3LTC A;  1A2K A;  1TFO A;  3X40 A;  1IK3 A;  1N9J A;  5IEO A;  1VQ8 3;  4J9A A;  4N6V 0;  3MKI A;  3V98 A;  1US1 A;  2Z6B A;  2ML5 A;  4KFD A;  1E97 A;  3T0U A;  2HMM B;  3NM2 A;  4AKY A;  1EG9 B;  3GZX B;  5BVB A;  1VZZ A;  3KE7 A;  2CW9 A;  3FSD A;  3SVA A;  1WMN A;  1V74 A;  3PZW A;  5DRV A;  1YIJ 3;  3J7Y d;  2RSX A;  5HGR A;  2W9P A;  1IVV A;  1A2V A;  4R80 A;  3UB1 A;  4TX4 A;  2HMJ B;  2CFD A;  4HM3 B;  3CCJ 3;  3MWZ A;  4KFE A;  2W2C A;  4RBN A;  3IPT A;  1M1X B;  1QAL A;  3CMA 3;  3CCS 3;  1QVG 2;  1OHS A;  1QVF 2;  4O02 B;  3NBR A;  5ELU A;  4FMD A;  4LMI A;  2JDI H;  1IVX A;  3F9S A;  3WOD G;  2QA4 3;  3CU3 A;  1N5P A;  3DGO A;  3CCE 3;  3U1W A;  4AKZ A;  2L4V A;  3M8C A;  3BNB A;  2GBW B;  4I4K A;  1W2B 2;  1FA3 A;  1N8R 4;  3STD A;  1OF5 B;  1LOX A;  3BNE A;  4OUQ A;  5CK6 A;  1JKG B;  1OCV A;  1OHP A;  3UNL A;  4N6O B;  1DMM A;  3S28 A;  1W5Z A;  1Q40 A;  5AYR B;  2W0Q A;  1L5G B;  2Z76 A;  1YIT 3;  4EV5 A;  2P0X A;  3SXX A;  5IG4 A;  2E2T A;  4XBY A;  1F8N A;  2CC3 A;  1PU4 A;  2OOV C;  1U8C B;  3HII A;  1RN7 A;  3MYT A;  4WHA A;  3T8N A;  3I55 3;  2RCD A;  3MG2 A;  1GS3 A;  4N3V A;  2GBX B;  3WOF B;  1EQK A;  2ZDJ A;  1RRL A;  4U13 A;  2ZL8 A;  3NV0 B;  1N5H A;  3S67 A;  4ORL A;  5AIG A;  3SED A;  4IIA A;  4AEQ A;  5IER A;  1VQ7 3;  2OWP A;  1ASK A;  3LT9 A;  3X3X A;  1UI8 A;  4HZ9 B;  2KRT A;  3X41 A;  3LH4 A;  3F8X A;  3KII A;  4K1U A;  2PZV A;  3K7C A;  3NX0 A;  3EQQ B;  1W6G A;  3EC9 A;  7STD A;  4IT7 A;  3RGA A;  3WA2 X;  3CCU 3;  1GY5 A;  3FH1 A;  2A15 A;  2QGU A;  1IQX A;  1NDO B;  1ROV A;  4EC6 A;  3LYG A;  4HM6 B;  2XFT A;  3NQZ A;  1QJG A;  4H3U A;  1J2B A;  1SPU A;  2YX9 A;  3U97 A;  1W7C A;  3DXO A;  4MEI A;  3UJM A;  4BTY A;  5AEU B;  3CCL 3;  2XRX B;  1AVL A;  1LNH A;  1FUW A;  4R9L A;  3MPH A;  1WMO A;  2FXT A;  3OWS A;  4KFF A;  1S72 3;  4O3V A;  3BLZ A;  4STD A;  1M1K 4;  4MMZ B;  1DVC A;  3FLJ A;  3LTA A;  1VQO 3;  3E99 A;  3D3L A;  1Y4K A;  1CQS A;  2E2V A;  1Q86 4;  2QEX 3;  2WGQ A;  3JUP A;  4MMX B;  1TUH A;  1DYU A;  1GY7 A;  1LVN A;  1D6Y A;  1MNL A;  3KN4 A;  3S29 A;  1O7N B;  1ZX2 A;  1ISK A;  1N9E A;  1O7H B;  3EF8 A;  2W56 A;  3Q2P A;  4MMY B;  5D83 A;  5TGN A;  1AVK A;  5AYS C;  5JPP A;  4HM8 B;  2GU1 A;  2BMR B;  3GAX A;  3NQY A;  1O7W B;  4XDV A;  1JJ2 2;  1M90 4;  3G16 A;  3X3Y A;  1VQ5 3;  1OGZ A;  2O9U X;  3FGY A;  3PCS A;  5AIF A;  5LC7 A;  2BHM A;  4HJL B;  3FZW A;  5CLK A;  5CXO A;  3WMD A;  1NU3 A;  3PGB A;  3S27 A;  3PCR A;  3HIG A;  2ML6 A;  1K73 4;  1LXE A;  3FG4 A;  2FNQ A;  3X42 A;  2WOH A;  1STF I;  3CCR 3;  3S5C A;  1JNQ A;  5IF6 A;  3LTD A;  1E3V A;  1O7M B;  3O8Y A;  4R4K A;  1UW1 A;  4N6T A;  1G96 A;  3G71 3;  2P05 A;  1OHO A;  4RNY A;  1TIJ A;  4GB5 A;  3GZY B;  3GWR A;  3CPW 2;  1UUV B;  2D42 A;  1D6Z A;  1JB2 A;  3BND A;  4NHF A;  3OWU A;  3QK9 A;  4O8S A;  3UL5 A;  3OWY A;  3ER7 A;  2YFI B;  1NWW A;  1M9G A;  2W9Q A;  3F7X A;  1W6Y A;  3ROB A;  2XR8 B;  1FGO A;  3CCV 3;  3VF1 A;  2FGT A;  3PS8 A;  1ZO2 A;  3QRD A;  4LGQ A;  4LEH A;  1YHQ 3;  1UUW B;  2OQE C;  3NBB A;  2P09 A;  2CG0 A;  2Q07 A;  2O3O A;  1FGM A;  3IJE B;  1W2Z A;  5BXQ A;  4WFO A;  4HM1 B;  1OH0 A;  1ULI B;  1E3R A;  5EVH A;  3GZB A;  3KSP A;  2OTL 3;  2HMO B;  4O2H A;  1UI7 A;  4N6M A;  3WDG B;  1VQ4 3;  1EKM A;  3FKA A;  3Q90 A;  2M7O A;  1CEW I;  2KXG A;  3EB8 A;  2CH9 A;  2JQ5 A;  1JRQ A;  1JN5 A;  3EE1 A;  8CHO A;  3LOY A;  4NRE A;  1K9M 4;  3DGM A;  3SOA A;  6STD A;  2STD A;  3ALA A;  4QWT A;  1K8A 4;  2C10 A;  3CCM 3;  4HKV B;  5AI1 A;  1VQ9 3;  5I97 A;  1JB5 A;  1VQ6 3;  1OUN A;  2OTJ 3;  1FGT A;  5G2G A;  2F98 A;  2CWV A;  3L0R A;  1KSI A;  3EX9 A;  1JB4 A;  2Y73 A;  2Z7A A;  3MG1 A;  3MG3 A;  4FR9 A;  4HYZ A;  2MC8 A;  1Q40 B;  3G4S 3;  4R9K A;  3K63 A;  3NBJ A;  3DM8 A;  1SQW A;  1SII A;  3FCS B;  4FCJ A;  1C7H A;  3AMO A;  4CDL A;  2I9W A;  1HKX A;  3B4O A;  3DMC A;  2OOV A;  4BTW A;  1OGX A;  3CC4 3;  3IMA B;  2CKF B;  3EN1 B;  1JV2 B;  1OPY A;  2YFJ B;  4K90 B;  4K61 A;  1IVU A;  4OK0 A;  3RDE A;  3G0K A;  3JUQ A;  5DRE A;  2WOF A;  1RRH A;  2IUK A;  3DY5 A;  3SLU A;  1YJW 3;  3N54 B;  1ROA A;  1FGR A;  2BMQ B;  5AII A;  4WP5 A;  4G1M B;  4FMC A;  1Q82 4;  3HX8 A;  3B7C A;  2XF3 A;  3CC2 3;  1Q81 4;  2BNG A;  1IDP A;  4EXR A;  4R1K A;  4PEJ A;  2BMO B;  2IMJ A;  3JVC A;  1IV9 A;  1KWI A;  2GEX A;  2CFG A;  1MOL A;  3DUK A;  5KP3 A;  3JUN A;  3NUV A;  1WMP A;  4OVM A;  3ECF A;  4FMA A;  1VQN 3;  3LT8 A;  3JUM A;  2W03 A;  2HMN B;  3G6E 3;  1AR0 A;  4EBG A;  3KFQ C;  1S5A A;  1NJI 4;  4N6U A;  3X3Z A;  2K54 A;  2PNC A;  1QAK A;  3CPO A;  4K1V A;  2HMK B;  1SJW A;  3V92 A;  4WYK B;  1PFP A;  4N6N B;  3WA3 A;  3B8L A;  5CF2 A;  4JF8 A;  1VQK 3;  3TDG A;  3GRD A;  3EBT A;  3KKG A;  5JBS A;  1CYV A;  2F86 B;  5KP4 A;  3NM7 A;  1YI2 3;  3N9H A;  2F99 A;  3PYJ A;  1T5Y A;  1WQL B;  2CWT A;  3DGN A;  3HK4 A;  1SIH A;  1Q42 A;  1GD3 A;  3SX1 A;  3I0Y A;  4HM2 B;  2SBL A;  4L8O A;  1IV7 A;  2W56 B;  5CF1 A;  1YJN 3;  4EYC A;  1DMN A;  4XB5 A;  5IG3 A;  1VQP 3;  3OXA A;  3EBY A;  4FCM A;  2HML B;  2CFL A;  4FMB A;  4HVN A;  4HM0 B;  3BB9 A;  3RGR A;  1IU7 A;  1W00 A;  4HBR A;  1OF5 A;  2B1X B;  3HZP A;  5IG0 A;  1JKG A;  1Q7Y 4;  1CYU A;  2XSO B;  3K0Z A;  1O7G B;  3KZT A;  3Q1C A;  2CK3 H;  5FGO A;  3DZL A;  5IEN A;  1KD1 4;  5IEP A;  3F14 A;  1O7P B;  2WO0 A;  1IT8 A;  1BUQ A;  2XEP A;  3FG3 A;  4XBT A;  5D82 A;  1WNH A;  4FCZ A;  1HU9 A;  4HM4 B;  2XSH B;  2W6J H;  2KCD A;  2BO9 B;  2LYX A;  2V1L A;  4HM7 B;  2CFK A;  3SOY A;  3F7S A;  1TFK A;  3NV0 A;  1IT7 A;  1ULJ B;  1YGE A;  3FF0 A;  3K9M C;  3F8H A;  1FGQ A;  4N6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...