1VQ73

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq7300
3CMA3 1K734 1YIJ3 1QVG2 1VQ93 1VQ83 3CCL3 1YJN3 1Q7Y4 1M1K4 1VQ63 1Q824 3CCQ3 2OTJ3 1KC84 3CCV3 1YIT3 3G713 1K9M4 1VQK3 3CCM3 1YJW3 1Q814 3I553 1KQS2 3CC73 3CCE3 3CC23 1YHQ3 1VQL3 2OTL3 3CCR3 3I563 3CCU3 1NJI4 1VQ73 3CCJ3 3G6E3 1YJ93 1YI23 1N8R4 3CXC2 3OW22 1Q864 3CCS3 1M904 2QEX3 1KD14 1VQN3 1JJ22 3CPW2 1K8A4 3CD63 3CME3 1VQ43 3CC43 1W2B2 2QA43 1QVF2 1VQO3 1VQP3 1VQ53 1S723 1VQM3 3G4S3
chains in the Genus database with same CATH superfamily
1TP6A 1DMQA 2B1XB 2CFDA 2IA7A 1AY7A 1QVG2 1LQGC 5BXQA 2BO9B 1NU3A 3EBYA 3CCL3 1CEWI 1JZDA 1LOVA 4EW5A 4WYKB 2WOFA 1RN7A 3TDGA 5KP4A 3GAXA 4R1KA 4HM5B 2D42A 1HKXA 1YHQ3 6GSPA 1E97A 1GMRA 2HMOB 2QA43 2P38A 3BNCA 2XGLA 4XB5A 3GZRA 4WYKA 4XDVA 3SLUA 3GZBA 4CCVA 2W9QA 1RCLA 1OF5A 2Q07A 1BAOA 3LT9A 5JBSA 2OWPA 1IVVA 3S29A 4KT3B 1UDII 4JRFA 2CH9A 3DXOA 3S5CA 8RNTA 3EF8A 3OWYA 3G4S3 2F98A 2V1LA 3NUVA 2P05A 1FGQA 3DM8A 3DGMA 1VQ93 4WFOA 3WDGB 1UGHI 3MG2A 2FXTA 1M1K4 1I2GA 3UL5A 1QAFA 1O7GB 2KF6A 4N6V0 4O8SA 5AI1A 1BSAA 3PGBA 3MHEA 3NM7A 3I553 2IMJA 2CKFB 3AMOA 4FMCA 5BIRA 3HX8A 3QK9A 1OHPA 1RHLA 3NQYA 2MC8A 4L8OA 3D4AA 3EQQB 5IF6A 1OACA 3T8NA 3HK4A 3CCJ3 1UI7A 1STDA 1IQXA 3SX1A 3V92A 1JN5B 3OXAA 3LTDA 3EC9A 1UUWB 1JJ22 1OUNA 6RNTA 1BIRA 1GD3A 1W2B2 4WP5A 3FF0A 3LZAA 1GSPA 1BNFA 1RGAA 1RMSA 4KFFA 1BNEA 3N54B 1I0XA 2WGOA 1FGMA 3FCSB 1K9M4 3T8UA 2XSHB 2W2CA 2UUGC 1O7HB 1RNTA 4XBXA 2BT3A 3FG3A 1Q40B 2CG0A 1WMPA 1GOYA 2CG1A 2P0XA 4BTXA 3EHCA 2H0GA 2XEPA 3OW22 1BNRA 3DZLA 4X2HA 3Q1CA 1IDPA 3KIIA 1VQ53 1RCKA 4HBRA 1S723 5IG5A 4BTYA 1EQKA 5FGOA 4TX4A 3AMOB 1WMOA 4R4KA 3BNEA 1UUVB 3WMDA 1FUWA 1JN5A 3WA2X 1CYUA 3G16A 4LZIA 1W6CA 3L0RA 1D6YA 2R4IA 4N6LA 1YJW3 1JV2B 3CCE3 2GSPA 1UCKA 1UCIA 3DGOA 3K63A 4HM3B 1NJI4 1YVBI 1RGEA 4FMAA 5ELUA 2HOHA 4GSPA 3LT8A 3D5GA 4J9AA 4EC6A 2BMRB 2Z7AA 2XR8B 2YFIB 3FGYA 3CCS3 1KD14 1DMMA 4HM4B 5AIHA 2O9UX 4NPBA 1Q42A 1IQ8A 1AR0A 2IUJA 1SIHA 3D79A 5IENA 3CMA3 2BMOB 3DMCA 1OF5B 3LMLA 1UUGB 1W01A 2W56B 3FF2A 3MPHA 1LRAA 1FZUA 1IT8A 2K0MA 3CCQ3 1YIT3 2Z76A 1B2ZA 3K9MC 2Z6BA 2XSOB 1IQYA 3WODG 2ZA4A 3BU4A 2W0QA 1JKGB 3PCSA 4O3VA 5DREA 2RGQA 3BNDA 2Y74A 1ASKA 4HAAA 1RSNA 4RNTA 1LNHA 2P09A 3BB9A 1BSCA 3NBJA 2E2TA 1YI23 1PFPA 3OWUA 2CFGA 3X3ZA 1LXEA 2CX0A 4OVMA 2ZHXB 2GXFA 3ALAA 1K8A4 2D1WA 5A0OB 3F40A 4MMXB 1BNGA 2W9PA 1MGWA 1BSEA 1Q9EA 1ULIB 3F8HA 1OH0A 1VQP3 1QJGA 1ULJB 3X3XA 2W04A 4U13A 3AGOA 1AVLA 1WNHA 1AV4A 1JB5A 1G0TA 1UGIA 2SARA 3FZWA 3NV0B 1US1A 1Q7Y4 4LGQA 1Y4KA 1D6UA 1HYFA 3X3YA 1HZ1A 2FNQA 2HMKB 7GSPA 2WOHA 3J7Yd 1MWRA 2CIUA 3N8BA 3F7SA 1N5PA 2AADA 3CC23 2H0HA 1ZO2A 1RLSA 1B20A 3OWSA 3URPA 1IK3A 2RSXA 2PNCA 3K5TA 3RNTA 1E3RA 4KZ1A 3EX9A 1TRPA 1KWIA 2Y73A 1BOXA 1B27A 4N6OB 1W4NA 3VF1A 3KFQC 2L1SA 1K28A 3CPW2 1NWWA 3IJEB 1GD4A 2GEXA 5AEWB 3EN1B 4X2OA 1PY3A 4MMZB 3ER7A 2QIYA 6STDA 3NBRA 2WO0A 3KN4A 1SQWA 2M7OA 2R41A 3N9HA 1ZS7A 4XM4A 1B3SA 1YIJ3 2WGQA 1GS3A 5AYRB 1OCVA 1CH0A 4HOHA 1M1XB 4HM0B 1OHSA 3SYUA 3U1WA 1S5AA 4HJLB 2ZDJA 3Q2PA 1W2ZA 1LVNA 3I0YA 1BRGA 4PEJA 1DVCA 2XGNA 3V98A 5AIGA 1ZGXA 1BSDA 1YVSA 2BMQB 4HM6B 1X1UA 1MNLA 1N8QA 4MJDA 1B2SA 3SEDA 5IEPA 1O7NB 1AQZA 7STDA 1RRHA 4KVHA 1N5HA 4CJNA 1C54A 1RGFA 1BRNL 3DGNA 4GHOA 2ML5A 1I70A 3B4PA 1CYVA 1GY7A 1T2HA 2PZVA 3QRDA 1LQMB 4FCMA 1JNQA 4XBYA 2J8XB 4RBNA 1KC84 1OGZA 8CHOA 4H61A 1GY5A 4CPKA 1VQK3 1KQS2 2GU3A 1A2PA 1FGTA 2RFRA 1RGCA 2CX1A 5TGNA 4IPBA 3GWRA 2E2VA 3WHOA 3HOHA 1VQQA 3DGYA 4HM2B 3JUOA 1VQ73 2CFLA 5ELJA 4XDWA 2W03A 5RNTA 2KF3A 1IYYA 1GMQA 1DMNA 1RN1A 1NB5I 1JKGA 2XFTA 1VQO3 1BGSA 1G02A 1TUHA 4I4KA 4K61A 1JBSA 2RBIA 1EUIC 3D5IA 1QAKA 2Z77A 3AHSA 4ZM8A 1PU4A 1FW7A 2CW9A 1JBTA 5IG3A 1B2MA 1VQ83 5EEOA 4BU4A 1BUQA 2O3OA 2XF3A 1IT7A 5CF2A 1JB2A 2C11A 1J2BA 1DYUA 4O02B 2INXA 3MG3A 3RGAA 4N6NB 3PZWA 5AYSC 1RGHA 4FMBA 2I9WA 2F5MA 1VQL3 1BRSA 4J8TA 4ILFA 1RN4A 2B24B 2CHCA 3DUKA 1E3VA 1GOVA 2STDA 4QWTA 4J5GA 3JUQA 1IVUA 3SXXA 4XBTA 5IEOA 1DE3A 2CWUA 2FGTA 4MMYB 2C10A 5EQLA 3WOFB 5CLKA 1IVXA 2CK3H 2KCDA 2QEX3 3CD63 3EJVA 3STDA 3JUPA 1LOYA 2OOVA 3LTAA 3ZFZA 1FUSA 4CDLA 4EBGA 5G1LA 1I2EA 3KE7A 1TTOA 4AEQA 1A2KA 2YFJB 5BVBA 1O7PB 2AAEA 2QGUA 1GMPA 4NREA 1O7MB 1RRLA 1LOXA 1UCJA 5IERA 3CCV3 1IU7A 2ML6A 5AIFA 1BNIA 3DGLA 3MKIA 3BNBA 3PCRA 3RGRA 3HI7A 2OTL3 3B4OA 4N3VA 3EB8A 3FH1A 5D81A 4RNYA 3NQZA 2L4VA 4H3UA 1RKYA 1F8NA 1I2FA 2KXGA 4KFEA 3MSOA 1BSBA 4DKIA 1D6ZA 2F99A 4LYLB 2F86B 1C7HA 4N6UA 3O8YA 4EYCA 4K1VA 5I97A 2XRXB 3F7XA 5M19A 1I3FA 1RDSA 3K0ZA 3ZG0A 1R4YA 3SOYA 1T2IA 1W6YA 3WOEB 1TRQA 2UX0A 3D9RA 3GZYB 2HMLB 3H3HA 4LMIA 1YNVX 1SIIA 3PYJA 4R9LA 5STDA 3NXJA 2RNTA 1EEJA 3PXMA 4FCJA 3H51A 1BNSA 3KZTA 1Q824 3G0KA 4RNZA 2LYXA 1FYSA 2F56A 2P0MA 2XH9A 1OPYA 1UI8A 4G1MB 4EV5A 2C4BA 3X41A 2OQEA 3B8LA 1IV9A 2E2UA 3DY5A 4MEIA 5IG4A 1WMNA 3FG1A 2W56A 4HM7B 1W5ZA 1W00A 3D3LA 3SVAA 1FUTA 2YFLB 3LH4A 3NHXA 3UNLA 1RJOA 1OHOA 3CNMA 3HZPA 4BL2A 1YJ93 4I5QA 1T5YA 3X40A 2JDIH 1VQN3 3LOYA 1RTUA 3KSED 3WR2A 1BUJA 3MYTA 5CK6A 1CQSA 1LNIA 3FG4A 1NO3A 1QVF2 2K3DA 1L5GB 3FKAA 2KRTA 1TU5A 3KKGA 4L8PA 3NBBA 4BTWA 1A2VA 1SJWA 5HOHA 1TIJA 2CWTA 4IT7A 5KP3A 3KSPA 1RGKA 3S67A 1G96A 4Q53A 3B7CA 4HM1B 2IUKA 2SBLA 3HIGA 5IG0A 3EBTA 1EG9B 3F14A 2YX9A 3NV0A 1BRIA 3I563 1IVWA 3GSPA 1HU9A 4BL3A 4EXRA 1FGOA 1W6GA 4IIAA 4BIRA 4N6TA 5CXOA 4JF8A 1A67A 1TJDA 1BVIA 2CWVA 3UL6A 4NHFA 1BRJA 1KSIA 1NDOB 5KP1A 5AEUB 1Z1SA 1Q40A 2GEYA 2IYJA 5IW9A 1N8R4 2OTJ3 5D82A 5GSPA 1I0VA 3BIRA 1K734 3EE1A 3VSYA 4WWUC 1V57A 4O2HA 5FW5A 1W7CA 4R80A 1T3BA 2LQVA 3CPOA 4STDA 2UGIA 3BLZA 5G1KA 3CCM3 1B2UA 1X1WA 1RGGA 1LOWA 4OUQA 1MWSA 3CCR3 3DH2A 4L7KA 1VZZA 3ZG5A 1X1XA 2HMNB 1NB3I 3HIIA 1UW1A 1DETA 2CFKA 3SOAA 1WQLB 1YGWA 3F8XA 1GOUA 4FR9A 2A15A 1Q864 2KAAA 1X1YA 1BNJA 2KF4A 2GBWB 3LXUX 5D83A 1IV7A 1N9JA 2RCDA 2W6JH 3G8ZA 3UJMA 1GYBA 5LC6A 1TFKA 3GZXB 4AKYA 2ZL8A 3MWZA 2F5WA 2BIRA 2HMJB 1RNBA 1YJN3 5G2GA 1TFOA 2H0IA 3V99A 1VQ63 3LTCA 1W02A 1Q814 4FMDA 1R4CA 2GU1A 3OX9A 3CC73 3FLJA 5BU4A 1U5OA 3U97A 1ROVA 4HZ9B 1QALA 2MF7A 1MWTA 1BU4A 4AKZA 1BRKA 3PS8A 3Q90A 4RZMA 3RDEA 2OCTA 1ISKA 2GBXB 9RNTA 4KFDA 3WA3A 3AGNA 3CXC2 1AVKA 1RGLA 5AIIA 1JB4A 1YGEA 1OGXA 4HVNA 3Q3FA 1NNVA 2HMMB 2IY2A 2JQ5A 2CFWA 1DVDA 3CNXA 4J5KA 3S27A 1M9GA 3K7CA 1EA2A 1JRQA 1GY6A 4LEHA 3IMAB 1K41A 4OK0A 1U8CB 4HZBB 3ROBA 2F4YA 1O7WB 2BHMA 3MG1A 1I3IA 1A90A 3NM2A 4HKVB 1JBRA 4LSOA 5JPUA 4WHAA 1PYLA 1EKMA 3LYGA 5EVHA 1V74A 3M8CA 3OV4A 1FGRA 3X42A 5M18A 1N9EA 5JPPA 3FSDA 4N6MA 3CME3 1VQ43 4GB5A 3A76A 4EV2A 2CC3A 1V58A 2OQEC 2XFSA 1SPUA 3ECFA 1Q7HA 3EN8A 3UB1A 3KCHA 1VQM3 1ZX2A 1QMAA 3CU3A 1UCLA 4HM8B 2BU4A 5M1AA 1WTHA 3VGNA 2KF5A 4K90B 4R9KA 3A5EA 2BNGA 3G713 5CF1A 7RNTA 1MGRA 4FCZA 1B2XA 5HGRA 1MWUA 3LTBA 3F9SA 1MOLA 1B21A 1BANA 3JUNA 4K1UA 4GL6A 4ORLA 2OOVC 3E99A 3CCU3 3S28A 1ROAA 3GRDA 1I8VA 3NX0A 2K54A 3G6E3 5DRVA 1FA3A 1M904 4HYZA 1SARA 3JVCA 3IPTA 3CC43 1BRHA 1JZOA 3T0UA 3AHWA 3JUMA 1STFI 5LC7A
chains in the Genus database with same CATH topology
1TP6A 1DMQA 2B1XB 2CFDA 2IA7A 1QVG2 5BXQA 2BO9B 1NU3A 3EBYA 3CCL3 1CEWI 4WYKB 2WOFA 1RN7A 3TDGA 5KP4A 3GAXA 4R1KA 4HM5B 2D42A 1HKXA 1YHQ3 1E97A 2HMOB 2P38A 3BNCA 2XGLA 4XB5A 3GZRA 4WYKA 4XDVA 3SLUA 3GZBA 4CCVA 2W9QA 1OF5A 2Q07A 5JBSA 3LT9A 2OWPA 1IVVA 3S29A 4JRFA 2CH9A 3DXOA 3S5CA 3EF8A 3OWYA 3G4S3 2F98A 2V1LA 3NUVA 2P05A 1FGQA 3DM8A 3DGMA 1VQ93 4WFOA 3WDGB 3MG2A 2FXTA 1M1K4 3UL5A 1QAFA 1O7GB 4N6V0 4O8SA 5AI1A 3PGBA 3MHEA 3NM7A 3I553 2IMJA 2CKFB 3AMOA 4FMCA 3HX8A 3QK9A 1OHPA 3NQYA 2MC8A 4L8OA 3EQQB 5IF6A 1OACA 3T8NA 3HK4A 3CCJ3 1UI7A 1STDA 1IQXA 3SX1A 3V92A 1JN5B 3OXAA 3LTDA 3EC9A 1UUWB 1JJ22 1OUNA 1GD3A 1W2B2 4WP5A 3FF0A 3LZAA 4KFFA 3N54B 2WGOA 1FGMA 3FCSB 1K9M4 3T8UA 2XSHB 2W2CA 1O7HB 4XBXA 2BT3A 3FG3A 1Q40B 2CG0A 1WMPA 2CG1A 2P0XA 4BTXA 3EHCA 2XEPA 3OW22 3DZLA 4X2HA 3Q1CA 1IDPA 3KIIA 1VQ53 4HBRA 1S723 5IG5A 4BTYA 1EQKA 5FGOA 4TX4A 3AMOB 1WMOA 4R4KA 3BNEA 1UUVB 3WMDA 1FUWA 1JN5A 3WA2X 1CYUA 3G16A 4LZIA 1W6CA 3L0RA 1D6YA 2R4IA 4N6LA 1YJW3 1JV2B 3CCE3 3DGOA 3K63A 4HM3B 1NJI4 1YVBI 4FMAA 5ELUA 3LT8A 4J9AA 4EC6A 2BMRB 2Z7AA 2XR8B 2YFIB 3FGYA 3CCS3 1KD14 1DMMA 4HM4B 5AIHA 2O9UX 1Q42A 1IQ8A 1AR0A 2IUJA 1SIHA 5IENA 3CMA3 2BMOB 3DMCA 1OF5B 3LMLA 1W01A 2W56B 3FF2A 3MPHA 2K0MA 3CCQ3 1IT8A 1YIT3 2Z76A 3K9MC 2Z6BA 2XSOB 1IQYA 3WODG 2W0QA 1JKGB 3PCSA 4O3VA 5DREA 2RGQA 3BNDA 2Y74A 1ASKA 1LNHA 2P09A 3BB9A 3NBJA 2E2TA 1YI23 1PFPA 3OWUA 2CFGA 3X3ZA 1LXEA 4OVMA 3ALAA 2GXFA 1K8A4 2D1WA 5A0OB 3F40A 4MMXB 2QA43 2W9PA 1VQP3 1ULIB 3F8HA 1OH0A 1QJGA 1ULJB 3X3XA 2W04A 4U13A 1YIJ3 1AVLA 1WNHA 1AV4A 1JB5A 3FZWA 3NV0B 1US1A 1Q7Y4 4LGQA 1Y4KA 1D6UA 3X3YA 2FNQA 2HMKB 3J7Yd 2WOHA 2CIUA 3N8BA 3F7SA 1N5PA 3CC23 1ZO2A 3OWSA 1IK3A 2RSXA 2PNCA 3K5TA 1E3RA 4KZ1A 3EX9A 1KWIA 2Y73A 4N6OB 1W4NA 3VF1A 3KFQC 3CPW2 1K28A 1NWWA 3IJEB 1GD4A 2GEXA 5AEWB 3EN1B 4X2OA 4MMZB 3ER7A 2QIYA 6STDA 3NBRA 2WO0A 3KN4A 1SQWA 2M7OA 3N9HA 4XM4A 2WGQA 1GS3A 5AYRB 1OCVA 1M1XB 4HM0B 1OHSA 3U1WA 1S5AA 4HJLB 2ZDJA 3Q2PA 1W2ZA 1LVNA 3I0YA 4PEJA 1DVCA 2XGNA 3V98A 5AIGA 2BMQB 4HM6B 3UNLA 4MJDA 1MNLA 1N8QA 3SEDA 5IEPA 1O7NB 7STDA 1RRHA 4KVHA 1N5HA 3DGNA 2ML5A 3B4PA 1CYVA 1GY7A 4FCMA 2PZVA 3QRDA 4XBYA 1JNQA 1KC84 4RBNA 1KQS2 1OGZA 8CHOA 4H61A 1GY5A 1VQK3 2GU3A 1FGTA 2RFRA 5TGNA 4IPBA 3GWRA 2E2VA 1VQ73 4HM2B 3JUOA 2CFLA 5ELJA 4XDWA 2W03A 1DMNA 1NB5I 1JKGA 2XFTA 1VQO3 4K61A 1TUHA 4I4KA 1PU4A 2Z77A 1QAKA 4ZM8A 2CW9A 5IG3A 1VQ83 5EEOA 1BUQA 2O3OA 2XF3A 1IT7A 5CF2A 1JB2A 2C11A 1J2BA 1DYUA 4O02B 2INXA 3MG3A 3RGAA 4N6NB 3PZWA 5AYSC 4FMBA 2I9WA 1VQL3 4J8TA 2B24B 3DUKA 2CHCA 4QWTA 1E3VA 2STDA 3JUQA 1IVUA 3SXXA 4XBTA 5IEOA 2CWUA 2FGTA 4MMYB 2C10A 5EQLA 3WOFB 5CLKA 1IVXA 2CK3H 2KCDA 2QEX3 3CD63 3EJVA 3STDA 3JUPA 2OOVA 3LTAA 4CDLA 4EBGA 3KE7A 4AEQA 1A2KA 2YFJB 5BVBA 1O7PB 2QGUA 4NREA 1O7MB 1RRLA 1LOXA 5IERA 3CCV3 1IU7A 2ML6A 5AIFA 3DGLA 3MKIA 3BNBA 3PCRA 3RGRA 3HI7A 2OTL3 3B4OA 4N3VA 3EB8A 3FH1A 5D81A 4RNYA 3NQZA 2L4VA 4H3UA 1RKYA 1F8NA 2KXGA 4KFEA 3MSOA 1D6ZA 2F99A 2F86B 1C7HA 4N6UA 3O8YA 4EYCA 4K1VA 5I97A 2XRXB 3F7XA 3K0ZA 3WOEB 3SOYA 1W6YA 2UX0A 3D9RA 3GZYB 2HMLB 3H3HA 4LMIA 1SIIA 3PYJA 4R9LA 5STDA 3NXJA 1Q824 3PXMA 4FCJA 3H51A 3KZTA 3G0KA 4RNZA 2LYXA 2XH9A 2P0MA 4G1MB 4EV5A 1OPYA 1UI8A 3X41A 2OQEA 3B8LA 1IV9A 2E2UA 3DY5A 4MEIA 5IG4A 1WMNA 3FG1A 2W56A 4HM7B 1W5ZA 1W00A 3D3LA 3SVAA 2YFLB 3LH4A 3NHXA 1RJOA 1OHOA 3CNMA 3HZPA 1YJ93 1T5YA 3X40A 2JDIH 1VQN3 3LOYA 3KSED 3MYTA 5CK6A 1CQSA 3FG4A 1NO3A 1QVF2 1L5GB 1TU5A 3FKAA 2KRTA 3KKGA 4L8PA 3NBBA 4BTWA 1A2VA 1SJWA 1TIJA 2CWTA 4IT7A 5KP3A 3KSPA 3S67A 1G96A 4Q53A 3B7CA 4HM1B 2IUKA 2SBLA 3HIGA 5IG0A 3EBTA 1EG9B 3F14A 2YX9A 3NV0A 3I563 1IVWA 4EXRA 1HU9A 1FGOA 1W6GA 4IIAA 4N6TA 5CXOA 4JF8A 1A67A 2CWVA 3UL6A 4NHFA 1KSIA 1NDOB 5KP1A 5AEUB 1Z1SA 1Q40A 2GEYA 5IW9A 1N8R4 2OTJ3 5D82A 1K734 3EE1A 3VSYA 4WWUC 4O2HA 5FW5A 1W7CA 4R80A 2LQVA 3CPOA 4STDA 3BLZA 3CCM3 4OUQA 3CCR3 4L7KA 1VZZA 2HMNB 1NB3I 3HIIA 1UW1A 2CFKA 3SOAA 1WQLB 3F8XA 4FR9A 2A15A 1Q864 3LXUX 2GBWB 5D83A 1IV7A 1N9JA 2RCDA 2W6JH 3G8ZA 3UJMA 1GYBA 5LC6A 1TFKA 3GZXB 4AKYA 2ZL8A 3MWZA 2HMJB 1YJN3 5G2GA 1TFOA 3V99A 1VQ63 3LTCA 1W02A 1Q814 4FMDA 1R4CA 2GU1A 3OX9A 3CC73 3FLJA 1U5OA 3U97A 1ROVA 4HZ9B 1QALA 2MF7A 4AKZA 3PS8A 3Q90A 4RZMA 3RDEA 2OCTA 1ISKA 2GBXB 4KFDA 3WA3A 3CXC2 1AVKA 5AIIA 1JB4A 1YGEA 1OGXA 4HVNA 2HMMB 2JQ5A 2CFWA 1DVDA 3CNXA 3S27A 1M9GA 3K7CA 1EA2A 1JRQA 1GY6A 4LEHA 3IMAB 1K41A 4OK0A 1U8CB 4HZBB 3ROBA 1O7WB 2BHMA 3MG1A 1A90A 3NM2A 4HKVB 4LSOA 5JPUA 4WHAA 3LYGA 1EKMA 5EVHA 1V74A 3M8CA 3OV4A 1FGRA 3X42A 1N9EA 5JPPA 3FSDA 4N6MA 3CME3 1VQ43 4GB5A 3A76A 4EV2A 2CC3A 2OQEC 3ECFA 2XFSA 1SPUA 3EN8A 3UB1A 1VQM3 1ZX2A 1QMAA 3CU3A 4HM8B 1WTHA 3VGNA 4K90B 4R9KA 2BNGA 3G713 5CF1A 4FCZA 5HGRA 3LTBA 3F9SA 1MOLA 4K1UA 3JUNA 4GL6A 4ORLA 2OOVC 3E99A 3CCU3 3S28A 1ROAA 3GRDA 3NX0A 2K54A 3G6E3 5DRVA 1FA3A 1M904 4HYZA 3JVCA 3IPTA 3CC43 3T0UA 3JUMA 1STFI 5LC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA 3;  1K73 4;  1YIJ 3;  1QVG 2;  1VQ9 3;  1VQ8 3;  3CCL 3;  1YJN 3;  1Q7Y 4;  1M1K 4;  1VQ6 3;  1Q82 4;  3CCQ 3;  2OTJ 3;  1KC8 4;  3CCV 3;  1YIT 3;  3G71 3;  1K9M 4;  1VQK 3;  3CCM 3;  1YJW 3;  1Q81 4;  3I55 3;  1KQS 2;  3CC7 3;  3CCE 3;  3CC2 3;  1YHQ 3;  1VQL 3;  2OTL 3;  3CCR 3;  3I56 3;  3CCU 3;  1NJI 4;  1VQ7 3;  3CCJ 3;  3G6E 3;  1YJ9 3;  1YI2 3;  1N8R 4;  3CXC 2;  3OW2 2;  1Q86 4;  3CCS 3;  1M90 4;  2QEX 3;  1KD1 4;  1VQN 3;  1JJ2 2;  3CPW 2;  1K8A 4;  3CD6 3;  3CME 3;  1VQ4 3;  3CC4 3;  1W2B 2;  2QA4 3;  1QVF 2;  1VQO 3;  1VQP 3;  1VQ5 3;  1S72 3;  1VQM 3;  3G4S 3; 
#chains in the Genus database with same CATH topology
 1TP6 A;  1DMQ A;  2B1X B;  2CFD A;  2IA7 A;  1AY7 A;  1QVG 2;  1LQG C;  5BXQ A;  2BO9 B;  1NU3 A;  3EBY A;  3CCL 3;  1CEW I;  1JZD A;  1LOV A;  4EW5 A;  4WYK B;  2WOF A;  1RN7 A;  3TDG A;  5KP4 A;  3GAX A;  4R1K A;  4HM5 B;  2D42 A;  1HKX A;  1YHQ 3;  6GSP A;  1E97 A;  1GMR A;  2HMO B;  2QA4 3;  2P38 A;  3BNC A;  2XGL A;  4XB5 A;  3GZR A;  4WYK A;  4XDV A;  3SLU A;  3GZB A;  4CCV A;  2W9Q A;  1RCL A;  1OF5 A;  2Q07 A;  1BAO A;  3LT9 A;  5JBS A;  2OWP A;  1IVV A;  3S29 A;  4KT3 B;  1UDI I;  4JRF A;  2CH9 A;  3DXO A;  3S5C A;  8RNT A;  3EF8 A;  3OWY A;  3G4S 3;  2F98 A;  2V1L A;  3NUV A;  2P05 A;  1FGQ A;  3DM8 A;  3DGM A;  1VQ9 3;  4WFO A;  3WDG B;  1UGH I;  3MG2 A;  2FXT A;  1M1K 4;  1I2G A;  3UL5 A;  1QAF A;  1O7G B;  2KF6 A;  4N6V 0;  4O8S A;  5AI1 A;  1BSA A;  3PGB A;  3MHE A;  3NM7 A;  3I55 3;  2IMJ A;  2CKF B;  3AMO A;  4FMC A;  5BIR A;  3HX8 A;  3QK9 A;  1OHP A;  1RHL A;  3NQY A;  2MC8 A;  4L8O A;  3D4A A;  3EQQ B;  5IF6 A;  1OAC A;  3T8N A;  3HK4 A;  3CCJ 3;  1UI7 A;  1STD A;  1IQX A;  3SX1 A;  3V92 A;  1JN5 B;  3OXA A;  3LTD A;  3EC9 A;  1UUW B;  1JJ2 2;  1OUN A;  6RNT A;  1BIR A;  1GD3 A;  1W2B 2;  4WP5 A;  3FF0 A;  3LZA A;  1GSP A;  1BNF A;  1RGA A;  1RMS A;  4KFF A;  1BNE A;  3N54 B;  1I0X A;  2WGO A;  1FGM A;  3FCS B;  1K9M 4;  3T8U A;  2XSH B;  2W2C A;  2UUG C;  1O7H B;  1RNT A;  4XBX A;  2BT3 A;  3FG3 A;  1Q40 B;  2CG0 A;  1WMP A;  1GOY A;  2CG1 A;  2P0X A;  4BTX A;  3EHC A;  2H0G A;  2XEP A;  3OW2 2;  1BNR A;  3DZL A;  4X2H A;  3Q1C A;  1IDP A;  3KII A;  1VQ5 3;  1RCK A;  4HBR A;  1S72 3;  5IG5 A;  4BTY A;  1EQK A;  5FGO A;  4TX4 A;  3AMO B;  1WMO A;  4R4K A;  3BNE A;  1UUV B;  3WMD A;  1FUW A;  1JN5 A;  3WA2 X;  1CYU A;  3G16 A;  4LZI A;  1W6C A;  3L0R A;  1D6Y A;  2R4I A;  4N6L A;  1YJW 3;  1JV2 B;  3CCE 3;  2GSP A;  1UCK A;  1UCI A;  3DGO A;  3K63 A;  4HM3 B;  1NJI 4;  1YVB I;  1RGE A;  4FMA A;  5ELU A;  2HOH A;  4GSP A;  3LT8 A;  3D5G A;  4J9A A;  4EC6 A;  2BMR B;  2Z7A A;  2XR8 B;  2YFI B;  3FGY A;  3CCS 3;  1KD1 4;  1DMM A;  4HM4 B;  5AIH A;  2O9U X;  4NPB A;  1Q42 A;  1IQ8 A;  1AR0 A;  2IUJ A;  1SIH A;  3D79 A;  5IEN A;  3CMA 3;  2BMO B;  3DMC A;  1OF5 B;  3LML A;  1UUG B;  1W01 A;  2W56 B;  3FF2 A;  3MPH A;  1LRA A;  1FZU A;  1IT8 A;  2K0M A;  3CCQ 3;  1YIT 3;  2Z76 A;  1B2Z A;  3K9M C;  2Z6B A;  2XSO B;  1IQY A;  3WOD G;  2ZA4 A;  3BU4 A;  2W0Q A;  1JKG B;  3PCS A;  4O3V A;  5DRE A;  2RGQ A;  3BND A;  2Y74 A;  1ASK A;  4HAA A;  1RSN A;  4RNT A;  1LNH A;  2P09 A;  3BB9 A;  1BSC A;  3NBJ A;  2E2T A;  1YI2 3;  1PFP A;  3OWU A;  2CFG A;  3X3Z A;  1LXE A;  2CX0 A;  4OVM A;  2ZHX B;  2GXF A;  3ALA A;  1K8A 4;  2D1W A;  5A0O B;  3F40 A;  4MMX B;  1BNG A;  2W9P A;  1MGW A;  1BSE A;  1Q9E A;  1ULI B;  3F8H A;  1OH0 A;  1VQP 3;  1QJG A;  1ULJ B;  3X3X A;  2W04 A;  4U13 A;  3AGO A;  1AVL A;  1WNH A;  1AV4 A;  1JB5 A;  1G0T A;  1UGI A;  2SAR A;  3FZW A;  3NV0 B;  1US1 A;  1Q7Y 4;  4LGQ A;  1Y4K A;  1D6U A;  1HYF A;  3X3Y A;  1HZ1 A;  2FNQ A;  2HMK B;  7GSP A;  2WOH A;  3J7Y d;  1MWR A;  2CIU A;  3N8B A;  3F7S A;  1N5P A;  2AAD A;  3CC2 3;  2H0H A;  1ZO2 A;  1RLS A;  1B20 A;  3OWS A;  3URP A;  1IK3 A;  2RSX A;  2PNC A;  3K5T A;  3RNT A;  1E3R A;  4KZ1 A;  3EX9 A;  1TRP A;  1KWI A;  2Y73 A;  1BOX A;  1B27 A;  4N6O B;  1W4N A;  3VF1 A;  3KFQ C;  2L1S A;  1K28 A;  3CPW 2;  1NWW A;  3IJE B;  1GD4 A;  2GEX A;  5AEW B;  3EN1 B;  4X2O A;  1PY3 A;  4MMZ B;  3ER7 A;  2QIY A;  6STD A;  3NBR A;  2WO0 A;  3KN4 A;  1SQW A;  2M7O A;  2R41 A;  3N9H A;  1ZS7 A;  4XM4 A;  1B3S A;  1YIJ 3;  2WGQ A;  1GS3 A;  5AYR B;  1OCV A;  1CH0 A;  4HOH A;  1M1X B;  4HM0 B;  1OHS A;  3SYU A;  3U1W A;  1S5A A;  4HJL B;  2ZDJ A;  3Q2P A;  1W2Z A;  1LVN A;  3I0Y A;  1BRG A;  4PEJ A;  1DVC A;  2XGN A;  3V98 A;  5AIG A;  1ZGX A;  1BSD A;  1YVS A;  2BMQ B;  4HM6 B;  1X1U A;  1MNL A;  1N8Q A;  4MJD A;  1B2S A;  3SED A;  5IEP A;  1O7N B;  1AQZ A;  7STD A;  1RRH A;  4KVH A;  1N5H A;  4CJN A;  1C54 A;  1RGF A;  1BRN L;  3DGN A;  4GHO A;  2ML5 A;  1I70 A;  3B4P A;  1CYV A;  1GY7 A;  1T2H A;  2PZV A;  3QRD A;  1LQM B;  4FCM A;  1JNQ A;  4XBY A;  2J8X B;  4RBN A;  1KC8 4;  1OGZ A;  8CHO A;  4H61 A;  1GY5 A;  4CPK A;  1VQK 3;  1KQS 2;  2GU3 A;  1A2P A;  1FGT A;  2RFR A;  1RGC A;  2CX1 A;  5TGN A;  4IPB A;  3GWR A;  2E2V A;  3WHO A;  3HOH A;  1VQQ A;  3DGY A;  4HM2 B;  3JUO A;  1VQ7 3;  2CFL A;  5ELJ A;  4XDW A;  2W03 A;  5RNT A;  2KF3 A;  1IYY A;  1GMQ A;  1DMN A;  1RN1 A;  1NB5 I;  1JKG A;  2XFT A;  1VQO 3;  1BGS A;  1G02 A;  1TUH A;  4I4K A;  4K61 A;  1JBS A;  2RBI A;  1EUI C;  3D5I A;  1QAK A;  2Z77 A;  3AHS A;  4ZM8 A;  1PU4 A;  1FW7 A;  2CW9 A;  1JBT A;  5IG3 A;  1B2M A;  1VQ8 3;  5EEO A;  4BU4 A;  1BUQ A;  2O3O A;  2XF3 A;  1IT7 A;  5CF2 A;  1JB2 A;  2C11 A;  1J2B A;  1DYU A;  4O02 B;  2INX A;  3MG3 A;  3RGA A;  4N6N B;  3PZW A;  5AYS C;  1RGH A;  4FMB A;  2I9W A;  2F5M A;  1VQL 3;  1BRS A;  4J8T A;  4ILF A;  1RN4 A;  2B24 B;  2CHC A;  3DUK A;  1E3V A;  1GOV A;  2STD A;  4QWT A;  4J5G A;  3JUQ A;  1IVU A;  3SXX A;  4XBT A;  5IEO A;  1DE3 A;  2CWU A;  2FGT A;  4MMY B;  2C10 A;  5EQL A;  3WOF B;  5CLK A;  1IVX A;  2CK3 H;  2KCD A;  2QEX 3;  3CD6 3;  3EJV A;  3STD A;  3JUP A;  1LOY A;  2OOV A;  3LTA A;  3ZFZ A;  1FUS A;  4CDL A;  4EBG A;  5G1L A;  1I2E A;  3KE7 A;  1TTO A;  4AEQ A;  1A2K A;  2YFJ B;  5BVB A;  1O7P B;  2AAE A;  2QGU A;  1GMP A;  4NRE A;  1O7M B;  1RRL A;  1LOX A;  1UCJ A;  5IER A;  3CCV 3;  1IU7 A;  2ML6 A;  5AIF A;  1BNI A;  3DGL A;  3MKI A;  3BNB A;  3PCR A;  3RGR A;  3HI7 A;  2OTL 3;  3B4O A;  4N3V A;  3EB8 A;  3FH1 A;  5D81 A;  4RNY A;  3NQZ A;  2L4V A;  4H3U A;  1RKY A;  1F8N A;  1I2F A;  2KXG A;  4KFE A;  3MSO A;  1BSB A;  4DKI A;  1D6Z A;  2F99 A;  4LYL B;  2F86 B;  1C7H A;  4N6U A;  3O8Y A;  4EYC A;  4K1V A;  5I97 A;  2XRX B;  3F7X A;  5M19 A;  1I3F A;  1RDS A;  3K0Z A;  3ZG0 A;  1R4Y A;  3SOY A;  1T2I A;  1W6Y A;  3WOE B;  1TRQ A;  2UX0 A;  3D9R A;  3GZY B;  2HML B;  3H3H A;  4LMI A;  1YNV X;  1SII A;  3PYJ A;  4R9L A;  5STD A;  3NXJ A;  2RNT A;  1EEJ A;  3PXM A;  4FCJ A;  3H51 A;  1BNS A;  3KZT A;  1Q82 4;  3G0K A;  4RNZ A;  2LYX A;  1FYS A;  2F56 A;  2P0M A;  2XH9 A;  1OPY A;  1UI8 A;  4G1M B;  4EV5 A;  2C4B A;  3X41 A;  2OQE A;  3B8L A;  1IV9 A;  2E2U A;  3DY5 A;  4MEI A;  5IG4 A;  1WMN A;  3FG1 A;  2W56 A;  4HM7 B;  1W5Z A;  1W00 A;  3D3L A;  3SVA A;  1FUT A;  2YFL B;  3LH4 A;  3NHX A;  3UNL A;  1RJO A;  1OHO A;  3CNM A;  3HZP A;  4BL2 A;  1YJ9 3;  4I5Q A;  1T5Y A;  3X40 A;  2JDI H;  1VQN 3;  3LOY A;  1RTU A;  3KSE D;  3WR2 A;  1BUJ A;  3MYT A;  5CK6 A;  1CQS A;  1LNI A;  3FG4 A;  1NO3 A;  1QVF 2;  2K3D A;  1L5G B;  3FKA A;  2KRT A;  1TU5 A;  3KKG A;  4L8P A;  3NBB A;  4BTW A;  1A2V A;  1SJW A;  5HOH A;  1TIJ A;  2CWT A;  4IT7 A;  5KP3 A;  3KSP A;  1RGK A;  3S67 A;  1G96 A;  4Q53 A;  3B7C A;  4HM1 B;  2IUK A;  2SBL A;  3HIG A;  5IG0 A;  3EBT A;  1EG9 B;  3F14 A;  2YX9 A;  3NV0 A;  1BRI A;  3I56 3;  1IVW A;  3GSP A;  1HU9 A;  4BL3 A;  4EXR A;  1FGO A;  1W6G A;  4IIA A;  4BIR A;  4N6T A;  5CXO A;  4JF8 A;  1A67 A;  1TJD A;  1BVI A;  2CWV A;  3UL6 A;  4NHF A;  1BRJ A;  1KSI A;  1NDO B;  5KP1 A;  5AEU B;  1Z1S A;  1Q40 A;  2GEY A;  2IYJ A;  5IW9 A;  1N8R 4;  2OTJ 3;  5D82 A;  5GSP A;  1I0V A;  3BIR A;  1K73 4;  3EE1 A;  3VSY A;  4WWU C;  1V57 A;  4O2H A;  5FW5 A;  1W7C A;  4R80 A;  1T3B A;  2LQV A;  3CPO A;  4STD A;  2UGI A;  3BLZ A;  5G1K A;  3CCM 3;  1B2U A;  1X1W A;  1RGG A;  1LOW A;  4OUQ A;  1MWS A;  3CCR 3;  3DH2 A;  4L7K A;  1VZZ A;  3ZG5 A;  1X1X A;  2HMN B;  1NB3 I;  3HII A;  1UW1 A;  1DET A;  2CFK A;  3SOA A;  1WQL B;  1YGW A;  3F8X A;  1GOU A;  4FR9 A;  2A15 A;  1Q86 4;  2KAA A;  1X1Y A;  1BNJ A;  2KF4 A;  2GBW B;  3LXU X;  5D83 A;  1IV7 A;  1N9J A;  2RCD A;  2W6J H;  3G8Z A;  3UJM A;  1GYB A;  5LC6 A;  1TFK A;  3GZX B;  4AKY A;  2ZL8 A;  3MWZ A;  2F5W A;  2BIR A;  2HMJ B;  1RNB A;  1YJN 3;  5G2G A;  1TFO A;  2H0I A;  3V99 A;  1VQ6 3;  3LTC A;  1W02 A;  1Q81 4;  4FMD A;  1R4C A;  2GU1 A;  3OX9 A;  3CC7 3;  3FLJ A;  5BU4 A;  1U5O A;  3U97 A;  1ROV A;  4HZ9 B;  1QAL A;  2MF7 A;  1MWT A;  1BU4 A;  4AKZ A;  1BRK A;  3PS8 A;  3Q90 A;  4RZM A;  3RDE A;  2OCT A;  1ISK A;  2GBX B;  9RNT A;  4KFD A;  3WA3 A;  3AGN A;  3CXC 2;  1AVK A;  1RGL A;  5AII A;  1JB4 A;  1YGE A;  1OGX A;  4HVN A;  3Q3F A;  1NNV A;  2HMM B;  2IY2 A;  2JQ5 A;  2CFW A;  1DVD A;  3CNX A;  4J5K A;  3S27 A;  1M9G A;  3K7C A;  1EA2 A;  1JRQ A;  1GY6 A;  4LEH A;  3IMA B;  1K41 A;  4OK0 A;  1U8C B;  4HZB B;  3ROB A;  2F4Y A;  1O7W B;  2BHM A;  3MG1 A;  1I3I A;  1A90 A;  3NM2 A;  4HKV B;  1JBR A;  4LSO A;  5JPU A;  4WHA A;  1PYL A;  1EKM A;  3LYG A;  5EVH A;  1V74 A;  3M8C A;  3OV4 A;  1FGR A;  3X42 A;  5M18 A;  1N9E A;  5JPP A;  3FSD A;  4N6M A;  3CME 3;  1VQ4 3;  4GB5 A;  3A76 A;  4EV2 A;  2CC3 A;  1V58 A;  2OQE C;  2XFS A;  1SPU A;  3ECF A;  1Q7H A;  3EN8 A;  3UB1 A;  3KCH A;  1VQM 3;  1ZX2 A;  1QMA A;  3CU3 A;  1UCL A;  4HM8 B;  2BU4 A;  5M1A A;  1WTH A;  3VGN A;  2KF5 A;  4K90 B;  4R9K A;  3A5E A;  2BNG A;  3G71 3;  5CF1 A;  7RNT A;  1MGR A;  4FCZ A;  1B2X A;  5HGR A;  1MWU A;  3LTB A;  3F9S A;  1MOL A;  1B21 A;  1BAN A;  3JUN A;  4K1U A;  4GL6 A;  4ORL A;  2OOV C;  3E99 A;  3CCU 3;  3S28 A;  1ROA A;  3GRD A;  1I8V A;  3NX0 A;  2K54 A;  3G6E 3;  5DRV A;  1FA3 A;  1M90 4;  4HYZ A;  1SAR A;  3JVC A;  3IPT A;  3CC4 3;  1BRH A;  1JZO A;  3T0U A;  3AHW A;  3JUM A;  1STF I;  5LC7 A; 
#chains in the Genus database with same CATH homology
 1TP6 A;  1DMQ A;  2B1X B;  2CFD A;  2IA7 A;  1QVG 2;  5BXQ A;  2BO9 B;  1NU3 A;  3EBY A;  3CCL 3;  1CEW I;  4WYK B;  2WOF A;  1RN7 A;  3TDG A;  5KP4 A;  3GAX A;  4R1K A;  4HM5 B;  2D42 A;  1HKX A;  1YHQ 3;  1E97 A;  2HMO B;  2P38 A;  3BNC A;  2XGL A;  4XB5 A;  3GZR A;  4WYK A;  4XDV A;  3SLU A;  3GZB A;  4CCV A;  2W9Q A;  1OF5 A;  2Q07 A;  5JBS A;  3LT9 A;  2OWP A;  1IVV A;  3S29 A;  4JRF A;  2CH9 A;  3DXO A;  3S5C A;  3EF8 A;  3OWY A;  3G4S 3;  2F98 A;  2V1L A;  3NUV A;  2P05 A;  1FGQ A;  3DM8 A;  3DGM A;  1VQ9 3;  4WFO A;  3WDG B;  3MG2 A;  2FXT A;  1M1K 4;  3UL5 A;  1QAF A;  1O7G B;  4N6V 0;  4O8S A;  5AI1 A;  3PGB A;  3MHE A;  3NM7 A;  3I55 3;  2IMJ A;  2CKF B;  3AMO A;  4FMC A;  3HX8 A;  3QK9 A;  1OHP A;  3NQY A;  2MC8 A;  4L8O A;  3EQQ B;  5IF6 A;  1OAC A;  3T8N A;  3HK4 A;  3CCJ 3;  1UI7 A;  1STD A;  1IQX A;  3SX1 A;  3V92 A;  1JN5 B;  3OXA A;  3LTD A;  3EC9 A;  1UUW B;  1JJ2 2;  1OUN A;  1GD3 A;  1W2B 2;  4WP5 A;  3FF0 A;  3LZA A;  4KFF A;  3N54 B;  2WGO A;  1FGM A;  3FCS B;  1K9M 4;  3T8U A;  2XSH B;  2W2C A;  1O7H B;  4XBX A;  2BT3 A;  3FG3 A;  1Q40 B;  2CG0 A;  1WMP A;  2CG1 A;  2P0X A;  4BTX A;  3EHC A;  2XEP A;  3OW2 2;  3DZL A;  4X2H A;  3Q1C A;  1IDP A;  3KII A;  1VQ5 3;  4HBR A;  1S72 3;  5IG5 A;  4BTY A;  1EQK A;  5FGO A;  4TX4 A;  3AMO B;  1WMO A;  4R4K A;  3BNE A;  1UUV B;  3WMD A;  1FUW A;  1JN5 A;  3WA2 X;  1CYU A;  3G16 A;  4LZI A;  1W6C A;  3L0R A;  1D6Y A;  2R4I A;  4N6L A;  1YJW 3;  1JV2 B;  3CCE 3;  3DGO A;  3K63 A;  4HM3 B;  1NJI 4;  1YVB I;  4FMA A;  5ELU A;  3LT8 A;  4J9A A;  4EC6 A;  2BMR B;  2Z7A A;  2XR8 B;  2YFI B;  3FGY A;  3CCS 3;  1KD1 4;  1DMM A;  4HM4 B;  5AIH A;  2O9U X;  1Q42 A;  1IQ8 A;  1AR0 A;  2IUJ A;  1SIH A;  5IEN A;  3CMA 3;  2BMO B;  3DMC A;  1OF5 B;  3LML A;  1W01 A;  2W56 B;  3FF2 A;  3MPH A;  2K0M A;  3CCQ 3;  1IT8 A;  1YIT 3;  2Z76 A;  3K9M C;  2Z6B A;  2XSO B;  1IQY A;  3WOD G;  2W0Q A;  1JKG B;  3PCS A;  4O3V A;  5DRE A;  2RGQ A;  3BND A;  2Y74 A;  1ASK A;  1LNH A;  2P09 A;  3BB9 A;  3NBJ A;  2E2T A;  1YI2 3;  1PFP A;  3OWU A;  2CFG A;  3X3Z A;  1LXE A;  4OVM A;  3ALA A;  2GXF A;  1K8A 4;  2D1W A;  5A0O B;  3F40 A;  4MMX B;  2QA4 3;  2W9P A;  1VQP 3;  1ULI B;  3F8H A;  1OH0 A;  1QJG A;  1ULJ B;  3X3X A;  2W04 A;  4U13 A;  1YIJ 3;  1AVL A;  1WNH A;  1AV4 A;  1JB5 A;  3FZW A;  3NV0 B;  1US1 A;  1Q7Y 4;  4LGQ A;  1Y4K A;  1D6U A;  3X3Y A;  2FNQ A;  2HMK B;  3J7Y d;  2WOH A;  2CIU A;  3N8B A;  3F7S A;  1N5P A;  3CC2 3;  1ZO2 A;  3OWS A;  1IK3 A;  2RSX A;  2PNC A;  3K5T A;  1E3R A;  4KZ1 A;  3EX9 A;  1KWI A;  2Y73 A;  4N6O B;  1W4N A;  3VF1 A;  3KFQ C;  3CPW 2;  1K28 A;  1NWW A;  3IJE B;  1GD4 A;  2GEX A;  5AEW B;  3EN1 B;  4X2O A;  4MMZ B;  3ER7 A;  2QIY A;  6STD A;  3NBR A;  2WO0 A;  3KN4 A;  1SQW A;  2M7O A;  3N9H A;  4XM4 A;  2WGQ A;  1GS3 A;  5AYR B;  1OCV A;  1M1X B;  4HM0 B;  1OHS A;  3U1W A;  1S5A A;  4HJL B;  2ZDJ A;  3Q2P A;  1W2Z A;  1LVN A;  3I0Y A;  4PEJ A;  1DVC A;  2XGN A;  3V98 A;  5AIG A;  2BMQ B;  4HM6 B;  3UNL A;  4MJD A;  1MNL A;  1N8Q A;  3SED A;  5IEP A;  1O7N B;  7STD A;  1RRH A;  4KVH A;  1N5H A;  3DGN A;  2ML5 A;  3B4P A;  1CYV A;  1GY7 A;  4FCM A;  2PZV A;  3QRD A;  4XBY A;  1JNQ A;  1KC8 4;  4RBN A;  1KQS 2;  1OGZ A;  8CHO A;  4H61 A;  1GY5 A;  1VQK 3;  2GU3 A;  1FGT A;  2RFR A;  5TGN A;  4IPB A;  3GWR A;  2E2V A;  1VQ7 3;  4HM2 B;  3JUO A;  2CFL A;  5ELJ A;  4XDW A;  2W03 A;  1DMN A;  1NB5 I;  1JKG A;  2XFT A;  1VQO 3;  4K61 A;  1TUH A;  4I4K A;  1PU4 A;  2Z77 A;  1QAK A;  4ZM8 A;  2CW9 A;  5IG3 A;  1VQ8 3;  5EEO A;  1BUQ A;  2O3O A;  2XF3 A;  1IT7 A;  5CF2 A;  1JB2 A;  2C11 A;  1J2B A;  1DYU A;  4O02 B;  2INX A;  3MG3 A;  3RGA A;  4N6N B;  3PZW A;  5AYS C;  4FMB A;  2I9W A;  1VQL 3;  4J8T A;  2B24 B;  3DUK A;  2CHC A;  4QWT A;  1E3V A;  2STD A;  3JUQ A;  1IVU A;  3SXX A;  4XBT A;  5IEO A;  2CWU A;  2FGT A;  4MMY B;  2C10 A;  5EQL A;  3WOF B;  5CLK A;  1IVX A;  2CK3 H;  2KCD A;  2QEX 3;  3CD6 3;  3EJV A;  3STD A;  3JUP A;  2OOV A;  3LTA A;  4CDL A;  4EBG A;  3KE7 A;  4AEQ A;  1A2K A;  2YFJ B;  5BVB A;  1O7P B;  2QGU A;  4NRE A;  1O7M B;  1RRL A;  1LOX A;  5IER A;  3CCV 3;  1IU7 A;  2ML6 A;  5AIF A;  3DGL A;  3MKI A;  3BNB A;  3PCR A;  3RGR A;  3HI7 A;  2OTL 3;  3B4O A;  4N3V A;  3EB8 A;  3FH1 A;  5D81 A;  4RNY A;  3NQZ A;  2L4V A;  4H3U A;  1RKY A;  1F8N A;  2KXG A;  4KFE A;  3MSO A;  1D6Z A;  2F99 A;  2F86 B;  1C7H A;  4N6U A;  3O8Y A;  4EYC A;  4K1V A;  5I97 A;  2XRX B;  3F7X A;  3K0Z A;  3WOE B;  3SOY A;  1W6Y A;  2UX0 A;  3D9R A;  3GZY B;  2HML B;  3H3H A;  4LMI A;  1SII A;  3PYJ A;  4R9L A;  5STD A;  3NXJ A;  1Q82 4;  3PXM A;  4FCJ A;  3H51 A;  3KZT A;  3G0K A;  4RNZ A;  2LYX A;  2XH9 A;  2P0M A;  4G1M B;  4EV5 A;  1OPY A;  1UI8 A;  3X41 A;  2OQE A;  3B8L A;  1IV9 A;  2E2U A;  3DY5 A;  4MEI A;  5IG4 A;  1WMN A;  3FG1 A;  2W56 A;  4HM7 B;  1W5Z A;  1W00 A;  3D3L A;  3SVA A;  2YFL B;  3LH4 A;  3NHX A;  1RJO A;  1OHO A;  3CNM A;  3HZP A;  1YJ9 3;  1T5Y A;  3X40 A;  2JDI H;  1VQN 3;  3LOY A;  3KSE D;  3MYT A;  5CK6 A;  1CQS A;  3FG4 A;  1NO3 A;  1QVF 2;  1L5G B;  1TU5 A;  3FKA A;  2KRT A;  3KKG A;  4L8P A;  3NBB A;  4BTW A;  1A2V A;  1SJW A;  1TIJ A;  2CWT A;  4IT7 A;  5KP3 A;  3KSP A;  3S67 A;  1G96 A;  4Q53 A;  3B7C A;  4HM1 B;  2IUK A;  2SBL A;  3HIG A;  5IG0 A;  3EBT A;  1EG9 B;  3F14 A;  2YX9 A;  3NV0 A;  3I56 3;  1IVW A;  4EXR A;  1HU9 A;  1FGO A;  1W6G A;  4IIA A;  4N6T A;  5CXO A;  4JF8 A;  1A67 A;  2CWV A;  3UL6 A;  4NHF A;  1KSI A;  1NDO B;  5KP1 A;  5AEU B;  1Z1S A;  1Q40 A;  2GEY A;  5IW9 A;  1N8R 4;  2OTJ 3;  5D82 A;  1K73 4;  3EE1 A;  3VSY A;  4WWU C;  4O2H A;  5FW5 A;  1W7C A;  4R80 A;  2LQV A;  3CPO A;  4STD A;  3BLZ A;  3CCM 3;  4OUQ A;  3CCR 3;  4L7K A;  1VZZ A;  2HMN B;  1NB3 I;  3HII A;  1UW1 A;  2CFK A;  3SOA A;  1WQL B;  3F8X A;  4FR9 A;  2A15 A;  1Q86 4;  3LXU X;  2GBW B;  5D83 A;  1IV7 A;  1N9J A;  2RCD A;  2W6J H;  3G8Z A;  3UJM A;  1GYB A;  5LC6 A;  1TFK A;  3GZX B;  4AKY A;  2ZL8 A;  3MWZ A;  2HMJ B;  1YJN 3;  5G2G A;  1TFO A;  3V99 A;  1VQ6 3;  3LTC A;  1W02 A;  1Q81 4;  4FMD A;  1R4C A;  2GU1 A;  3OX9 A;  3CC7 3;  3FLJ A;  1U5O A;  3U97 A;  1ROV A;  4HZ9 B;  1QAL A;  2MF7 A;  4AKZ A;  3PS8 A;  3Q90 A;  4RZM A;  3RDE A;  2OCT A;  1ISK A;  2GBX B;  4KFD A;  3WA3 A;  3CXC 2;  1AVK A;  5AII A;  1JB4 A;  1YGE A;  1OGX A;  4HVN A;  2HMM B;  2JQ5 A;  2CFW A;  1DVD A;  3CNX A;  3S27 A;  1M9G A;  3K7C A;  1EA2 A;  1JRQ A;  1GY6 A;  4LEH A;  3IMA B;  1K41 A;  4OK0 A;  1U8C B;  4HZB B;  3ROB A;  1O7W B;  2BHM A;  3MG1 A;  1A90 A;  3NM2 A;  4HKV B;  4LSO A;  5JPU A;  4WHA A;  3LYG A;  1EKM A;  5EVH A;  1V74 A;  3M8C A;  3OV4 A;  1FGR A;  3X42 A;  1N9E A;  5JPP A;  3FSD A;  4N6M A;  3CME 3;  1VQ4 3;  4GB5 A;  3A76 A;  4EV2 A;  2CC3 A;  2OQE C;  3ECF A;  2XFS A;  1SPU A;  3EN8 A;  3UB1 A;  1VQM 3;  1ZX2 A;  1QMA A;  3CU3 A;  4HM8 B;  1WTH A;  3VGN A;  4K90 B;  4R9K A;  2BNG A;  3G71 3;  5CF1 A;  4FCZ A;  5HGR A;  3LTB A;  3F9S A;  1MOL A;  4K1U A;  3JUN A;  4GL6 A;  4ORL A;  2OOV C;  3E99 A;  3CCU 3;  3S28 A;  1ROA A;  3GRD A;  3NX0 A;  2K54 A;  3G6E 3;  5DRV A;  1FA3 A;  1M90 4;  4HYZ A;  3JVC A;  3IPT A;  3CC4 3;  3T0U A;  3JUM A;  1STF I;  5LC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...