1VQ73

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq7300
3I563 3CCJ3 1W2B2 1VQO3 2QA43 1YI23 3I553 1VQ43 1Q864 3CCE3 1K9M4 3CC43 1VQK3 1VQM3 3G713 1N8R4 1VQL3 1VQ93 2OTL3 1S723 1YJ93 1Q7Y4 1Q814 1JJ22 1VQ63 2QEX3 3CCV3 1YIT3 1VQP3 1VQ73 3CCL3 1KD14 3CCS3 3CME3 1VQ83 3CC23 3CCM3 1K8A4 1KQS2 3CC73 1QVG2 1YIJ3 1Q824 1M904 3CD63 1YHQ3 1M1K4 1KC84 1YJN3 2OTJ3 3G4S3 1VQ53 3CMA3 1QVF2 1YJW3 3CCQ3 1NJI4 1K734 3CXC2 3CCR3 3OW22 3G6E3 1VQN3 3CPW2 3CCU3
chains in the Genus database with same CATH superfamily
4STDA 1VQO3 1YI23 4N6MA 1AV4A 2OQEA 1K9M4 4R9KA 1K41A 2W9QA 3A76A 3NBJA 3VGNA 5AYRB 3V99A 1BUQA 1STDA 3G713 4O02B 1C7HA 2CWVA 4K1VA 1Q7Y4 2GBWB 3F9SA 1GOUA 3M8CA 1RNTA 5IEPA 1KD14 1DYUA 2H0IA 1QJGA 2ML6A 1RGFA 3MWZA 3K5TA 2W56B 4H3UA 4L8PA 1K8A4 2Q07A 2WGQA 3G16A 2FXTA 2BHMA 2RGQA 1GY7A 1SIIA 2PZVA 3G8ZA 1IU7A 2BMRB 3ROBA 3EB8A 3D9RA 1YVSA 4ORLA 1O7GB 1TRPA 2LQVA 6GSPA 1Q42A 1YNVX 5AIGA 5HOHA 2KF3A 3JUMA 2YFLB 1Q40B 2M7OA 2RNTA 4GSPA 3OXAA 1JZOA 4CDLA 2GU1A 3LXUX 3HOHA 2OQEC 1HYFA 2K0MA 5AEUB 1FGTA 1JV2B 1UGIA 4I5QA 4XDVA 4N6V0 4MMYB 5CK6A 5FGOA 1UDII 2P0XA 5JPPA 2HMMB 3HI7A 2Y73A 5TGNA 3RGAA 5A0OB 1NDOB 1RLSA 3HK4A 3CME3 1Q7HA 1R4YA 1OGZA 2UX0A 3KZTA 3F8XA 4XB5A 2BNGA 2CFGA 3UL6A 1O7MB 2GSPA 1FGMA 4EC6A 1BSBA 3EHCA 4GB5A 5IEOA 2CFDA 1A2PA 1IQXA 1JZDA 3S28A 1A2VA 1UCLA 4TX4A 2F56A 3LTAA 1U8CB 5M19A 1OF5A 1FUTA 1OHSA 1T5YA 1GMQA 1I70A 1RNBA 3AMOA 5DREA 2Z7AA 1Y4KA 2C4BA 3X40A 4O2HA 1TUHA 2F98A 3HIGA 1BNRA 1YGEA 3I0YA 2SBLA 2V1LA 2FGTA 2Z76A 3S29A 4OVMA 3T8NA 1RDSA 3F8HA 5CXOA 1GS3A 1I3IA 1RGKA 3WODG 4MMZB 1FGRA 1CH0A 4CJNA 3FGYA 1CYVA 5BVBA 3WDGB 3PZWA 4RNZA 5G2GA 4EXRA 3LTDA 2ZL8A 5GSPA 4J5KA 2IUJA 1BVIA 3CXC2 2XSHB 1BNEA 2J8XB 2P38A 3OW22 4R1KA 1DMQA 3BB9A 3LZAA 2XFSA 4FMBA 3B8LA 1NWWA 1W2ZA 1WMNA 1TIJA 1AVLA 3U1WA 1UGHI 3SOYA 4HVNA 1UCJA 3CU3A 1GMRA 4G1MB 2K3DA 2CG0A 1N8R4 1VQL3 5EEOA 4HM6B 3NM2A 1JN5B 2OCTA 2D42A 4BTYA 1BRKA 5IG3A 1RGLA 1ZX2A 2CW9A 4K61A 3EQQB 3DGYA 3FF0A 3CC23 2IA7A 5BXQA 5IERA 3UNLA 1JKGB 1W7CA 2QGUA 3FSDA 1SQWA 4XBYA 1B27A 2IUKA 4BTWA 3NQZA 3DGMA 4O3VA 3EX9A 2F5MA 4J8TA 1W01A 3NM7A 5IW9A 3LOYA 1S5AA 1IVXA 2XEPA 4X2OA 1GD3A 2XGNA 1IQYA 3G6E3 3KSPA 4IIAA 4RNYA 1OACA 2IMJA 2CK3H 4OK0A 1PYLA 3CCE3 1AY7A 3EF8A 1BSCA 2ZDJA 1IVWA 3OV4A 2HMJB 3X3ZA 2P09A 3GWRA 2UUGC 1UW1A 4CPKA 2QEX3 1LOYA 2MC8A 3LMLA 1YIT3 1O7NB 1IV9A 1K28A 1RTUA 5CF1A 3J7Yd 3CCM3 4HM1B 8CHOA 1C54A 1ULIB 3O8YA 2W03A 3CC73 1LNHA 3DUKA 3FCSB 3F7SA 3NQYA 3CNMA 3FF2A 2XH9A 1IDPA 2INXA 4LGQA 1B2UA 1FGQA 2KXGA 5FW5A 4EBGA 2CKFB 3BLZA 1RRHA 1I2EA 1GY6A 2W56A 1EEJA 1F8NA 3AHSA 1JBTA 1UUWB 1DMNA 1BAOA 3KN4A 1VQ43 1VQN3 1VQQA 1W2B2 1WMOA 1D6YA 1W6GA 1I8VA 1WTHA 1ZO2A 1JB4A 2STDA 3V98A 2KAAA 3Q90A 1CEWI 2HMKB 2YFJB 4KFEA 3PCRA 1YJ93 1Q40A 2KCDA 2ZHXB 1I0VA 1IT7A 2BMOB 4HM5B 1FZUA 1CYUA 3URPA 3SYUA 1YIJ3 2JDIH 1RN7A 2PNCA 2L4VA 3DH2A 2P05A 2BU4A 2KF4A 3Q1CA 4IPBA 1BU4A 1JRQA 3K7CA 3PS8A 2BT3A 3LT8A 1HZ1A 1UCIA 3CCQ3 1B2MA 1MWSA 2GXFA 1HKXA 1T3BA 4EW5A 3MSOA 3SLUA 1IVVA 3LTCA 1UCKA 4JF8A 3I553 3KFQC 5STDA 2CWTA 2KF6A 7GSPA 2W0QA 3SEDA 4MEIA 3DGOA 3BU4A 1B21A 1Q814 4HM0B 3T8UA 3ALAA 3NBRA 2GU3A 1OGXA 1OUNA 1N9JA 1UI8A 1YVBI 4RNTA 1BNGA 3PYJA 1VQ83 1UUVB 1IV7A 4WWUC 1RKYA 1TFOA 4OUQA 1M904 1JNQA 5HGRA 3MYTA 7RNTA 3AGNA 3H51A 1GY5A 4FCJA 1RHLA 1GYBA 1O7PB 1Z1SA 1T2IA 2QIYA 2H0HA 3B4OA 3WR2A 4X2HA 5M18A 5AIHA 2CHCA 4LYLB 1LRAA 4H61A 1ULJB 1X1WA 4ILFA 4N6OB 3UB1A 3CPW2 2W9PA 2OOVC 3DZLA 3X3XA 1I0XA 1OH0A 5EQLA 3N8BA 2A15A 1NU3A 1RGCA 4PEJA 1OHOA 1KSIA 4WYKB 1VQ63 4HM3B 5LC7A 1IT8A 3KSED 1MNLA 2WO0A 1SIHA 2KF5A 3JUNA 3X42A 2CIUA 3LT9A 2XSOB 5JBSA 3NBBA 1KQS2 5AI1A 1LOVA 4BU4A 5M1AA 4O8SA 3U97A 4N6UA 1EUIC 3RNTA 3GZRA 2F86B 1BANA 4HJLB 1GD4A 1W02A 1JN5A 2F5WA 2KRTA 4HM8B 4HM2B 1EQKA 5G1KA 1W6CA 4FR9A 4EYCA 4LMIA 1JKGA 1LVNA 2XR8B 5D83A 1ISKA 1GOYA 5KP1A 4N6NB 4MMXB 3MG2A 5IG5A 1W4NA 1MGWA 2CX1A 1BUJA 1D6UA 1JB2A 3Q3FA 3BIRA 2AADA 2B1XB 2O9UX 5IG0A 3GAXA 1LOWA 1I2FA 1B20A 1R4CA 1WMPA 3G0KA 1VQ73 4KT3B 3F14A 3FZWA 3FH1A 4RBNA 3S5CA 1N5HA 2YFIB 1QVG2 1JB5A 1RJOA 1V58A 3JVCA 1I2GA 1AVKA 1DMMA 3GSPA 4RZMA 5BU4A 2CX0A 4KVHA 4HBRA 2Z6BA 5RNTA 1NB3I 4HM7B 5CLKA 4GHOA 1E97A 5IENA 3F7XA 1QAKA 1IVUA 1OCVA 3EBTA 2GEYA 1JBSA 4FCMA 3CCJ3 3DMCA 1A2KA 5CF2A 3QRDA 1EA2A 1EG9B 1RCLA 2H0GA 3OWSA 2GBXB 1PU4A 1VQM3 3BNBA 3AHWA 2RFRA 3NXJA 2Z77A 4NPBA 3L0RA 3WHOA 4LEHA 2MF7A 3SOAA 3D4AA 3WMDA 1B3SA 4AEQA 2UGIA 3S67A 1TTOA 1YHQ3 1OPYA 3F40A 1RSNA 2BO9B 2HMNB 1US1A 1SJWA 1BSDA 4JRFA 1G0TA 1V57A 2HMOB 2Y74A 2ZA4A 3WOEB 1QVF2 1BSEA 1RGEA 1AR0A 1ASKA 1ROVA 4Q53A 5AEWB 3CCR3 1TRQA 4XBTA 3KIIA 2CFKA 2F4YA 3CCU3 4FMAA 1PFPA 1BNIA 3SXXA 3GZYB 2W6JH 1W00A 2B24B 2FNQA 8RNTA 4N6TA 4XBXA 1BIRA 1TJDA 3UJMA 1TU5A 1CQSA 3BNCA 1FGOA 3IJEB 1JBRA 3KKGA 1V74A 4NREA 1X1YA 1LXEA 3HZPA 1N8QA 1RMSA 2CH9A 1E3RA 3KCHA 3CCL3 4K90B 4HOHA 3MG3A 1G02A 1A67A 1D6ZA 1DVCA 1RGHA 2OWPA 3EN1B 3JUOA 4GL6A 3UL5A 3X3YA 4LSOA 3STDA 3EN8A 3QK9A 1M1K4 1YJN3 2OTJ3 1AQZA 2XGLA 3VSYA 3T0UA 2I9WA 1IQ8A 3D3LA 1RN4A 3EE1A 1N5PA 1NO3A 4HM4B 2BMQB 3GZXB 5G1LA 1K734 3WA2X 1A90A 3NHXA 1PY3A 2CC3A 3MHEA 4J9AA 2OOVA 1B2XA 2R4IA 1VZZA 1BRIA 3NV0B 2RCDA 1QALA 4BIRA 1QMAA 4AKYA 2CWUA 5ELUA 1VQP3 1BRNL 5BIRA 3GZBA 1STFI 4FCZA 3N9HA 3D79A 5KP4A 3CD63 4HZBB 1BRSA 3B4PA 4WYKA 4N6LA 2XFTA 4LZIA 2XRXB 3AGOA 4L7KA 4K1UA 3LTBA 3K9MC 1W6YA 3NUVA 3FG4A 2E2VA 4J5GA 4KFFA 1L5GB 1KWIA 2HOHA 3N54B 2LYXA 4WFOA 5AYSC 2L1SA 3S27A 4EV5A 3CC43 2E2UA 1FYSA 4WP5A 5AIFA 1O7HB 4BL2A 1B2SA 1EKMA 1SARA 5I97A 1IK3A 3CNXA 3WA3A 3SVAA 2YX9A 1RCKA 4FMDA 3D5IA 3CCS3 2D1WA 3EC9A 1GMPA 1UI7A 1RGAA 4HAAA 1E3VA 4R9LA 1DVDA 4ZM8A 3GRDA 4AKZA 4R80A 5DRVA 3MKIA 2SARA 1ROAA 2R41A 4DKIA 3FG1A 6STDA 4HKVB 5IG4A 4IT7A 1YJW3 5EVHA 3IPTA 5ELJA 1FUWA 1MWRA 3A5EA 3X41A 1N9EA 1IYYA 2QA43 1B2ZA 3DY5A 3JUQA 4WHAA 1NB5I 3DGLA 5IF6A 1QAFA 1VQK3 3E99A 4QWTA 5AIIA 5LC6A 3FLJA 4N3VA 5D81A 3TDGA 3EBYA 4NHFA 4EV2A 2JQ5A 9RNTA 3IMAB 2IY2A 1OF5B 3ECFA 2C10A 1Q824 2BIRA 1SPUA 1ZGXA 1NNVA 3AMOB 1MOLA 1ZS7A 3BNDA 4KFDA 2WGOA 5D82A 2P0MA 2XF3A 2RBIA 3JUPA 3SX1A 5JPUA 1KC84 3OX9A 1W5ZA 1WNHA 1HU9A 2CG1A 1NJI4 4CCVA 4HYZA 2E2TA 4L8OA 3NX0A 3LYGA 6RNTA 3WOFB 2HMLB 1VQ93 3DM8A 3HX8A 1DETA 3I563 1LQGC 1LQMB 1X1XA 1J2BA 3ZG5A 1FW7A 1BRJA 1M1XB 1GOVA 1Q864 1FA3A 3OWUA 1LOXA 2CFWA 1LNIA 2C11A 1S723 2GEXA 1UUGB 3RDEA 3DGNA 1BSAA 3K63A 3CCV3 1M9GA 3RGRA 1WQLB 1BNJA 1BOXA 4FMCA 2F99A 3PGBA 1BGSA 1MGRA 5KP3A 3H3HA 1RN1A 3MG1A 1T2HA 1MWTA 2RSXA 3MPHA 4XM4A 2AAEA 1RRLA 3VF1A 1G96A 4HZ9B 1VQ53 3EJVA 1X1UA 4BL3A 1YGWA 1BRGA 2W04A 1MWUA 3OWYA 3KE7A 3K0ZA 2WOHA 4KZ1A 3ZG0A 3LH4A 1BNFA 3V92A 3PCSA 2CFLA 3DXOA 2OTL3 4I4KA 2W2CA 3B7CA 1JJ22 3D5GA 4R4KA 3HIIA 2O3OA 1RGGA 1FUSA 1GSPA 2ML5A 3FKAA 4U13A 2WOFA 1OHPA 3CPOA 1O7WB 1Q9EA 3FG3A 3NV0A 1BNSA 4XDWA 3G4S3 3ZFZA 3BNEA 1TFKA 1DE3A 4BTXA 3Q2PA 4MJDA 3CMA3 3ER7A 1U5OA 1TP6A 1BRHA 2IYJA 2K54A 3PXMA 7STDA 1I3FA
chains in the Genus database with same CATH topology
4STDA 1VQO3 1YI23 4N6MA 1AV4A 2OQEA 1K9M4 4R9KA 1K41A 2W9QA 3A76A 3NBJA 3VGNA 5AYRB 3V99A 1BUQA 1STDA 3G713 4O02B 1C7HA 2CWVA 4K1VA 1Q7Y4 2GBWB 3F9SA 3M8CA 5IEPA 1KD14 1DYUA 2ML6A 1QJGA 3MWZA 4H3UA 4L8PA 3K5TA 2W56B 3S27A 1K8A4 2Q07A 2WGQA 3G16A 2FXTA 2BHMA 2RGQA 1GY7A 1SIIA 2PZVA 3G8ZA 1IU7A 2BMRB 3ROBA 3EB8A 3D9RA 4ORLA 1O7GB 2LQVA 1Q42A 5AIGA 3JUMA 2YFLB 1Q40B 2M7OA 3OXAA 4CDLA 2GU1A 3LXUX 2OQEC 2K0MA 5AEUB 1FGTA 1JV2B 4XDVA 4N6V0 4MMYB 5CK6A 5FGOA 2P0XA 5JPPA 2HMMB 3HI7A 2Y73A 5TGNA 3RGAA 5A0OB 1NDOB 3HK4A 3CME3 1OGZA 2UX0A 3KZTA 3F8XA 4XB5A 2BNGA 2CFGA 3UL6A 1O7MB 1FGMA 4EC6A 3EHCA 4GB5A 5IEOA 2CFDA 1IQXA 3S28A 1A2VA 4TX4A 3LTAA 1U8CB 1OF5A 1OHSA 1T5YA 3AMOA 5DREA 2Z7AA 1Y4KA 3X40A 4O2HA 1TUHA 2F98A 3HIGA 1YGEA 3I0YA 2SBLA 2V1LA 2FGTA 2Z76A 3S29A 4OVMA 3T8NA 3F8HA 5CXOA 1GS3A 3WODG 4MMZB 1FGRA 3FGYA 1CYVA 5BVBA 3WDGB 3PZWA 4RNZA 5G2GA 4EXRA 3LTDA 2ZL8A 2IUJA 3CXC2 2XSHB 2P38A 3OW22 4R1KA 1DMQA 3BB9A 3LZAA 2XFSA 4FMBA 3B8LA 1NWWA 1W2ZA 1WMNA 1TIJA 1AVLA 3U1WA 3SOYA 4HVNA 3CU3A 4G1MB 2CG0A 1N8R4 1VQL3 5EEOA 4HM6B 3NM2A 1JN5B 2OCTA 2D42A 4BTYA 5IG3A 1ZX2A 2CW9A 4K61A 3EQQB 3FF0A 3CC23 2IA7A 5BXQA 5IERA 3UNLA 1JKGB 1W7CA 2QGUA 3FSDA 1SQWA 4XBYA 2IUKA 4BTWA 3NQZA 3DGMA 4O3VA 3EX9A 4J8TA 1W01A 3NM7A 5IW9A 3LOYA 1S5AA 1IVXA 2XEPA 4X2OA 2XGNA 1GD3A 1IQYA 3G6E3 3KSPA 4IIAA 4RNYA 1OACA 2IMJA 2CK3H 4OK0A 3CCE3 3EF8A 2ZDJA 1IVWA 3OV4A 2HMJB 3X3ZA 2P09A 3GWRA 1UW1A 2QEX3 1YIT3 2MC8A 3LMLA 1O7NB 1IV9A 1K28A 5CF1A 3J7Yd 3CCM3 4HM1B 8CHOA 1ULIB 3O8YA 2W03A 3CC73 1LNHA 3DUKA 3FCSB 3F7SA 3NQYA 3CNMA 3FF2A 2XH9A 1IDPA 2INXA 4LGQA 1FGQA 5FW5A 2KXGA 4EBGA 2CKFB 3BLZA 1RRHA 1GY6A 2W56A 1F8NA 1UUWB 1DMNA 3KN4A 1VQ43 1VQN3 1W2B2 1WMOA 1D6YA 1W6GA 1WTHA 1ZO2A 1JB4A 2STDA 3V98A 3Q90A 1CEWI 2HMKB 2YFJB 4KFEA 3PCRA 1YJ93 1Q40A 2KCDA 1IT7A 2BMOB 4HM5B 1CYUA 1YIJ3 2JDIH 1RN7A 2PNCA 2L4VA 2P05A 3Q1CA 4IPBA 1JRQA 3K7CA 3PS8A 2BT3A 3LT8A 3CCQ3 2GXFA 1HKXA 3MSOA 3SLUA 1IVVA 3LTCA 4JF8A 3I553 3KFQC 5STDA 2CWTA 2W0QA 3SEDA 4MEIA 3DGOA 1Q814 4HM0B 3ALAA 3NBRA 2GU3A 1OGXA 1OUNA 1N9JA 1UI8A 1YVBI 3PYJA 1VQ83 1UUVB 1IV7A 4WWUC 1RKYA 1TFOA 4OUQA 1M904 1JNQA 5HGRA 3MYTA 3H51A 1GY5A 4FCJA 1GYBA 1O7PB 1Z1SA 2QIYA 3B4OA 4X2HA 5AIHA 2CHCA 4H61A 1ULJB 4N6OB 3UB1A 3CPW2 2W9PA 2OOVC 3DZLA 3X3XA 1OH0A 5EQLA 3N8BA 2A15A 1NU3A 4WYKB 4PEJA 1OHOA 1KSIA 1VQ63 4HM3B 5LC7A 1IT8A 3KSED 1MNLA 2WO0A 1SIHA 3JUNA 3X42A 2CIUA 3LT9A 2XSOB 5JBSA 3NBBA 1KQS2 5AI1A 4O8SA 3U97A 4N6UA 3GZRA 2F86B 4HJLB 1GD4A 1W02A 1JN5A 2KRTA 4HM8B 4HM2B 1EQKA 1W6CA 4FR9A 4EYCA 4LMIA 2XR8B 1JKGA 1LVNA 5D83A 1ISKA 1FA3A 5KP1A 4N6NB 4MMXB 3MG2A 5IG5A 1W4NA 1D6UA 1JB2A 2B1XB 2O9UX 5IG0A 3GAXA 1WMPA 1R4CA 3G0KA 1VQ73 3F14A 3FZWA 3FH1A 4RBNA 3S5CA 1N5HA 2YFIB 1QVG2 1JB5A 1RJOA 3JVCA 4RZMA 1AVKA 1DMMA 4KVHA 4HBRA 2Z6BA 1NB3I 4HM7B 5CLKA 1E97A 5IENA 3F7XA 1QAKA 1IVUA 1OCVA 3EBTA 2GEYA 4FCMA 3CCJ3 3DMCA 1A2KA 5CF2A 3QRDA 1EA2A 1EG9B 1PU4A 3OWSA 2GBXB 1VQM3 3BNBA 2RFRA 3NXJA 2Z77A 3L0RA 4LEHA 2MF7A 3SOAA 3WMDA 4AEQA 1YHQ3 3S67A 1OPYA 3F40A 2BO9B 2HMNB 1US1A 1SJWA 4JRFA 2HMOB 3WOEB 2Y74A 1QVF2 1AR0A 1ASKA 1ROVA 4Q53A 5AEWB 3CCR3 4XBTA 3KIIA 2CFKA 3CCU3 4FMAA 1PFPA 3SXXA 3GZYB 2W6JH 1W00A 2B24B 2FNQA 4N6TA 4XBXA 3UJMA 1TU5A 1CQSA 3BNCA 1FGOA 3IJEB 3KKGA 1V74A 4NREA 1LXEA 3HZPA 1N8QA 2CH9A 1E3RA 3CCL3 4K90B 3MG3A 1A67A 1D6ZA 1DVCA 2OWPA 3EN1B 3JUOA 4GL6A 3UL5A 3X3YA 4LSOA 3STDA 3EN8A 3QK9A 1M1K4 1YJN3 2OTJ3 2XGLA 3VSYA 3T0UA 2I9WA 1IQ8A 3D3LA 3EE1A 1N5PA 1NO3A 4HM4B 2BMQB 3GZXB 1K734 3WA2X 1A90A 3NHXA 2CC3A 3MHEA 4J9AA 2OOVA 2R4IA 1VZZA 3NV0B 2RCDA 1QALA 1QMAA 4AKYA 2CWUA 5ELUA 1VQP3 3GZBA 1STFI 4FCZA 3N9HA 5KP4A 3CD63 4HZBB 3B4PA 4WYKA 4N6LA 2XFTA 4LZIA 2XRXB 4L7KA 4K1UA 3LTBA 3K9MC 1W6YA 3NUVA 3FG4A 2E2VA 4KFFA 1L5GB 1KWIA 3N54B 4WFOA 2LYXA 5AYSC 4EV5A 3CC43 2E2UA 4WP5A 5AIFA 1O7HB 1EKMA 5I97A 1IK3A 3CNXA 3WA3A 3SVAA 2YX9A 4FMDA 3CCS3 2D1WA 3EC9A 1UI7A 4R9LA 1DVDA 1E3VA 4ZM8A 3GRDA 4AKZA 4R80A 5DRVA 3MKIA 1ROAA 3FG1A 6STDA 4HKVB 5IG4A 4IT7A 1YJW3 5EVHA 3IPTA 5ELJA 1FUWA 3X41A 1N9EA 2QA43 3DY5A 3JUQA 4WHAA 1NB5I 3DGLA 5IF6A 1QAFA 1VQK3 3E99A 4QWTA 5AIIA 5LC6A 3FLJA 4N3VA 5D81A 3TDGA 3EBYA 4NHFA 4EV2A 2JQ5A 3IMAB 3ECFA 1OF5B 2C10A 1Q824 1SPUA 3AMOB 3BNDA 1MOLA 4KFDA 5D82A 2WGOA 3SX1A 2P0MA 2XF3A 3JUPA 5JPUA 1KC84 3OX9A 1W5ZA 1WNHA 1HU9A 2CG1A 1NJI4 4CCVA 4HYZA 2E2TA 4L8OA 3NX0A 3LYGA 3WOFB 2HMLB 1VQ93 3DM8A 3HX8A 3I563 1J2BA 1M1XB 1Q864 3OWUA 1LOXA 2CFWA 2C11A 1S723 2GEXA 3RDEA 3DGNA 3K63A 3CCV3 1M9GA 3RGRA 1WQLB 4FMCA 2F99A 3PGBA 5KP3A 3H3HA 3MG1A 2RSXA 3MPHA 4XM4A 3VF1A 1RRLA 1G96A 4HZ9B 1VQ53 3EJVA 2W04A 3OWYA 3KE7A 3K0ZA 2WOHA 4KZ1A 3LH4A 3V92A 3PCSA 2CFLA 3DXOA 2OTL3 4I4KA 2W2CA 3B7CA 1JJ22 4R4KA 3HIIA 2O3OA 2ML5A 3FKAA 4U13A 2WOFA 1OHPA 3CPOA 1O7WB 3FG3A 3NV0A 4XDWA 3G4S3 3BNEA 1TFKA 4BTXA 3Q2PA 4MJDA 3CMA3 3ER7A 1U5OA 1TP6A 2K54A 3PXMA 7STDA 3T8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 3;  3CCJ 3;  1W2B 2;  1VQO 3;  2QA4 3;  1YI2 3;  3I55 3;  1VQ4 3;  1Q86 4;  3CCE 3;  1K9M 4;  3CC4 3;  1VQK 3;  1VQM 3;  3G71 3;  1N8R 4;  1VQL 3;  1VQ9 3;  2OTL 3;  1S72 3;  1YJ9 3;  1Q7Y 4;  1Q81 4;  1JJ2 2;  1VQ6 3;  2QEX 3;  3CCV 3;  1YIT 3;  1VQP 3;  1VQ7 3;  3CCL 3;  1KD1 4;  3CCS 3;  3CME 3;  1VQ8 3;  3CC2 3;  3CCM 3;  1K8A 4;  1KQS 2;  3CC7 3;  1QVG 2;  1YIJ 3;  1Q82 4;  1M90 4;  3CD6 3;  1YHQ 3;  1M1K 4;  1KC8 4;  1YJN 3;  2OTJ 3;  3G4S 3;  1VQ5 3;  3CMA 3;  1QVF 2;  1YJW 3;  3CCQ 3;  1NJI 4;  1K73 4;  3CXC 2;  3CCR 3;  3OW2 2;  3G6E 3;  1VQN 3;  3CPW 2;  3CCU 3; 
#chains in the Genus database with same CATH topology
 4STD A;  1VQO 3;  1YI2 3;  4N6M A;  1AV4 A;  2OQE A;  1K9M 4;  4R9K A;  1K41 A;  2W9Q A;  3A76 A;  3NBJ A;  3VGN A;  5AYR B;  3V99 A;  1BUQ A;  1STD A;  3G71 3;  4O02 B;  1C7H A;  2CWV A;  4K1V A;  1Q7Y 4;  2GBW B;  3F9S A;  1GOU A;  3M8C A;  1RNT A;  5IEP A;  1KD1 4;  1DYU A;  2H0I A;  1QJG A;  2ML6 A;  1RGF A;  3MWZ A;  3K5T A;  2W56 B;  4H3U A;  4L8P A;  1K8A 4;  2Q07 A;  2WGQ A;  3G16 A;  2FXT A;  2BHM A;  2RGQ A;  1GY7 A;  1SII A;  2PZV A;  3G8Z A;  1IU7 A;  2BMR B;  3ROB A;  3EB8 A;  3D9R A;  1YVS A;  4ORL A;  1O7G B;  1TRP A;  2LQV A;  6GSP A;  1Q42 A;  1YNV X;  5AIG A;  5HOH A;  2KF3 A;  3JUM A;  2YFL B;  1Q40 B;  2M7O A;  2RNT A;  4GSP A;  3OXA A;  1JZO A;  4CDL A;  2GU1 A;  3LXU X;  3HOH A;  2OQE C;  1HYF A;  2K0M A;  5AEU B;  1FGT A;  1JV2 B;  1UGI A;  4I5Q A;  4XDV A;  4N6V 0;  4MMY B;  5CK6 A;  5FGO A;  1UDI I;  2P0X A;  5JPP A;  2HMM B;  3HI7 A;  2Y73 A;  5TGN A;  3RGA A;  5A0O B;  1NDO B;  1RLS A;  3HK4 A;  3CME 3;  1Q7H A;  1R4Y A;  1OGZ A;  2UX0 A;  3KZT A;  3F8X A;  4XB5 A;  2BNG A;  2CFG A;  3UL6 A;  1O7M B;  2GSP A;  1FGM A;  4EC6 A;  1BSB A;  3EHC A;  4GB5 A;  5IEO A;  2CFD A;  1A2P A;  1IQX A;  1JZD A;  3S28 A;  1A2V A;  1UCL A;  4TX4 A;  2F56 A;  3LTA A;  1U8C B;  5M19 A;  1OF5 A;  1FUT A;  1OHS A;  1T5Y A;  1GMQ A;  1I70 A;  1RNB A;  3AMO A;  5DRE A;  2Z7A A;  1Y4K A;  2C4B A;  3X40 A;  4O2H A;  1TUH A;  2F98 A;  3HIG A;  1BNR A;  1YGE A;  3I0Y A;  2SBL A;  2V1L A;  2FGT A;  2Z76 A;  3S29 A;  4OVM A;  3T8N A;  1RDS A;  3F8H A;  5CXO A;  1GS3 A;  1I3I A;  1RGK A;  3WOD G;  4MMZ B;  1FGR A;  1CH0 A;  4CJN A;  3FGY A;  1CYV A;  5BVB A;  3WDG B;  3PZW A;  4RNZ A;  5G2G A;  4EXR A;  3LTD A;  2ZL8 A;  5GSP A;  4J5K A;  2IUJ A;  1BVI A;  3CXC 2;  2XSH B;  1BNE A;  2J8X B;  2P38 A;  3OW2 2;  4R1K A;  1DMQ A;  3BB9 A;  3LZA A;  2XFS A;  4FMB A;  3B8L A;  1NWW A;  1W2Z A;  1WMN A;  1TIJ A;  1AVL A;  3U1W A;  1UGH I;  3SOY A;  4HVN A;  1UCJ A;  3CU3 A;  1GMR A;  4G1M B;  2K3D A;  2CG0 A;  1N8R 4;  1VQL 3;  5EEO A;  4HM6 B;  3NM2 A;  1JN5 B;  2OCT A;  2D42 A;  4BTY A;  1BRK A;  5IG3 A;  1RGL A;  1ZX2 A;  2CW9 A;  4K61 A;  3EQQ B;  3DGY A;  3FF0 A;  3CC2 3;  2IA7 A;  5BXQ A;  5IER A;  3UNL A;  1JKG B;  1W7C A;  2QGU A;  3FSD A;  1SQW A;  4XBY A;  1B27 A;  2IUK A;  4BTW A;  3NQZ A;  3DGM A;  4O3V A;  3EX9 A;  2F5M A;  4J8T A;  1W01 A;  3NM7 A;  5IW9 A;  3LOY A;  1S5A A;  1IVX A;  2XEP A;  4X2O A;  1GD3 A;  2XGN A;  1IQY A;  3G6E 3;  3KSP A;  4IIA A;  4RNY A;  1OAC A;  2IMJ A;  2CK3 H;  4OK0 A;  1PYL A;  3CCE 3;  1AY7 A;  3EF8 A;  1BSC A;  2ZDJ A;  1IVW A;  3OV4 A;  2HMJ B;  3X3Z A;  2P09 A;  3GWR A;  2UUG C;  1UW1 A;  4CPK A;  2QEX 3;  1LOY A;  2MC8 A;  3LML A;  1YIT 3;  1O7N B;  1IV9 A;  1K28 A;  1RTU A;  5CF1 A;  3J7Y d;  3CCM 3;  4HM1 B;  8CHO A;  1C54 A;  1ULI B;  3O8Y A;  2W03 A;  3CC7 3;  1LNH A;  3DUK A;  3FCS B;  3F7S A;  3NQY A;  3CNM A;  3FF2 A;  2XH9 A;  1IDP A;  2INX A;  4LGQ A;  1B2U A;  1FGQ A;  2KXG A;  5FW5 A;  4EBG A;  2CKF B;  3BLZ A;  1RRH A;  1I2E A;  1GY6 A;  2W56 A;  1EEJ A;  1F8N A;  3AHS A;  1JBT A;  1UUW B;  1DMN A;  1BAO A;  3KN4 A;  1VQ4 3;  1VQN 3;  1VQQ A;  1W2B 2;  1WMO A;  1D6Y A;  1W6G A;  1I8V A;  1WTH A;  1ZO2 A;  1JB4 A;  2STD A;  3V98 A;  2KAA A;  3Q90 A;  1CEW I;  2HMK B;  2YFJ B;  4KFE A;  3PCR A;  1YJ9 3;  1Q40 A;  2KCD A;  2ZHX B;  1I0V A;  1IT7 A;  2BMO B;  4HM5 B;  1FZU A;  1CYU A;  3URP A;  3SYU A;  1YIJ 3;  2JDI H;  1RN7 A;  2PNC A;  2L4V A;  3DH2 A;  2P05 A;  2BU4 A;  2KF4 A;  3Q1C A;  4IPB A;  1BU4 A;  1JRQ A;  3K7C A;  3PS8 A;  2BT3 A;  3LT8 A;  1HZ1 A;  1UCI A;  3CCQ 3;  1B2M A;  1MWS A;  2GXF A;  1HKX A;  1T3B A;  4EW5 A;  3MSO A;  3SLU A;  1IVV A;  3LTC A;  1UCK A;  4JF8 A;  3I55 3;  3KFQ C;  5STD A;  2CWT A;  2KF6 A;  7GSP A;  2W0Q A;  3SED A;  4MEI A;  3DGO A;  3BU4 A;  1B21 A;  1Q81 4;  4HM0 B;  3T8U A;  3ALA A;  3NBR A;  2GU3 A;  1OGX A;  1OUN A;  1N9J A;  1UI8 A;  1YVB I;  4RNT A;  1BNG A;  3PYJ A;  1VQ8 3;  1UUV B;  1IV7 A;  4WWU C;  1RKY A;  1TFO A;  4OUQ A;  1M90 4;  1JNQ A;  5HGR A;  3MYT A;  7RNT A;  3AGN A;  3H51 A;  1GY5 A;  4FCJ A;  1RHL A;  1GYB A;  1O7P B;  1Z1S A;  1T2I A;  2QIY A;  2H0H A;  3B4O A;  3WR2 A;  4X2H A;  5M18 A;  5AIH A;  2CHC A;  4LYL B;  1LRA A;  4H61 A;  1ULJ B;  1X1W A;  4ILF A;  4N6O B;  3UB1 A;  3CPW 2;  2W9P A;  2OOV C;  3DZL A;  3X3X A;  1I0X A;  1OH0 A;  5EQL A;  3N8B A;  2A15 A;  1NU3 A;  1RGC A;  4PEJ A;  1OHO A;  1KSI A;  4WYK B;  1VQ6 3;  4HM3 B;  5LC7 A;  1IT8 A;  3KSE D;  1MNL A;  2WO0 A;  1SIH A;  2KF5 A;  3JUN A;  3X42 A;  2CIU A;  3LT9 A;  2XSO B;  5JBS A;  3NBB A;  1KQS 2;  5AI1 A;  1LOV A;  4BU4 A;  5M1A A;  4O8S A;  3U97 A;  4N6U A;  1EUI C;  3RNT A;  3GZR A;  2F86 B;  1BAN A;  4HJL B;  1GD4 A;  1W02 A;  1JN5 A;  2F5W A;  2KRT A;  4HM8 B;  4HM2 B;  1EQK A;  5G1K A;  1W6C A;  4FR9 A;  4EYC A;  4LMI A;  1JKG A;  1LVN A;  2XR8 B;  5D83 A;  1ISK A;  1GOY A;  5KP1 A;  4N6N B;  4MMX B;  3MG2 A;  5IG5 A;  1W4N A;  1MGW A;  2CX1 A;  1BUJ A;  1D6U A;  1JB2 A;  3Q3F A;  3BIR A;  2AAD A;  2B1X B;  2O9U X;  5IG0 A;  3GAX A;  1LOW A;  1I2F A;  1B20 A;  1R4C A;  1WMP A;  3G0K A;  1VQ7 3;  4KT3 B;  3F14 A;  3FZW A;  3FH1 A;  4RBN A;  3S5C A;  1N5H A;  2YFI B;  1QVG 2;  1JB5 A;  1RJO A;  1V58 A;  3JVC A;  1I2G A;  1AVK A;  1DMM A;  3GSP A;  4RZM A;  5BU4 A;  2CX0 A;  4KVH A;  4HBR A;  2Z6B A;  5RNT A;  1NB3 I;  4HM7 B;  5CLK A;  4GHO A;  1E97 A;  5IEN A;  3F7X A;  1QAK A;  1IVU A;  1OCV A;  3EBT A;  2GEY A;  1JBS A;  4FCM A;  3CCJ 3;  3DMC A;  1A2K A;  5CF2 A;  3QRD A;  1EA2 A;  1EG9 B;  1RCL A;  2H0G A;  3OWS A;  2GBX B;  1PU4 A;  1VQM 3;  3BNB A;  3AHW A;  2RFR A;  3NXJ A;  2Z77 A;  4NPB A;  3L0R A;  3WHO A;  4LEH A;  2MF7 A;  3SOA A;  3D4A A;  3WMD A;  1B3S A;  4AEQ A;  2UGI A;  3S67 A;  1TTO A;  1YHQ 3;  1OPY A;  3F40 A;  1RSN A;  2BO9 B;  2HMN B;  1US1 A;  1SJW A;  1BSD A;  4JRF A;  1G0T A;  1V57 A;  2HMO B;  2Y74 A;  2ZA4 A;  3WOE B;  1QVF 2;  1BSE A;  1RGE A;  1AR0 A;  1ASK A;  1ROV A;  4Q53 A;  5AEW B;  3CCR 3;  1TRQ A;  4XBT A;  3KII A;  2CFK A;  2F4Y A;  3CCU 3;  4FMA A;  1PFP A;  1BNI A;  3SXX A;  3GZY B;  2W6J H;  1W00 A;  2B24 B;  2FNQ A;  8RNT A;  4N6T A;  4XBX A;  1BIR A;  1TJD A;  3UJM A;  1TU5 A;  1CQS A;  3BNC A;  1FGO A;  3IJE B;  1JBR A;  3KKG A;  1V74 A;  4NRE A;  1X1Y A;  1LXE A;  3HZP A;  1N8Q A;  1RMS A;  2CH9 A;  1E3R A;  3KCH A;  3CCL 3;  4K90 B;  4HOH A;  3MG3 A;  1G02 A;  1A67 A;  1D6Z A;  1DVC A;  1RGH A;  2OWP A;  3EN1 B;  3JUO A;  4GL6 A;  3UL5 A;  3X3Y A;  4LSO A;  3STD A;  3EN8 A;  3QK9 A;  1M1K 4;  1YJN 3;  2OTJ 3;  1AQZ A;  2XGL A;  3VSY A;  3T0U A;  2I9W A;  1IQ8 A;  3D3L A;  1RN4 A;  3EE1 A;  1N5P A;  1NO3 A;  4HM4 B;  2BMQ B;  3GZX B;  5G1L A;  1K73 4;  3WA2 X;  1A90 A;  3NHX A;  1PY3 A;  2CC3 A;  3MHE A;  4J9A A;  2OOV A;  1B2X A;  2R4I A;  1VZZ A;  1BRI A;  3NV0 B;  2RCD A;  1QAL A;  4BIR A;  1QMA A;  4AKY A;  2CWU A;  5ELU A;  1VQP 3;  1BRN L;  5BIR A;  3GZB A;  1STF I;  4FCZ A;  3N9H A;  3D79 A;  5KP4 A;  3CD6 3;  4HZB B;  1BRS A;  3B4P A;  4WYK A;  4N6L A;  2XFT A;  4LZI A;  2XRX B;  3AGO A;  4L7K A;  4K1U A;  3LTB A;  3K9M C;  1W6Y A;  3NUV A;  3FG4 A;  2E2V A;  4J5G A;  4KFF A;  1L5G B;  1KWI A;  2HOH A;  3N54 B;  2LYX A;  4WFO A;  5AYS C;  2L1S A;  3S27 A;  4EV5 A;  3CC4 3;  2E2U A;  1FYS A;  4WP5 A;  5AIF A;  1O7H B;  4BL2 A;  1B2S A;  1EKM A;  1SAR A;  5I97 A;  1IK3 A;  3CNX A;  3WA3 A;  3SVA A;  2YX9 A;  1RCK A;  4FMD A;  3D5I A;  3CCS 3;  2D1W A;  3EC9 A;  1GMP A;  1UI7 A;  1RGA A;  4HAA A;  1E3V A;  4R9L A;  1DVD A;  4ZM8 A;  3GRD A;  4AKZ A;  4R80 A;  5DRV A;  3MKI A;  2SAR A;  1ROA A;  2R41 A;  4DKI A;  3FG1 A;  6STD A;  4HKV B;  5IG4 A;  4IT7 A;  1YJW 3;  5EVH A;  3IPT A;  5ELJ A;  1FUW A;  1MWR A;  3A5E A;  3X41 A;  1N9E A;  1IYY A;  2QA4 3;  1B2Z A;  3DY5 A;  3JUQ A;  4WHA A;  1NB5 I;  3DGL A;  5IF6 A;  1QAF A;  1VQK 3;  3E99 A;  4QWT A;  5AII A;  5LC6 A;  3FLJ A;  4N3V A;  5D81 A;  3TDG A;  3EBY A;  4NHF A;  4EV2 A;  2JQ5 A;  9RNT A;  3IMA B;  2IY2 A;  1OF5 B;  3ECF A;  2C10 A;  1Q82 4;  2BIR A;  1SPU A;  1ZGX A;  1NNV A;  3AMO B;  1MOL A;  1ZS7 A;  3BND A;  4KFD A;  2WGO A;  5D82 A;  2P0M A;  2XF3 A;  2RBI A;  3JUP A;  3SX1 A;  5JPU A;  1KC8 4;  3OX9 A;  1W5Z A;  1WNH A;  1HU9 A;  2CG1 A;  1NJI 4;  4CCV A;  4HYZ A;  2E2T A;  4L8O A;  3NX0 A;  3LYG A;  6RNT A;  3WOF B;  2HML B;  1VQ9 3;  3DM8 A;  3HX8 A;  1DET A;  3I56 3;  1LQG C;  1LQM B;  1X1X A;  1J2B A;  3ZG5 A;  1FW7 A;  1BRJ A;  1M1X B;  1GOV A;  1Q86 4;  1FA3 A;  3OWU A;  1LOX A;  2CFW A;  1LNI A;  2C11 A;  1S72 3;  2GEX A;  1UUG B;  3RDE A;  3DGN A;  1BSA A;  3K63 A;  3CCV 3;  1M9G A;  3RGR A;  1WQL B;  1BNJ A;  1BOX A;  4FMC A;  2F99 A;  3PGB A;  1BGS A;  1MGR A;  5KP3 A;  3H3H A;  1RN1 A;  3MG1 A;  1T2H A;  1MWT A;  2RSX A;  3MPH A;  4XM4 A;  2AAE A;  1RRL A;  3VF1 A;  1G96 A;  4HZ9 B;  1VQ5 3;  3EJV A;  1X1U A;  4BL3 A;  1YGW A;  1BRG A;  2W04 A;  1MWU A;  3OWY A;  3KE7 A;  3K0Z A;  2WOH A;  4KZ1 A;  3ZG0 A;  3LH4 A;  1BNF A;  3V92 A;  3PCS A;  2CFL A;  3DXO A;  2OTL 3;  4I4K A;  2W2C A;  3B7C A;  1JJ2 2;  3D5G A;  4R4K A;  3HII A;  2O3O A;  1RGG A;  1FUS A;  1GSP A;  2ML5 A;  3FKA A;  4U13 A;  2WOF A;  1OHP A;  3CPO A;  1O7W B;  1Q9E A;  3FG3 A;  3NV0 A;  1BNS A;  4XDW A;  3G4S 3;  3ZFZ A;  3BNE A;  1TFK A;  1DE3 A;  4BTX A;  3Q2P A;  4MJD A;  3CMA 3;  3ER7 A;  1U5O A;  1TP6 A;  1BRH A;  2IYJ A;  2K54 A;  3PXM A;  7STD A;  1I3F A; 
#chains in the Genus database with same CATH homology
 4STD A;  1VQO 3;  1YI2 3;  4N6M A;  1AV4 A;  2OQE A;  1K9M 4;  4R9K A;  1K41 A;  2W9Q A;  3A76 A;  3NBJ A;  3VGN A;  5AYR B;  3V99 A;  1BUQ A;  1STD A;  3G71 3;  4O02 B;  1C7H A;  2CWV A;  4K1V A;  1Q7Y 4;  2GBW B;  3F9S A;  3M8C A;  5IEP A;  1KD1 4;  1DYU A;  2ML6 A;  1QJG A;  3MWZ A;  4H3U A;  4L8P A;  3K5T A;  2W56 B;  3S27 A;  1K8A 4;  2Q07 A;  2WGQ A;  3G16 A;  2FXT A;  2BHM A;  2RGQ A;  1GY7 A;  1SII A;  2PZV A;  3G8Z A;  1IU7 A;  2BMR B;  3ROB A;  3EB8 A;  3D9R A;  4ORL A;  1O7G B;  2LQV A;  1Q42 A;  5AIG A;  3JUM A;  2YFL B;  1Q40 B;  2M7O A;  3OXA A;  4CDL A;  2GU1 A;  3LXU X;  2OQE C;  2K0M A;  5AEU B;  1FGT A;  1JV2 B;  4XDV A;  4N6V 0;  4MMY B;  5CK6 A;  5FGO A;  2P0X A;  5JPP A;  2HMM B;  3HI7 A;  2Y73 A;  5TGN A;  3RGA A;  5A0O B;  1NDO B;  3HK4 A;  3CME 3;  1OGZ A;  2UX0 A;  3KZT A;  3F8X A;  4XB5 A;  2BNG A;  2CFG A;  3UL6 A;  1O7M B;  1FGM A;  4EC6 A;  3EHC A;  4GB5 A;  5IEO A;  2CFD A;  1IQX A;  3S28 A;  1A2V A;  4TX4 A;  3LTA A;  1U8C B;  1OF5 A;  1OHS A;  1T5Y A;  3AMO A;  5DRE A;  2Z7A A;  1Y4K A;  3X40 A;  4O2H A;  1TUH A;  2F98 A;  3HIG A;  1YGE A;  3I0Y A;  2SBL A;  2V1L A;  2FGT A;  2Z76 A;  3S29 A;  4OVM A;  3T8N A;  3F8H A;  5CXO A;  1GS3 A;  3WOD G;  4MMZ B;  1FGR A;  3FGY A;  1CYV A;  5BVB A;  3WDG B;  3PZW A;  4RNZ A;  5G2G A;  4EXR A;  3LTD A;  2ZL8 A;  2IUJ A;  3CXC 2;  2XSH B;  2P38 A;  3OW2 2;  4R1K A;  1DMQ A;  3BB9 A;  3LZA A;  2XFS A;  4FMB A;  3B8L A;  1NWW A;  1W2Z A;  1WMN A;  1TIJ A;  1AVL A;  3U1W A;  3SOY A;  4HVN A;  3CU3 A;  4G1M B;  2CG0 A;  1N8R 4;  1VQL 3;  5EEO A;  4HM6 B;  3NM2 A;  1JN5 B;  2OCT A;  2D42 A;  4BTY A;  5IG3 A;  1ZX2 A;  2CW9 A;  4K61 A;  3EQQ B;  3FF0 A;  3CC2 3;  2IA7 A;  5BXQ A;  5IER A;  3UNL A;  1JKG B;  1W7C A;  2QGU A;  3FSD A;  1SQW A;  4XBY A;  2IUK A;  4BTW A;  3NQZ A;  3DGM A;  4O3V A;  3EX9 A;  4J8T A;  1W01 A;  3NM7 A;  5IW9 A;  3LOY A;  1S5A A;  1IVX A;  2XEP A;  4X2O A;  2XGN A;  1GD3 A;  1IQY A;  3G6E 3;  3KSP A;  4IIA A;  4RNY A;  1OAC A;  2IMJ A;  2CK3 H;  4OK0 A;  3CCE 3;  3EF8 A;  2ZDJ A;  1IVW A;  3OV4 A;  2HMJ B;  3X3Z A;  2P09 A;  3GWR A;  1UW1 A;  2QEX 3;  1YIT 3;  2MC8 A;  3LML A;  1O7N B;  1IV9 A;  1K28 A;  5CF1 A;  3J7Y d;  3CCM 3;  4HM1 B;  8CHO A;  1ULI B;  3O8Y A;  2W03 A;  3CC7 3;  1LNH A;  3DUK A;  3FCS B;  3F7S A;  3NQY A;  3CNM A;  3FF2 A;  2XH9 A;  1IDP A;  2INX A;  4LGQ A;  1FGQ A;  5FW5 A;  2KXG A;  4EBG A;  2CKF B;  3BLZ A;  1RRH A;  1GY6 A;  2W56 A;  1F8N A;  1UUW B;  1DMN A;  3KN4 A;  1VQ4 3;  1VQN 3;  1W2B 2;  1WMO A;  1D6Y A;  1W6G A;  1WTH A;  1ZO2 A;  1JB4 A;  2STD A;  3V98 A;  3Q90 A;  1CEW I;  2HMK B;  2YFJ B;  4KFE A;  3PCR A;  1YJ9 3;  1Q40 A;  2KCD A;  1IT7 A;  2BMO B;  4HM5 B;  1CYU A;  1YIJ 3;  2JDI H;  1RN7 A;  2PNC A;  2L4V A;  2P05 A;  3Q1C A;  4IPB A;  1JRQ A;  3K7C A;  3PS8 A;  2BT3 A;  3LT8 A;  3CCQ 3;  2GXF A;  1HKX A;  3MSO A;  3SLU A;  1IVV A;  3LTC A;  4JF8 A;  3I55 3;  3KFQ C;  5STD A;  2CWT A;  2W0Q A;  3SED A;  4MEI A;  3DGO A;  1Q81 4;  4HM0 B;  3ALA A;  3NBR A;  2GU3 A;  1OGX A;  1OUN A;  1N9J A;  1UI8 A;  1YVB I;  3PYJ A;  1VQ8 3;  1UUV B;  1IV7 A;  4WWU C;  1RKY A;  1TFO A;  4OUQ A;  1M90 4;  1JNQ A;  5HGR A;  3MYT A;  3H51 A;  1GY5 A;  4FCJ A;  1GYB A;  1O7P B;  1Z1S A;  2QIY A;  3B4O A;  4X2H A;  5AIH A;  2CHC A;  4H61 A;  1ULJ B;  4N6O B;  3UB1 A;  3CPW 2;  2W9P A;  2OOV C;  3DZL A;  3X3X A;  1OH0 A;  5EQL A;  3N8B A;  2A15 A;  1NU3 A;  4WYK B;  4PEJ A;  1OHO A;  1KSI A;  1VQ6 3;  4HM3 B;  5LC7 A;  1IT8 A;  3KSE D;  1MNL A;  2WO0 A;  1SIH A;  3JUN A;  3X42 A;  2CIU A;  3LT9 A;  2XSO B;  5JBS A;  3NBB A;  1KQS 2;  5AI1 A;  4O8S A;  3U97 A;  4N6U A;  3GZR A;  2F86 B;  4HJL B;  1GD4 A;  1W02 A;  1JN5 A;  2KRT A;  4HM8 B;  4HM2 B;  1EQK A;  1W6C A;  4FR9 A;  4EYC A;  4LMI A;  2XR8 B;  1JKG A;  1LVN A;  5D83 A;  1ISK A;  1FA3 A;  5KP1 A;  4N6N B;  4MMX B;  3MG2 A;  5IG5 A;  1W4N A;  1D6U A;  1JB2 A;  2B1X B;  2O9U X;  5IG0 A;  3GAX A;  1WMP A;  1R4C A;  3G0K A;  1VQ7 3;  3F14 A;  3FZW A;  3FH1 A;  4RBN A;  3S5C A;  1N5H A;  2YFI B;  1QVG 2;  1JB5 A;  1RJO A;  3JVC A;  4RZM A;  1AVK A;  1DMM A;  4KVH A;  4HBR A;  2Z6B A;  1NB3 I;  4HM7 B;  5CLK A;  1E97 A;  5IEN A;  3F7X A;  1QAK A;  1IVU A;  1OCV A;  3EBT A;  2GEY A;  4FCM A;  3CCJ 3;  3DMC A;  1A2K A;  5CF2 A;  3QRD A;  1EA2 A;  1EG9 B;  1PU4 A;  3OWS A;  2GBX B;  1VQM 3;  3BNB A;  2RFR A;  3NXJ A;  2Z77 A;  3L0R A;  4LEH A;  2MF7 A;  3SOA A;  3WMD A;  4AEQ A;  1YHQ 3;  3S67 A;  1OPY A;  3F40 A;  2BO9 B;  2HMN B;  1US1 A;  1SJW A;  4JRF A;  2HMO B;  3WOE B;  2Y74 A;  1QVF 2;  1AR0 A;  1ASK A;  1ROV A;  4Q53 A;  5AEW B;  3CCR 3;  4XBT A;  3KII A;  2CFK A;  3CCU 3;  4FMA A;  1PFP A;  3SXX A;  3GZY B;  2W6J H;  1W00 A;  2B24 B;  2FNQ A;  4N6T A;  4XBX A;  3UJM A;  1TU5 A;  1CQS A;  3BNC A;  1FGO A;  3IJE B;  3KKG A;  1V74 A;  4NRE A;  1LXE A;  3HZP A;  1N8Q A;  2CH9 A;  1E3R A;  3CCL 3;  4K90 B;  3MG3 A;  1A67 A;  1D6Z A;  1DVC A;  2OWP A;  3EN1 B;  3JUO A;  4GL6 A;  3UL5 A;  3X3Y A;  4LSO A;  3STD A;  3EN8 A;  3QK9 A;  1M1K 4;  1YJN 3;  2OTJ 3;  2XGL A;  3VSY A;  3T0U A;  2I9W A;  1IQ8 A;  3D3L A;  3EE1 A;  1N5P A;  1NO3 A;  4HM4 B;  2BMQ B;  3GZX B;  1K73 4;  3WA2 X;  1A90 A;  3NHX A;  2CC3 A;  3MHE A;  4J9A A;  2OOV A;  2R4I A;  1VZZ A;  3NV0 B;  2RCD A;  1QAL A;  1QMA A;  4AKY A;  2CWU A;  5ELU A;  1VQP 3;  3GZB A;  1STF I;  4FCZ A;  3N9H A;  5KP4 A;  3CD6 3;  4HZB B;  3B4P A;  4WYK A;  4N6L A;  2XFT A;  4LZI A;  2XRX B;  4L7K A;  4K1U A;  3LTB A;  3K9M C;  1W6Y A;  3NUV A;  3FG4 A;  2E2V A;  4KFF A;  1L5G B;  1KWI A;  3N54 B;  4WFO A;  2LYX A;  5AYS C;  4EV5 A;  3CC4 3;  2E2U A;  4WP5 A;  5AIF A;  1O7H B;  1EKM A;  5I97 A;  1IK3 A;  3CNX A;  3WA3 A;  3SVA A;  2YX9 A;  4FMD A;  3CCS 3;  2D1W A;  3EC9 A;  1UI7 A;  4R9L A;  1DVD A;  1E3V A;  4ZM8 A;  3GRD A;  4AKZ A;  4R80 A;  5DRV A;  3MKI A;  1ROA A;  3FG1 A;  6STD A;  4HKV B;  5IG4 A;  4IT7 A;  1YJW 3;  5EVH A;  3IPT A;  5ELJ A;  1FUW A;  3X41 A;  1N9E A;  2QA4 3;  3DY5 A;  3JUQ A;  4WHA A;  1NB5 I;  3DGL A;  5IF6 A;  1QAF A;  1VQK 3;  3E99 A;  4QWT A;  5AII A;  5LC6 A;  3FLJ A;  4N3V A;  5D81 A;  3TDG A;  3EBY A;  4NHF A;  4EV2 A;  2JQ5 A;  3IMA B;  3ECF A;  1OF5 B;  2C10 A;  1Q82 4;  1SPU A;  3AMO B;  3BND A;  1MOL A;  4KFD A;  5D82 A;  2WGO A;  3SX1 A;  2P0M A;  2XF3 A;  3JUP A;  5JPU A;  1KC8 4;  3OX9 A;  1W5Z A;  1WNH A;  1HU9 A;  2CG1 A;  1NJI 4;  4CCV A;  4HYZ A;  2E2T A;  4L8O A;  3NX0 A;  3LYG A;  3WOF B;  2HML B;  1VQ9 3;  3DM8 A;  3HX8 A;  3I56 3;  1J2B A;  1M1X B;  1Q86 4;  3OWU A;  1LOX A;  2CFW A;  2C11 A;  1S72 3;  2GEX A;  3RDE A;  3DGN A;  3K63 A;  3CCV 3;  1M9G A;  3RGR A;  1WQL B;  4FMC A;  2F99 A;  3PGB A;  5KP3 A;  3H3H A;  3MG1 A;  2RSX A;  3MPH A;  4XM4 A;  3VF1 A;  1RRL A;  1G96 A;  4HZ9 B;  1VQ5 3;  3EJV A;  2W04 A;  3OWY A;  3KE7 A;  3K0Z A;  2WOH A;  4KZ1 A;  3LH4 A;  3V92 A;  3PCS A;  2CFL A;  3DXO A;  2OTL 3;  4I4K A;  2W2C A;  3B7C A;  1JJ2 2;  4R4K A;  3HII A;  2O3O A;  2ML5 A;  3FKA A;  4U13 A;  2WOF A;  1OHP A;  3CPO A;  1O7W B;  3FG3 A;  3NV0 A;  4XDW A;  3G4S 3;  3BNE A;  1TFK A;  4BTX A;  3Q2P A;  4MJD A;  3CMA 3;  3ER7 A;  1U5O A;  1TP6 A;  2K54 A;  3PXM A;  7STD A;  3T8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...