6GSPA

Ribonuclease t1/3'-gmp, 15 weeks
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 6gspA00
2F56A 4GSPA 3KCHA 2F4YA 3AGNA 3BIRA 1X1UA 1BGSA 1HZ1A 1LOVA 1BNFA 1B20A 1UCIA 1JBSA 1UCJA 2ZA4A 3Q3FA 1BRSA 1HYFA 2F5MA 1RGKA 1YNVX 1BNGA 1DE3A 1RGFA 3WR2A 1A2PA 1LRAA 7RNTA 1RCKA 2C4BA 1BRJA 1GMPA 1X1XA 1BRNL 1JBTA 1MGRA 5RNTA 2KAAA 1RCLA 1GOVA 1BRIA 3D5GA 1YVSA 1Q9EA 1I3IA 4J5GA 2SARA 1GSPA 3GSPA 1B2MA 1JBRA 1UCLA 1X1YA 1I2FA 1BOXA 3D4AA 4BIRA 1GMQA 5BIRA 1BU4A 1GMRA 1X1WA 1CH0A 1GOYA 1I0XA 4HAAA 3RNTA 1RN1A 3A5EA 2KF5A 1I3FA 1RN4A 2KF6A 6GSPA 1FW7A 1R4YA 1RGGA 1BAOA 4BU4A 3DH2A 1FYSA 1I2GA 1BIRA 1RGCA 3AHSA 8RNTA 1BANA 2HOHA 3AGOA 1TRQA 2BIRA 2F5WA 2RBIA 1RMSA 1B2ZA 1FUTA 4RNTA 1FZUA 1PYLA 2KF3A 1LNIA 1B2UA 1BSEA 2GSPA 1B2SA 1TRPA 1RNTA 1SARA 9RNTA 1RGLA 1FUSA 1RGHA 1T2IA 1C54A 1I0VA 1UCKA 2AAEA 3WHOA 1BRHA 1RSNA 4J5KA 1BNIA 1RDSA 1BNEA 1B2XA 1I70A 1PY3A 2KF4A 1IYYA 1AQZA 1RLSA 4HOHA 4GHOA 1TTOA 6RNTA 1BRKA 7GSPA 1BSBA 1B27A 1B3SA 1RHLA 1AY7A 1GOUA 1DETA 3SYUA 1BSDA 3D5IA 1BVIA 1RGAA 1I2EA 3AHWA 5GSPA 1BUJA 1MGWA 1I8VA 1YGWA 1RNBA 2BU4A 1T2HA 1ZGXA 1BSCA 1B21A 1BRGA 1BNJA 1LOYA 3DGYA 2AADA 1BNRA 3BU4A 1RTUA 1BSAA 5BU4A 1G02A 1RGEA 5HOHA 1BNSA 3URPA 3HOHA 2RNTA 1LOWA
chains in the Genus database with same CATH superfamily
2Z76A 3DUKA 3FG1A 3VSYA 1OCVA 3AGNA 1TUHA 1VQN3 4L8PA 5AIIA 1BGSA 3JUNA 4ZM8A 3V92A 3ALAA 2CHCA 1B20A 4EV5A 2CK3H 1UCJA 3KSPA 3Q3FA 1BRSA 1HYFA 1Y4KA 2CX1A 3LTDA 3KSED 3MKIA 3WA2X 3CC43 1RGFA 3EF8A 2W9PA 1YHQ3 2MF7A 1YJW3 1GD4A 1BUQA 1SIHA 2Z7AA 1LRAA 1O7PB 3FSDA 2C10A 5IW9A 3I563 3UL6A 1US1A 3UB1A 4FMAA 4N6MA 2RSXA 1BRJA 2FNQA 3NV0A 3X40A 1JRQA 1MGRA 2V1LA 4AEQA 5RNTA 1VQP3 1OUNA 1GOVA 4O2HA 4WYKA 1BRIA 3LXUX 4XBXA 5FGOA 1LVNA 3OWSA 2IYJA 1JV2B 3KKGA 1Q9EA 1RRHA 1I3IA 3PGBA 3PZWA 1IK3A 2I9WA 3K9MC 1N8R4 2OWPA 3MHEA 1X1YA 1LXEA 4JF8A 1JZDA 3OWYA 2XGNA 1W02A 1GMQA 5BIRA 1BU4A 1GMRA 1X1WA 1W01A 5CF1A 1IV9A 1CH0A 1GOYA 1QAFA 2O9UX 2MC8A 4FR9A 4HAAA 5IERA 1AVLA 1U5OA 2BMQB 3DGLA 4ILFA 1LQMB 4LEHA 3LTAA 2CX0A 2IMJA 1RGGA 1M1K4 5DRVA 1E3VA 3DH2A 5G1KA 3AHSA 1I2GA 5M1AA 1KQS2 2RCDA 3AGOA 5AIHA 2XEPA 2BIRA 2F5WA 1OHPA 3OV4A 3FF2A 1TFKA 3S5CA 1ZX2A 2ZL8A 4AKYA 3EBYA 2Y74A 2YFLB 1NDOB 1D6ZA 2H0HA 3ER7A 2KF3A 3CCM3 5G1LA 1ROAA 1SQWA 3FKAA 3JVCA 1B2UA 2QEX3 1O7MB 1B2SA 4NPBA 1FUSA 1OHSA 4BTWA 1RGHA 2W56B 3LT8A 1T2IA 2HMKB 3ZG5A 3PCSA 3TDGA 5BVBA 4LSOA 4GL6A 3DGNA 2YX9A 2O3OA 7STDA 3BNEA 1O7WB 1ZO2A 3G713 3U97A 1RDSA 3FG3A 1WMPA 3Q90A 1I70A 1AQZA 3V99A 4R80A 3Q2PA 4N6V0 1PU4A 3BB9A 3FZWA 1RHLA 3DZLA 1LNHA 2RGQA 2CWTA 3F7XA 1NU3A 3G16A 4CCVA 1F8NA 2E2VA 2LYXA 1ROVA 1Q864 1IVVA 1KWIA 1HKXA 1YI23 1JB5A 3NUVA 4N3VA 1E3RA 4HKVB 3HIGA 1GS3A 1MGWA 5GSPA 3EX9A 3CME3 1DYUA 3N9HA 2BU4A 1RNBA 1O7NB 1ZGXA 3EBTA 3N54B 4HM0B 3NX0A 2GEYA 2J8XB 3NBJA 3NBBA 5CXOA 5IG5A 1RN7A 2INXA 1BSAA 1M1XB 4XDWA 5BU4A 1UUVB 1NB3I 4CJNA 3WA3A 2XFTA 1GY6A 3F7SA 2HMLB 3K5TA 4LYLB 4RBNA 3OW22 3J7Yd 1VQ63 4NHFA 1OF5A 2F56A 3FLJA 1W5ZA 1W00A 1W4NA 3CCU3 3BIRA 1Q40A 3I553 1LOVA 1N8QA 1ULJB 3KFQC 1Q824 2IUKA 1IVUA 5DREA 4K1VA 2WO0A 2ZA4A 4WYKB 4HBRA 2F5MA 1YIJ3 1YNVX 3D3LA 5LC7A 2OQEA 3SXXA 1KD14 3WDGB 1EUIC 2XSHB 2P05A 3LYGA 3WR2A 4EBGA 2XR8B 3CCQ3 1A2PA 2JDIH 4R9KA 2CFKA 4OK0A 7RNTA 2CH9A 4LGQA 1IU7A 4OUQA 1VZZA 2Z6BA 2BMRB 1A67A 1RCKA 4RNZA 1GMPA 1BRNL 1JBTA 3F14A 1J2BA 2KAAA 4OVMA 1VQL3 1RCLA 1MWRA 3F40A 3WODG 1OHOA 8CHOA 1YVSA 3CPOA 1UI8A 5JPUA 4QWTA 1GSPA 3GSPA 3A76A 4N6UA 3CMA3 1JNQA 2BT3A 1UCLA 1JBRA 2QGUA 2OQEC 2P0MA 3U1WA 1MWUA 1IQXA 2F98A 2CG1A 5CF2A 3LZAA 1Z1SA 4KFEA 5AI1A 4WWUC 1DVCA 3KZTA 5AEWB 1FA3A 3H51A 4HM4B 3RNTA 1VQ73 2W0QA 4R4KA 4X2HA 5AEUB 2Z77A 3EN8A 1VQK3 4HM1B 3ECFA 9RNTA 6GSPA 1VQ93 3DM8A 3PS8A 1FGRA 4KFDA 1R4YA 4HM8B 4MEIA 4WFOA 3EC9A 2Y73A 5IEOA 4BU4A 2XFSA 1STFI 3K63A 2RFRA 1FYSA 3OWUA 1UDII 1JKGA 1VQM3 4R9LA 2HOHA 2RBIA 2GU3A 2Q07A 1RMSA 1B2ZA 4N6NB 2WGOA 1FUTA 4KT3B 4RNTA 2P09A 3O8YA 3CXC2 2XGLA 1IDPA 2WOFA 3FCSB 3NBRA 1BSEA 5D82A 1JB2A 1TRPA 3LTBA 3EE1A 1JN5A 1UUWB 1WTHA 4U13A 4HM3B 3CC23 3HK4A 1S723 3CU3A 1IVXA 2GXFA 1VQO3 1QVF2 2D1WA 1CYUA 4FMBA 2CFGA 1FGQA 4IPBA 1EKMA 2F99A 4G1MB 4XM4A 1YVBI 1PY3A 1IYYA 4ORLA 4O02B 2K3DA 3D79A 1T3BA 3LOYA 3N8BA 3FG4A 3T8NA 2QIYA 7GSPA 2B1XB 3SOAA 1B27A 2BNGA 3MG2A 1K8A4 3HIIA 2H0IA 5G2GA 4L7KA 4HZ9B 3GWRA 1GY5A 5IEPA 3D5IA 2W9QA 1RGAA 5HGRA 1I2EA 1Q42A 1OF5B 5KP3A 2OTL3 4RZMA 4MMXB 1IT8A 3RGRA 3BNCA 5FW5A 1FGOA 4EV2A 1Q40B 1BSCA 1QAKA 4HZBB 3EJVA 1BRGA 2GEXA 1BNJA 2CW9A 4KVHA 5KP1A 1M904 3JUMA 5JBSA 1VQ53 1IT7A 1TIJA 3BU4A 1RTUA 2GBXB 3G0KA 2CFLA 3URPA 1L5GB 1UW1A 4FCZA 3FH1A 4K61A 3GZBA 4HM5B 1WQLB 4XBYA 3KCHA 4STDA 3H3HA 1OGXA 1HZ1A 1AVKA 1Q7HA 1KC84 3IJEB 1BNFA 3WMDA 4XB5A 2E2TA 1JZOA 1RGKA 1DE3A 1BNGA 3S27A 5IF6A 3OX9A 4CPKA 1DMQA 1SIIA 3GZRA 3MWZA 4HYZA 2L4VA 4HM7B 1QALA 2ZDJA 2FXTA 1K9M4 4EC6A 4IT7A 4MJDA 4I5QA 1A2VA 5EEOA 3X41A 4EYCA 2A15A 3D5GA 4MMZB 4J5GA 2SARA 3CNXA 4X2OA 1B2MA 4O8SA 3NV0B 1OPYA 3FF0A 3JUPA 5CLKA 1I2FA 1JKGB 1MNLA 1W6CA 1IVWA 3UJMA 4LZIA 2E2UA 1RJOA 4DKIA 1G96A 1I0XA 1RN1A 3A5EA 2KF5A 3BNDA 1EQKA 1RN4A 3UL5A 4I4KA 2KF6A 3E99A 3S67A 3SLUA 3F9SA 2JQ5A 1JN5B 1FW7A 1NJI4 1ISKA 1BAOA 1ZS7A 1T5YA 2OCTA 4HM2B 3Q1CA 3RGAA 3JUOA 3KIIA 3X42A 1BIRA 1RGCA 1TFOA 3EHCA 4MMYB 1V58A 3FGYA 2W56A 2KRTA 2XRXB 3WOEB 2D42A 1LOXA 1TU5A 3HI7A 2SBLA 1LNIA 3F8HA 3LT9A 4EW5A 5AIFA 2F86B 2GSPA 1VQQA 2OOVC 3B8LA 1RNTA 3S28A 1DMNA 2ML5A 3GRDA 4HVNA 4XDVA 1LQGC 3M8CA 4L8OA 1IQ8A 3DGMA 5EVHA 1I0VA 1UCKA 1DMMA 3WHOA 1C54A 1BRHA 1W7CA 2HMMB 2LQVA 1K734 1OH0A 3CCV3 1A90A 2OTJ3 3CPW2 3DGOA 5AYRB 1BNIA 1UUGB 3CCS3 3CCL3 1W2ZA 1WMNA 3IPTA 1BNEA 1B2XA 3AMOA 1Q814 4N6OB 4HOHA 3RDEA 6RNTA 4K1UA 1AY7A 2P0XA 1IV7A 1NWWA 4IIAA 1GOUA 3OXAA 1JB4A 2HMJB 4WHAA 3ROBA 1DETA 3WOFB 3BLZA 3UNLA 3LTCA 3X3ZA 3SYUA 4FCMA 1OACA 1V74A 1BVIA 2BHMA 3LMLA 1N5PA 2W6JH 3CC73 1AV4A 1E97A 3LH4A 1BUJA 3PYJA 1YGWA 1EA2A 1T2HA 1W2B2 1B21A 1K41A 3NM7A 5IENA 3DGYA 3JUQA 2HMOB 2L1SA 2CFDA 2AADA 4K90B 4BL3A 4KFFA 3I0YA 5ELJA 2CFWA 5CK6A 1G02A 1RGEA 5BXQA 4JRFA 1HU9A 5M18A 1AR0A 2RNTA 3GZXB 1LOWA 2PZVA 1QMAA 1WNHA 1U8CB 1ASKA 4O3VA 2W04A 1STDA 4GSPA 4KZ1A 2F4YA 4HJLB 1MWTA 1X1UA 3S29A 3CCJ3 3IMAB 5TGNA 3SEDA 3G4S3 2CWUA 2BMOB 1UCIA 1JBSA 1OGZA 3EN1B 3B4PA 5AIGA 2PNCA 2KCDA 3D9RA 2QA43 1UGIA 2YFIB 1CYVA 1Q7Y4 2B24B 2CC3A 5IG3A 1D6YA 5A0OB 5JPPA 1R4CA 1S5AA 2C11A 3ZG0A 3NQYA 1IQYA 1VQ83 2C4BA 3DXOA 3GAXA 1X1XA 1TJDA 5M19A 4J9AA 4FCJA 1YIT3 1O7GB 5EQLA 2W03A 3SOYA 1PFPA 1TP6A 1SJWA 3SX1A 3QRDA 1N5HA 3STDA 4EXRA 1GYBA 2IY2A 3MYTA 3G6E3 1NB5I 5IG4A 2W2CA 3HX8A 4CDLA 1RKYA 4BIRA 1BOXA 3D4AA 3QK9A 1UGHI 6STDA 2YFJB 2BO9B 2P38A 3K7CA 4FMCA 2XSOB 2CKFB 4BTXA 1I3FA 1M9GA 1KSIA 1W6GA 2HMNB 2K54A 2UGIA 2CIUA 2XH9A 3V98A 1V57A 4BTYA 4LMIA 1DVDA 3NXJA 2UUGC 3EQQB 3DY5A 1C7HA 3X3YA 4PEJA 1YJN3 4Q53A 2IA7A 5LC6A 3CNMA 8RNTA 1BANA 3DMCA 1TRQA 4N6LA 3K0ZA 1UI7A 2ML6A 1FZUA 3MSOA 3F8XA 4BL2A 5ELUA 4XBTA 1PYLA 4GB5A 2K0MA 1MOLA 3NHXA 1FUWA 3T8UA 1YJ93 3SVAA 1WMOA 3AMOB 2GU1A 3MG3A 4WP5A 5I97A 5D81A 1SARA 2M7OA 1RGLA 1G0TA 3B7CA 1K28A 4H61A 3PXMA 4N6TA 4RNYA 3ZFZA 3EB8A 4TX4A 2OOVA 3CD63 3PCRA 2AAEA 2R41A 4H3UA 1JJ22 1CEWI 1W6YA 1EEJA 1RSNA 1EG9B 2FGTA 2WGQA 2UX0A 4J5KA 2STDA 4J8TA 3VGNA 2CWVA 1SPUA 3CCE3 1D6UA 1O7HB 2KF4A 2IUJA 4R1KA 1RLSA 4GHOA 1TTOA 3BNBA 1BRKA 1VQ43 5STDA 1BSBA 1B3SA 3KE7A 3HZPA 3MG1A 4AKZA 2R4IA 4HM6B 1A2KA 3VF1A 1BSDA 1YGEA 3AHWA 3L0RA 3GZYB 5D83A 3B4OA 1CQSA 1I8VA 1RRLA 2XF3A 2CG0A 4FMDA 3MPHA 1GY7A 1LOYA 1FGTA 1FGMA 1NNVA 2H0GA 1MWSA 3NM2A 1N9JA 5KP4A 3T0UA 1N9EA 1BNRA 2GBWB 3CCR3 2ZHXB 5IG0A 1NO3A 5AYSC 5HOHA 1ULIB 1GD3A 3G8ZA 1BNSA 1QVG2 2KXGA 3HOHA 1QJGA 3KN4A 3X3XA 3NQZA 2WOHA 4NREA
chains in the Genus database with same CATH topology
2F56A 4GSPA 3KCHA 2F4YA 3AGNA 3BIRA 1X1UA 1BGSA 1HZ1A 1LOVA 1BNFA 1B20A 1UCIA 1JBSA 1UCJA 2ZA4A 3Q3FA 1BRSA 1HYFA 2F5MA 1RGKA 1YNVX 1BNGA 1DE3A 1RGFA 3WR2A 1A2PA 1LRAA 7RNTA 1RCKA 2C4BA 1BRJA 1GMPA 1X1XA 1BRNL 1JBTA 1MGRA 5RNTA 2KAAA 1RCLA 1GOVA 1BRIA 3D5GA 1YVSA 1Q9EA 1I3IA 4J5GA 2SARA 1GSPA 3GSPA 1B2MA 1JBRA 1UCLA 1X1YA 1I2FA 1BOXA 3D4AA 4BIRA 1GMQA 5BIRA 1BU4A 1GMRA 1X1WA 1CH0A 1GOYA 1I0XA 4HAAA 3RNTA 1RN1A 3A5EA 2KF5A 1I3FA 1RN4A 2KF6A 6GSPA 1FW7A 1R4YA 1RGGA 1BAOA 4BU4A 3DH2A 1FYSA 1I2GA 1BIRA 1RGCA 3AHSA 8RNTA 1BANA 2HOHA 3AGOA 1TRQA 2BIRA 2F5WA 2RBIA 1RMSA 1B2ZA 1FUTA 4RNTA 1FZUA 1PYLA 2KF3A 1LNIA 1B2UA 1BSEA 2GSPA 1B2SA 1TRPA 1RNTA 1SARA 9RNTA 1RGLA 1FUSA 1RGHA 1T2IA 1C54A 1I0VA 1UCKA 2AAEA 3WHOA 1BRHA 1RSNA 4J5KA 1BNIA 1RDSA 1BNEA 1B2XA 1I70A 1PY3A 2KF4A 1IYYA 1AQZA 1RLSA 4HOHA 4GHOA 1TTOA 6RNTA 1BRKA 7GSPA 1BSBA 1B27A 1B3SA 1RHLA 1AY7A 1GOUA 1DETA 3SYUA 1BSDA 3D5IA 1BVIA 1RGAA 1I2EA 3AHWA 5GSPA 1BUJA 1MGWA 1I8VA 1YGWA 1RNBA 2BU4A 1T2HA 1ZGXA 1BSCA 1B21A 1BRGA 1BNJA 1LOYA 3DGYA 2AADA 1BNRA 3BU4A 1RTUA 1BSAA 5BU4A 1G02A 1RGEA 5HOHA 1BNSA 3URPA 3HOHA 2RNTA 1LOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F56 A;  4GSP A;  3KCH A;  2F4Y A;  3AGN A;  3BIR A;  1X1U A;  1BGS A;  1HZ1 A;  1LOV A;  1BNF A;  1B20 A;  1UCI A;  1JBS A;  1UCJ A;  2ZA4 A;  3Q3F A;  1BRS A;  1HYF A;  2F5M A;  1RGK A;  1YNV X;  1BNG A;  1DE3 A;  1RGF A;  3WR2 A;  1A2P A;  1LRA A;  7RNT A;  1RCK A;  2C4B A;  1BRJ A;  1GMP A;  1X1X A;  1BRN L;  1JBT A;  1MGR A;  5RNT A;  2KAA A;  1RCL A;  1GOV A;  1BRI A;  3D5G A;  1YVS A;  1Q9E A;  1I3I A;  4J5G A;  2SAR A;  1GSP A;  3GSP A;  1B2M A;  1JBR A;  1UCL A;  1X1Y A;  1I2F A;  1BOX A;  3D4A A;  4BIR A;  1GMQ A;  5BIR A;  1BU4 A;  1GMR A;  1X1W A;  1CH0 A;  1GOY A;  1I0X A;  4HAA A;  3RNT A;  1RN1 A;  3A5E A;  2KF5 A;  1I3F A;  1RN4 A;  2KF6 A;  6GSP A;  1FW7 A;  1R4Y A;  1RGG A;  1BAO A;  4BU4 A;  3DH2 A;  1FYS A;  1I2G A;  1BIR A;  1RGC A;  3AHS A;  8RNT A;  1BAN A;  2HOH A;  3AGO A;  1TRQ A;  2BIR A;  2F5W A;  2RBI A;  1RMS A;  1B2Z A;  1FUT A;  4RNT A;  1FZU A;  1PYL A;  2KF3 A;  1LNI A;  1B2U A;  1BSE A;  2GSP A;  1B2S A;  1TRP A;  1RNT A;  1SAR A;  9RNT A;  1RGL A;  1FUS A;  1RGH A;  1T2I A;  1C54 A;  1I0V A;  1UCK A;  2AAE A;  3WHO A;  1BRH A;  1RSN A;  4J5K A;  1BNI A;  1RDS A;  1BNE A;  1B2X A;  1I70 A;  1PY3 A;  2KF4 A;  1IYY A;  1AQZ A;  1RLS A;  4HOH A;  4GHO A;  1TTO A;  6RNT A;  1BRK A;  7GSP A;  1BSB A;  1B27 A;  1B3S A;  1RHL A;  1AY7 A;  1GOU A;  1DET A;  3SYU A;  1BSD A;  3D5I A;  1BVI A;  1RGA A;  1I2E A;  3AHW A;  5GSP A;  1BUJ A;  1MGW A;  1I8V A;  1YGW A;  1RNB A;  2BU4 A;  1T2H A;  1ZGX A;  1BSC A;  1B21 A;  1BRG A;  1BNJ A;  1LOY A;  3DGY A;  2AAD A;  1BNR A;  3BU4 A;  1RTU A;  1BSA A;  5BU4 A;  1G02 A;  1RGE A;  5HOH A;  1BNS A;  3URP A;  3HOH A;  2RNT A;  1LOW A; 
#chains in the Genus database with same CATH topology
 2Z76 A;  3DUK A;  3FG1 A;  3VSY A;  1OCV A;  3AGN A;  1TUH A;  1VQN 3;  4L8P A;  5AII A;  1BGS A;  3JUN A;  4ZM8 A;  3V92 A;  3ALA A;  2CHC A;  1B20 A;  4EV5 A;  2CK3 H;  1UCJ A;  3KSP A;  3Q3F A;  1BRS A;  1HYF A;  1Y4K A;  2CX1 A;  3LTD A;  3KSE D;  3MKI A;  3WA2 X;  3CC4 3;  1RGF A;  3EF8 A;  2W9P A;  1YHQ 3;  2MF7 A;  1YJW 3;  1GD4 A;  1BUQ A;  1SIH A;  2Z7A A;  1LRA A;  1O7P B;  3FSD A;  2C10 A;  5IW9 A;  3I56 3;  3UL6 A;  1US1 A;  3UB1 A;  4FMA A;  4N6M A;  2RSX A;  1BRJ A;  2FNQ A;  3NV0 A;  3X40 A;  1JRQ A;  1MGR A;  2V1L A;  4AEQ A;  5RNT A;  1VQP 3;  1OUN A;  1GOV A;  4O2H A;  4WYK A;  1BRI A;  3LXU X;  4XBX A;  5FGO A;  1LVN A;  3OWS A;  2IYJ A;  1JV2 B;  3KKG A;  1Q9E A;  1RRH A;  1I3I A;  3PGB A;  3PZW A;  1IK3 A;  2I9W A;  3K9M C;  1N8R 4;  2OWP A;  3MHE A;  1X1Y A;  1LXE A;  4JF8 A;  1JZD A;  3OWY A;  2XGN A;  1W02 A;  1GMQ A;  5BIR A;  1BU4 A;  1GMR A;  1X1W A;  1W01 A;  5CF1 A;  1IV9 A;  1CH0 A;  1GOY A;  1QAF A;  2O9U X;  2MC8 A;  4FR9 A;  4HAA A;  5IER A;  1AVL A;  1U5O A;  2BMQ B;  3DGL A;  4ILF A;  1LQM B;  4LEH A;  3LTA A;  2CX0 A;  2IMJ A;  1RGG A;  1M1K 4;  5DRV A;  1E3V A;  3DH2 A;  5G1K A;  3AHS A;  1I2G A;  5M1A A;  1KQS 2;  2RCD A;  3AGO A;  5AIH A;  2XEP A;  2BIR A;  2F5W A;  1OHP A;  3OV4 A;  3FF2 A;  1TFK A;  3S5C A;  1ZX2 A;  2ZL8 A;  4AKY A;  3EBY A;  2Y74 A;  2YFL B;  1NDO B;  1D6Z A;  2H0H A;  3ER7 A;  2KF3 A;  3CCM 3;  5G1L A;  1ROA A;  1SQW A;  3FKA A;  3JVC A;  1B2U A;  2QEX 3;  1O7M B;  1B2S A;  4NPB A;  1FUS A;  1OHS A;  4BTW A;  1RGH A;  2W56 B;  3LT8 A;  1T2I A;  2HMK B;  3ZG5 A;  3PCS A;  3TDG A;  5BVB A;  4LSO A;  4GL6 A;  3DGN A;  2YX9 A;  2O3O A;  7STD A;  3BNE A;  1O7W B;  1ZO2 A;  3G71 3;  3U97 A;  1RDS A;  3FG3 A;  1WMP A;  3Q90 A;  1I70 A;  1AQZ A;  3V99 A;  4R80 A;  3Q2P A;  4N6V 0;  1PU4 A;  3BB9 A;  3FZW A;  1RHL A;  3DZL A;  1LNH A;  2RGQ A;  2CWT A;  3F7X A;  1NU3 A;  3G16 A;  4CCV A;  1F8N A;  2E2V A;  2LYX A;  1ROV A;  1Q86 4;  1IVV A;  1KWI A;  1HKX A;  1YI2 3;  1JB5 A;  3NUV A;  4N3V A;  1E3R A;  4HKV B;  3HIG A;  1GS3 A;  1MGW A;  5GSP A;  3EX9 A;  3CME 3;  1DYU A;  3N9H A;  2BU4 A;  1RNB A;  1O7N B;  1ZGX A;  3EBT A;  3N54 B;  4HM0 B;  3NX0 A;  2GEY A;  2J8X B;  3NBJ A;  3NBB A;  5CXO A;  5IG5 A;  1RN7 A;  2INX A;  1BSA A;  1M1X B;  4XDW A;  5BU4 A;  1UUV B;  1NB3 I;  4CJN A;  3WA3 A;  2XFT A;  1GY6 A;  3F7S A;  2HML B;  3K5T A;  4LYL B;  4RBN A;  3OW2 2;  3J7Y d;  1VQ6 3;  4NHF A;  1OF5 A;  2F56 A;  3FLJ A;  1W5Z A;  1W00 A;  1W4N A;  3CCU 3;  3BIR A;  1Q40 A;  3I55 3;  1LOV A;  1N8Q A;  1ULJ B;  3KFQ C;  1Q82 4;  2IUK A;  1IVU A;  5DRE A;  4K1V A;  2WO0 A;  2ZA4 A;  4WYK B;  4HBR A;  2F5M A;  1YIJ 3;  1YNV X;  3D3L A;  5LC7 A;  2OQE A;  3SXX A;  1KD1 4;  3WDG B;  1EUI C;  2XSH B;  2P05 A;  3LYG A;  3WR2 A;  4EBG A;  2XR8 B;  3CCQ 3;  1A2P A;  2JDI H;  4R9K A;  2CFK A;  4OK0 A;  7RNT A;  2CH9 A;  4LGQ A;  1IU7 A;  4OUQ A;  1VZZ A;  2Z6B A;  2BMR B;  1A67 A;  1RCK A;  4RNZ A;  1GMP A;  1BRN L;  1JBT A;  3F14 A;  1J2B A;  2KAA A;  4OVM A;  1VQL 3;  1RCL A;  1MWR A;  3F40 A;  3WOD G;  1OHO A;  8CHO A;  1YVS A;  3CPO A;  1UI8 A;  5JPU A;  4QWT A;  1GSP A;  3GSP A;  3A76 A;  4N6U A;  3CMA 3;  1JNQ A;  2BT3 A;  1UCL A;  1JBR A;  2QGU A;  2OQE C;  2P0M A;  3U1W A;  1MWU A;  1IQX A;  2F98 A;  2CG1 A;  5CF2 A;  3LZA A;  1Z1S A;  4KFE A;  5AI1 A;  4WWU C;  1DVC A;  3KZT A;  5AEW B;  1FA3 A;  3H51 A;  4HM4 B;  3RNT A;  1VQ7 3;  2W0Q A;  4R4K A;  4X2H A;  5AEU B;  2Z77 A;  3EN8 A;  1VQK 3;  4HM1 B;  3ECF A;  9RNT A;  6GSP A;  1VQ9 3;  3DM8 A;  3PS8 A;  1FGR A;  4KFD A;  1R4Y A;  4HM8 B;  4MEI A;  4WFO A;  3EC9 A;  2Y73 A;  5IEO A;  4BU4 A;  2XFS A;  1STF I;  3K63 A;  2RFR A;  1FYS A;  3OWU A;  1UDI I;  1JKG A;  1VQM 3;  4R9L A;  2HOH A;  2RBI A;  2GU3 A;  2Q07 A;  1RMS A;  1B2Z A;  4N6N B;  2WGO A;  1FUT A;  4KT3 B;  4RNT A;  2P09 A;  3O8Y A;  3CXC 2;  2XGL A;  1IDP A;  2WOF A;  3FCS B;  3NBR A;  1BSE A;  5D82 A;  1JB2 A;  1TRP A;  3LTB A;  3EE1 A;  1JN5 A;  1UUW B;  1WTH A;  4U13 A;  4HM3 B;  3CC2 3;  3HK4 A;  1S72 3;  3CU3 A;  1IVX A;  2GXF A;  1VQO 3;  1QVF 2;  2D1W A;  1CYU A;  4FMB A;  2CFG A;  1FGQ A;  4IPB A;  1EKM A;  2F99 A;  4G1M B;  4XM4 A;  1YVB I;  1PY3 A;  1IYY A;  4ORL A;  4O02 B;  2K3D A;  3D79 A;  1T3B A;  3LOY A;  3N8B A;  3FG4 A;  3T8N A;  2QIY A;  7GSP A;  2B1X B;  3SOA A;  1B27 A;  2BNG A;  3MG2 A;  1K8A 4;  3HII A;  2H0I A;  5G2G A;  4L7K A;  4HZ9 B;  3GWR A;  1GY5 A;  5IEP A;  3D5I A;  2W9Q A;  1RGA A;  5HGR A;  1I2E A;  1Q42 A;  1OF5 B;  5KP3 A;  2OTL 3;  4RZM A;  4MMX B;  1IT8 A;  3RGR A;  3BNC A;  5FW5 A;  1FGO A;  4EV2 A;  1Q40 B;  1BSC A;  1QAK A;  4HZB B;  3EJV A;  1BRG A;  2GEX A;  1BNJ A;  2CW9 A;  4KVH A;  5KP1 A;  1M90 4;  3JUM A;  5JBS A;  1VQ5 3;  1IT7 A;  1TIJ A;  3BU4 A;  1RTU A;  2GBX B;  3G0K A;  2CFL A;  3URP A;  1L5G B;  1UW1 A;  4FCZ A;  3FH1 A;  4K61 A;  3GZB A;  4HM5 B;  1WQL B;  4XBY A;  3KCH A;  4STD A;  3H3H A;  1OGX A;  1HZ1 A;  1AVK A;  1Q7H A;  1KC8 4;  3IJE B;  1BNF A;  3WMD A;  4XB5 A;  2E2T A;  1JZO A;  1RGK A;  1DE3 A;  1BNG A;  3S27 A;  5IF6 A;  3OX9 A;  4CPK A;  1DMQ A;  1SII A;  3GZR A;  3MWZ A;  4HYZ A;  2L4V A;  4HM7 B;  1QAL A;  2ZDJ A;  2FXT A;  1K9M 4;  4EC6 A;  4IT7 A;  4MJD A;  4I5Q A;  1A2V A;  5EEO A;  3X41 A;  4EYC A;  2A15 A;  3D5G A;  4MMZ B;  4J5G A;  2SAR A;  3CNX A;  4X2O A;  1B2M A;  4O8S A;  3NV0 B;  1OPY A;  3FF0 A;  3JUP A;  5CLK A;  1I2F A;  1JKG B;  1MNL A;  1W6C A;  1IVW A;  3UJM A;  4LZI A;  2E2U A;  1RJO A;  4DKI A;  1G96 A;  1I0X A;  1RN1 A;  3A5E A;  2KF5 A;  3BND A;  1EQK A;  1RN4 A;  3UL5 A;  4I4K A;  2KF6 A;  3E99 A;  3S67 A;  3SLU A;  3F9S A;  2JQ5 A;  1JN5 B;  1FW7 A;  1NJI 4;  1ISK A;  1BAO A;  1ZS7 A;  1T5Y A;  2OCT A;  4HM2 B;  3Q1C A;  3RGA A;  3JUO A;  3KII A;  3X42 A;  1BIR A;  1RGC A;  1TFO A;  3EHC A;  4MMY B;  1V58 A;  3FGY A;  2W56 A;  2KRT A;  2XRX B;  3WOE B;  2D42 A;  1LOX A;  1TU5 A;  3HI7 A;  2SBL A;  1LNI A;  3F8H A;  3LT9 A;  4EW5 A;  5AIF A;  2F86 B;  2GSP A;  1VQQ A;  2OOV C;  3B8L A;  1RNT A;  3S28 A;  1DMN A;  2ML5 A;  3GRD A;  4HVN A;  4XDV A;  1LQG C;  3M8C A;  4L8O A;  1IQ8 A;  3DGM A;  5EVH A;  1I0V A;  1UCK A;  1DMM A;  3WHO A;  1C54 A;  1BRH A;  1W7C A;  2HMM B;  2LQV A;  1K73 4;  1OH0 A;  3CCV 3;  1A90 A;  2OTJ 3;  3CPW 2;  3DGO A;  5AYR B;  1BNI A;  1UUG B;  3CCS 3;  3CCL 3;  1W2Z A;  1WMN A;  3IPT A;  1BNE A;  1B2X A;  3AMO A;  1Q81 4;  4N6O B;  4HOH A;  3RDE A;  6RNT A;  4K1U A;  1AY7 A;  2P0X A;  1IV7 A;  1NWW A;  4IIA A;  1GOU A;  3OXA A;  1JB4 A;  2HMJ B;  4WHA A;  3ROB A;  1DET A;  3WOF B;  3BLZ A;  3UNL A;  3LTC A;  3X3Z A;  3SYU A;  4FCM A;  1OAC A;  1V74 A;  1BVI A;  2BHM A;  3LML A;  1N5P A;  2W6J H;  3CC7 3;  1AV4 A;  1E97 A;  3LH4 A;  1BUJ A;  3PYJ A;  1YGW A;  1EA2 A;  1T2H A;  1W2B 2;  1B21 A;  1K41 A;  3NM7 A;  5IEN A;  3DGY A;  3JUQ A;  2HMO B;  2L1S A;  2CFD A;  2AAD A;  4K90 B;  4BL3 A;  4KFF A;  3I0Y A;  5ELJ A;  2CFW A;  5CK6 A;  1G02 A;  1RGE A;  5BXQ A;  4JRF A;  1HU9 A;  5M18 A;  1AR0 A;  2RNT A;  3GZX B;  1LOW A;  2PZV A;  1QMA A;  1WNH A;  1U8C B;  1ASK A;  4O3V A;  2W04 A;  1STD A;  4GSP A;  4KZ1 A;  2F4Y A;  4HJL B;  1MWT A;  1X1U A;  3S29 A;  3CCJ 3;  3IMA B;  5TGN A;  3SED A;  3G4S 3;  2CWU A;  2BMO B;  1UCI A;  1JBS A;  1OGZ A;  3EN1 B;  3B4P A;  5AIG A;  2PNC A;  2KCD A;  3D9R A;  2QA4 3;  1UGI A;  2YFI B;  1CYV A;  1Q7Y 4;  2B24 B;  2CC3 A;  5IG3 A;  1D6Y A;  5A0O B;  5JPP A;  1R4C A;  1S5A A;  2C11 A;  3ZG0 A;  3NQY A;  1IQY A;  1VQ8 3;  2C4B A;  3DXO A;  3GAX A;  1X1X A;  1TJD A;  5M19 A;  4J9A A;  4FCJ A;  1YIT 3;  1O7G B;  5EQL A;  2W03 A;  3SOY A;  1PFP A;  1TP6 A;  1SJW A;  3SX1 A;  3QRD A;  1N5H A;  3STD A;  4EXR A;  1GYB A;  2IY2 A;  3MYT A;  3G6E 3;  1NB5 I;  5IG4 A;  2W2C A;  3HX8 A;  4CDL A;  1RKY A;  4BIR A;  1BOX A;  3D4A A;  3QK9 A;  1UGH I;  6STD A;  2YFJ B;  2BO9 B;  2P38 A;  3K7C A;  4FMC A;  2XSO B;  2CKF B;  4BTX A;  1I3F A;  1M9G A;  1KSI A;  1W6G A;  2HMN B;  2K54 A;  2UGI A;  2CIU A;  2XH9 A;  3V98 A;  1V57 A;  4BTY A;  4LMI A;  1DVD A;  3NXJ A;  2UUG C;  3EQQ B;  3DY5 A;  1C7H A;  3X3Y A;  4PEJ A;  1YJN 3;  4Q53 A;  2IA7 A;  5LC6 A;  3CNM A;  8RNT A;  1BAN A;  3DMC A;  1TRQ A;  4N6L A;  3K0Z A;  1UI7 A;  2ML6 A;  1FZU A;  3MSO A;  3F8X A;  4BL2 A;  5ELU A;  4XBT A;  1PYL A;  4GB5 A;  2K0M A;  1MOL A;  3NHX A;  1FUW A;  3T8U A;  1YJ9 3;  3SVA A;  1WMO A;  3AMO B;  2GU1 A;  3MG3 A;  4WP5 A;  5I97 A;  5D81 A;  1SAR A;  2M7O A;  1RGL A;  1G0T A;  3B7C A;  1K28 A;  4H61 A;  3PXM A;  4N6T A;  4RNY A;  3ZFZ A;  3EB8 A;  4TX4 A;  2OOV A;  3CD6 3;  3PCR A;  2AAE A;  2R41 A;  4H3U A;  1JJ2 2;  1CEW I;  1W6Y A;  1EEJ A;  1RSN A;  1EG9 B;  2FGT A;  2WGQ A;  2UX0 A;  4J5K A;  2STD A;  4J8T A;  3VGN A;  2CWV A;  1SPU A;  3CCE 3;  1D6U A;  1O7H B;  2KF4 A;  2IUJ A;  4R1K A;  1RLS A;  4GHO A;  1TTO A;  3BNB A;  1BRK A;  1VQ4 3;  5STD A;  1BSB A;  1B3S A;  3KE7 A;  3HZP A;  3MG1 A;  4AKZ A;  2R4I A;  4HM6 B;  1A2K A;  3VF1 A;  1BSD A;  1YGE A;  3AHW A;  3L0R A;  3GZY B;  5D83 A;  3B4O A;  1CQS A;  1I8V A;  1RRL A;  2XF3 A;  2CG0 A;  4FMD A;  3MPH A;  1GY7 A;  1LOY A;  1FGT A;  1FGM A;  1NNV A;  2H0G A;  1MWS A;  3NM2 A;  1N9J A;  5KP4 A;  3T0U A;  1N9E A;  1BNR A;  2GBW B;  3CCR 3;  2ZHX B;  5IG0 A;  1NO3 A;  5AYS C;  5HOH A;  1ULI B;  1GD3 A;  3G8Z A;  1BNS A;  1QVG 2;  2KXG A;  3HOH A;  1QJG A;  3KN4 A;  3X3X A;  3NQZ A;  2WOH A;  4NRE A; 
#chains in the Genus database with same CATH homology
 2F56 A;  4GSP A;  3KCH A;  2F4Y A;  3AGN A;  3BIR A;  1X1U A;  1BGS A;  1HZ1 A;  1LOV A;  1BNF A;  1B20 A;  1UCI A;  1JBS A;  1UCJ A;  2ZA4 A;  3Q3F A;  1BRS A;  1HYF A;  2F5M A;  1RGK A;  1YNV X;  1BNG A;  1DE3 A;  1RGF A;  3WR2 A;  1A2P A;  1LRA A;  7RNT A;  1RCK A;  2C4B A;  1BRJ A;  1GMP A;  1X1X A;  1BRN L;  1JBT A;  1MGR A;  5RNT A;  2KAA A;  1RCL A;  1GOV A;  1BRI A;  3D5G A;  1YVS A;  1Q9E A;  1I3I A;  4J5G A;  2SAR A;  1GSP A;  3GSP A;  1B2M A;  1JBR A;  1UCL A;  1X1Y A;  1I2F A;  1BOX A;  3D4A A;  4BIR A;  1GMQ A;  5BIR A;  1BU4 A;  1GMR A;  1X1W A;  1CH0 A;  1GOY A;  1I0X A;  4HAA A;  3RNT A;  1RN1 A;  3A5E A;  2KF5 A;  1I3F A;  1RN4 A;  2KF6 A;  6GSP A;  1FW7 A;  1R4Y A;  1RGG A;  1BAO A;  4BU4 A;  3DH2 A;  1FYS A;  1I2G A;  1BIR A;  1RGC A;  3AHS A;  8RNT A;  1BAN A;  2HOH A;  3AGO A;  1TRQ A;  2BIR A;  2F5W A;  2RBI A;  1RMS A;  1B2Z A;  1FUT A;  4RNT A;  1FZU A;  1PYL A;  2KF3 A;  1LNI A;  1B2U A;  1BSE A;  2GSP A;  1B2S A;  1TRP A;  1RNT A;  1SAR A;  9RNT A;  1RGL A;  1FUS A;  1RGH A;  1T2I A;  1C54 A;  1I0V A;  1UCK A;  2AAE A;  3WHO A;  1BRH A;  1RSN A;  4J5K A;  1BNI A;  1RDS A;  1BNE A;  1B2X A;  1I70 A;  1PY3 A;  2KF4 A;  1IYY A;  1AQZ A;  1RLS A;  4HOH A;  4GHO A;  1TTO A;  6RNT A;  1BRK A;  7GSP A;  1BSB A;  1B27 A;  1B3S A;  1RHL A;  1AY7 A;  1GOU A;  1DET A;  3SYU A;  1BSD A;  3D5I A;  1BVI A;  1RGA A;  1I2E A;  3AHW A;  5GSP A;  1BUJ A;  1MGW A;  1I8V A;  1YGW A;  1RNB A;  2BU4 A;  1T2H A;  1ZGX A;  1BSC A;  1B21 A;  1BRG A;  1BNJ A;  1LOY A;  3DGY A;  2AAD A;  1BNR A;  3BU4 A;  1RTU A;  1BSA A;  5BU4 A;  1G02 A;  1RGE A;  5HOH A;  1BNS A;  3URP A;  3HOH A;  2RNT A;  1LOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...