6GSPA

Ribonuclease t1/3'-gmp, 15 weeks
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 6gspA00
1UCKA 1B2ZA 2BU4A 3WR2A 1BSEA 2RNTA 3AHSA 1R4YA 1X1YA 2SARA 1TRQA 3GSPA 1MGRA 1B3SA 3RNTA 1GOVA 1X1XA 1RNTA 1BRSA 4GHOA 1B20A 1BUJA 3BU4A 1UCIA 3Q3FA 1RGCA 8RNTA 1B2SA 1RGGA 1RMSA 1BGSA 1YGWA 5RNTA 1GOUA 1BSAA 1BANA 1JBRA 1BNIA 7RNTA 2F5WA 2F5MA 1I70A 1I8VA 1LOVA 1RLSA 1G02A 1RCLA 3DH2A 1I2EA 1C54A 1BAOA 4BIRA 1X1WA 3SYUA 5GSPA 2RBIA 3KCHA 1RGEA 1RGFA 2C4BA 1RGKA 1I2GA 1TRPA 1BU4A 1I3IA 2KF6A 2F4YA 3AGNA 1RN4A 1RNBA 1IYYA 1YNVX 1I3FA 1RDSA 2KAAA 1GMQA 1B2MA 1BVIA 1RGAA 1RCKA 3AGOA 3D5IA 1BSDA 1UCLA 1GSPA 1GOYA 1JBSA 1DE3A 9RNTA 1BRHA 1RSNA 4HOHA 1BNGA 1FUTA 1RGLA 3WHOA 1BNSA 1ZGXA 1YVSA 2KF3A 1X1UA 4HAAA 1FZUA 1B2XA 7GSPA 2HOHA 1HYFA 1Q9EA 5BIRA 1HZ1A 1CH0A 1UCJA 1RGHA 6GSPA 1B21A 1BSCA 4GSPA 6RNTA 1A2PA 1LOWA 1BRKA 1B2UA 1AQZA 1BRNL 1RN1A 1T2HA 1GMRA 1TTOA 1BSBA 1JBTA 3D4AA 3URPA 1BOXA 1I2FA 1LNIA 2BIRA 1I0VA 1BNRA 1LOYA 1GMPA 1T2IA 2GSPA 4RNTA 2AAEA 1BNEA 1FYSA 1MGWA 1BNFA 4J5GA 1BIRA 1AY7A 5BU4A 2AADA 1FW7A 4J5KA 3BIRA 1PY3A 1BRGA 1B27A 1RHLA 2ZA4A 1DETA 1RTUA 1BRIA 1LRAA 1FUSA 2KF5A 3DGYA 3HOHA 5HOHA 1BNJA 3A5EA 2KF4A 3AHWA 1PYLA 2F56A 1I0XA 3D5GA 4BU4A 1BRJA 1SARA
chains in the Genus database with same CATH superfamily
5IG5A 3PZWA 4ZM8A 4EXRA 3WMDA 1UCKA 3FLJA 1JNQA 3EN8A 2WOHA 3PCSA 5ELUA 1NB3I 4OUQA 3GWRA 1SIHA 3CCE3 2XFSA 5KP3A 2QEX3 1X1YA 2WGOA 3FSDA 4FMAA 4HM0B 1YJW3 1NB5I 3GSPA 1MGRA 2IMJA 1B3SA 1OF5A 5AEUB 3EC9A 1LXEA 1N8QA 1RRHA 2OQEC 2OWPA 2J8XB 1X1XA 1RNTA 1BRSA 2CIUA 2XFTA 2E2TA 3X3YA 3KZTA 4LYLB 3CCR3 1O7NB 2WGQA 1M904 5AIHA 3T0UA 1RMSA 1YGWA 3X40A 3SX1A 1S723 2GBWB 1IU7A 2OTJ3 3NV0A 4HZBB 1W01A 2F5WA 5IG3A 2E2VA 2F5MA 2H0IA 1I8VA 3V98A 3H51A 1RLSA 5IG0A 3SVAA 5FW5A 1DYUA 4EBGA 1GD3A 1BUQA 4BIRA 2O3OA 3EN1B 1LNHA 3HIGA 5IEPA 2RBIA 1JJ22 4XBYA 1QJGA 1UUWB 1TRPA 3S27A 1BU4A 1I3IA 1U8CB 2CWVA 2KF6A 2PZVA 2CFWA 3HIIA 3AGNA 1RN4A 3G0KA 4IT7A 3U97A 4EV2A 1Q7Y4 4XDVA 1YIJ3 2OTL3 5LC6A 2KCDA 1I3FA 2YFLB 2CFDA 1B2MA 4CPKA 3KIIA 5BXQA 5EEOA 5CLKA 2CW9A 4FCMA 3CCJ3 1W00A 1UCLA 1GSPA 1OCVA 2BMOB 1EUIC 2ML6A 5TGNA 1BRHA 1BNGA 1Q40B 1ROAA 3MG3A 1FUTA 2XH9A 5IG4A 2XR8B 1JB5A 1ZGXA 2Q07A 1W6YA 4HVNA 1RRLA 3WDGB 1X1UA 1FZUA 7GSPA 2IUKA 2XGNA 3B4OA 3GRDA 3G8ZA 3HX8A 3LYGA 3CPW2 3JUPA 2CX0A 1OF5B 2BHMA 3HZPA 3S29A 3I0YA 1BSCA 4GSPA 6RNTA 3N8BA 1A2PA 1LOWA 2B24B 2HMNB 3KE7A 4K90B 5FGOA 4G1MB 1FGTA 1RN1A 2XGLA 1Q42A 1T5YA 3X41A 1BOXA 1HU9A 2BIRA 1I0VA 4J9AA 4LMIA 4MMYB 5I97A 1BNRA 3K7CA 4RNTA 2AAEA 2W2CA 1BNEA 1FYSA 1ULJB 4FCJA 3LTCA 3NV0B 1GY5A 4RBNA 4WWUC 2BT3A 3RGAA 3BIRA 3DZLA 1PY3A 3NBRA 4HM6B 4LGQA 1V58A 2CFLA 1B27A 3BLZA 3FG1A 2CKFB 5STDA 2W03A 4KVHA 1JZDA 1BRIA 1LRAA 3BNCA 2IYJA 3E99A 6STDA 1TP6A 1W2B2 1O7PB 2KF5A 1K41A 3DGYA 3NBBA 3PXMA 4N6MA 4EC6A 5KP4A 5HOHA 1IQ8A 3DGLA 1QAKA 3A5EA 1Q814 2KF4A 4AKYA 1VQK3 4FR9A 1A2VA 1PYLA 4HJLB 2F56A 4JF8A 2KXGA 3F14A 1RN7A 3F7XA 4EV5A 1O7HB 1BRJA 2P09A 1JRQA 5LC7A 1IQXA 1B2ZA 2GEYA 3NQYA 3MKIA 1TIJA 1EQKA 3WR2A 1WMOA 5AEWB 2D42A 1SQWA 3LTBA 1TRQA 2W0QA 2QGUA 4I4KA 3CCV3 1GOVA 4JRFA 3G4S3 3JUMA 3LT8A 4N6V0 3KN4A 4GHOA 3GZYB 2HMOB 1RKYA 1HKXA 4R1KA 2FGTA 3ECFA 5IEOA 4K1UA 2W56B 1JZOA 3Q3FA 2IUJA 5HGRA 3TDGA 4H61A 1RGGA 3OW22 1BGSA 1VQ93 1A90A 4O02B 1Y4KA 1GOUA 2QIYA 1BSAA 2JDIH 2XSOB 1BANA 3D9RA 3FZWA 3CD63 1JBRA 1BNIA 4DKIA 1U5OA 1IQYA 1I70A 2XEPA 1G02A 5G1LA 2CWTA 1CQSA 2OQEA 2W9PA 1IK3A 5CF1A 1IV7A 1QALA 3VSYA 1C54A 1BAOA 4J8TA 1TJDA 3KCHA 3ER7A 3LTAA 1RGKA 4OK0A 1IVVA 1W02A 1FUWA 1TUHA 3G6E3 3JUNA 3S28A 1IT8A 2Y73A 2Z76A 1C7HA 3PCRA 4MMXB 1G0TA 2KAAA 3NX0A 4BL3A 3DGNA 1WNHA 5D82A 1KSIA 1YI23 3FG3A 3BB9A 1G96A 2R4IA 1NWWA 1N5PA 1TFOA 3AGOA 3D5IA 1BSDA 1CEWI 5CF2A 1J2BA 1AR0A 1STFI 1V57A 3DY5A 1VQM3 1DE3A 1DMQA 2ML5A 1M1XB 5EQLA 3N54B 2F86B 2SBLA 3AMOA 1BNSA 1Z1SA 4NPBA 1JB4A 1YVSA 1IT7A 2KF3A 1B2XA 1UUVB 1Q9EA 4N6UA 4FCZA 3F7SA 4FMDA 1CH0A 1O7GB 6GSPA 8CHOA 1FGRA 3A76A 1B21A 1LQMB 1IVUA 5AYRB 1CYVA 2GBXB 1BRKA 5G1KA 1BRNL 1OPYA 1MWTA 3X42A 1T2HA 1GMRA 1TTOA 3D4AA 2ZDJA 3CNXA 3UL6A 4BTWA 1LOYA 1YJ93 1T2IA 3PS8A 2PNCA 4HM4B 1N5HA 4WHAA 3GZRA 1BNFA 3I553 2WOFA 4GB5A 3WA2X 5BU4A 4BL2A 4J5KA 3NM2A 1ZX2A 1PFPA 3S67A 1IDPA 1RHLA 4H3UA 1E3RA 4L8PA 1N9EA 5IF6A 1OHPA 2GEXA 2B1XB 3CC43 1MNLA 3OWSA 5JPPA 3CPOA 3MG1A 2P0MA 4HZ9B 1W5ZA 4HYZA 2UX0A 3N9HA 7STDA 1UI7A 1O7WB 1UUGB 1I0XA 2I9WA 1KWIA 2C11A 3H3HA 2CG1A 1OH0A 1E3VA 3CME3 5A0OB 4I5QA 4N6NB 2BO9B 2YX9A 3F40A 2BU4A 1DVCA 2XSHB 3F8HA 4N6TA 1BSEA 3K5TA 2FNQA 2LYXA 2RNTA 3AHSA 4ILFA 3STDA 5M18A 3CXC2 3IMAB 1US1A 4BTYA 4HM2B 1VQQA 1K9M4 1VZZA 2P05A 2INXA 3D79A 3ZFZA 3AMOB 1N8R4 2KRTA 3Q2PA 3CNMA 1GS3A 2H0HA 3OX9A 1BUJA 3BU4A 4FMCA 2A15A 8RNTA 1B2SA 1MWSA 1GY6A 4RNZA 5KP1A 3CCQ3 1Q864 7RNTA 1LOVA 4HM1B 1EA2A 5D83A 3T8NA 1RCLA 4CCVA 4HM8B 5IW9A 2UUGC 3FCSB 2MC8A 3SXXA 3GZXB 1X1WA 3GZBA 3Q90A 1L5GB 2V1LA 3CC23 2F98A 3CCL3 3D3LA 4BTXA 3IJEB 2IY2A 3PGBA 1RGFA 1IV9A 2C4BA 4HM3B 4AEQA 4MMZB 1NU3A 4NREA 3WODG 2F4YA 1OACA 3LTDA 5BVBA 4K1VA 3B7CA 4MEIA 1QVG2 1OGZA 2GU1A 1VQ73 4KZ1A 3EBYA 1RDSA 1MOLA 3B8LA 1ZO2A 1WQLB 1GMQA 3JUQA 1IVXA 1RJOA 3EB8A 1BVIA 1A67A 3EQQB 1ISKA 2BNGA 3PYJA 1VQL3 1MWUA 1RCKA 2ZL8A 2RSXA 3KSPA 3NHXA 2LQVA 1UDII 4KFFA 1GOYA 2CFKA 3CU3A 3MYTA 1JBSA 3LH4A 1RSNA 3I563 1MWRA 2OOVC 1RGLA 2W6JH 3KKGA 2CWUA 2WO0A 1SPUA 1OUNA 2FXTA 1WTHA 2H0GA 4WP5A 3WOFB 3CCS3 1VQP3 1VQ83 1ROVA 2P38A 2CHCA 2YFIB 3LXUX 4GL6A 3ZG5A 1HYFA 3VGNA 1AVLA 1D6ZA 2CC3A 2CFGA 4U13A 5BIRA 1N9JA 1RGHA 4LSOA 2D1WA 2YFJB 2STDA 2ZHXB 1GYBA 3X3XA 3F8XA 3LOYA 3FKAA 3EE1A 1B2UA 1IVWA 1LVNA 3MWZA 3NBJA 4RZMA 4WYKA 4XBTA 2RFRA 3OWYA 1FGOA 1JBTA 2K0MA 3FG4A 3JUOA 3UJMA 1I2FA 2XF3A 4MJDA 2GXFA 2UGIA 1STDA 1Q40A 3KFQC 4EW5A 2CG0A 1E97A 3GAXA 4LZIA 3F9SA 3CMA3 3HK4A 1KD14 1W4NA 1SIIA 3NUVA 1S5AA 2XRXB 3DGOA 1BIRA 5CXOA 2AADA 2F99A 3DMCA 1W7CA 3BNBA 1LQGC 1AVKA 2BMRB 5DRVA 4KT3B 1V74A 4AKZA 2Y74A 4L7KA 1QAFA 1NNVA 1NO3A 3HI7A 1RTUA 3M8CA 1M9GA 5D81A 3DUKA 4PEJA 3UNLA 1YIT3 1YJN3 3LT9A 5M1AA 3HOHA 4R4KA 4XBXA 1YGEA 2HMJB 3B4PA 2K3DA 1BNJA 3ALAA 3JVCA 4Q53A 3ROBA 1UGIA 4EYCA 2Z7AA 1OGXA 1CYUA 3D5GA 1W6CA 4BU4A 1SARA 3V99A 4IPBA 3Q1CA 1JB2A 4WFOA 1EG9B 1JKGA 4N6LA 1JN5A 1R4YA 2SARA 2L4VA 3EHCA 3DGMA 2HMMB 3EF8A 3RDEA 2HMLB 3RNTA 3SLUA 1W2ZA 1AV4A 4HM5B 3SOYA 1NJI4 5AYSC 3NM7A 1TFKA 1T3BA 3L0RA 2W04A 3LZAA 3U1WA 5AI1A 5JBSA 1B20A 3EX9A 1QVF2 1SJWA 3SEDA 2CH9A 1UCIA 3K0ZA 1OHSA 1RGCA 3QRDA 3O8YA 3VF1A 1Q7HA 5M19A 5RNTA 1ULIB 2Z6BA 2K54A 1YVBI 3V92A 2W9QA 3G713 4WYKB 3IPTA 1F8NA 5JPUA 5IENA 5ELJA 3KSED 3ZG0A 3DH2A 4XDWA 4R9LA 1WMNA 3FGYA 3UL5A 1DMNA 1I2EA 4ORLA 3LMLA 2E2UA 4HKVB 1PU4A 1QMAA 4IIAA 1DMMA 3SYUA 5GSPA 4NHFA 1K28A 2M7OA 1LOXA 4R80A 3MG2A 4QWTA 1FGQA 4CJNA 1Q824 1K734 4N3VA 1RGEA 4LEHA 2W56A 1WMPA 4HBRA 1I2GA 1EEJA 3BNEA 1JV2B 4HM7B 1RNBA 1IYYA 1YNVX 5AIGA 1M1K4 3MHEA 4KFEA 4L8OA 3NQZA 2BMQB 2RGQA 3FF2A 5AIFA 1EKMA 1RGAA 4OVMA 4CDLA 3T8UA 1O7MB 1ASKA 1UGHI 3FH1A 1FA3A 9RNTA 3MSOA 4HOHA 5AIIA 1D6UA 3WHOA 2C10A 1UW1A 3SOAA 1JKGB 1JN5B 4HAAA 3J7Yd 1ZS7A 3OV4A 1VQ43 2HOHA 3WA3A 2IA7A 3MPHA 1HZ1A 4K61A 1UCJA 4O3VA 1VQ53 1GY7A 1K8A4 4X2HA 3OXAA 4TX4A 1VQ63 4O8SA 3EJVA 3WOEB 4KFDA 3S5CA 5IERA 2P0XA 2L1SA 1AQZA 1OHOA 2HMKB 2O9UX 3BNDA 4N6OB 1DVDA 3EBTA 1BSBA 2Z77A 3URPA 5CK6A 2OOVA 1LNIA 1FGMA 3FF0A 1GMPA 5EVHA 2GSPA 5DREA 2MF7A 1MGWA 5G2GA 4STDA 4J5GA 1TU5A 1KQS2 3QK9A 2GU3A 1AY7A 2CX1A 3DM8A 4XB5A 3RGRA 2R41A 1FW7A 3OWUA 1BRGA 2OCTA 2RCDA 1YHQ3 3CCU3 2ZA4A 2CK3H 1DETA 1D6YA 4RNYA 1R4CA 1FUSA 4R9KA 1KC84 3CCM3 3DXOA 2QA43 1NDOB 4X2OA 1VQO3 3CC73 1GD4A 4FMBA 1W6GA 1VQN3 3UB1A 3X3ZA 4O2HA 3NXJA 3G16A 3AHWA 1A2KA 3K9MC 2JQ5A 4XM4A 3K63A 1UI8A
chains in the Genus database with same CATH topology
1UCKA 1B2ZA 2BU4A 3WR2A 1BSEA 2RNTA 3AHSA 1R4YA 1X1YA 2SARA 1TRQA 3GSPA 1MGRA 1B3SA 3RNTA 1GOVA 1X1XA 1RNTA 1BRSA 4GHOA 1B20A 1BUJA 3BU4A 1UCIA 3Q3FA 1RGCA 8RNTA 1B2SA 1RGGA 1RMSA 1BGSA 1YGWA 5RNTA 1GOUA 1BSAA 1BANA 1JBRA 1BNIA 7RNTA 2F5WA 2F5MA 1I70A 1I8VA 1LOVA 1RLSA 1G02A 1RCLA 3DH2A 1I2EA 1C54A 1BAOA 4BIRA 1X1WA 3SYUA 5GSPA 2RBIA 3KCHA 1RGEA 1RGFA 2C4BA 1RGKA 1I2GA 1TRPA 1BU4A 1I3IA 2KF6A 2F4YA 3AGNA 1RN4A 1RNBA 1IYYA 1YNVX 1I3FA 1RDSA 2KAAA 1GMQA 1B2MA 1BVIA 1RGAA 1RCKA 3AGOA 3D5IA 1BSDA 1UCLA 1GSPA 1GOYA 1JBSA 1DE3A 9RNTA 1BRHA 1RSNA 4HOHA 1BNGA 1FUTA 1RGLA 3WHOA 1BNSA 1ZGXA 1YVSA 2KF3A 1X1UA 4HAAA 1FZUA 1B2XA 7GSPA 2HOHA 1HYFA 1Q9EA 5BIRA 1HZ1A 1CH0A 1UCJA 1RGHA 6GSPA 1B21A 1BSCA 4GSPA 6RNTA 1A2PA 1LOWA 1BRKA 1B2UA 1AQZA 1BRNL 1RN1A 1T2HA 1GMRA 1TTOA 1BSBA 1JBTA 3D4AA 3URPA 1BOXA 1I2FA 1LNIA 2BIRA 1I0VA 1BNRA 1LOYA 1GMPA 1T2IA 2GSPA 4RNTA 2AAEA 1BNEA 1FYSA 1MGWA 1BNFA 4J5GA 1BIRA 1AY7A 5BU4A 2AADA 1FW7A 4J5KA 3BIRA 1PY3A 1BRGA 1B27A 1RHLA 2ZA4A 1DETA 1RTUA 1BRIA 1LRAA 1FUSA 2KF5A 3DGYA 3HOHA 5HOHA 1BNJA 3A5EA 2KF4A 3AHWA 1PYLA 2F56A 1I0XA 3D5GA 4BU4A 1BRJA 1SARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCK A;  1B2Z A;  2BU4 A;  3WR2 A;  1BSE A;  2RNT A;  3AHS A;  1R4Y A;  1X1Y A;  2SAR A;  1TRQ A;  3GSP A;  1MGR A;  1B3S A;  3RNT A;  1GOV A;  1X1X A;  1RNT A;  1BRS A;  4GHO A;  1B20 A;  1BUJ A;  3BU4 A;  1UCI A;  3Q3F A;  1RGC A;  8RNT A;  1B2S A;  1RGG A;  1RMS A;  1BGS A;  1YGW A;  5RNT A;  1GOU A;  1BSA A;  1BAN A;  1JBR A;  1BNI A;  7RNT A;  2F5W A;  2F5M A;  1I70 A;  1I8V A;  1LOV A;  1RLS A;  1G02 A;  1RCL A;  3DH2 A;  1I2E A;  1C54 A;  1BAO A;  4BIR A;  1X1W A;  3SYU A;  5GSP A;  2RBI A;  3KCH A;  1RGE A;  1RGF A;  2C4B A;  1RGK A;  1I2G A;  1TRP A;  1BU4 A;  1I3I A;  2KF6 A;  2F4Y A;  3AGN A;  1RN4 A;  1RNB A;  1IYY A;  1YNV X;  1I3F A;  1RDS A;  2KAA A;  1GMQ A;  1B2M A;  1BVI A;  1RGA A;  1RCK A;  3AGO A;  3D5I A;  1BSD A;  1UCL A;  1GSP A;  1GOY A;  1JBS A;  1DE3 A;  9RNT A;  1BRH A;  1RSN A;  4HOH A;  1BNG A;  1FUT A;  1RGL A;  3WHO A;  1BNS A;  1ZGX A;  1YVS A;  2KF3 A;  1X1U A;  4HAA A;  1FZU A;  1B2X A;  7GSP A;  2HOH A;  1HYF A;  1Q9E A;  5BIR A;  1HZ1 A;  1CH0 A;  1UCJ A;  1RGH A;  6GSP A;  1B21 A;  1BSC A;  4GSP A;  6RNT A;  1A2P A;  1LOW A;  1BRK A;  1B2U A;  1AQZ A;  1BRN L;  1RN1 A;  1T2H A;  1GMR A;  1TTO A;  1BSB A;  1JBT A;  3D4A A;  3URP A;  1BOX A;  1I2F A;  1LNI A;  2BIR A;  1I0V A;  1BNR A;  1LOY A;  1GMP A;  1T2I A;  2GSP A;  4RNT A;  2AAE A;  1BNE A;  1FYS A;  1MGW A;  1BNF A;  4J5G A;  1BIR A;  1AY7 A;  5BU4 A;  2AAD A;  1FW7 A;  4J5K A;  3BIR A;  1PY3 A;  1BRG A;  1B27 A;  1RHL A;  2ZA4 A;  1DET A;  1RTU A;  1BRI A;  1LRA A;  1FUS A;  2KF5 A;  3DGY A;  3HOH A;  5HOH A;  1BNJ A;  3A5E A;  2KF4 A;  3AHW A;  1PYL A;  2F56 A;  1I0X A;  3D5G A;  4BU4 A;  1BRJ A;  1SAR A; 
#chains in the Genus database with same CATH topology
 5IG5 A;  3PZW A;  4ZM8 A;  4EXR A;  3WMD A;  1UCK A;  3FLJ A;  1JNQ A;  3EN8 A;  2WOH A;  3PCS A;  5ELU A;  1NB3 I;  4OUQ A;  3GWR A;  1SIH A;  3CCE 3;  2XFS A;  5KP3 A;  2QEX 3;  1X1Y A;  2WGO A;  3FSD A;  4FMA A;  4HM0 B;  1YJW 3;  1NB5 I;  3GSP A;  1MGR A;  2IMJ A;  1B3S A;  1OF5 A;  5AEU B;  3EC9 A;  1LXE A;  1N8Q A;  1RRH A;  2OQE C;  2OWP A;  2J8X B;  1X1X A;  1RNT A;  1BRS A;  2CIU A;  2XFT A;  2E2T A;  3X3Y A;  3KZT A;  4LYL B;  3CCR 3;  1O7N B;  2WGQ A;  1M90 4;  5AIH A;  3T0U A;  1RMS A;  1YGW A;  3X40 A;  3SX1 A;  1S72 3;  2GBW B;  1IU7 A;  2OTJ 3;  3NV0 A;  4HZB B;  1W01 A;  2F5W A;  5IG3 A;  2E2V A;  2F5M A;  2H0I A;  1I8V A;  3V98 A;  3H51 A;  1RLS A;  5IG0 A;  3SVA A;  5FW5 A;  1DYU A;  4EBG A;  1GD3 A;  1BUQ A;  4BIR A;  2O3O A;  3EN1 B;  1LNH A;  3HIG A;  5IEP A;  2RBI A;  1JJ2 2;  4XBY A;  1QJG A;  1UUW B;  1TRP A;  3S27 A;  1BU4 A;  1I3I A;  1U8C B;  2CWV A;  2KF6 A;  2PZV A;  2CFW A;  3HII A;  3AGN A;  1RN4 A;  3G0K A;  4IT7 A;  3U97 A;  4EV2 A;  1Q7Y 4;  4XDV A;  1YIJ 3;  2OTL 3;  5LC6 A;  2KCD A;  1I3F A;  2YFL B;  2CFD A;  1B2M A;  4CPK A;  3KII A;  5BXQ A;  5EEO A;  5CLK A;  2CW9 A;  4FCM A;  3CCJ 3;  1W00 A;  1UCL A;  1GSP A;  1OCV A;  2BMO B;  1EUI C;  2ML6 A;  5TGN A;  1BRH A;  1BNG A;  1Q40 B;  1ROA A;  3MG3 A;  1FUT A;  2XH9 A;  5IG4 A;  2XR8 B;  1JB5 A;  1ZGX A;  2Q07 A;  1W6Y A;  4HVN A;  1RRL A;  3WDG B;  1X1U A;  1FZU A;  7GSP A;  2IUK A;  2XGN A;  3B4O A;  3GRD A;  3G8Z A;  3HX8 A;  3LYG A;  3CPW 2;  3JUP A;  2CX0 A;  1OF5 B;  2BHM A;  3HZP A;  3S29 A;  3I0Y A;  1BSC A;  4GSP A;  6RNT A;  3N8B A;  1A2P A;  1LOW A;  2B24 B;  2HMN B;  3KE7 A;  4K90 B;  5FGO A;  4G1M B;  1FGT A;  1RN1 A;  2XGL A;  1Q42 A;  1T5Y A;  3X41 A;  1BOX A;  1HU9 A;  2BIR A;  1I0V A;  4J9A A;  4LMI A;  4MMY B;  5I97 A;  1BNR A;  3K7C A;  4RNT A;  2AAE A;  2W2C A;  1BNE A;  1FYS A;  1ULJ B;  4FCJ A;  3LTC A;  3NV0 B;  1GY5 A;  4RBN A;  4WWU C;  2BT3 A;  3RGA A;  3BIR A;  3DZL A;  1PY3 A;  3NBR A;  4HM6 B;  4LGQ A;  1V58 A;  2CFL A;  1B27 A;  3BLZ A;  3FG1 A;  2CKF B;  5STD A;  2W03 A;  4KVH A;  1JZD A;  1BRI A;  1LRA A;  3BNC A;  2IYJ A;  3E99 A;  6STD A;  1TP6 A;  1W2B 2;  1O7P B;  2KF5 A;  1K41 A;  3DGY A;  3NBB A;  3PXM A;  4N6M A;  4EC6 A;  5KP4 A;  5HOH A;  1IQ8 A;  3DGL A;  1QAK A;  3A5E A;  1Q81 4;  2KF4 A;  4AKY A;  1VQK 3;  4FR9 A;  1A2V A;  1PYL A;  4HJL B;  2F56 A;  4JF8 A;  2KXG A;  3F14 A;  1RN7 A;  3F7X A;  4EV5 A;  1O7H B;  1BRJ A;  2P09 A;  1JRQ A;  5LC7 A;  1IQX A;  1B2Z A;  2GEY A;  3NQY A;  3MKI A;  1TIJ A;  1EQK A;  3WR2 A;  1WMO A;  5AEW B;  2D42 A;  1SQW A;  3LTB A;  1TRQ A;  2W0Q A;  2QGU A;  4I4K A;  3CCV 3;  1GOV A;  4JRF A;  3G4S 3;  3JUM A;  3LT8 A;  4N6V 0;  3KN4 A;  4GHO A;  3GZY B;  2HMO B;  1RKY A;  1HKX A;  4R1K A;  2FGT A;  3ECF A;  5IEO A;  4K1U A;  2W56 B;  1JZO A;  3Q3F A;  2IUJ A;  5HGR A;  3TDG A;  4H61 A;  1RGG A;  3OW2 2;  1BGS A;  1VQ9 3;  1A90 A;  4O02 B;  1Y4K A;  1GOU A;  2QIY A;  1BSA A;  2JDI H;  2XSO B;  1BAN A;  3D9R A;  3FZW A;  3CD6 3;  1JBR A;  1BNI A;  4DKI A;  1U5O A;  1IQY A;  1I70 A;  2XEP A;  1G02 A;  5G1L A;  2CWT A;  1CQS A;  2OQE A;  2W9P A;  1IK3 A;  5CF1 A;  1IV7 A;  1QAL A;  3VSY A;  1C54 A;  1BAO A;  4J8T A;  1TJD A;  3KCH A;  3ER7 A;  3LTA A;  1RGK A;  4OK0 A;  1IVV A;  1W02 A;  1FUW A;  1TUH A;  3G6E 3;  3JUN A;  3S28 A;  1IT8 A;  2Y73 A;  2Z76 A;  1C7H A;  3PCR A;  4MMX B;  1G0T A;  2KAA A;  3NX0 A;  4BL3 A;  3DGN A;  1WNH A;  5D82 A;  1KSI A;  1YI2 3;  3FG3 A;  3BB9 A;  1G96 A;  2R4I A;  1NWW A;  1N5P A;  1TFO A;  3AGO A;  3D5I A;  1BSD A;  1CEW I;  5CF2 A;  1J2B A;  1AR0 A;  1STF I;  1V57 A;  3DY5 A;  1VQM 3;  1DE3 A;  1DMQ A;  2ML5 A;  1M1X B;  5EQL A;  3N54 B;  2F86 B;  2SBL A;  3AMO A;  1BNS A;  1Z1S A;  4NPB A;  1JB4 A;  1YVS A;  1IT7 A;  2KF3 A;  1B2X A;  1UUV B;  1Q9E A;  4N6U A;  4FCZ A;  3F7S A;  4FMD A;  1CH0 A;  1O7G B;  6GSP A;  8CHO A;  1FGR A;  3A76 A;  1B21 A;  1LQM B;  1IVU A;  5AYR B;  1CYV A;  2GBX B;  1BRK A;  5G1K A;  1BRN L;  1OPY A;  1MWT A;  3X42 A;  1T2H A;  1GMR A;  1TTO A;  3D4A A;  2ZDJ A;  3CNX A;  3UL6 A;  4BTW A;  1LOY A;  1YJ9 3;  1T2I A;  3PS8 A;  2PNC A;  4HM4 B;  1N5H A;  4WHA A;  3GZR A;  1BNF A;  3I55 3;  2WOF A;  4GB5 A;  3WA2 X;  5BU4 A;  4BL2 A;  4J5K A;  3NM2 A;  1ZX2 A;  1PFP A;  3S67 A;  1IDP A;  1RHL A;  4H3U A;  1E3R A;  4L8P A;  1N9E A;  5IF6 A;  1OHP A;  2GEX A;  2B1X B;  3CC4 3;  1MNL A;  3OWS A;  5JPP A;  3CPO A;  3MG1 A;  2P0M A;  4HZ9 B;  1W5Z A;  4HYZ A;  2UX0 A;  3N9H A;  7STD A;  1UI7 A;  1O7W B;  1UUG B;  1I0X A;  2I9W A;  1KWI A;  2C11 A;  3H3H A;  2CG1 A;  1OH0 A;  1E3V A;  3CME 3;  5A0O B;  4I5Q A;  4N6N B;  2BO9 B;  2YX9 A;  3F40 A;  2BU4 A;  1DVC A;  2XSH B;  3F8H A;  4N6T A;  1BSE A;  3K5T A;  2FNQ A;  2LYX A;  2RNT A;  3AHS A;  4ILF A;  3STD A;  5M18 A;  3CXC 2;  3IMA B;  1US1 A;  4BTY A;  4HM2 B;  1VQQ A;  1K9M 4;  1VZZ A;  2P05 A;  2INX A;  3D79 A;  3ZFZ A;  3AMO B;  1N8R 4;  2KRT A;  3Q2P A;  3CNM A;  1GS3 A;  2H0H A;  3OX9 A;  1BUJ A;  3BU4 A;  4FMC A;  2A15 A;  8RNT A;  1B2S A;  1MWS A;  1GY6 A;  4RNZ A;  5KP1 A;  3CCQ 3;  1Q86 4;  7RNT A;  1LOV A;  4HM1 B;  1EA2 A;  5D83 A;  3T8N A;  1RCL A;  4CCV A;  4HM8 B;  5IW9 A;  2UUG C;  3FCS B;  2MC8 A;  3SXX A;  3GZX B;  1X1W A;  3GZB A;  3Q90 A;  1L5G B;  2V1L A;  3CC2 3;  2F98 A;  3CCL 3;  3D3L A;  4BTX A;  3IJE B;  2IY2 A;  3PGB A;  1RGF A;  1IV9 A;  2C4B A;  4HM3 B;  4AEQ A;  4MMZ B;  1NU3 A;  4NRE A;  3WOD G;  2F4Y A;  1OAC A;  3LTD A;  5BVB A;  4K1V A;  3B7C A;  4MEI A;  1QVG 2;  1OGZ A;  2GU1 A;  1VQ7 3;  4KZ1 A;  3EBY A;  1RDS A;  1MOL A;  3B8L A;  1ZO2 A;  1WQL B;  1GMQ A;  3JUQ A;  1IVX A;  1RJO A;  3EB8 A;  1BVI A;  1A67 A;  3EQQ B;  1ISK A;  2BNG A;  3PYJ A;  1VQL 3;  1MWU A;  1RCK A;  2ZL8 A;  2RSX A;  3KSP A;  3NHX A;  2LQV A;  1UDI I;  4KFF A;  1GOY A;  2CFK A;  3CU3 A;  3MYT A;  1JBS A;  3LH4 A;  1RSN A;  3I56 3;  1MWR A;  2OOV C;  1RGL A;  2W6J H;  3KKG A;  2CWU A;  2WO0 A;  1SPU A;  1OUN A;  2FXT A;  1WTH A;  2H0G A;  4WP5 A;  3WOF B;  3CCS 3;  1VQP 3;  1VQ8 3;  1ROV A;  2P38 A;  2CHC A;  2YFI B;  3LXU X;  4GL6 A;  3ZG5 A;  1HYF A;  3VGN A;  1AVL A;  1D6Z A;  2CC3 A;  2CFG A;  4U13 A;  5BIR A;  1N9J A;  1RGH A;  4LSO A;  2D1W A;  2YFJ B;  2STD A;  2ZHX B;  1GYB A;  3X3X A;  3F8X A;  3LOY A;  3FKA A;  3EE1 A;  1B2U A;  1IVW A;  1LVN A;  3MWZ A;  3NBJ A;  4RZM A;  4WYK A;  4XBT A;  2RFR A;  3OWY A;  1FGO A;  1JBT A;  2K0M A;  3FG4 A;  3JUO A;  3UJM A;  1I2F A;  2XF3 A;  4MJD A;  2GXF A;  2UGI A;  1STD A;  1Q40 A;  3KFQ C;  4EW5 A;  2CG0 A;  1E97 A;  3GAX A;  4LZI A;  3F9S A;  3CMA 3;  3HK4 A;  1KD1 4;  1W4N A;  1SII A;  3NUV A;  1S5A A;  2XRX B;  3DGO A;  1BIR A;  5CXO A;  2AAD A;  2F99 A;  3DMC A;  1W7C A;  3BNB A;  1LQG C;  1AVK A;  2BMR B;  5DRV A;  4KT3 B;  1V74 A;  4AKZ A;  2Y74 A;  4L7K A;  1QAF A;  1NNV A;  1NO3 A;  3HI7 A;  1RTU A;  3M8C A;  1M9G A;  5D81 A;  3DUK A;  4PEJ A;  3UNL A;  1YIT 3;  1YJN 3;  3LT9 A;  5M1A A;  3HOH A;  4R4K A;  4XBX A;  1YGE A;  2HMJ B;  3B4P A;  2K3D A;  1BNJ A;  3ALA A;  3JVC A;  4Q53 A;  3ROB A;  1UGI A;  4EYC A;  2Z7A A;  1OGX A;  1CYU A;  3D5G A;  1W6C A;  4BU4 A;  1SAR A;  3V99 A;  4IPB A;  3Q1C A;  1JB2 A;  4WFO A;  1EG9 B;  1JKG A;  4N6L A;  1JN5 A;  1R4Y A;  2SAR A;  2L4V A;  3EHC A;  3DGM A;  2HMM B;  3EF8 A;  3RDE A;  2HML B;  3RNT A;  3SLU A;  1W2Z A;  1AV4 A;  4HM5 B;  3SOY A;  1NJI 4;  5AYS C;  3NM7 A;  1TFK A;  1T3B A;  3L0R A;  2W04 A;  3LZA A;  3U1W A;  5AI1 A;  5JBS A;  1B20 A;  3EX9 A;  1QVF 2;  1SJW A;  3SED A;  2CH9 A;  1UCI A;  3K0Z A;  1OHS A;  1RGC A;  3QRD A;  3O8Y A;  3VF1 A;  1Q7H A;  5M19 A;  5RNT A;  1ULI B;  2Z6B A;  2K54 A;  1YVB I;  3V92 A;  2W9Q A;  3G71 3;  4WYK B;  3IPT A;  1F8N A;  5JPU A;  5IEN A;  5ELJ A;  3KSE D;  3ZG0 A;  3DH2 A;  4XDW A;  4R9L A;  1WMN A;  3FGY A;  3UL5 A;  1DMN A;  1I2E A;  4ORL A;  3LML A;  2E2U A;  4HKV B;  1PU4 A;  1QMA A;  4IIA A;  1DMM A;  3SYU A;  5GSP A;  4NHF A;  1K28 A;  2M7O A;  1LOX A;  4R80 A;  3MG2 A;  4QWT A;  1FGQ A;  4CJN A;  1Q82 4;  1K73 4;  4N3V A;  1RGE A;  4LEH A;  2W56 A;  1WMP A;  4HBR A;  1I2G A;  1EEJ A;  3BNE A;  1JV2 B;  4HM7 B;  1RNB A;  1IYY A;  1YNV X;  5AIG A;  1M1K 4;  3MHE A;  4KFE A;  4L8O A;  3NQZ A;  2BMQ B;  2RGQ A;  3FF2 A;  5AIF A;  1EKM A;  1RGA A;  4OVM A;  4CDL A;  3T8U A;  1O7M B;  1ASK A;  1UGH I;  3FH1 A;  1FA3 A;  9RNT A;  3MSO A;  4HOH A;  5AII A;  1D6U A;  3WHO A;  2C10 A;  1UW1 A;  3SOA A;  1JKG B;  1JN5 B;  4HAA A;  3J7Y d;  1ZS7 A;  3OV4 A;  1VQ4 3;  2HOH A;  3WA3 A;  2IA7 A;  3MPH A;  1HZ1 A;  4K61 A;  1UCJ A;  4O3V A;  1VQ5 3;  1GY7 A;  1K8A 4;  4X2H A;  3OXA A;  4TX4 A;  1VQ6 3;  4O8S A;  3EJV A;  3WOE B;  4KFD A;  3S5C A;  5IER A;  2P0X A;  2L1S A;  1AQZ A;  1OHO A;  2HMK B;  2O9U X;  3BND A;  4N6O B;  1DVD A;  3EBT A;  1BSB A;  2Z77 A;  3URP A;  5CK6 A;  2OOV A;  1LNI A;  1FGM A;  3FF0 A;  1GMP A;  5EVH A;  2GSP A;  5DRE A;  2MF7 A;  1MGW A;  5G2G A;  4STD A;  4J5G A;  1TU5 A;  1KQS 2;  3QK9 A;  2GU3 A;  1AY7 A;  2CX1 A;  3DM8 A;  4XB5 A;  3RGR A;  2R41 A;  1FW7 A;  3OWU A;  1BRG A;  2OCT A;  2RCD A;  1YHQ 3;  3CCU 3;  2ZA4 A;  2CK3 H;  1DET A;  1D6Y A;  4RNY A;  1R4C A;  1FUS A;  4R9K A;  1KC8 4;  3CCM 3;  3DXO A;  2QA4 3;  1NDO B;  4X2O A;  1VQO 3;  3CC7 3;  1GD4 A;  4FMB A;  1W6G A;  1VQN 3;  3UB1 A;  3X3Z A;  4O2H A;  3NXJ A;  3G16 A;  3AHW A;  1A2K A;  3K9M C;  2JQ5 A;  4XM4 A;  3K63 A;  1UI8 A; 
#chains in the Genus database with same CATH homology
 1UCK A;  1B2Z A;  2BU4 A;  3WR2 A;  1BSE A;  2RNT A;  3AHS A;  1R4Y A;  1X1Y A;  2SAR A;  1TRQ A;  3GSP A;  1MGR A;  1B3S A;  3RNT A;  1GOV A;  1X1X A;  1RNT A;  1BRS A;  4GHO A;  1B20 A;  1BUJ A;  3BU4 A;  1UCI A;  3Q3F A;  1RGC A;  8RNT A;  1B2S A;  1RGG A;  1RMS A;  1BGS A;  1YGW A;  5RNT A;  1GOU A;  1BSA A;  1BAN A;  1JBR A;  1BNI A;  7RNT A;  2F5W A;  2F5M A;  1I70 A;  1I8V A;  1LOV A;  1RLS A;  1G02 A;  1RCL A;  3DH2 A;  1I2E A;  1C54 A;  1BAO A;  4BIR A;  1X1W A;  3SYU A;  5GSP A;  2RBI A;  3KCH A;  1RGE A;  1RGF A;  2C4B A;  1RGK A;  1I2G A;  1TRP A;  1BU4 A;  1I3I A;  2KF6 A;  2F4Y A;  3AGN A;  1RN4 A;  1RNB A;  1IYY A;  1YNV X;  1I3F A;  1RDS A;  2KAA A;  1GMQ A;  1B2M A;  1BVI A;  1RGA A;  1RCK A;  3AGO A;  3D5I A;  1BSD A;  1UCL A;  1GSP A;  1GOY A;  1JBS A;  1DE3 A;  9RNT A;  1BRH A;  1RSN A;  4HOH A;  1BNG A;  1FUT A;  1RGL A;  3WHO A;  1BNS A;  1ZGX A;  1YVS A;  2KF3 A;  1X1U A;  4HAA A;  1FZU A;  1B2X A;  7GSP A;  2HOH A;  1HYF A;  1Q9E A;  5BIR A;  1HZ1 A;  1CH0 A;  1UCJ A;  1RGH A;  6GSP A;  1B21 A;  1BSC A;  4GSP A;  6RNT A;  1A2P A;  1LOW A;  1BRK A;  1B2U A;  1AQZ A;  1BRN L;  1RN1 A;  1T2H A;  1GMR A;  1TTO A;  1BSB A;  1JBT A;  3D4A A;  3URP A;  1BOX A;  1I2F A;  1LNI A;  2BIR A;  1I0V A;  1BNR A;  1LOY A;  1GMP A;  1T2I A;  2GSP A;  4RNT A;  2AAE A;  1BNE A;  1FYS A;  1MGW A;  1BNF A;  4J5G A;  1BIR A;  1AY7 A;  5BU4 A;  2AAD A;  1FW7 A;  4J5K A;  3BIR A;  1PY3 A;  1BRG A;  1B27 A;  1RHL A;  2ZA4 A;  1DET A;  1RTU A;  1BRI A;  1LRA A;  1FUS A;  2KF5 A;  3DGY A;  3HOH A;  5HOH A;  1BNJ A;  3A5E A;  2KF4 A;  3AHW A;  1PYL A;  2F56 A;  1I0X A;  3D5G A;  4BU4 A;  1BRJ A;  1SAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...