4R9KA

Structure of thermostable eightfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
144
structure length
144
Chain Sequence
IEQPRWASKDPAAGKASTPDEKIVLEFMDALTSNDAAKLIKYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFKVMSIDAVEVFHIGSSKGLVFTERVDVLRALPTGKSYNLSILGVFQLTDGKITGWRDYFDLREFEEAVDLPLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic validation of structure predictions used in computational design for protein stabilization.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
total genus 42
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r9kA00
2HMJB 3MSOA 3T8NA 3RGRA 2HMNB 1UUWB 3OWUA 1JB4A 3DM8A 2B1XB 4FCMA 3STDA 3F40A 2Z76A 4LGQA 1EA2A 1U5OA 3NUVA 3FF2A 1Z1SA 3B8LA 4XM4A 5CXOA 4KVHA 5D81A 3KKGA 2F86B 2JQ5A 1OCVA 3UNLA 1JN5B 3GZBA 3HX8A 4HM6B 5IF6A 3FH1A 5BXQA 1WQLB 3F7SA 3KZTA 2PZVA 1OF5A 4XBXA 4HKVB 4J8TA 1W00A 3CNXA 4XDVA 3EX9A 3NV0B 5AIGA 3G8ZA 1ULJB 3MG2A 1QMAA 1S5AA 1QJGA 3ER7A 1DMMA 1SJWA 1ULIB 3OWYA 1O7PB 4HM3B 4HZ9B 3DMCA 3EBYA 3DXOA 3FGYA 2BMQB 3JUMA 3EN1B 2YFJB 4XBTA 3EHCA 2GBXB 3BLZA 5CK6A 1BUQA 4WP5A 3T8UA 3HK4A 2GEYA 1GY7A 5IG3A 5IEPA 3CU3A 2RGQA 4HVNA 1TP6A 2BMRB 4XDWA 3SEDA 1JB2A 1ASKA 2INXA 3JUOA 3KE7A 2K54A 1E3VA 4LEHA 1OHSA 3JUNA 5AI1A 3B7CA 3H3HA 2Z77A 4Q53A 3MKIA 4R9LA 1W02A 4K1VA 1E97A 2CHCA 3GRDA 8CHOA 3VGNA 1AR0A 3M8CA 5FW5A 4FCJA 4U13A 3A76A 4HM0B 1O7HB 2R4IA 1ZX2A 5TGNA 3F14A 1C7HA 4LMIA 1W01A 1E3RA 2BMOB 3IPTA 4STDA 6STDA 5KP1A 1NDOB 5KP4A 2HMKB 3D9RA 3GZRA 5DREA 3NBRA 5HGRA 3WMDA 1TUHA 3MYTA 3NXJA 2YFLB 4HM2B 1GY6A 4L8PA 4HJLB 4OVMA 1K41A 1O7GB 3SOYA 2GEXA 3F8HA 1OUNA 3CNMA 3EBTA 4RZMA 2I9WA 2RCDA 3GWRA 5STDA 2OWPA 1DMQA 1JKGA 1UUVB 1NWWA 4WYKB 1OGZA 1STDA 1W6YA 2UX0A 1O7WB 3F8XA 5IEOA 3OWSA 3ECFA 3EN8A 1A2KA 4IIAA 4H3UA 4HM5B 3EF8A 1DMNA 3GZYB 3FZWA 4X2HA 1JN5A 5CLKA 5AIHA 2HMMB 3E99A 3FLJA 4HM4B 2HMOB 3EC9A 4J9AA 1JKGB 5IERA 4K1UA 4X2OA 3MG3A 4HM8B 3JUQA 3OV4A 1OF5B 2GBWB 2XRXB 4GB5A 4CDLA 4MJDA 4XB5A 5AIIA 5IG0A 1NU3A 1OHPA 5CF2A 4XBYA 3B4OA 5IENA 3OXAA 5D82A 3S5CA 4WYKA 3HZPA 2GXFA 3Q90A 5KP3A 3CPOA 5AIFA 4OUQA 1OGXA 4R9KA 3RGAA 1CQSA 1Q40A 2A15A 1GY5A 3EQQB 3F9SA 3LYGA 3NV0A 4ORLA 5EVHA 3ROBA 5G2GA 1OPYA 3F7XA 5D83A 3SOAA 4PEJA 1O7MB 2STDA 3FKAA 3FF0A 2QIYA 3MG1A 5CF1A 2XR8B 4I4KA 1GS3A 1OHOA 4R1KA 4HZBB 1Q42A 2QGUA 4L7KA 1IDPA 1VZZA 3G0KA 5BVBA 1OH0A 3GZXB 4HM7B 4WWUC 5JPPA 3KSPA 2XSOB 3BB9A 3NM2A 1GYBA 2F98A 3EJVA 1Q40B 3OX9A 4N3VA 5IG4A 5IG5A 2XSHB 2Z7AA 7STDA 3JUPA 1O7NB 1EG9B 3G16A 1ZO2A 2YFIB 3H51A 2RFRA 3I0YA 3K0ZA 1HKXA 2W2CA 3K7CA 2CKFB 2IMJA 4L8OA 2HMLB 3NHXA 3DUKA 3B4PA 4HM1B 3UJMA 3DZLA 2F99A 2BNGA 3MHEA 5AEUB 1JB5A 3LZAA 3VSYA 3FSDA 5AEWB 1ISKA 2B24B 5DRVA 5JPUA
chains in the Genus database with same CATH superfamily
4EC6A 2FXTA 3T8NA 2HMNB 1UUWB 1JB4A 3HIGA 1WNHA 1B21A 2Z76A 4LGQA 1EA2A 2IYJA 1LNIA 2J8XB 2O9UX 3FF2A 4XM4A 2F5MA 5CXOA 3CXC2 2ZDJA 1A90A 1BRKA 7RNTA 4KZ1A 5IF6A 3FH1A 3NX0A 2BIRA 4FMBA 3IMAB 4RNZA 5BXQA 1GOUA 1DVDA 1N9EA 1PU4A 1RLSA 3CNXA 3CMA3 2Y73A 4ILFA 4XDVA 5AIGA 3G8ZA 1CYVA 1FGOA 1QMAA 2W0QA 3BIRA 4OK0A 1M904 1UCKA 1B2ZA 4NREA 2YFJB 3EHCA 2OCTA 4WP5A 2GEYA 1GY7A 4BTXA 2ZL8A 3LT9A 2RGQA 1UI7A 5JPPA 1ASKA 3ALAA 1UGIA 3PCRA 3B7CA 3X3YA 1Q824 1SQWA 4KFDA 4KFFA 3HOHA 4N6LA 3SX1A 2R4IA 3CCM3 1C7HA 1I0XA 1E3RA 3DGYA 3IPTA 1BAOA 4R80A 4HYZA 1FA3A 1ROVA 2JDIH 3NBRA 1TUHA 4HM2B 1GY6A 2OQEC 3FG1A 1YVSA 1K41A 1V57A 2KXGA 5AYSC 3SOYA 1KD14 1EUIC 4RZMA 2RCDA 1W2ZA 3BNCA 4WHAA 1RDSA 3CC43 1A67A 1OGZA 2CWUA 1STDA 1W6YA 3FCSB 2H0HA 1D6YA 5IEOA 1A2KA 1T2IA 3EF8A 1NNVA 3FZWA 1JN5A 1WMOA 5AIHA 1RNTA 4HM4B 5IERA 1TFOA 4K1UA 2FNQA 1KWIA 4MJDA 2AAEA 4XB5A 5AIIA 1NU3A 1OHPA 5IG0A 5CF2A 2CFLA 1A2VA 4MMYB 3HI7A 3OXAA 3S5CA 4WYKA 3U1WA 2GXFA 3KSED 3WOFB 5G1KA 1BSDA 1Q864 1RGAA 2F5WA 3EQQB 3LTDA 3AGOA 1K9M4 5G2GA 1G96A 3F7XA 5M18A 2XH9A 1O7MB 1W7CA 2STDA 4MEIA 1M1K4 2QIYA 3MG1A 3T0UA 5BU4A 1C54A 1I2FA 4I4KA 1GS3A 4HZBB 1Q42A 1QAKA 2KRTA 2QGUA 1KQS2 1FYSA 1IK3A 4HM7B 4WWUC 4EXRA 2V1LA 3KSPA 1BRSA 1GMRA 1JV2B 1WMNA 1YNVX 3EJVA 3D5IA 4EV5A 2Z7AA 5IG5A 1IV9A 1BSEA 1UCJA 3JUPA 1MWRA 1ZO2A 3I0YA 3UL5A 1ROAA 1YJN3 3CC73 2OOVA 2BO9B 1N5PA 1B2SA 1PYLA 4AEQA 3DZLA 1I3FA 4J5KA 1JB5A 1LQGC 2F56A 2P05A 5AEWB 2B24B 1U8CB 5JPUA 3D5GA 3AMOA 1RCKA 2P0XA 1VQ53 2CK3H 2CH9A 3DM8A 2B1XB 1PY3A 1RKYA 3OW22 1RGLA 3F40A 4R4KA 1I3IA 2WGQA 1T2HA 3NBBA 3TDGA 9RNTA 5LC6A 3PS8A 2F86B 2JQ5A 1IYYA 1DYUA 1IVVA 2OQEA 1JN5B 4RNYA 1RRLA 1JBRA 2F4YA 4FMAA 4LZIA 1STFI 1WQLB 3F7SA 4EYCA 1R4CA 1HZ1A 4J8TA 1TTOA 1W00A 4N6V0 1KC84 1ULJB 3V98A 2CFKA 1QJGA 3CCV3 1SJWA 2OOVC 3Q1CA 1ULIB 3OWYA 4FCZA 4HZ9B 1BSBA 1NB3I 2M7OA 3AHWA 2XFSA 2KF3A 1FGTA 3EBYA 4XBTA 5CK6A 1RGCA 3BLZA 2KF4A 1L5GB 1BGSA 1FGQA 2QA43 1LOVA 2K0MA 1FUTA 3DGNA 5M1AA 1K28A 2BMRB 3D4AA 1YIT3 2INXA 3I553 3KE7A 2K54A 2PNCA 1X1XA 1OHSA 4IPBA 4Q53A 2Z77A 4K1VA 1BNGA 2CHCA 3GRDA 4N6MA 8CHOA 1AR0A 1RHLA 3M8CA 1BRGA 1YGWA 2SBLA 3LTCA 4HM0B 5TGNA 2QEX3 1W4NA 1YGEA 3BNBA 3F14A 3K5TA 1W01A 4LMIA 3S29A 2OTL3 4K61A 5KP4A 4O2HA 4BIRA 1TFKA 2CFDA 3D9RA 2CFWA 3EB8A 3VF1A 3NXJA 2YFLB 4L8PA 4QWTA 3EE1A 4HJLB 1BSAA 3NQYA 2GEXA 1FUWA 1OUNA 2ZHXB 3WR2A 3LH4A 4BTYA 1RNBA 1JKGA 2YX9A 1QALA 3OWSA 4N6UA 3EN8A 1QAFA 4NPBA 3ZG0A 1DMNA 4AKZA 3LOYA 1YIJ3 2HMMB 3X42A 2HMOB 3A5EA 4J9AA 1B27A 1GSPA 4X2OA 4HM8B 2SARA 1VQ63 1OF5B 2GBWB 2OTJ3 1IVUA 4FMCA 4CDLA 1QVG2 1UUGB 4N6TA 3Q2PA 1RRHA 1I0VA 7GSPA 1RN4A 1TU5A 1UI8A 2XGNA 1TIJA 3V99A 5AIFA 1OGXA 4I5QA 1GD3A 1CQSA 1Q40A 1UGHI 1BNFA 2A15A 3F9SA 4ORLA 2MF7A 3ROBA 2GU1A 3SOAA 5D83A 3SVAA 5A0OB 1D6ZA 1Q814 2XGLA 2XEPA 1JJ22 3DGMA 3NQZA 3FKAA 1RCLA 1R4YA 1IQYA 3KIIA 5RNTA 1FGMA 4L7KA 1YJW3 1HU9A 3CME3 1IDPA 3AHSA 3G0KA 5BVBA 3S67A 1OH0A 1IVWA 1UDII 3GZXB 1G02A 4G1MB 3CCU3 4HBRA 2RNTA 3OX9A 1T5YA 7STDA 5FGOA 3UJMA 3K0ZA 1EQKA 2KF5A 3I563 2IMJA 2HMLB 2O3OA 4HM1B 1AV4A 3N8BA 1AVLA 4RBNA 3LMLA 1BRIA 1SIHA 3D3LA 4WFOA 3VSYA 2BT3A 5DRVA 1Q7Y4 2ML6A 5IW9A 1JBSA 2HMJB 4TX4A 2AADA 4DKIA 3HIIA 2P09A 3STDA 2UGIA 1V74A 1U5OA 4MMXB 3N54B 1RMSA 1QVF2 1LOWA 1Z1SA 1IT8A 1OACA 3B8LA 5D81A 2BHMA 1NJI4 1OCVA 4N6NB 2MC8A 1JZOA 3GSPA 3UNLA 3GZBA 1RGEA 2KAAA 1SPUA 2ML5A 4GSPA 1RTUA 3X3ZA 3WA3A 1K8A4 3KZTA 1IT7A 1OF5A 2PZVA 2GSPA 3EX9A 3MG2A 3U97A 1BRHA 1WMPA 2W56B 2IY2A 2ZA4A 3ER7A 6RNTA 1DMMA 3S27A 4J5GA 1O7PB 4HM3B 1US1A 1EKMA 1B20A 2Q07A 2WGOA 2WOHA 3DMCA 1T3BA 3DXOA 3GAXA 3MWZA 5BIRA 1RN1A 2XF3A 1BUQA 3HK4A 4BTWA 1BRNL 1Q7HA 5IG3A 4BL2A 4HVNA 4XDWA 3SEDA 1LXEA 1TP6A 5IEPA 2W03A 3JUOA 1LOYA 1MGRA 4LEHA 1DETA 1E3VA 3AGNA 1AQZA 5AI1A 5GSPA 2CG1A 3H3HA 4GHOA 3G4S3 3MKIA 1GMPA 4R9LA 3RNTA 2C11A 3VGNA 5FW5A 4AKYA 4U13A 3KFQC 5EQLA 1ZX2A 5I97A 3UL6A 4STDA 2E2VA 4EV2A 6STDA 1LOXA 1NDOB 2CG0A 1UW1A 2IA7A 1B2MA 2HMKB 1VQ83 3WMDA 4JF8A 2CFGA 5EEOA 1N9JA 2BU4A 1B3SA 1VQ43 4ZM8A 1S723 3F8HA 1MWTA 3EBTA 3CNMA 1J2BA 5STDA 2OWPA 1NB5I 2H0GA 1ZS7A 4LYLB 2CC3A 3LXUX 1MWSA 3Q3FA 3N9HA 1GOYA 1O7WB 3F8XA 1RGKA 1BNRA 4IIAA 4X2HA 3WODG 3DGOA 1YI23 1MGWA 3FLJA 3EC9A 2W04A 3WOEB 1RN7A 4CPKA 2LQVA 2XRXB 3OV4A 1YHQ3 1I2GA 4CCVA 4O02B 3JVCA 2HOHA 1BSCA 3K9MC 3KCHA 1FW7A 3Q90A 5KP3A 3CPOA 3LT8A 4R9KA 1I8VA 2P0MA 1VQK3 3LYGA 5EVHA 4BU4A 1OPYA 1WTHA 1IU7A 4PEJA 3X3XA 1N5HA 1JBTA 1G0TA 3KN4A 3FF0A 1FZUA 5G1LA 3URPA 5CF1A 5HOHA 4JRFA 1IQXA 3K63A 1VQM3 1A2PA 1OHOA 1BRJA 1JRQA 3CD63 1ZGXA 2GU3A 3CCQ3 2WO0A 1W6CA 1SIIA 3NM2A 2XSOB 1LQMB 1GYBA 2F98A 5IG4A 1Q40B 2R41A 1JNQA 4N3VA 3FG4A 3CCS3 1VQN3 1MNLA 2XSHB 1VQ73 1EG9B 4K90B 2YFIB 1D6UA 3H51A 3K7CA 2W2CA 3X41A 1X1UA 3NM7A 1PFPA 1W2B2 1SARA 2D1WA 3SYUA 4CJNA 1RGHA 2BNGA 1DVCA 2F99A 1RGFA 2P38A 2RBIA 6GSPA 1ISKA 3PZWA 2E2TA 4HOHA 3CCE3 1N8R4 1TRQA 3MSOA 4RNTA 3RGRA 1RSNA 3OWUA 4FCMA 4HAAA 1MOLA 3MPHA 3NUVA 2FGTA 4KT3B 1VQO3 4KVHA 1TRPA 3KKGA 4O3VA 3AMOB 5ELUA 1X1WA 3CPW2 1BUJA 1Y4KA 2K3DA 3HX8A 4HM6B 3NBJA 4MMZB 3WHOA 1X1YA 2D42A 1YJ93 2KF6A 1VQ93 1GOVA 3J7Yd 1KSIA 4HKVB 1V58A 3PYJA 2IUKA 1W6GA 3DY5A 3NV0B 1Q9EA 1S5AA 3LTAA 3CCL3 3ZG5A 1BNEA 1LNHA 3SLUA 3CCR3 2CX0A 3JUMA 3FGYA 2BMQB 4XBXA 3EN1B 1BVIA 2GBXB 3V92A 1TJDA 3T8UA 1I2EA 1I70A 3CU3A 1JB2A 3RDEA 3BNEA 4GL6A 2KCDA 3JUNA 2Z6BA 5M19A 1VQQA 2C10A 1UCIA 5ELJA 1W02A 1E97A 4EBGA 1CH0A 2W56A 4FMDA 3LTBA 1AVKA 1IVXA 1NO3A 4FCJA 3ZFZA 3IJEB 4EW5A 2CWVA 1BIRA 1O7HB 3A76A 3WDGB 2RSXA 2BMOB 1BU4A 3DGLA 3PCSA 5KP1A 2CWTA 3D79A 1VQP3 1AY7A 1BANA 1GMQA 3BU4A 3GZRA 3MYTA 5HGRA 1HYFA 1JZDA 4OVMA 3BNDA 2Y74A 3PXMA 1O7GB 1DE3A 1LVNA 1LRAA 1GD4A 2W6JH 2I9WA 3GWRA 1FUSA 5JBSA 1DMQA 1UUVB 1NWWA 4WYKB 5LC7A 1K734 2UX0A 4IT7A 4NHFA 3ECFA 1BNIA 1UCLA 1IV7A 4H3UA 1B2UA 3GZYB 5CLKA 3WA2X 3E99A 1JKGB 1MWUA 3QK9A 3MG3A 3JUQA 2H0IA 1F8NA 2XFTA 4GB5A 1CYUA 3CC23 8RNTA 3G713 5IENA 4XBYA 3B4OA 4BL3A 5D82A 1M1XB 3FG3A 3HZPA 3SXXA 1CEWI 2W9PA 2L1SA 1IQ8A 4OUQA 3RGAA 3L0RA 3G6E3 3DH2A 1GY5A 3NV0A 3UB1A 1M9GA 4N6OB 3QRDA 1YVBI 3X40A 4O8SA 4R1KA 2LYXA 1VZZA 3S28A 3O8YA 2E2UA 3CCJ3 4FR9A 2UUGC 3BB9A 5AYRB 3PGBA 4H61A 1EEJA 1N8QA 1W5ZA 1VQL3 1FGRA 1O7NB 3G16A 2W9QA 4HM5B 2RFRA 2CW9A 1BNSA 1HKXA 2WOFA 2CKFB 4L8OA 3NHXA 4LSOA 2CX1A 1RGGA 3DUKA 1BOXA 3B4PA 2L4VA 2CIUA 3MHEA 1B2XA 1RJOA 5AEUB 3LZAA 1BNJA 3FSDA 2IUJA 2XR8B 5DREA 2C4BA 4KFEA
chains in the Genus database with same CATH topology
4EC6A 2FXTA 3T8NA 2HMNB 1UUWB 1JB4A 3HIGA 1WNHA 2Z76A 4LGQA 1EA2A 2O9UX 3FF2A 4XM4A 5CXOA 3CXC2 2ZDJA 1A90A 4KZ1A 5IF6A 3FH1A 3NX0A 4FMBA 3IMAB 4RNZA 5BXQA 1DVDA 1N9EA 1PU4A 3CNXA 3CMA3 2Y73A 4XDVA 5AIGA 3G8ZA 1CYVA 1FGOA 1QMAA 2W0QA 4OK0A 1M904 4NREA 2YFJB 3EHCA 2OCTA 4WP5A 2GEYA 1GY7A 4BTXA 2ZL8A 3LT9A 2RGQA 1UI7A 5JPPA 1ASKA 3ALAA 3PCRA 3B7CA 3X3YA 1Q824 1SQWA 4KFDA 4KFFA 4N6LA 3SX1A 2R4IA 3CCM3 1C7HA 1E3RA 3IPTA 4R80A 4HYZA 1FA3A 1ROVA 2JDIH 3NBRA 1TUHA 4HM2B 1GY6A 2OQEC 3FG1A 1K41A 2KXGA 5AYSC 3SOYA 1KD14 4RZMA 2RCDA 1W2ZA 3BNCA 4WHAA 3CC43 1A67A 1OGZA 2CWUA 1STDA 1W6YA 3FCSB 1D6YA 5IEOA 1A2KA 3EF8A 3FZWA 1JN5A 1WMOA 5AIHA 4HM4B 5IERA 1TFOA 4K1UA 2FNQA 1KWIA 4MJDA 4XB5A 5AIIA 5IG0A 1NU3A 1OHPA 5CF2A 2CFLA 1A2VA 4MMYB 3HI7A 3OXAA 3S5CA 4WYKA 3U1WA 2GXFA 3KSED 3WOFB 1Q864 3LTDA 3EQQB 1K9M4 5G2GA 1G96A 3F7XA 2XH9A 1O7MB 1W7CA 2STDA 4MEIA 1M1K4 2QIYA 3MG1A 3T0UA 4I4KA 1GS3A 4HZBB 1Q42A 1QAKA 2KRTA 2QGUA 1KQS2 1IK3A 4HM7B 4WWUC 4EXRA 2V1LA 3KSPA 1JV2B 1WMNA 3EJVA 4EV5A 5IG5A 2Z7AA 1IV9A 3JUPA 1ZO2A 3I0YA 3UL5A 1YJN3 1ROAA 3CC73 2OOVA 2BO9B 1N5PA 4AEQA 3DZLA 1JB5A 5AEWB 2P05A 2B24B 1U8CB 5JPUA 3AMOA 2P0XA 1VQ53 2CK3H 2CH9A 3DM8A 2B1XB 1RKYA 3OW22 3F40A 4R4KA 2WGQA 3NBBA 3TDGA 5LC6A 3PS8A 2F86B 2JQ5A 1DYUA 1IVVA 2OQEA 1JN5B 4RNYA 1RRLA 4FMAA 4LZIA 1STFI 1WQLB 3F7SA 4EYCA 1R4CA 4J8TA 4N6V0 1W00A 1KC84 1ULJB 3V98A 2CFKA 1QJGA 3CCV3 1SJWA 2OOVC 3Q1CA 1ULIB 3OWYA 4FCZA 4HZ9B 1NB3I 2M7OA 3EBYA 2XFSA 4XBTA 1FGTA 5CK6A 3BLZA 1L5GB 1FGQA 2QA43 2K0MA 3DGNA 1K28A 2BMRB 1YIT3 2INXA 3I553 3KE7A 2K54A 2PNCA 4IPBA 1OHSA 4Q53A 2Z77A 4K1VA 2CHCA 3GRDA 4N6MA 8CHOA 1AR0A 3M8CA 3LTCA 2SBLA 2QEX3 4HM0B 5TGNA 1W4NA 1YGEA 3BNBA 3F14A 3K5TA 1W01A 4LMIA 3S29A 2OTL3 4K61A 5KP4A 4O2HA 1TFKA 2CFDA 3D9RA 2CFWA 3EB8A 3VF1A 3NXJA 2YFLB 4L8PA 4QWTA 3EE1A 4HJLB 3NQYA 2GEXA 1FUWA 1OUNA 3LH4A 4BTYA 1JKGA 2YX9A 1QALA 3OWSA 4N6UA 3EN8A 1QAFA 4AKZA 1DMNA 3LOYA 1YIJ3 2HMMB 3X42A 2HMOB 4J9AA 4X2OA 4HM8B 1VQ63 1OF5B 2GBWB 2OTJ3 1IVUA 4FMCA 4CDLA 1QVG2 4N6TA 3Q2PA 1RRHA 1TU5A 1UI8A 2XGNA 1TIJA 3V99A 5AIFA 1OGXA 1GD3A 1CQSA 1Q40A 2A15A 4ORLA 3F9SA 3ROBA 2MF7A 2GU1A 3SOAA 5D83A 3SVAA 5A0OB 1D6ZA 1Q814 2XGLA 2XEPA 1JJ22 3DGMA 3NQZA 3FKAA 1IQYA 3KIIA 1FGMA 4L7KA 1YJW3 1HU9A 3CME3 1IDPA 3G0KA 5BVBA 3S67A 1OH0A 1IVWA 3GZXB 4G1MB 3CCU3 4HBRA 3OX9A 1T5YA 7STDA 5FGOA 3UJMA 3K0ZA 1EQKA 3I563 2IMJA 2HMLB 2O3OA 4HM1B 1AV4A 3N8BA 1AVLA 4RBNA 3LMLA 1SIHA 3VSYA 3D3LA 4WFOA 1Q7Y4 2BT3A 5DRVA 2ML6A 5IW9A 2HMJB 4TX4A 3HIIA 2P09A 3STDA 1V74A 1U5OA 4MMXB 3N54B 1QVF2 5D81A 1Z1SA 1IT8A 1OACA 3B8LA 2BHMA 1NJI4 1OCVA 4N6NB 2MC8A 3UNLA 3GZBA 1SPUA 2ML5A 3X3ZA 3WA3A 1K8A4 3KZTA 1IT7A 1OF5A 2PZVA 3EX9A 3MG2A 3U97A 1WMPA 2W56B 3ER7A 1DMMA 3S27A 1O7PB 4HM3B 1US1A 1EKMA 2Q07A 2WGOA 2WOHA 3DMCA 3DXOA 3GAXA 3MWZA 2XF3A 1BUQA 3HK4A 4BTWA 5IG3A 5IEPA 4HVNA 4XDWA 3SEDA 1LXEA 1TP6A 2W03A 3JUOA 4LEHA 1E3VA 5AI1A 3G4S3 2CG1A 3H3HA 3MKIA 4R9LA 2C11A 3VGNA 5FW5A 4AKYA 4U13A 3KFQC 5EQLA 1ZX2A 5I97A 3UL6A 4STDA 2E2VA 4EV2A 6STDA 1LOXA 1NDOB 2CG0A 1UW1A 2IA7A 2HMKB 1VQ83 3WMDA 4JF8A 2CFGA 5EEOA 1N9JA 1VQ43 4ZM8A 1S723 3F8HA 3EBTA 3CNMA 1J2BA 5STDA 2OWPA 1NB5I 2CC3A 3LXUX 3N9HA 1O7WB 3F8XA 4IIAA 4X2HA 3WODG 3DGOA 1YI23 3FLJA 3EC9A 2W04A 3WOEB 1RN7A 2LQVA 2XRXB 3OV4A 1YHQ3 4CCVA 4O02B 3JVCA 3K9MC 3Q90A 5KP3A 3CPOA 3LT8A 4R9KA 2P0MA 1VQK3 3LYGA 5EVHA 1OPYA 1WTHA 1IU7A 4PEJA 3X3XA 1N5HA 3KN4A 3FF0A 5CF1A 4JRFA 1IQXA 3K63A 1VQM3 1OHOA 1JRQA 3CD63 2GU3A 3CCQ3 2WO0A 1W6CA 1SIIA 3NM2A 2XSOB 1GYBA 2F98A 5IG4A 1Q40B 3CCS3 1JNQA 4N3VA 3FG4A 1VQN3 1MNLA 2XSHB 1VQ73 1EG9B 4K90B 2YFIB 1D6UA 3H51A 3K7CA 2W2CA 3X41A 1PFPA 1W2B2 2D1WA 2F99A 1DVCA 2BNGA 2P38A 1ISKA 3PZWA 2E2TA 1N8R4 3CCE3 3MSOA 3RGRA 3OWUA 4FCMA 1MOLA 3MPHA 3NUVA 2FGTA 1VQO3 4KVHA 4O3VA 3KKGA 3AMOB 5ELUA 3CPW2 1Y4KA 3HX8A 4HM6B 3NBJA 4MMZB 2D42A 1YJ93 1VQ93 3J7Yd 1KSIA 4HKVB 3PYJA 2IUKA 1W6GA 3DY5A 3NV0B 1S5AA 3LTAA 3CCL3 1LNHA 3SLUA 3CCR3 3JUMA 4XBXA 3FGYA 2BMQB 3EN1B 2GBXB 3V92A 3T8UA 3CU3A 1JB2A 3RDEA 3BNEA 4GL6A 2KCDA 3JUNA 2Z6BA 2C10A 5ELJA 1W02A 1E97A 4EBGA 2W56A 4FMDA 3LTBA 1IVXA 1AVKA 1NO3A 4FCJA 3IJEB 2CWVA 3A76A 1O7HB 3WDGB 2RSXA 2BMOB 3DGLA 5KP1A 3PCSA 2CWTA 1VQP3 3GZRA 5HGRA 3MYTA 4OVMA 3BNDA 2Y74A 3PXMA 1O7GB 1LVNA 1GD4A 2W6JH 2I9WA 3GWRA 5JBSA 1DMQA 1UUVB 1NWWA 4WYKB 5LC7A 1K734 2UX0A 4IT7A 4NHFA 3ECFA 1IV7A 4H3UA 3GZYB 5CLKA 3WA2X 3E99A 1JKGB 3QK9A 3MG3A 3JUQA 2XFTA 1F8NA 4GB5A 1CYUA 3CC23 3G713 5IENA 4XBYA 3B4OA 5D82A 1M1XB 3FG3A 3HZPA 3SXXA 1CEWI 2W9PA 1IQ8A 4OUQA 3RGAA 3L0RA 3G6E3 1GY5A 3NV0A 3UB1A 1M9GA 4N6OB 3QRDA 1YVBI 3X40A 4O8SA 4R1KA 2LYXA 1VZZA 3S28A 3O8YA 2E2UA 3CCJ3 4FR9A 5AYRB 3BB9A 3PGBA 4H61A 1N8QA 1W5ZA 1VQL3 1FGRA 1O7NB 3G16A 2W9QA 4HM5B 2RFRA 2CW9A 1HKXA 4L8OA 2WOFA 2CKFB 3NHXA 4LSOA 3DUKA 3B4PA 2L4VA 2CIUA 3MHEA 5AEUB 1RJOA 3LZAA 2IUJA 3FSDA 2XR8B 5DREA 3NM7A 4KFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMJ B;  3MSO A;  3T8N A;  3RGR A;  2HMN B;  1UUW B;  3OWU A;  1JB4 A;  3DM8 A;  2B1X B;  4FCM A;  3STD A;  3F40 A;  2Z76 A;  4LGQ A;  1EA2 A;  1U5O A;  3NUV A;  3FF2 A;  1Z1S A;  3B8L A;  4XM4 A;  5CXO A;  4KVH A;  5D81 A;  3KKG A;  2F86 B;  2JQ5 A;  1OCV A;  3UNL A;  1JN5 B;  3GZB A;  3HX8 A;  4HM6 B;  5IF6 A;  3FH1 A;  5BXQ A;  1WQL B;  3F7S A;  3KZT A;  2PZV A;  1OF5 A;  4XBX A;  4HKV B;  4J8T A;  1W00 A;  3CNX A;  4XDV A;  3EX9 A;  3NV0 B;  5AIG A;  3G8Z A;  1ULJ B;  3MG2 A;  1QMA A;  1S5A A;  1QJG A;  3ER7 A;  1DMM A;  1SJW A;  1ULI B;  3OWY A;  1O7P B;  4HM3 B;  4HZ9 B;  3DMC A;  3EBY A;  3DXO A;  3FGY A;  2BMQ B;  3JUM A;  3EN1 B;  2YFJ B;  4XBT A;  3EHC A;  2GBX B;  3BLZ A;  5CK6 A;  1BUQ A;  4WP5 A;  3T8U A;  3HK4 A;  2GEY A;  1GY7 A;  5IG3 A;  5IEP A;  3CU3 A;  2RGQ A;  4HVN A;  1TP6 A;  2BMR B;  4XDW A;  3SED A;  1JB2 A;  1ASK A;  2INX A;  3JUO A;  3KE7 A;  2K54 A;  1E3V A;  4LEH A;  1OHS A;  3JUN A;  5AI1 A;  3B7C A;  3H3H A;  2Z77 A;  4Q53 A;  3MKI A;  4R9L A;  1W02 A;  4K1V A;  1E97 A;  2CHC A;  3GRD A;  8CHO A;  3VGN A;  1AR0 A;  3M8C A;  5FW5 A;  4FCJ A;  4U13 A;  3A76 A;  4HM0 B;  1O7H B;  2R4I A;  1ZX2 A;  5TGN A;  3F14 A;  1C7H A;  4LMI A;  1W01 A;  1E3R A;  2BMO B;  3IPT A;  4STD A;  6STD A;  5KP1 A;  1NDO B;  5KP4 A;  2HMK B;  3D9R A;  3GZR A;  5DRE A;  3NBR A;  5HGR A;  3WMD A;  1TUH A;  3MYT A;  3NXJ A;  2YFL B;  4HM2 B;  1GY6 A;  4L8P A;  4HJL B;  4OVM A;  1K41 A;  1O7G B;  3SOY A;  2GEX A;  3F8H A;  1OUN A;  3CNM A;  3EBT A;  4RZM A;  2I9W A;  2RCD A;  3GWR A;  5STD A;  2OWP A;  1DMQ A;  1JKG A;  1UUV B;  1NWW A;  4WYK B;  1OGZ A;  1STD A;  1W6Y A;  2UX0 A;  1O7W B;  3F8X A;  5IEO A;  3OWS A;  3ECF A;  3EN8 A;  1A2K A;  4IIA A;  4H3U A;  4HM5 B;  3EF8 A;  1DMN A;  3GZY B;  3FZW A;  4X2H A;  1JN5 A;  5CLK A;  5AIH A;  2HMM B;  3E99 A;  3FLJ A;  4HM4 B;  2HMO B;  3EC9 A;  4J9A A;  1JKG B;  5IER A;  4K1U A;  4X2O A;  3MG3 A;  4HM8 B;  3JUQ A;  3OV4 A;  1OF5 B;  2GBW B;  2XRX B;  4GB5 A;  4CDL A;  4MJD A;  4XB5 A;  5AII A;  5IG0 A;  1NU3 A;  1OHP A;  5CF2 A;  4XBY A;  3B4O A;  5IEN A;  3OXA A;  5D82 A;  3S5C A;  4WYK A;  3HZP A;  2GXF A;  3Q90 A;  5KP3 A;  3CPO A;  5AIF A;  4OUQ A;  1OGX A;  4R9K A;  3RGA A;  1CQS A;  1Q40 A;  2A15 A;  1GY5 A;  3EQQ B;  3F9S A;  3LYG A;  3NV0 A;  4ORL A;  5EVH A;  3ROB A;  5G2G A;  1OPY A;  3F7X A;  5D83 A;  3SOA A;  4PEJ A;  1O7M B;  2STD A;  3FKA A;  3FF0 A;  2QIY A;  3MG1 A;  5CF1 A;  2XR8 B;  4I4K A;  1GS3 A;  1OHO A;  4R1K A;  4HZB B;  1Q42 A;  2QGU A;  4L7K A;  1IDP A;  1VZZ A;  3G0K A;  5BVB A;  1OH0 A;  3GZX B;  4HM7 B;  4WWU C;  5JPP A;  3KSP A;  2XSO B;  3BB9 A;  3NM2 A;  1GYB A;  2F98 A;  3EJV A;  1Q40 B;  3OX9 A;  4N3V A;  5IG4 A;  5IG5 A;  2XSH B;  2Z7A A;  7STD A;  3JUP A;  1O7N B;  1EG9 B;  3G16 A;  1ZO2 A;  2YFI B;  3H51 A;  2RFR A;  3I0Y A;  3K0Z A;  1HKX A;  2W2C A;  3K7C A;  2CKF B;  2IMJ A;  4L8O A;  2HML B;  3NHX A;  3DUK A;  3B4P A;  4HM1 B;  3UJM A;  3DZL A;  2F99 A;  2BNG A;  3MHE A;  5AEU B;  1JB5 A;  3LZA A;  3VSY A;  3FSD A;  5AEW B;  1ISK A;  2B24 B;  5DRV A;  5JPU A; 
#chains in the Genus database with same CATH topology
 4EC6 A;  2FXT A;  3T8N A;  2HMN B;  1UUW B;  1JB4 A;  3HIG A;  1WNH A;  1B21 A;  2Z76 A;  4LGQ A;  1EA2 A;  2IYJ A;  1LNI A;  2J8X B;  2O9U X;  3FF2 A;  4XM4 A;  2F5M A;  5CXO A;  3CXC 2;  2ZDJ A;  1A90 A;  1BRK A;  7RNT A;  4KZ1 A;  5IF6 A;  3FH1 A;  3NX0 A;  2BIR A;  4FMB A;  3IMA B;  4RNZ A;  5BXQ A;  1GOU A;  1DVD A;  1N9E A;  1PU4 A;  1RLS A;  3CNX A;  3CMA 3;  2Y73 A;  4ILF A;  4XDV A;  5AIG A;  3G8Z A;  1CYV A;  1FGO A;  1QMA A;  2W0Q A;  3BIR A;  4OK0 A;  1M90 4;  1UCK A;  1B2Z A;  4NRE A;  2YFJ B;  3EHC A;  2OCT A;  4WP5 A;  2GEY A;  1GY7 A;  4BTX A;  2ZL8 A;  3LT9 A;  2RGQ A;  1UI7 A;  5JPP A;  1ASK A;  3ALA A;  1UGI A;  3PCR A;  3B7C A;  3X3Y A;  1Q82 4;  1SQW A;  4KFD A;  4KFF A;  3HOH A;  4N6L A;  3SX1 A;  2R4I A;  3CCM 3;  1C7H A;  1I0X A;  1E3R A;  3DGY A;  3IPT A;  1BAO A;  4R80 A;  4HYZ A;  1FA3 A;  1ROV A;  2JDI H;  3NBR A;  1TUH A;  4HM2 B;  1GY6 A;  2OQE C;  3FG1 A;  1YVS A;  1K41 A;  1V57 A;  2KXG A;  5AYS C;  3SOY A;  1KD1 4;  1EUI C;  4RZM A;  2RCD A;  1W2Z A;  3BNC A;  4WHA A;  1RDS A;  3CC4 3;  1A67 A;  1OGZ A;  2CWU A;  1STD A;  1W6Y A;  3FCS B;  2H0H A;  1D6Y A;  5IEO A;  1A2K A;  1T2I A;  3EF8 A;  1NNV A;  3FZW A;  1JN5 A;  1WMO A;  5AIH A;  1RNT A;  4HM4 B;  5IER A;  1TFO A;  4K1U A;  2FNQ A;  1KWI A;  4MJD A;  2AAE A;  4XB5 A;  5AII A;  1NU3 A;  1OHP A;  5IG0 A;  5CF2 A;  2CFL A;  1A2V A;  4MMY B;  3HI7 A;  3OXA A;  3S5C A;  4WYK A;  3U1W A;  2GXF A;  3KSE D;  3WOF B;  5G1K A;  1BSD A;  1Q86 4;  1RGA A;  2F5W A;  3EQQ B;  3LTD A;  3AGO A;  1K9M 4;  5G2G A;  1G96 A;  3F7X A;  5M18 A;  2XH9 A;  1O7M B;  1W7C A;  2STD A;  4MEI A;  1M1K 4;  2QIY A;  3MG1 A;  3T0U A;  5BU4 A;  1C54 A;  1I2F A;  4I4K A;  1GS3 A;  4HZB B;  1Q42 A;  1QAK A;  2KRT A;  2QGU A;  1KQS 2;  1FYS A;  1IK3 A;  4HM7 B;  4WWU C;  4EXR A;  2V1L A;  3KSP A;  1BRS A;  1GMR A;  1JV2 B;  1WMN A;  1YNV X;  3EJV A;  3D5I A;  4EV5 A;  2Z7A A;  5IG5 A;  1IV9 A;  1BSE A;  1UCJ A;  3JUP A;  1MWR A;  1ZO2 A;  3I0Y A;  3UL5 A;  1ROA A;  1YJN 3;  3CC7 3;  2OOV A;  2BO9 B;  1N5P A;  1B2S A;  1PYL A;  4AEQ A;  3DZL A;  1I3F A;  4J5K A;  1JB5 A;  1LQG C;  2F56 A;  2P05 A;  5AEW B;  2B24 B;  1U8C B;  5JPU A;  3D5G A;  3AMO A;  1RCK A;  2P0X A;  1VQ5 3;  2CK3 H;  2CH9 A;  3DM8 A;  2B1X B;  1PY3 A;  1RKY A;  3OW2 2;  1RGL A;  3F40 A;  4R4K A;  1I3I A;  2WGQ A;  1T2H A;  3NBB A;  3TDG A;  9RNT A;  5LC6 A;  3PS8 A;  2F86 B;  2JQ5 A;  1IYY A;  1DYU A;  1IVV A;  2OQE A;  1JN5 B;  4RNY A;  1RRL A;  1JBR A;  2F4Y A;  4FMA A;  4LZI A;  1STF I;  1WQL B;  3F7S A;  4EYC A;  1R4C A;  1HZ1 A;  4J8T A;  1TTO A;  1W00 A;  4N6V 0;  1KC8 4;  1ULJ B;  3V98 A;  2CFK A;  1QJG A;  3CCV 3;  1SJW A;  2OOV C;  3Q1C A;  1ULI B;  3OWY A;  4FCZ A;  4HZ9 B;  1BSB A;  1NB3 I;  2M7O A;  3AHW A;  2XFS A;  2KF3 A;  1FGT A;  3EBY A;  4XBT A;  5CK6 A;  1RGC A;  3BLZ A;  2KF4 A;  1L5G B;  1BGS A;  1FGQ A;  2QA4 3;  1LOV A;  2K0M A;  1FUT A;  3DGN A;  5M1A A;  1K28 A;  2BMR B;  3D4A A;  1YIT 3;  2INX A;  3I55 3;  3KE7 A;  2K54 A;  2PNC A;  1X1X A;  1OHS A;  4IPB A;  4Q53 A;  2Z77 A;  4K1V A;  1BNG A;  2CHC A;  3GRD A;  4N6M A;  8CHO A;  1AR0 A;  1RHL A;  3M8C A;  1BRG A;  1YGW A;  2SBL A;  3LTC A;  4HM0 B;  5TGN A;  2QEX 3;  1W4N A;  1YGE A;  3BNB A;  3F14 A;  3K5T A;  1W01 A;  4LMI A;  3S29 A;  2OTL 3;  4K61 A;  5KP4 A;  4O2H A;  4BIR A;  1TFK A;  2CFD A;  3D9R A;  2CFW A;  3EB8 A;  3VF1 A;  3NXJ A;  2YFL B;  4L8P A;  4QWT A;  3EE1 A;  4HJL B;  1BSA A;  3NQY A;  2GEX A;  1FUW A;  1OUN A;  2ZHX B;  3WR2 A;  3LH4 A;  4BTY A;  1RNB A;  1JKG A;  2YX9 A;  1QAL A;  3OWS A;  4N6U A;  3EN8 A;  1QAF A;  4NPB A;  3ZG0 A;  1DMN A;  4AKZ A;  3LOY A;  1YIJ 3;  2HMM B;  3X42 A;  2HMO B;  3A5E A;  4J9A A;  1B27 A;  1GSP A;  4X2O A;  4HM8 B;  2SAR A;  1VQ6 3;  1OF5 B;  2GBW B;  2OTJ 3;  1IVU A;  4FMC A;  4CDL A;  1QVG 2;  1UUG B;  4N6T A;  3Q2P A;  1RRH A;  1I0V A;  7GSP A;  1RN4 A;  1TU5 A;  1UI8 A;  2XGN A;  1TIJ A;  3V99 A;  5AIF A;  1OGX A;  4I5Q A;  1GD3 A;  1CQS A;  1Q40 A;  1UGH I;  1BNF A;  2A15 A;  3F9S A;  4ORL A;  2MF7 A;  3ROB A;  2GU1 A;  3SOA A;  5D83 A;  3SVA A;  5A0O B;  1D6Z A;  1Q81 4;  2XGL A;  2XEP A;  1JJ2 2;  3DGM A;  3NQZ A;  3FKA A;  1RCL A;  1R4Y A;  1IQY A;  3KII A;  5RNT A;  1FGM A;  4L7K A;  1YJW 3;  1HU9 A;  3CME 3;  1IDP A;  3AHS A;  3G0K A;  5BVB A;  3S67 A;  1OH0 A;  1IVW A;  1UDI I;  3GZX B;  1G02 A;  4G1M B;  3CCU 3;  4HBR A;  2RNT A;  3OX9 A;  1T5Y A;  7STD A;  5FGO A;  3UJM A;  3K0Z A;  1EQK A;  2KF5 A;  3I56 3;  2IMJ A;  2HML B;  2O3O A;  4HM1 B;  1AV4 A;  3N8B A;  1AVL A;  4RBN A;  3LML A;  1BRI A;  1SIH A;  3D3L A;  4WFO A;  3VSY A;  2BT3 A;  5DRV A;  1Q7Y 4;  2ML6 A;  5IW9 A;  1JBS A;  2HMJ B;  4TX4 A;  2AAD A;  4DKI A;  3HII A;  2P09 A;  3STD A;  2UGI A;  1V74 A;  1U5O A;  4MMX B;  3N54 B;  1RMS A;  1QVF 2;  1LOW A;  1Z1S A;  1IT8 A;  1OAC A;  3B8L A;  5D81 A;  2BHM A;  1NJI 4;  1OCV A;  4N6N B;  2MC8 A;  1JZO A;  3GSP A;  3UNL A;  3GZB A;  1RGE A;  2KAA A;  1SPU A;  2ML5 A;  4GSP A;  1RTU A;  3X3Z A;  3WA3 A;  1K8A 4;  3KZT A;  1IT7 A;  1OF5 A;  2PZV A;  2GSP A;  3EX9 A;  3MG2 A;  3U97 A;  1BRH A;  1WMP A;  2W56 B;  2IY2 A;  2ZA4 A;  3ER7 A;  6RNT A;  1DMM A;  3S27 A;  4J5G A;  1O7P B;  4HM3 B;  1US1 A;  1EKM A;  1B20 A;  2Q07 A;  2WGO A;  2WOH A;  3DMC A;  1T3B A;  3DXO A;  3GAX A;  3MWZ A;  5BIR A;  1RN1 A;  2XF3 A;  1BUQ A;  3HK4 A;  4BTW A;  1BRN L;  1Q7H A;  5IG3 A;  4BL2 A;  4HVN A;  4XDW A;  3SED A;  1LXE A;  1TP6 A;  5IEP A;  2W03 A;  3JUO A;  1LOY A;  1MGR A;  4LEH A;  1DET A;  1E3V A;  3AGN A;  1AQZ A;  5AI1 A;  5GSP A;  2CG1 A;  3H3H A;  4GHO A;  3G4S 3;  3MKI A;  1GMP A;  4R9L A;  3RNT A;  2C11 A;  3VGN A;  5FW5 A;  4AKY A;  4U13 A;  3KFQ C;  5EQL A;  1ZX2 A;  5I97 A;  3UL6 A;  4STD A;  2E2V A;  4EV2 A;  6STD A;  1LOX A;  1NDO B;  2CG0 A;  1UW1 A;  2IA7 A;  1B2M A;  2HMK B;  1VQ8 3;  3WMD A;  4JF8 A;  2CFG A;  5EEO A;  1N9J A;  2BU4 A;  1B3S A;  1VQ4 3;  4ZM8 A;  1S72 3;  3F8H A;  1MWT A;  3EBT A;  3CNM A;  1J2B A;  5STD A;  2OWP A;  1NB5 I;  2H0G A;  1ZS7 A;  4LYL B;  2CC3 A;  3LXU X;  1MWS A;  3Q3F A;  3N9H A;  1GOY A;  1O7W B;  3F8X A;  1RGK A;  1BNR A;  4IIA A;  4X2H A;  3WOD G;  3DGO A;  1YI2 3;  1MGW A;  3FLJ A;  3EC9 A;  2W04 A;  3WOE B;  1RN7 A;  4CPK A;  2LQV A;  2XRX B;  3OV4 A;  1YHQ 3;  1I2G A;  4CCV A;  4O02 B;  3JVC A;  2HOH A;  1BSC A;  3K9M C;  3KCH A;  1FW7 A;  3Q90 A;  5KP3 A;  3CPO A;  3LT8 A;  4R9K A;  1I8V A;  2P0M A;  1VQK 3;  3LYG A;  5EVH A;  4BU4 A;  1OPY A;  1WTH A;  1IU7 A;  4PEJ A;  3X3X A;  1N5H A;  1JBT A;  1G0T A;  3KN4 A;  3FF0 A;  1FZU A;  5G1L A;  3URP A;  5CF1 A;  5HOH A;  4JRF A;  1IQX A;  3K63 A;  1VQM 3;  1A2P A;  1OHO A;  1BRJ A;  1JRQ A;  3CD6 3;  1ZGX A;  2GU3 A;  3CCQ 3;  2WO0 A;  1W6C A;  1SII A;  3NM2 A;  2XSO B;  1LQM B;  1GYB A;  2F98 A;  5IG4 A;  1Q40 B;  2R41 A;  1JNQ A;  4N3V A;  3FG4 A;  3CCS 3;  1VQN 3;  1MNL A;  2XSH B;  1VQ7 3;  1EG9 B;  4K90 B;  2YFI B;  1D6U A;  3H51 A;  3K7C A;  2W2C A;  3X41 A;  1X1U A;  3NM7 A;  1PFP A;  1W2B 2;  1SAR A;  2D1W A;  3SYU A;  4CJN A;  1RGH A;  2BNG A;  1DVC A;  2F99 A;  1RGF A;  2P38 A;  2RBI A;  6GSP A;  1ISK A;  3PZW A;  2E2T A;  4HOH A;  3CCE 3;  1N8R 4;  1TRQ A;  3MSO A;  4RNT A;  3RGR A;  1RSN A;  3OWU A;  4FCM A;  4HAA A;  1MOL A;  3MPH A;  3NUV A;  2FGT A;  4KT3 B;  1VQO 3;  4KVH A;  1TRP A;  3KKG A;  4O3V A;  3AMO B;  5ELU A;  1X1W A;  3CPW 2;  1BUJ A;  1Y4K A;  2K3D A;  3HX8 A;  4HM6 B;  3NBJ A;  4MMZ B;  3WHO A;  1X1Y A;  2D42 A;  1YJ9 3;  2KF6 A;  1VQ9 3;  1GOV A;  3J7Y d;  1KSI A;  4HKV B;  1V58 A;  3PYJ A;  2IUK A;  1W6G A;  3DY5 A;  3NV0 B;  1Q9E A;  1S5A A;  3LTA A;  3CCL 3;  3ZG5 A;  1BNE A;  1LNH A;  3SLU A;  3CCR 3;  2CX0 A;  3JUM A;  3FGY A;  2BMQ B;  4XBX A;  3EN1 B;  1BVI A;  2GBX B;  3V92 A;  1TJD A;  3T8U A;  1I2E A;  1I70 A;  3CU3 A;  1JB2 A;  3RDE A;  3BNE A;  4GL6 A;  2KCD A;  3JUN A;  2Z6B A;  5M19 A;  1VQQ A;  2C10 A;  1UCI A;  5ELJ A;  1W02 A;  1E97 A;  4EBG A;  1CH0 A;  2W56 A;  4FMD A;  3LTB A;  1AVK A;  1IVX A;  1NO3 A;  4FCJ A;  3ZFZ A;  3IJE B;  4EW5 A;  2CWV A;  1BIR A;  1O7H B;  3A76 A;  3WDG B;  2RSX A;  2BMO B;  1BU4 A;  3DGL A;  3PCS A;  5KP1 A;  2CWT A;  3D79 A;  1VQP 3;  1AY7 A;  1BAN A;  1GMQ A;  3BU4 A;  3GZR A;  3MYT A;  5HGR A;  1HYF A;  1JZD A;  4OVM A;  3BND A;  2Y74 A;  3PXM A;  1O7G B;  1DE3 A;  1LVN A;  1LRA A;  1GD4 A;  2W6J H;  2I9W A;  3GWR A;  1FUS A;  5JBS A;  1DMQ A;  1UUV B;  1NWW A;  4WYK B;  5LC7 A;  1K73 4;  2UX0 A;  4IT7 A;  4NHF A;  3ECF A;  1BNI A;  1UCL A;  1IV7 A;  4H3U A;  1B2U A;  3GZY B;  5CLK A;  3WA2 X;  3E99 A;  1JKG B;  1MWU A;  3QK9 A;  3MG3 A;  3JUQ A;  2H0I A;  1F8N A;  2XFT A;  4GB5 A;  1CYU A;  3CC2 3;  8RNT A;  3G71 3;  5IEN A;  4XBY A;  3B4O A;  4BL3 A;  5D82 A;  1M1X B;  3FG3 A;  3HZP A;  3SXX A;  1CEW I;  2W9P A;  2L1S A;  1IQ8 A;  4OUQ A;  3RGA A;  3L0R A;  3G6E 3;  3DH2 A;  1GY5 A;  3NV0 A;  3UB1 A;  1M9G A;  4N6O B;  3QRD A;  1YVB I;  3X40 A;  4O8S A;  4R1K A;  2LYX A;  1VZZ A;  3S28 A;  3O8Y A;  2E2U A;  3CCJ 3;  4FR9 A;  2UUG C;  3BB9 A;  5AYR B;  3PGB A;  4H61 A;  1EEJ A;  1N8Q A;  1W5Z A;  1VQL 3;  1FGR A;  1O7N B;  3G16 A;  2W9Q A;  4HM5 B;  2RFR A;  2CW9 A;  1BNS A;  1HKX A;  2WOF A;  2CKF B;  4L8O A;  3NHX A;  4LSO A;  2CX1 A;  1RGG A;  3DUK A;  1BOX A;  3B4P A;  2L4V A;  2CIU A;  3MHE A;  1B2X A;  1RJO A;  5AEU B;  3LZA A;  1BNJ A;  3FSD A;  2IUJ A;  2XR8 B;  5DRE A;  2C4B A;  4KFE A; 
#chains in the Genus database with same CATH homology
 4EC6 A;  2FXT A;  3T8N A;  2HMN B;  1UUW B;  1JB4 A;  3HIG A;  1WNH A;  2Z76 A;  4LGQ A;  1EA2 A;  2O9U X;  3FF2 A;  4XM4 A;  5CXO A;  3CXC 2;  2ZDJ A;  1A90 A;  4KZ1 A;  5IF6 A;  3FH1 A;  3NX0 A;  4FMB A;  3IMA B;  4RNZ A;  5BXQ A;  1DVD A;  1N9E A;  1PU4 A;  3CNX A;  3CMA 3;  2Y73 A;  4XDV A;  5AIG A;  3G8Z A;  1CYV A;  1FGO A;  1QMA A;  2W0Q A;  4OK0 A;  1M90 4;  4NRE A;  2YFJ B;  3EHC A;  2OCT A;  4WP5 A;  2GEY A;  1GY7 A;  4BTX A;  2ZL8 A;  3LT9 A;  2RGQ A;  1UI7 A;  5JPP A;  1ASK A;  3ALA A;  3PCR A;  3B7C A;  3X3Y A;  1Q82 4;  1SQW A;  4KFD A;  4KFF A;  4N6L A;  3SX1 A;  2R4I A;  3CCM 3;  1C7H A;  1E3R A;  3IPT A;  4R80 A;  4HYZ A;  1FA3 A;  1ROV A;  2JDI H;  3NBR A;  1TUH A;  4HM2 B;  1GY6 A;  2OQE C;  3FG1 A;  1K41 A;  2KXG A;  5AYS C;  3SOY A;  1KD1 4;  4RZM A;  2RCD A;  1W2Z A;  3BNC A;  4WHA A;  3CC4 3;  1A67 A;  1OGZ A;  2CWU A;  1STD A;  1W6Y A;  3FCS B;  1D6Y A;  5IEO A;  1A2K A;  3EF8 A;  3FZW A;  1JN5 A;  1WMO A;  5AIH A;  4HM4 B;  5IER A;  1TFO A;  4K1U A;  2FNQ A;  1KWI A;  4MJD A;  4XB5 A;  5AII A;  5IG0 A;  1NU3 A;  1OHP A;  5CF2 A;  2CFL A;  1A2V A;  4MMY B;  3HI7 A;  3OXA A;  3S5C A;  4WYK A;  3U1W A;  2GXF A;  3KSE D;  3WOF B;  1Q86 4;  3LTD A;  3EQQ B;  1K9M 4;  5G2G A;  1G96 A;  3F7X A;  2XH9 A;  1O7M B;  1W7C A;  2STD A;  4MEI A;  1M1K 4;  2QIY A;  3MG1 A;  3T0U A;  4I4K A;  1GS3 A;  4HZB B;  1Q42 A;  1QAK A;  2KRT A;  2QGU A;  1KQS 2;  1IK3 A;  4HM7 B;  4WWU C;  4EXR A;  2V1L A;  3KSP A;  1JV2 B;  1WMN A;  3EJV A;  4EV5 A;  5IG5 A;  2Z7A A;  1IV9 A;  3JUP A;  1ZO2 A;  3I0Y A;  3UL5 A;  1YJN 3;  1ROA A;  3CC7 3;  2OOV A;  2BO9 B;  1N5P A;  4AEQ A;  3DZL A;  1JB5 A;  5AEW B;  2P05 A;  2B24 B;  1U8C B;  5JPU A;  3AMO A;  2P0X A;  1VQ5 3;  2CK3 H;  2CH9 A;  3DM8 A;  2B1X B;  1RKY A;  3OW2 2;  3F40 A;  4R4K A;  2WGQ A;  3NBB A;  3TDG A;  5LC6 A;  3PS8 A;  2F86 B;  2JQ5 A;  1DYU A;  1IVV A;  2OQE A;  1JN5 B;  4RNY A;  1RRL A;  4FMA A;  4LZI A;  1STF I;  1WQL B;  3F7S A;  4EYC A;  1R4C A;  4J8T A;  4N6V 0;  1W00 A;  1KC8 4;  1ULJ B;  3V98 A;  2CFK A;  1QJG A;  3CCV 3;  1SJW A;  2OOV C;  3Q1C A;  1ULI B;  3OWY A;  4FCZ A;  4HZ9 B;  1NB3 I;  2M7O A;  3EBY A;  2XFS A;  4XBT A;  1FGT A;  5CK6 A;  3BLZ A;  1L5G B;  1FGQ A;  2QA4 3;  2K0M A;  3DGN A;  1K28 A;  2BMR B;  1YIT 3;  2INX A;  3I55 3;  3KE7 A;  2K54 A;  2PNC A;  4IPB A;  1OHS A;  4Q53 A;  2Z77 A;  4K1V A;  2CHC A;  3GRD A;  4N6M A;  8CHO A;  1AR0 A;  3M8C A;  3LTC A;  2SBL A;  2QEX 3;  4HM0 B;  5TGN A;  1W4N A;  1YGE A;  3BNB A;  3F14 A;  3K5T A;  1W01 A;  4LMI A;  3S29 A;  2OTL 3;  4K61 A;  5KP4 A;  4O2H A;  1TFK A;  2CFD A;  3D9R A;  2CFW A;  3EB8 A;  3VF1 A;  3NXJ A;  2YFL B;  4L8P A;  4QWT A;  3EE1 A;  4HJL B;  3NQY A;  2GEX A;  1FUW A;  1OUN A;  3LH4 A;  4BTY A;  1JKG A;  2YX9 A;  1QAL A;  3OWS A;  4N6U A;  3EN8 A;  1QAF A;  4AKZ A;  1DMN A;  3LOY A;  1YIJ 3;  2HMM B;  3X42 A;  2HMO B;  4J9A A;  4X2O A;  4HM8 B;  1VQ6 3;  1OF5 B;  2GBW B;  2OTJ 3;  1IVU A;  4FMC A;  4CDL A;  1QVG 2;  4N6T A;  3Q2P A;  1RRH A;  1TU5 A;  1UI8 A;  2XGN A;  1TIJ A;  3V99 A;  5AIF A;  1OGX A;  1GD3 A;  1CQS A;  1Q40 A;  2A15 A;  4ORL A;  3F9S A;  3ROB A;  2MF7 A;  2GU1 A;  3SOA A;  5D83 A;  3SVA A;  5A0O B;  1D6Z A;  1Q81 4;  2XGL A;  2XEP A;  1JJ2 2;  3DGM A;  3NQZ A;  3FKA A;  1IQY A;  3KII A;  1FGM A;  4L7K A;  1YJW 3;  1HU9 A;  3CME 3;  1IDP A;  3G0K A;  5BVB A;  3S67 A;  1OH0 A;  1IVW A;  3GZX B;  4G1M B;  3CCU 3;  4HBR A;  3OX9 A;  1T5Y A;  7STD A;  5FGO A;  3UJM A;  3K0Z A;  1EQK A;  3I56 3;  2IMJ A;  2HML B;  2O3O A;  4HM1 B;  1AV4 A;  3N8B A;  1AVL A;  4RBN A;  3LML A;  1SIH A;  3VSY A;  3D3L A;  4WFO A;  1Q7Y 4;  2BT3 A;  5DRV A;  2ML6 A;  5IW9 A;  2HMJ B;  4TX4 A;  3HII A;  2P09 A;  3STD A;  1V74 A;  1U5O A;  4MMX B;  3N54 B;  1QVF 2;  5D81 A;  1Z1S A;  1IT8 A;  1OAC A;  3B8L A;  2BHM A;  1NJI 4;  1OCV A;  4N6N B;  2MC8 A;  3UNL A;  3GZB A;  1SPU A;  2ML5 A;  3X3Z A;  3WA3 A;  1K8A 4;  3KZT A;  1IT7 A;  1OF5 A;  2PZV A;  3EX9 A;  3MG2 A;  3U97 A;  1WMP A;  2W56 B;  3ER7 A;  1DMM A;  3S27 A;  1O7P B;  4HM3 B;  1US1 A;  1EKM A;  2Q07 A;  2WGO A;  2WOH A;  3DMC A;  3DXO A;  3GAX A;  3MWZ A;  2XF3 A;  1BUQ A;  3HK4 A;  4BTW A;  5IG3 A;  5IEP A;  4HVN A;  4XDW A;  3SED A;  1LXE A;  1TP6 A;  2W03 A;  3JUO A;  4LEH A;  1E3V A;  5AI1 A;  3G4S 3;  2CG1 A;  3H3H A;  3MKI A;  4R9L A;  2C11 A;  3VGN A;  5FW5 A;  4AKY A;  4U13 A;  3KFQ C;  5EQL A;  1ZX2 A;  5I97 A;  3UL6 A;  4STD A;  2E2V A;  4EV2 A;  6STD A;  1LOX A;  1NDO B;  2CG0 A;  1UW1 A;  2IA7 A;  2HMK B;  1VQ8 3;  3WMD A;  4JF8 A;  2CFG A;  5EEO A;  1N9J A;  1VQ4 3;  4ZM8 A;  1S72 3;  3F8H A;  3EBT A;  3CNM A;  1J2B A;  5STD A;  2OWP A;  1NB5 I;  2CC3 A;  3LXU X;  3N9H A;  1O7W B;  3F8X A;  4IIA A;  4X2H A;  3WOD G;  3DGO A;  1YI2 3;  3FLJ A;  3EC9 A;  2W04 A;  3WOE B;  1RN7 A;  2LQV A;  2XRX B;  3OV4 A;  1YHQ 3;  4CCV A;  4O02 B;  3JVC A;  3K9M C;  3Q90 A;  5KP3 A;  3CPO A;  3LT8 A;  4R9K A;  2P0M A;  1VQK 3;  3LYG A;  5EVH A;  1OPY A;  1WTH A;  1IU7 A;  4PEJ A;  3X3X A;  1N5H A;  3KN4 A;  3FF0 A;  5CF1 A;  4JRF A;  1IQX A;  3K63 A;  1VQM 3;  1OHO A;  1JRQ A;  3CD6 3;  2GU3 A;  3CCQ 3;  2WO0 A;  1W6C A;  1SII A;  3NM2 A;  2XSO B;  1GYB A;  2F98 A;  5IG4 A;  1Q40 B;  3CCS 3;  1JNQ A;  4N3V A;  3FG4 A;  1VQN 3;  1MNL A;  2XSH B;  1VQ7 3;  1EG9 B;  4K90 B;  2YFI B;  1D6U A;  3H51 A;  3K7C A;  2W2C A;  3X41 A;  1PFP A;  1W2B 2;  2D1W A;  2F99 A;  1DVC A;  2BNG A;  2P38 A;  1ISK A;  3PZW A;  2E2T A;  1N8R 4;  3CCE 3;  3MSO A;  3RGR A;  3OWU A;  4FCM A;  1MOL A;  3MPH A;  3NUV A;  2FGT A;  1VQO 3;  4KVH A;  4O3V A;  3KKG A;  3AMO B;  5ELU A;  3CPW 2;  1Y4K A;  3HX8 A;  4HM6 B;  3NBJ A;  4MMZ B;  2D42 A;  1YJ9 3;  1VQ9 3;  3J7Y d;  1KSI A;  4HKV B;  3PYJ A;  2IUK A;  1W6G A;  3DY5 A;  3NV0 B;  1S5A A;  3LTA A;  3CCL 3;  1LNH A;  3SLU A;  3CCR 3;  3JUM A;  4XBX A;  3FGY A;  2BMQ B;  3EN1 B;  2GBX B;  3V92 A;  3T8U A;  3CU3 A;  1JB2 A;  3RDE A;  3BNE A;  4GL6 A;  2KCD A;  3JUN A;  2Z6B A;  2C10 A;  5ELJ A;  1W02 A;  1E97 A;  4EBG A;  2W56 A;  4FMD A;  3LTB A;  1IVX A;  1AVK A;  1NO3 A;  4FCJ A;  3IJE B;  2CWV A;  3A76 A;  1O7H B;  3WDG B;  2RSX A;  2BMO B;  3DGL A;  5KP1 A;  3PCS A;  2CWT A;  1VQP 3;  3GZR A;  5HGR A;  3MYT A;  4OVM A;  3BND A;  2Y74 A;  3PXM A;  1O7G B;  1LVN A;  1GD4 A;  2W6J H;  2I9W A;  3GWR A;  5JBS A;  1DMQ A;  1UUV B;  1NWW A;  4WYK B;  5LC7 A;  1K73 4;  2UX0 A;  4IT7 A;  4NHF A;  3ECF A;  1IV7 A;  4H3U A;  3GZY B;  5CLK A;  3WA2 X;  3E99 A;  1JKG B;  3QK9 A;  3MG3 A;  3JUQ A;  2XFT A;  1F8N A;  4GB5 A;  1CYU A;  3CC2 3;  3G71 3;  5IEN A;  4XBY A;  3B4O A;  5D82 A;  1M1X B;  3FG3 A;  3HZP A;  3SXX A;  1CEW I;  2W9P A;  1IQ8 A;  4OUQ A;  3RGA A;  3L0R A;  3G6E 3;  1GY5 A;  3NV0 A;  3UB1 A;  1M9G A;  4N6O B;  3QRD A;  1YVB I;  3X40 A;  4O8S A;  4R1K A;  2LYX A;  1VZZ A;  3S28 A;  3O8Y A;  2E2U A;  3CCJ 3;  4FR9 A;  5AYR B;  3BB9 A;  3PGB A;  4H61 A;  1N8Q A;  1W5Z A;  1VQL 3;  1FGR A;  1O7N B;  3G16 A;  2W9Q A;  4HM5 B;  2RFR A;  2CW9 A;  1HKX A;  4L8O A;  2WOF A;  2CKF B;  3NHX A;  4LSO A;  3DUK A;  3B4P A;  2L4V A;  2CIU A;  3MHE A;  5AEU B;  1RJO A;  3LZA A;  2IUJ A;  3FSD A;  2XR8 B;  5DRE A;  3NM7 A;  4KFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...