4R9KA

Structure of thermostable eightfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
144
structure length
144
Chain Sequence
IEQPRWASKDPAAGKASTPDEKIVLEFMDALTSNDAAKLIKYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFKVMSIDAVEVFHIGSSKGLVFTERVDVLRALPTGKSYNLSILGVFQLTDGKITGWRDYFDLREFEEAVDLPLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
publication title X-ray crystallographic validation of structure predictions used in computational design for protein stabilization.
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 42
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r9kA00
3BB9A 3MSOA 4J9AA 3STDA 3OWSA 4PEJA 3B4OA 5CLKA 2Z7AA 5AIGA 4HKVB 2I9WA 2R4IA 3FF0A 4HM3B 4MJDA 3CNMA 1OCVA 2W2CA 1OGZA 4WYKB 5HGRA 3KE7A 3ECFA 5AIIA 3CPOA 3ROBA 3GZBA 5JPPA 4HVNA 1JB2A 1OF5B 4WP5A 3S5CA 4HM5B 3D9RA 3DZLA 3EBYA 4HM6B 1E3VA 3DM8A 2STDA 1Q42A 4X2HA 3F9SA 5AIFA 4WWUC 4R9KA 2BMOB 1OF5A 4LGQA 1S5AA 3G8ZA 4L8PA 1QJGA 4IIAA 1OUNA 5IG3A 4FCJA 3NUVA 4H3UA 3FKAA 3OWYA 3T8UA 2IMJA 3MYTA 5IEPA 1OHPA 1JB5A 3HK4A 3JUOA 5DREA 1U5OA 4L7KA 2QIYA 3EN8A 5FW5A 3GWRA 4Q53A 2RGQA 3F8XA 1JN5A 1UUWB 4R1KA 4HM0B 1Q40A 3DUKA 5KP3A 1DMNA 3KZTA 1A2KA 3M8CA 3EC9A 1OGXA 3JUPA 1NWWA 3K7CA 8CHOA 4K1VA 4STDA 4XDVA 1JB4A 3NXJA 2HMKB 3BLZA 3MKIA 3F7XA 2BMQB 2XRXB 1ASKA 3IPTA 2F86B 2CHCA 3FLJA 3OV4A 5IERA 1EA2A 4J8TA 1C7HA 4L8OA 1ULJB 1JKGB 5CF1A 2A15A 4XM4A 3VGNA 1TP6A 1CQSA 3RGRA 3JUMA 5D83A 5TGNA 3MHEA 3JUQA 1Z1SA 1HKXA 1GY6A 2B1XB 4CDLA 2BNGA 1OPYA 5CF2A 3EJVA 3H3HA 1TUHA 1OHSA 4N3VA 3T8NA 3GRDA 1JKGA 3F40A 3LZAA 1AR0A 4HM2B 5EVHA 5AEWB 3SEDA 3Q90A 3FZWA 1GY7A 4XBXA 3MG1A 5CK6A 3DXOA 1E3RA 1OHOA 2F98A 1JN5B 4R9LA 4GB5A 4RZMA 1O7MB 1Q40B 2OWPA 4HM1B 1VZZA 4HJLB 5AIHA 3MG2A 4XBYA 4U13A 5D82A 5IG0A 5IG5A 1STDA 5G2GA 3NV0B 3FSDA 3MG3A 4HM7B 1W02A 3EBTA 3FH1A 2HMMB 1W01A 4I4KA 1W6YA 1NDOB 1O7WB 3GZXB 3B7CA 5KP4A 5KP1A 2CKFB 3G0KA 3CNXA 7STDA 5IF6A 2RFRA 3NV0A 1K41A 1UUVB 3F7SA 3EQQB 1ISKA 3GZYB 4XDWA 1GYBA 3HZPA 1OH0A 2PZVA 2YFLB 5DRVA 2RCDA 4OUQA 3H51A 1BUQA 5D81A 2HMJB 1W00A 4XBTA 1O7HB 3KKGA 3GZRA 3F8HA 1NU3A 1ULIB 3OXAA 3RGAA 4HZ9B 1ZX2A 2HMLB 4X2OA 4HZBB 3OWUA 2F99A 1IDPA 3CU3A 3FGYA 2XSHB 4HM4B 3OX9A 3DMCA 1SJWA 3SOYA 3UNLA 4XB5A 5AEUB 3ER7A 3NM2A 5IENA 4LMIA 2GEXA 3EX9A 2GBXB 3I0YA 6STDA 2XR8B 2YFJB 3G16A 2GBWB 3HX8A 3UJMA 5BVBA 1O7NB 4WYKA 1QMAA 3K0ZA 1GS3A 4ORLA 2HMOB 2K54A 1GY5A 3F14A 2JQ5A 3KSPA 3NHXA 2YFIB 4HM8B 2XSOB 3A76A 1ZO2A 3B4PA 3WMDA 3EF8A 1DMMA 4K1UA 4FCMA 5IG4A 3NBRA 2Z77A 2GEYA 3EN1B 3LYGA 3EHCA 3E99A 2HMNB 5STDA 5BXQA 1EG9B 5AI1A 5IEOA 5JPUA 5CXOA 2Z76A 2UX0A 2B24B 2BMRB 3FF2A 1DMQA 2GXFA 4LEHA 4KVHA 1WQLB 1O7PB 2QGUA 1E97A 3B8LA 3JUNA 3SOAA 3VSYA 4OVMA 2INXA 1O7GB
chains in the Genus database with same CATH superfamily
1BNSA 1MWTA 1V74A 1UCJA 2CFLA 3CC73 2F4YA 1I0VA 3BB9A 5AYRB 1D6YA 5I97A 1JBRA 3MSOA 2W56B 1BSBA 1LOYA 1N5PA 1IVUA 4J9AA 3STDA 1T3BA 1BNFA 1B21A 3S67A 3OWSA 1G02A 1LOWA 4RNYA 2O3OA 1M1K4 1RN1A 1UUGB 1SPUA 4PEJA 1BNIA 2Y74A 3B4OA 1EEJA 5CLKA 2Z7AA 1STFI 4FMBA 5AIGA 3SLUA 2KF5A 4HKVB 1W6CA 1I70A 1Q864 1VQN3 2I9WA 2R4IA 3FF0A 4HM3B 4MJDA 3CNMA 1TIJA 1OCVA 2ZL8A 2W2CA 4AKZA 1RGEA 4TX4A 3LH4A 1LQMB 1BOXA 3D4AA 1GMQA 3S27A 1VQM3 3UL5A 1SARA 1OGZA 4WYKB 4K90B 3JVCA 3DGNA 5HGRA 3S28A 3NM7A 3KE7A 3QK9A 1TU5A 2W56A 3ECFA 5AIIA 3CPOA 3ROBA 3GZBA 5JPPA 2H0HA 4HVNA 1MNLA 1JB2A 1OF5B 4BTYA 4WP5A 3S5CA 1GSPA 4HM5B 3CCL3 3BNDA 3VF1A 1KSIA 1KWIA 1RCKA 3D3LA 3D9RA 3DZLA 3V99A 3CCQ3 3EBYA 4BTXA 3PYJA 1BIRA 2RSXA 4HM6B 1E3VA 4IT7A 3LTDA 4JF8A 3DM8A 1T5YA 1BNJA 2STDA 4R4KA 2CWUA 1VQP3 1Q42A 2KRTA 4LYLB 4X2HA 1B27A 4BL3A 4WHAA 1QALA 3F9SA 5AIFA 1LOXA 4N6LA 1US1A 2CWVA 2SARA 1BSEA 1X1UA 2F5MA 4WWUC 5G1KA 4R9KA 1RMSA 3PXMA 5GSPA 2BMOB 1YNVX 1OF5A 1LRAA 4LGQA 4EYCA 1S5AA 3HIIA 3CCM3 1W5ZA 3RNTA 3G8ZA 2LYXA 1RJOA 4L8PA 2OTL3 1JBSA 1I2EA 1QJGA 1B2UA 2ML6A 3PZWA 4IIAA 4NHFA 1A2VA 1OUNA 5IG3A 3CCU3 2J8XB 3L0RA 2BIRA 3OW22 1Y4KA 1KC84 2BO9B 4FCJA 3NUVA 1VQL3 4H3UA 4EW5A 3FKAA 2YX9A 3OWYA 2GSPA 1GMRA 3T8UA 1EUIC 3PCSA 2IMJA 2CX0A 2ZHXB 2WGQA 3G6E3 2KCDA 3D5IA 3X40A 1UGIA 4EV5A 3LTCA 3MYTA 3DY5A 1B2XA 1CYUA 1GOVA 3UL6A 5IEPA 1OHPA 3BNCA 2XGLA 1JB5A 3HK4A 3JUOA 5G1LA 2OQEC 5DREA 4NPBA 5EEOA 1NB3I 1U5OA 2W9QA 3X3ZA 2QIYA 2AADA 4L7KA 3CCR3 3EN8A 1WTHA 3ALAA 1SIIA 2Q07A 4MEIA 5FW5A 3GWRA 4Q53A 1YVSA 2SBLA 2RGQA 1BSDA 1U8CB 1Q7HA 1Q9EA 2W04A 2XEPA 3F8XA 1CH0A 1JN5A 1GD3A 1LXEA 1UDII 1JV2B 1UUWB 4R1KA 4HM0B 1I2GA 1Q40A 2RNTA 3DUKA 1HU9A 3EB8A 5KP3A 2OQEA 3G4S3 1DMNA 2QA43 3KZTA 1A2KA 1YVBI 3M8CA 5ELJA 3QRDA 3EC9A 2CG1A 3I553 1OGXA 2OCTA 3JUPA 1C54A 4OK0A 1NWWA 3BNBA 1AVLA 3I563 3K7CA 3EE1A 3ZG0A 1RGCA 4K61A 3N8BA 1V58A 2AAEA 2BU4A 8CHOA 2Z6BA 1RNTA 4N6V0 2KXGA 4K1VA 4STDA 2Y73A 4XDVA 3LOYA 3NBBA 3V92A 1LQGC 1YGEA 1IQYA 4FCZA 1JB4A 3NXJA 1B2MA 2HMKB 3DGOA 1FZUA 3BLZA 3MKIA 3F7XA 2C10A 1HYFA 4N6OB 2BMQB 2IY2A 2XRXB 1ASKA 1VQ53 2CW9A 3IPTA 1SIHA 2F86B 2CHCA 1JNQA 3FLJA 3OV4A 1N9JA 2KAAA 2E2VA 5IERA 1RGAA 2W6JH 3SX1A 1EA2A 4J8TA 2CX1A 1UW1A 1C7HA 5M18A 1VQ83 1IT7A 2L4VA 2XF3A 4L8OA 2QEX3 1ROVA 5AYSC 2CFDA 2L1SA 3WODG 3LT8A 2CC3A 4RNTA 3S29A 7RNTA 1ULJB 1BU4A 1IQ8A 2WO0A 2XH9A 1VQO3 1BVIA 2H0GA 3LTBA 3CMA3 3IJEB 1JKGB 3X3YA 1FW7A 4HAAA 1UI7A 3U1WA 1K9M4 4O8SA 2A15A 5CF1A 1K734 2CWTA 3GSPA 4XM4A 1TFKA 1QAFA 1CYVA 3VGNA 1TP6A 1I0XA 1RLSA 1V57A 4AKYA 3CXC2 1I3IA 4JRFA 1CQSA 2E2UA 3RGRA 1BANA 4BU4A 2F5WA 4GSPA 1DYUA 1RGLA 3JUMA 5D83A 2D42A 3FG4A 3HIGA 1IT8A 1UCIA 1WMOA 1BSCA 3N54B 6RNTA 5TGNA 3MHEA 1K28A 1B20A 1MWRA 3JUQA 1Z1SA 2R41A 1HKXA 1GY6A 2XFTA 2B1XB 4CDLA 1RDSA 2BNGA 1OPYA 5CF2A 2GU3A 4LZIA 1YIT3 3EJVA 1IV7A 3H3HA 5RNTA 1TUHA 1OHSA 1RGFA 1TJDA 4N3VA 3T8NA 2OTJ3 3RDEA 1GOUA 1JKGA 1IU7A 1HZ1A 2KF4A 3GRDA 3K63A 3KCHA 1FUSA 3Q2PA 3WA3A 1RN4A 3WA2X 3PGBA 1J2BA 4G1MB 4KFDA 3F40A 3LZAA 4BL2A 6GSPA 4KFFA 1JJ22 1AVKA 3GAXA 1AR0A 1WMPA 2IA7A 4HM2B 3HOHA 9RNTA 5EVHA 1F8NA 2FGTA 1Q814 5AEWB 3SEDA 1DETA 1ZGXA 3NX0A 3PS8A 2UUGC 3Q90A 1YI23 1RHLA 2F56A 4FMAA 1UGHI 4N6TA 1L5GB 1DVDA 3FZWA 3X41A 1B2ZA 2W9PA 3LXUX 1BGSA 4QWTA 1GY7A 4EBGA 1SQWA 1JRQA 3FCSB 4XBXA 3MG1A 1D6UA 3KN4A 4H61A 4NREA 5CK6A 3DXOA 1YGWA 2P38A 1E3RA 2JDIH 4MMZB 2CH9A 4MMYB 1OHOA 4AEQA 2F98A 1JN5B 1VQK3 2O9UX 4R9LA 1AV4A 4GB5A 1M1XB 3AMOA 4RZMA 1O7MB 1Q40B 2OWPA 4HM1B 1VZZA 4HJLB 5AIHA 4EV2A 1NJI4 2P09A 3HI7A 1FUWA 1LVNA 3MG2A 2MC8A 4XBYA 1BAOA 1IVXA 4FMDA 4U13A 5D82A 5IG0A 5HOHA 1IK3A 2E2TA 3AHWA 3SVAA 1KQS2 2WOHA 4GL6A 5IG5A 1STDA 3CPW2 3Q3FA 4BTWA 1RGHA 3CME3 4N6UA 1BUJA 4KFEA 5G2GA 1BRIA 1I8VA 1ROAA 3NV0B 1LNIA 2RBIA 4EXRA 1RSNA 3FSDA 1FA3A 3MG3A 4HM7B 1W02A 3EBTA 3FH1A 2IUJA 2PNCA 1M9GA 1IV9A 1X1XA 2HMMB 3CCS3 1W01A 4N6NB 4I4KA 1YIJ3 1BSAA 1W6YA 1NDOB 3D79A 1FYSA 3U97A 1O7WB 3MPHA 1BRNL 3GZXB 4RNZA 1LNHA 1W2B2 3B7CA 1MGWA 5KP4A 5KP1A 1KD14 2CKFB 1MWUA 3DGMA 3CNXA 3G0KA 2HOHA 4O02B 5FGOA 7STDA 2OOVC 1BNEA 3BU4A 1RN7A 1X1WA 3SXXA 1YHQ3 4ILFA 3IMAB 5IF6A 2RFRA 3NV0A 1A2PA 2P0MA 1K41A 1UUVB 1FGOA 3O8YA 3F7SA 1BRHA 1JZOA 3EQQB 2P0XA 3KFQC 1RKYA 1UCKA 1ISKA 1WNHA 1R4YA 3GZYB 1I2FA 3WHOA 1BNGA 5LC6A 4XDWA 3CCE3 1BRSA 1FGMA 5BIRA 1GYBA 3LMLA 3HZPA 1GD4A 4HYZA 1OH0A 2M7OA 2PZVA 2YFLB 3WDGB 1PFPA 3FG1A 2FXTA 3NQZA 1N9EA 2OOVA 1G0TA 3WOFB 1T2IA 2KF3A 2GU1A 1VQ63 5DRVA 4MMXB 2RCDA 4OUQA 1IVWA 1R4CA 2D1WA 3H51A 3SYUA 1RGGA 4KZ1A 1BUQA 5D81A 2UGIA 2XGNA 2ZDJA 1QVG2 2HMJB 1GMPA 1W00A 4XBTA 3K9MC 1O7HB 5M1AA 1IVVA 3KKGA 1Q824 3GZRA 2LQVA 3WOEB 3F8HA 1NU3A 1ULIB 1TFOA 3OXAA 1RTUA 3RGAA 4N6MA 4HZ9B 5ELUA 1NNVA 1N8R4 5A0OB 3UB1A 1ZX2A 2H0IA 2HMLB 3DGLA 1N5HA 3ZFZA 1S723 2P05A 2BHMA 4X2OA 1FGRA 4HZBB 3LTAA 2KF6A 3OWUA 1FGQA 3DGYA 2F99A 2CG0A 1OACA 1BRJA 1TRPA 5LC7A 1IDPA 3CU3A 3FGYA 2FNQA 2XSHB 4CJNA 5IW9A 1BNRA 1JBTA 4HM4B 1VQ93 3NBJA 3OX9A 1YJW3 3DMCA 1SJWA 3SOYA 3UNLA 2W03A 4O3VA 4XB5A 1PYLA 5AEUB 4J5GA 1VQ73 1W6GA 3ER7A 3AMOB 1I3FA 1TTOA 8RNTA 3NM2A 1UI8A 4LMIA 2GEXA 5IENA 3CC23 3EX9A 3NQYA 1EKMA 2GBXB 2C4BA 1LOVA 3DH2A 4CPKA 3I0YA 1PU4A 6STDA 3FG3A 1MOLA 2XR8B 2YFJB 3G16A 2GBWB 1D6ZA 1W4NA 2WOFA 3HX8A 4DKIA 1AQZA 1W2ZA 3KIIA 3PCRA 3UJMA 5BVBA 1O7NB 3Q1CA 1IQXA 3T0UA 3G713 4WYKA 4CCVA 1A90A 1RRHA 1QMAA 1JZDA 3K0ZA 4EC6A 1QVF2 3AGOA 1GS3A 2HMOB 2K54A 1GY5A 3BIRA 4ORLA 3A5EA 3F14A 1ZS7A 2JQ5A 3AGNA 1NO3A 3KSPA 4FR9A 3NHXA 4GHOA 1TRQA 2YFIB 4HM8B 2CFKA 2XSOB 3A76A 1ZO2A 3B4PA 4HOHA 4LSOA 1FUTA 3WMDA 3EF8A 3D5GA 5BU4A 1W7CA 1DMMA 5M19A 4K1UA 4FCMA 4J5KA 2MF7A 1GOYA 5IG4A 3NBRA 3KSED 2W0QA 1VQ43 3N9HA 1RCLA 2Z77A 2IUKA 2GEYA 5EQLA 3TDGA 1MWSA 3CCJ3 1B2SA 3BNEA 3EN1B 1PY3A 3K5TA 1N8QA 3V98A 7GSPA 3URPA 3LYGA 1DE3A 2ML5A 4WFOA 2BT3A 2CK3H 3X42A 1M904 3EHCA 3E99A 1DVCA 2HMNB 5STDA 3AHSA 1QAKA 5BXQA 1EG9B 2ZA4A 2CFWA 5AI1A 5IEOA 5JPUA 3CCV3 1NB5I 5CXOA 1RRLA 2Z76A 2UX0A 4FMCA 2B24B 2BMRB 3J7Yd 1YJN3 3FF2A 4ZM8A 3LT9A 1DMQA 1X1YA 2GXFA 2IYJA 4LEHA 5JBSA 1MGRA 1G96A 4KVHA 1A67A 2K0MA 4HBRA 4R80A 1T2HA 1WQLB 1O7PB 2CIUA 1CEWI 1BRKA 2WGOA 2QGUA 1YJ93 1AY7A 1E97A 2K3DA 3B8LA 1WMNA 4RBNA 4IPBA 1VQQA 3JUNA 4O2HA 3SOAA 3VSYA 1RGKA 4I5QA 2V1LA 3MWZA 1BRGA 3CC43 1UCLA 1RNBA 1K8A4 3CD63 3WR2A 1FGTA 4OVMA 1Q7Y4 1EQKA 2CFGA 3ZG5A 2INXA 3X3XA 4BIRA 1O7GB 1IYYA 1B3SA 2C11A 4KT3B 2XFSA
chains in the Genus database with same CATH topology
1V74A 2CFLA 3CC73 3BB9A 5AYRB 1D6YA 5I97A 3MSOA 2W56B 1N5PA 4J9AA 1IVUA 3STDA 3S67A 3OWSA 4RNYA 2O3OA 1M1K4 1SPUA 4PEJA 2Y74A 3B4OA 5CLKA 2Z7AA 1STFI 4FMBA 5AIGA 3SLUA 4HKVB 1W6CA 1Q864 1VQN3 2I9WA 2R4IA 3FF0A 4HM3B 4MJDA 3CNMA 1TIJA 1OCVA 2ZL8A 2W2CA 4AKZA 4TX4A 3LH4A 3S27A 1VQM3 3UL5A 1OGZA 4WYKB 4K90B 3JVCA 3DGNA 5HGRA 3S28A 3NM7A 3KE7A 3QK9A 1TU5A 2W56A 3ECFA 5AIIA 3CPOA 3ROBA 3GZBA 5JPPA 4HVNA 1MNLA 1JB2A 1OF5B 4BTYA 4WP5A 3S5CA 4HM5B 3CCL3 3BNDA 3VF1A 1KSIA 1KWIA 3D3LA 3D9RA 3DZLA 3V99A 3CCQ3 3EBYA 4BTXA 3PYJA 2RSXA 4HM6B 1E3VA 4IT7A 3LTDA 4JF8A 3DM8A 1T5YA 2STDA 4R4KA 2CWUA 1VQP3 1Q42A 2KRTA 4X2HA 4WHAA 1QALA 3F9SA 5AIFA 1LOXA 4N6LA 1US1A 2CWVA 4WWUC 4R9KA 3PXMA 2BMOB 1OF5A 4LGQA 4EYCA 1S5AA 3HIIA 3CCM3 1W5ZA 3G8ZA 2LYXA 1RJOA 4L8PA 2OTL3 1QJGA 2ML6A 3PZWA 4IIAA 4NHFA 1A2VA 1OUNA 5IG3A 3CCU3 3L0RA 3OW22 1KC84 1Y4KA 2BO9B 4FCJA 3NUVA 1VQL3 4H3UA 3FKAA 2YX9A 3OWYA 3T8UA 3PCSA 2IMJA 2WGQA 3G6E3 2KCDA 3X40A 4EV5A 3LTCA 3MYTA 3DY5A 1CYUA 3UL6A 5IEPA 1OHPA 3BNCA 2XGLA 1JB5A 3HK4A 3JUOA 2OQEC 5DREA 5EEOA 1NB3I 1U5OA 2W9QA 3X3ZA 2QIYA 4L7KA 3CCR3 3EN8A 1WTHA 3ALAA 1SIIA 2Q07A 4MEIA 5FW5A 3GWRA 4Q53A 2SBLA 2RGQA 1U8CB 2XEPA 2W04A 3F8XA 1JN5A 1GD3A 1LXEA 1UUWB 1JV2B 4R1KA 5LC7A 4HM0B 1Q40A 3DUKA 3EB8A 5KP3A 1HU9A 2OQEA 3G4S3 1DMNA 2QA43 3KZTA 1A2KA 1YVBI 3M8CA 5ELJA 3QRDA 3EC9A 2CG1A 3I553 1OGXA 2OCTA 3JUPA 4OK0A 1NWWA 3BNBA 1AVLA 3I563 3K7CA 3EE1A 4K61A 3N8BA 8CHOA 2Z6BA 4N6V0 2KXGA 4K1VA 4STDA 2Y73A 4XDVA 3LOYA 3NBBA 3V92A 4FCZA 1YGEA 1IQYA 1JB4A 3NXJA 2HMKB 3DGOA 3BLZA 3MKIA 3F7XA 2C10A 4N6OB 2BMQB 2XRXB 1ASKA 1VQ53 2CW9A 3IPTA 1SIHA 2F86B 2CHCA 1JNQA 3FLJA 3OV4A 1N9JA 5IERA 2E2VA 2W6JH 3SX1A 1EA2A 4J8TA 1VQ83 1UW1A 1C7HA 1IT7A 2L4VA 2XF3A 4L8OA 2QEX3 1ROVA 5AYSC 2CFDA 3WODG 3LT8A 2CC3A 3S29A 1ULJB 1IQ8A 2WO0A 2XH9A 1VQO3 3LTBA 3CMA3 3IJEB 1JKGB 3X3YA 1UI7A 3U1WA 1K9M4 4O8SA 2A15A 5CF1A 1K734 2CWTA 4XM4A 1TFKA 1QAFA 1CYVA 3VGNA 1TP6A 4AKYA 3CXC2 4JRFA 1CQSA 2E2UA 3RGRA 1DYUA 3JUMA 5D83A 2D42A 3FG4A 3HIGA 1IT8A 1WMOA 3N54B 5TGNA 3MHEA 1K28A 3JUQA 1Z1SA 1HKXA 1GY6A 2XFTA 2B1XB 4CDLA 2BNGA 1OPYA 5CF2A 2GU3A 4LZIA 1YIT3 3EJVA 1IV7A 3H3HA 1TUHA 1OHSA 2OTJ3 4N3VA 3T8NA 3RDEA 3GRDA 1JKGA 1IU7A 3K63A 3Q2PA 3WA3A 1J2BA 3WA2X 3PGBA 4G1MB 4KFDA 3F40A 3LZAA 4KFFA 1JJ22 1AVKA 3GAXA 1AR0A 1WMPA 2IA7A 4HM2B 5EVHA 1F8NA 2FGTA 1Q814 5AEWB 3SEDA 3NX0A 3PS8A 3Q90A 1YI23 4FMAA 4N6TA 1L5GB 1DVDA 3FZWA 3X41A 2W9PA 3LXUX 4QWTA 1GY7A 4EBGA 1SQWA 1JRQA 3FCSB 4XBXA 3MG1A 1D6UA 3KN4A 4H61A 4NREA 5CK6A 3DXOA 2P38A 4MMYB 1E3RA 2JDIH 4MMZB 2CH9A 4AEQA 1OHOA 2F98A 1JN5B 1VQK3 2O9UX 4R9LA 1AV4A 4GB5A 1M1XB 3AMOA 4RZMA 1O7MB 1Q40B 2OWPA 4HM1B 1VZZA 4HJLB 5AIHA 4EV2A 1NJI4 2P09A 3HI7A 1FUWA 1LVNA 3MG2A 2MC8A 4XBYA 1IVXA 4FMDA 4U13A 5D82A 5IG0A 1IK3A 2E2TA 3SVAA 1KQS2 2WOHA 4GL6A 5IG5A 1STDA 3CPW2 4BTWA 3CME3 4N6UA 4KFEA 5G2GA 1ROAA 3NV0B 4EXRA 3FSDA 1FA3A 3MG3A 4HM7B 1W02A 3EBTA 3FH1A 2IUJA 2PNCA 1M9GA 1IV9A 2HMMB 3CCS3 1W01A 4N6NB 4I4KA 1YIJ3 1W6YA 1NDOB 3U97A 1O7WB 3MPHA 3GZXB 4RNZA 1LNHA 1W2B2 3B7CA 5KP4A 5KP1A 1KD14 2CKFB 3DGMA 3CNXA 3G0KA 4O02B 5FGOA 7STDA 2OOVC 1YHQ3 1RN7A 3SXXA 3IMAB 5IF6A 2RFRA 3NV0A 2P0MA 1K41A 1UUVB 1FGOA 3O8YA 3F7SA 3EQQB 2P0XA 3KFQC 1RKYA 1ISKA 1WNHA 3GZYB 5LC6A 4XDWA 3CCE3 1FGMA 1GYBA 3LMLA 3HZPA 1GD4A 4HYZA 1OH0A 2M7OA 2PZVA 2YFLB 3WDGB 1PFPA 3FG1A 2FXTA 3NQZA 1N9EA 2OOVA 3WOFB 2GU1A 1VQ63 5DRVA 4MMXB 2RCDA 4OUQA 1IVWA 1R4CA 2D1WA 3H51A 4KZ1A 1BUQA 5D81A 2XGNA 1QVG2 2ZDJA 2HMJB 1W00A 4XBTA 3K9MC 1O7HB 1IVVA 3KKGA 1Q824 3GZRA 2LQVA 3WOEB 3F8HA 1NU3A 1ULIB 1TFOA 3OXAA 3RGAA 4N6MA 4HZ9B 5ELUA 1N8R4 5A0OB 3UB1A 1ZX2A 2HMLB 3DGLA 1N5HA 1S723 2P05A 2BHMA 4X2OA 1FGRA 4HZBB 3LTAA 3OWUA 1FGQA 2F99A 2CG0A 1OACA 1IDPA 3CU3A 3FGYA 2FNQA 2XSHB 5IW9A 4HM4B 1VQ93 3NBJA 3OX9A 1YJW3 3DMCA 1SJWA 3SOYA 3UNLA 2W03A 4O3VA 4XB5A 5AEUB 1VQ73 1W6GA 3ER7A 3AMOB 3NM2A 1UI8A 4LMIA 2GEXA 5IENA 3CC23 3EX9A 3NQYA 1EKMA 2GBXB 3I0YA 1PU4A 6STDA 3FG3A 1MOLA 2XR8B 2YFJB 3G16A 2GBWB 1D6ZA 1W4NA 2WOFA 3HX8A 1W2ZA 3KIIA 3PCRA 3UJMA 5BVBA 1O7NB 3Q1CA 1IQXA 3T0UA 3G713 4WYKA 4CCVA 1A90A 1RRHA 1QMAA 3K0ZA 4EC6A 1QVF2 1GS3A 2HMOB 2K54A 1GY5A 4ORLA 3F14A 2JQ5A 1NO3A 3KSPA 4FR9A 3NHXA 2YFIB 4HM8B 2CFKA 2XSOB 3A76A 1ZO2A 3B4PA 4LSOA 3WMDA 3EF8A 1W7CA 1DMMA 4K1UA 4FCMA 2MF7A 5IG4A 3NBRA 3KSED 2W0QA 1VQ43 3N9HA 2Z77A 2IUKA 2GEYA 5EQLA 3TDGA 3CCJ3 3BNEA 3EN1B 3K5TA 1N8QA 3V98A 3LYGA 2ML5A 4WFOA 2BT3A 2CK3H 3X42A 1M904 3EHCA 3E99A 1DVCA 2HMNB 5STDA 5BXQA 1QAKA 1EG9B 2CFWA 5AI1A 5IEOA 5JPUA 3CCV3 1NB5I 5CXOA 1RRLA 2Z76A 2UX0A 4FMCA 2B24B 2BMRB 3J7Yd 1YJN3 3FF2A 4ZM8A 3LT9A 1DMQA 2GXFA 4LEHA 5JBSA 1G96A 4KVHA 1A67A 2K0MA 4HBRA 4R80A 1WQLB 1O7PB 2CIUA 1CEWI 2WGOA 2QGUA 1YJ93 1E97A 3B8LA 1WMNA 4RBNA 4IPBA 3JUNA 4O2HA 3SOAA 3VSYA 2V1LA 3MWZA 3CC43 1K8A4 3CD63 1FGTA 4OVMA 1Q7Y4 1EQKA 2CFGA 2INXA 3X3XA 1O7GB 2C11A 2XFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BB9 A;  3MSO A;  4J9A A;  3STD A;  3OWS A;  4PEJ A;  3B4O A;  5CLK A;  2Z7A A;  5AIG A;  4HKV B;  2I9W A;  2R4I A;  3FF0 A;  4HM3 B;  4MJD A;  3CNM A;  1OCV A;  2W2C A;  1OGZ A;  4WYK B;  5HGR A;  3KE7 A;  3ECF A;  5AII A;  3CPO A;  3ROB A;  3GZB A;  5JPP A;  4HVN A;  1JB2 A;  1OF5 B;  4WP5 A;  3S5C A;  4HM5 B;  3D9R A;  3DZL A;  3EBY A;  4HM6 B;  1E3V A;  3DM8 A;  2STD A;  1Q42 A;  4X2H A;  3F9S A;  5AIF A;  4WWU C;  4R9K A;  2BMO B;  1OF5 A;  4LGQ A;  1S5A A;  3G8Z A;  4L8P A;  1QJG A;  4IIA A;  1OUN A;  5IG3 A;  4FCJ A;  3NUV A;  4H3U A;  3FKA A;  3OWY A;  3T8U A;  2IMJ A;  3MYT A;  5IEP A;  1OHP A;  1JB5 A;  3HK4 A;  3JUO A;  5DRE A;  1U5O A;  4L7K A;  2QIY A;  3EN8 A;  5FW5 A;  3GWR A;  4Q53 A;  2RGQ A;  3F8X A;  1JN5 A;  1UUW B;  4R1K A;  4HM0 B;  1Q40 A;  3DUK A;  5KP3 A;  1DMN A;  3KZT A;  1A2K A;  3M8C A;  3EC9 A;  1OGX A;  3JUP A;  1NWW A;  3K7C A;  8CHO A;  4K1V A;  4STD A;  4XDV A;  1JB4 A;  3NXJ A;  2HMK B;  3BLZ A;  3MKI A;  3F7X A;  2BMQ B;  2XRX B;  1ASK A;  3IPT A;  2F86 B;  2CHC A;  3FLJ A;  3OV4 A;  5IER A;  1EA2 A;  4J8T A;  1C7H A;  4L8O A;  1ULJ B;  1JKG B;  5CF1 A;  2A15 A;  4XM4 A;  3VGN A;  1TP6 A;  1CQS A;  3RGR A;  3JUM A;  5D83 A;  5TGN A;  3MHE A;  3JUQ A;  1Z1S A;  1HKX A;  1GY6 A;  2B1X B;  4CDL A;  2BNG A;  1OPY A;  5CF2 A;  3EJV A;  3H3H A;  1TUH A;  1OHS A;  4N3V A;  3T8N A;  3GRD A;  1JKG A;  3F40 A;  3LZA A;  1AR0 A;  4HM2 B;  5EVH A;  5AEW B;  3SED A;  3Q90 A;  3FZW A;  1GY7 A;  4XBX A;  3MG1 A;  5CK6 A;  3DXO A;  1E3R A;  1OHO A;  2F98 A;  1JN5 B;  4R9L A;  4GB5 A;  4RZM A;  1O7M B;  1Q40 B;  2OWP A;  4HM1 B;  1VZZ A;  4HJL B;  5AIH A;  3MG2 A;  4XBY A;  4U13 A;  5D82 A;  5IG0 A;  5IG5 A;  1STD A;  5G2G A;  3NV0 B;  3FSD A;  3MG3 A;  4HM7 B;  1W02 A;  3EBT A;  3FH1 A;  2HMM B;  1W01 A;  4I4K A;  1W6Y A;  1NDO B;  1O7W B;  3GZX B;  3B7C A;  5KP4 A;  5KP1 A;  2CKF B;  3G0K A;  3CNX A;  7STD A;  5IF6 A;  2RFR A;  3NV0 A;  1K41 A;  1UUV B;  3F7S A;  3EQQ B;  1ISK A;  3GZY B;  4XDW A;  1GYB A;  3HZP A;  1OH0 A;  2PZV A;  2YFL B;  5DRV A;  2RCD A;  4OUQ A;  3H51 A;  1BUQ A;  5D81 A;  2HMJ B;  1W00 A;  4XBT A;  1O7H B;  3KKG A;  3GZR A;  3F8H A;  1NU3 A;  1ULI B;  3OXA A;  3RGA A;  4HZ9 B;  1ZX2 A;  2HML B;  4X2O A;  4HZB B;  3OWU A;  2F99 A;  1IDP A;  3CU3 A;  3FGY A;  2XSH B;  4HM4 B;  3OX9 A;  3DMC A;  1SJW A;  3SOY A;  3UNL A;  4XB5 A;  5AEU B;  3ER7 A;  3NM2 A;  5IEN A;  4LMI A;  2GEX A;  3EX9 A;  2GBX B;  3I0Y A;  6STD A;  2XR8 B;  2YFJ B;  3G16 A;  2GBW B;  3HX8 A;  3UJM A;  5BVB A;  1O7N B;  4WYK A;  1QMA A;  3K0Z A;  1GS3 A;  4ORL A;  2HMO B;  2K54 A;  1GY5 A;  3F14 A;  2JQ5 A;  3KSP A;  3NHX A;  2YFI B;  4HM8 B;  2XSO B;  3A76 A;  1ZO2 A;  3B4P A;  3WMD A;  3EF8 A;  1DMM A;  4K1U A;  4FCM A;  5IG4 A;  3NBR A;  2Z77 A;  2GEY A;  3EN1 B;  3LYG A;  3EHC A;  3E99 A;  2HMN B;  5STD A;  5BXQ A;  1EG9 B;  5AI1 A;  5IEO A;  5JPU A;  5CXO A;  2Z76 A;  2UX0 A;  2B24 B;  2BMR B;  3FF2 A;  1DMQ A;  2GXF A;  4LEH A;  4KVH A;  1WQL B;  1O7P B;  2QGU A;  1E97 A;  3B8L A;  3JUN A;  3SOA A;  3VSY A;  4OVM A;  2INX A;  1O7G B; 
#chains in the Genus database with same CATH topology
 1BNS A;  1MWT A;  1V74 A;  1UCJ A;  2CFL A;  3CC7 3;  2F4Y A;  1I0V A;  3BB9 A;  5AYR B;  1D6Y A;  5I97 A;  1JBR A;  3MSO A;  2W56 B;  1BSB A;  1LOY A;  1N5P A;  1IVU A;  4J9A A;  3STD A;  1T3B A;  1BNF A;  1B21 A;  3S67 A;  3OWS A;  1G02 A;  1LOW A;  4RNY A;  2O3O A;  1M1K 4;  1RN1 A;  1UUG B;  1SPU A;  4PEJ A;  1BNI A;  2Y74 A;  3B4O A;  1EEJ A;  5CLK A;  2Z7A A;  1STF I;  4FMB A;  5AIG A;  3SLU A;  2KF5 A;  4HKV B;  1W6C A;  1I70 A;  1Q86 4;  1VQN 3;  2I9W A;  2R4I A;  3FF0 A;  4HM3 B;  4MJD A;  3CNM A;  1TIJ A;  1OCV A;  2ZL8 A;  2W2C A;  4AKZ A;  1RGE A;  4TX4 A;  3LH4 A;  1LQM B;  1BOX A;  3D4A A;  1GMQ A;  3S27 A;  1VQM 3;  3UL5 A;  1SAR A;  1OGZ A;  4WYK B;  4K90 B;  3JVC A;  3DGN A;  5HGR A;  3S28 A;  3NM7 A;  3KE7 A;  3QK9 A;  1TU5 A;  2W56 A;  3ECF A;  5AII A;  3CPO A;  3ROB A;  3GZB A;  5JPP A;  2H0H A;  4HVN A;  1MNL A;  1JB2 A;  1OF5 B;  4BTY A;  4WP5 A;  3S5C A;  1GSP A;  4HM5 B;  3CCL 3;  3BND A;  3VF1 A;  1KSI A;  1KWI A;  1RCK A;  3D3L A;  3D9R A;  3DZL A;  3V99 A;  3CCQ 3;  3EBY A;  4BTX A;  3PYJ A;  1BIR A;  2RSX A;  4HM6 B;  1E3V A;  4IT7 A;  3LTD A;  4JF8 A;  3DM8 A;  1T5Y A;  1BNJ A;  2STD A;  4R4K A;  2CWU A;  1VQP 3;  1Q42 A;  2KRT A;  4LYL B;  4X2H A;  1B27 A;  4BL3 A;  4WHA A;  1QAL A;  3F9S A;  5AIF A;  1LOX A;  4N6L A;  1US1 A;  2CWV A;  2SAR A;  1BSE A;  1X1U A;  2F5M A;  4WWU C;  5G1K A;  4R9K A;  1RMS A;  3PXM A;  5GSP A;  2BMO B;  1YNV X;  1OF5 A;  1LRA A;  4LGQ A;  4EYC A;  1S5A A;  3HII A;  3CCM 3;  1W5Z A;  3RNT A;  3G8Z A;  2LYX A;  1RJO A;  4L8P A;  2OTL 3;  1JBS A;  1I2E A;  1QJG A;  1B2U A;  2ML6 A;  3PZW A;  4IIA A;  4NHF A;  1A2V A;  1OUN A;  5IG3 A;  3CCU 3;  2J8X B;  3L0R A;  2BIR A;  3OW2 2;  1Y4K A;  1KC8 4;  2BO9 B;  4FCJ A;  3NUV A;  1VQL 3;  4H3U A;  4EW5 A;  3FKA A;  2YX9 A;  3OWY A;  2GSP A;  1GMR A;  3T8U A;  1EUI C;  3PCS A;  2IMJ A;  2CX0 A;  2ZHX B;  2WGQ A;  3G6E 3;  2KCD A;  3D5I A;  3X40 A;  1UGI A;  4EV5 A;  3LTC A;  3MYT A;  3DY5 A;  1B2X A;  1CYU A;  1GOV A;  3UL6 A;  5IEP A;  1OHP A;  3BNC A;  2XGL A;  1JB5 A;  3HK4 A;  3JUO A;  5G1L A;  2OQE C;  5DRE A;  4NPB A;  5EEO A;  1NB3 I;  1U5O A;  2W9Q A;  3X3Z A;  2QIY A;  2AAD A;  4L7K A;  3CCR 3;  3EN8 A;  1WTH A;  3ALA A;  1SII A;  2Q07 A;  4MEI A;  5FW5 A;  3GWR A;  4Q53 A;  1YVS A;  2SBL A;  2RGQ A;  1BSD A;  1U8C B;  1Q7H A;  1Q9E A;  2W04 A;  2XEP A;  3F8X A;  1CH0 A;  1JN5 A;  1GD3 A;  1LXE A;  1UDI I;  1JV2 B;  1UUW B;  4R1K A;  4HM0 B;  1I2G A;  1Q40 A;  2RNT A;  3DUK A;  1HU9 A;  3EB8 A;  5KP3 A;  2OQE A;  3G4S 3;  1DMN A;  2QA4 3;  3KZT A;  1A2K A;  1YVB I;  3M8C A;  5ELJ A;  3QRD A;  3EC9 A;  2CG1 A;  3I55 3;  1OGX A;  2OCT A;  3JUP A;  1C54 A;  4OK0 A;  1NWW A;  3BNB A;  1AVL A;  3I56 3;  3K7C A;  3EE1 A;  3ZG0 A;  1RGC A;  4K61 A;  3N8B A;  1V58 A;  2AAE A;  2BU4 A;  8CHO A;  2Z6B A;  1RNT A;  4N6V 0;  2KXG A;  4K1V A;  4STD A;  2Y73 A;  4XDV A;  3LOY A;  3NBB A;  3V92 A;  1LQG C;  1YGE A;  1IQY A;  4FCZ A;  1JB4 A;  3NXJ A;  1B2M A;  2HMK B;  3DGO A;  1FZU A;  3BLZ A;  3MKI A;  3F7X A;  2C10 A;  1HYF A;  4N6O B;  2BMQ B;  2IY2 A;  2XRX B;  1ASK A;  1VQ5 3;  2CW9 A;  3IPT A;  1SIH A;  2F86 B;  2CHC A;  1JNQ A;  3FLJ A;  3OV4 A;  1N9J A;  2KAA A;  2E2V A;  5IER A;  1RGA A;  2W6J H;  3SX1 A;  1EA2 A;  4J8T A;  2CX1 A;  1UW1 A;  1C7H A;  5M18 A;  1VQ8 3;  1IT7 A;  2L4V A;  2XF3 A;  4L8O A;  2QEX 3;  1ROV A;  5AYS C;  2CFD A;  2L1S A;  3WOD G;  3LT8 A;  2CC3 A;  4RNT A;  3S29 A;  7RNT A;  1ULJ B;  1BU4 A;  1IQ8 A;  2WO0 A;  2XH9 A;  1VQO 3;  1BVI A;  2H0G A;  3LTB A;  3CMA 3;  3IJE B;  1JKG B;  3X3Y A;  1FW7 A;  4HAA A;  1UI7 A;  3U1W A;  1K9M 4;  4O8S A;  2A15 A;  5CF1 A;  1K73 4;  2CWT A;  3GSP A;  4XM4 A;  1TFK A;  1QAF A;  1CYV A;  3VGN A;  1TP6 A;  1I0X A;  1RLS A;  1V57 A;  4AKY A;  3CXC 2;  1I3I A;  4JRF A;  1CQS A;  2E2U A;  3RGR A;  1BAN A;  4BU4 A;  2F5W A;  4GSP A;  1DYU A;  1RGL A;  3JUM A;  5D83 A;  2D42 A;  3FG4 A;  3HIG A;  1IT8 A;  1UCI A;  1WMO A;  1BSC A;  3N54 B;  6RNT A;  5TGN A;  3MHE A;  1K28 A;  1B20 A;  1MWR A;  3JUQ A;  1Z1S A;  2R41 A;  1HKX A;  1GY6 A;  2XFT A;  2B1X B;  4CDL A;  1RDS A;  2BNG A;  1OPY A;  5CF2 A;  2GU3 A;  4LZI A;  1YIT 3;  3EJV A;  1IV7 A;  3H3H A;  5RNT A;  1TUH A;  1OHS A;  1RGF A;  1TJD A;  4N3V A;  3T8N A;  2OTJ 3;  3RDE A;  1GOU A;  1JKG A;  1IU7 A;  1HZ1 A;  2KF4 A;  3GRD A;  3K63 A;  3KCH A;  1FUS A;  3Q2P A;  3WA3 A;  1RN4 A;  3WA2 X;  3PGB A;  1J2B A;  4G1M B;  4KFD A;  3F40 A;  3LZA A;  4BL2 A;  6GSP A;  4KFF A;  1JJ2 2;  1AVK A;  3GAX A;  1AR0 A;  1WMP A;  2IA7 A;  4HM2 B;  3HOH A;  9RNT A;  5EVH A;  1F8N A;  2FGT A;  1Q81 4;  5AEW B;  3SED A;  1DET A;  1ZGX A;  3NX0 A;  3PS8 A;  2UUG C;  3Q90 A;  1YI2 3;  1RHL A;  2F56 A;  4FMA A;  1UGH I;  4N6T A;  1L5G B;  1DVD A;  3FZW A;  3X41 A;  1B2Z A;  2W9P A;  3LXU X;  1BGS A;  4QWT A;  1GY7 A;  4EBG A;  1SQW A;  1JRQ A;  3FCS B;  4XBX A;  3MG1 A;  1D6U A;  3KN4 A;  4H61 A;  4NRE A;  5CK6 A;  3DXO A;  1YGW A;  2P38 A;  1E3R A;  2JDI H;  4MMZ B;  2CH9 A;  4MMY B;  1OHO A;  4AEQ A;  2F98 A;  1JN5 B;  1VQK 3;  2O9U X;  4R9L A;  1AV4 A;  4GB5 A;  1M1X B;  3AMO A;  4RZM A;  1O7M B;  1Q40 B;  2OWP A;  4HM1 B;  1VZZ A;  4HJL B;  5AIH A;  4EV2 A;  1NJI 4;  2P09 A;  3HI7 A;  1FUW A;  1LVN A;  3MG2 A;  2MC8 A;  4XBY A;  1BAO A;  1IVX A;  4FMD A;  4U13 A;  5D82 A;  5IG0 A;  5HOH A;  1IK3 A;  2E2T A;  3AHW A;  3SVA A;  1KQS 2;  2WOH A;  4GL6 A;  5IG5 A;  1STD A;  3CPW 2;  3Q3F A;  4BTW A;  1RGH A;  3CME 3;  4N6U A;  1BUJ A;  4KFE A;  5G2G A;  1BRI A;  1I8V A;  1ROA A;  3NV0 B;  1LNI A;  2RBI A;  4EXR A;  1RSN A;  3FSD A;  1FA3 A;  3MG3 A;  4HM7 B;  1W02 A;  3EBT A;  3FH1 A;  2IUJ A;  2PNC A;  1M9G A;  1IV9 A;  1X1X A;  2HMM B;  3CCS 3;  1W01 A;  4N6N B;  4I4K A;  1YIJ 3;  1BSA A;  1W6Y A;  1NDO B;  3D79 A;  1FYS A;  3U97 A;  1O7W B;  3MPH A;  1BRN L;  3GZX B;  4RNZ A;  1LNH A;  1W2B 2;  3B7C A;  1MGW A;  5KP4 A;  5KP1 A;  1KD1 4;  2CKF B;  1MWU A;  3DGM A;  3CNX A;  3G0K A;  2HOH A;  4O02 B;  5FGO A;  7STD A;  2OOV C;  1BNE A;  3BU4 A;  1RN7 A;  1X1W A;  3SXX A;  1YHQ 3;  4ILF A;  3IMA B;  5IF6 A;  2RFR A;  3NV0 A;  1A2P A;  2P0M A;  1K41 A;  1UUV B;  1FGO A;  3O8Y A;  3F7S A;  1BRH A;  1JZO A;  3EQQ B;  2P0X A;  3KFQ C;  1RKY A;  1UCK A;  1ISK A;  1WNH A;  1R4Y A;  3GZY B;  1I2F A;  3WHO A;  1BNG A;  5LC6 A;  4XDW A;  3CCE 3;  1BRS A;  1FGM A;  5BIR A;  1GYB A;  3LML A;  3HZP A;  1GD4 A;  4HYZ A;  1OH0 A;  2M7O A;  2PZV A;  2YFL B;  3WDG B;  1PFP A;  3FG1 A;  2FXT A;  3NQZ A;  1N9E A;  2OOV A;  1G0T A;  3WOF B;  1T2I A;  2KF3 A;  2GU1 A;  1VQ6 3;  5DRV A;  4MMX B;  2RCD A;  4OUQ A;  1IVW A;  1R4C A;  2D1W A;  3H51 A;  3SYU A;  1RGG A;  4KZ1 A;  1BUQ A;  5D81 A;  2UGI A;  2XGN A;  2ZDJ A;  1QVG 2;  2HMJ B;  1GMP A;  1W00 A;  4XBT A;  3K9M C;  1O7H B;  5M1A A;  1IVV A;  3KKG A;  1Q82 4;  3GZR A;  2LQV A;  3WOE B;  3F8H A;  1NU3 A;  1ULI B;  1TFO A;  3OXA A;  1RTU A;  3RGA A;  4N6M A;  4HZ9 B;  5ELU A;  1NNV A;  1N8R 4;  5A0O B;  3UB1 A;  1ZX2 A;  2H0I A;  2HML B;  3DGL A;  1N5H A;  3ZFZ A;  1S72 3;  2P05 A;  2BHM A;  4X2O A;  1FGR A;  4HZB B;  3LTA A;  2KF6 A;  3OWU A;  1FGQ A;  3DGY A;  2F99 A;  2CG0 A;  1OAC A;  1BRJ A;  1TRP A;  5LC7 A;  1IDP A;  3CU3 A;  3FGY A;  2FNQ A;  2XSH B;  4CJN A;  5IW9 A;  1BNR A;  1JBT A;  4HM4 B;  1VQ9 3;  3NBJ A;  3OX9 A;  1YJW 3;  3DMC A;  1SJW A;  3SOY A;  3UNL A;  2W03 A;  4O3V A;  4XB5 A;  1PYL A;  5AEU B;  4J5G A;  1VQ7 3;  1W6G A;  3ER7 A;  3AMO B;  1I3F A;  1TTO A;  8RNT A;  3NM2 A;  1UI8 A;  4LMI A;  2GEX A;  5IEN A;  3CC2 3;  3EX9 A;  3NQY A;  1EKM A;  2GBX B;  2C4B A;  1LOV A;  3DH2 A;  4CPK A;  3I0Y A;  1PU4 A;  6STD A;  3FG3 A;  1MOL A;  2XR8 B;  2YFJ B;  3G16 A;  2GBW B;  1D6Z A;  1W4N A;  2WOF A;  3HX8 A;  4DKI A;  1AQZ A;  1W2Z A;  3KII A;  3PCR A;  3UJM A;  5BVB A;  1O7N B;  3Q1C A;  1IQX A;  3T0U A;  3G71 3;  4WYK A;  4CCV A;  1A90 A;  1RRH A;  1QMA A;  1JZD A;  3K0Z A;  4EC6 A;  1QVF 2;  3AGO A;  1GS3 A;  2HMO B;  2K54 A;  1GY5 A;  3BIR A;  4ORL A;  3A5E A;  3F14 A;  1ZS7 A;  2JQ5 A;  3AGN A;  1NO3 A;  3KSP A;  4FR9 A;  3NHX A;  4GHO A;  1TRQ A;  2YFI B;  4HM8 B;  2CFK A;  2XSO B;  3A76 A;  1ZO2 A;  3B4P A;  4HOH A;  4LSO A;  1FUT A;  3WMD A;  3EF8 A;  3D5G A;  5BU4 A;  1W7C A;  1DMM A;  5M19 A;  4K1U A;  4FCM A;  4J5K A;  2MF7 A;  1GOY A;  5IG4 A;  3NBR A;  3KSE D;  2W0Q A;  1VQ4 3;  3N9H A;  1RCL A;  2Z77 A;  2IUK A;  2GEY A;  5EQL A;  3TDG A;  1MWS A;  3CCJ 3;  1B2S A;  3BNE A;  3EN1 B;  1PY3 A;  3K5T A;  1N8Q A;  3V98 A;  7GSP A;  3URP A;  3LYG A;  1DE3 A;  2ML5 A;  4WFO A;  2BT3 A;  2CK3 H;  3X42 A;  1M90 4;  3EHC A;  3E99 A;  1DVC A;  2HMN B;  5STD A;  3AHS A;  1QAK A;  5BXQ A;  1EG9 B;  2ZA4 A;  2CFW A;  5AI1 A;  5IEO A;  5JPU A;  3CCV 3;  1NB5 I;  5CXO A;  1RRL A;  2Z76 A;  2UX0 A;  4FMC A;  2B24 B;  2BMR B;  3J7Y d;  1YJN 3;  3FF2 A;  4ZM8 A;  3LT9 A;  1DMQ A;  1X1Y A;  2GXF A;  2IYJ A;  4LEH A;  5JBS A;  1MGR A;  1G96 A;  4KVH A;  1A67 A;  2K0M A;  4HBR A;  4R80 A;  1T2H A;  1WQL B;  1O7P B;  2CIU A;  1CEW I;  1BRK A;  2WGO A;  2QGU A;  1YJ9 3;  1AY7 A;  1E97 A;  2K3D A;  3B8L A;  1WMN A;  4RBN A;  4IPB A;  1VQQ A;  3JUN A;  4O2H A;  3SOA A;  3VSY A;  1RGK A;  4I5Q A;  2V1L A;  3MWZ A;  1BRG A;  3CC4 3;  1UCL A;  1RNB A;  1K8A 4;  3CD6 3;  3WR2 A;  1FGT A;  4OVM A;  1Q7Y 4;  1EQK A;  2CFG A;  3ZG5 A;  2INX A;  3X3X A;  4BIR A;  1O7G B;  1IYY A;  1B3S A;  2C11 A;  4KT3 B;  2XFS A; 
#chains in the Genus database with same CATH homology
 1V74 A;  2CFL A;  3CC7 3;  3BB9 A;  5AYR B;  1D6Y A;  5I97 A;  3MSO A;  2W56 B;  1N5P A;  4J9A A;  1IVU A;  3STD A;  3S67 A;  3OWS A;  4RNY A;  2O3O A;  1M1K 4;  1SPU A;  4PEJ A;  2Y74 A;  3B4O A;  5CLK A;  2Z7A A;  1STF I;  4FMB A;  5AIG A;  3SLU A;  4HKV B;  1W6C A;  1Q86 4;  1VQN 3;  2I9W A;  2R4I A;  3FF0 A;  4HM3 B;  4MJD A;  3CNM A;  1TIJ A;  1OCV A;  2ZL8 A;  2W2C A;  4AKZ A;  4TX4 A;  3LH4 A;  3S27 A;  1VQM 3;  3UL5 A;  1OGZ A;  4WYK B;  4K90 B;  3JVC A;  3DGN A;  5HGR A;  3S28 A;  3NM7 A;  3KE7 A;  3QK9 A;  1TU5 A;  2W56 A;  3ECF A;  5AII A;  3CPO A;  3ROB A;  3GZB A;  5JPP A;  4HVN A;  1MNL A;  1JB2 A;  1OF5 B;  4BTY A;  4WP5 A;  3S5C A;  4HM5 B;  3CCL 3;  3BND A;  3VF1 A;  1KSI A;  1KWI A;  3D3L A;  3D9R A;  3DZL A;  3V99 A;  3CCQ 3;  3EBY A;  4BTX A;  3PYJ A;  2RSX A;  4HM6 B;  1E3V A;  4IT7 A;  3LTD A;  4JF8 A;  3DM8 A;  1T5Y A;  2STD A;  4R4K A;  2CWU A;  1VQP 3;  1Q42 A;  2KRT A;  4X2H A;  4WHA A;  1QAL A;  3F9S A;  5AIF A;  1LOX A;  4N6L A;  1US1 A;  2CWV A;  4WWU C;  4R9K A;  3PXM A;  2BMO B;  1OF5 A;  4LGQ A;  4EYC A;  1S5A A;  3HII A;  3CCM 3;  1W5Z A;  3G8Z A;  2LYX A;  1RJO A;  4L8P A;  2OTL 3;  1QJG A;  2ML6 A;  3PZW A;  4IIA A;  4NHF A;  1A2V A;  1OUN A;  5IG3 A;  3CCU 3;  3L0R A;  3OW2 2;  1KC8 4;  1Y4K A;  2BO9 B;  4FCJ A;  3NUV A;  1VQL 3;  4H3U A;  3FKA A;  2YX9 A;  3OWY A;  3T8U A;  3PCS A;  2IMJ A;  2WGQ A;  3G6E 3;  2KCD A;  3X40 A;  4EV5 A;  3LTC A;  3MYT A;  3DY5 A;  1CYU A;  3UL6 A;  5IEP A;  1OHP A;  3BNC A;  2XGL A;  1JB5 A;  3HK4 A;  3JUO A;  2OQE C;  5DRE A;  5EEO A;  1NB3 I;  1U5O A;  2W9Q A;  3X3Z A;  2QIY A;  4L7K A;  3CCR 3;  3EN8 A;  1WTH A;  3ALA A;  1SII A;  2Q07 A;  4MEI A;  5FW5 A;  3GWR A;  4Q53 A;  2SBL A;  2RGQ A;  1U8C B;  2XEP A;  2W04 A;  3F8X A;  1JN5 A;  1GD3 A;  1LXE A;  1UUW B;  1JV2 B;  4R1K A;  5LC7 A;  4HM0 B;  1Q40 A;  3DUK A;  3EB8 A;  5KP3 A;  1HU9 A;  2OQE A;  3G4S 3;  1DMN A;  2QA4 3;  3KZT A;  1A2K A;  1YVB I;  3M8C A;  5ELJ A;  3QRD A;  3EC9 A;  2CG1 A;  3I55 3;  1OGX A;  2OCT A;  3JUP A;  4OK0 A;  1NWW A;  3BNB A;  1AVL A;  3I56 3;  3K7C A;  3EE1 A;  4K61 A;  3N8B A;  8CHO A;  2Z6B A;  4N6V 0;  2KXG A;  4K1V A;  4STD A;  2Y73 A;  4XDV A;  3LOY A;  3NBB A;  3V92 A;  4FCZ A;  1YGE A;  1IQY A;  1JB4 A;  3NXJ A;  2HMK B;  3DGO A;  3BLZ A;  3MKI A;  3F7X A;  2C10 A;  4N6O B;  2BMQ B;  2XRX B;  1ASK A;  1VQ5 3;  2CW9 A;  3IPT A;  1SIH A;  2F86 B;  2CHC A;  1JNQ A;  3FLJ A;  3OV4 A;  1N9J A;  5IER A;  2E2V A;  2W6J H;  3SX1 A;  1EA2 A;  4J8T A;  1VQ8 3;  1UW1 A;  1C7H A;  1IT7 A;  2L4V A;  2XF3 A;  4L8O A;  2QEX 3;  1ROV A;  5AYS C;  2CFD A;  3WOD G;  3LT8 A;  2CC3 A;  3S29 A;  1ULJ B;  1IQ8 A;  2WO0 A;  2XH9 A;  1VQO 3;  3LTB A;  3CMA 3;  3IJE B;  1JKG B;  3X3Y A;  1UI7 A;  3U1W A;  1K9M 4;  4O8S A;  2A15 A;  5CF1 A;  1K73 4;  2CWT A;  4XM4 A;  1TFK A;  1QAF A;  1CYV A;  3VGN A;  1TP6 A;  4AKY A;  3CXC 2;  4JRF A;  1CQS A;  2E2U A;  3RGR A;  1DYU A;  3JUM A;  5D83 A;  2D42 A;  3FG4 A;  3HIG A;  1IT8 A;  1WMO A;  3N54 B;  5TGN A;  3MHE A;  1K28 A;  3JUQ A;  1Z1S A;  1HKX A;  1GY6 A;  2XFT A;  2B1X B;  4CDL A;  2BNG A;  1OPY A;  5CF2 A;  2GU3 A;  4LZI A;  1YIT 3;  3EJV A;  1IV7 A;  3H3H A;  1TUH A;  1OHS A;  2OTJ 3;  4N3V A;  3T8N A;  3RDE A;  3GRD A;  1JKG A;  1IU7 A;  3K63 A;  3Q2P A;  3WA3 A;  1J2B A;  3WA2 X;  3PGB A;  4G1M B;  4KFD A;  3F40 A;  3LZA A;  4KFF A;  1JJ2 2;  1AVK A;  3GAX A;  1AR0 A;  1WMP A;  2IA7 A;  4HM2 B;  5EVH A;  1F8N A;  2FGT A;  1Q81 4;  5AEW B;  3SED A;  3NX0 A;  3PS8 A;  3Q90 A;  1YI2 3;  4FMA A;  4N6T A;  1L5G B;  1DVD A;  3FZW A;  3X41 A;  2W9P A;  3LXU X;  4QWT A;  1GY7 A;  4EBG A;  1SQW A;  1JRQ A;  3FCS B;  4XBX A;  3MG1 A;  1D6U A;  3KN4 A;  4H61 A;  4NRE A;  5CK6 A;  3DXO A;  2P38 A;  4MMY B;  1E3R A;  2JDI H;  4MMZ B;  2CH9 A;  4AEQ A;  1OHO A;  2F98 A;  1JN5 B;  1VQK 3;  2O9U X;  4R9L A;  1AV4 A;  4GB5 A;  1M1X B;  3AMO A;  4RZM A;  1O7M B;  1Q40 B;  2OWP A;  4HM1 B;  1VZZ A;  4HJL B;  5AIH A;  4EV2 A;  1NJI 4;  2P09 A;  3HI7 A;  1FUW A;  1LVN A;  3MG2 A;  2MC8 A;  4XBY A;  1IVX A;  4FMD A;  4U13 A;  5D82 A;  5IG0 A;  1IK3 A;  2E2T A;  3SVA A;  1KQS 2;  2WOH A;  4GL6 A;  5IG5 A;  1STD A;  3CPW 2;  4BTW A;  3CME 3;  4N6U A;  4KFE A;  5G2G A;  1ROA A;  3NV0 B;  4EXR A;  3FSD A;  1FA3 A;  3MG3 A;  4HM7 B;  1W02 A;  3EBT A;  3FH1 A;  2IUJ A;  2PNC A;  1M9G A;  1IV9 A;  2HMM B;  3CCS 3;  1W01 A;  4N6N B;  4I4K A;  1YIJ 3;  1W6Y A;  1NDO B;  3U97 A;  1O7W B;  3MPH A;  3GZX B;  4RNZ A;  1LNH A;  1W2B 2;  3B7C A;  5KP4 A;  5KP1 A;  1KD1 4;  2CKF B;  3DGM A;  3CNX A;  3G0K A;  4O02 B;  5FGO A;  7STD A;  2OOV C;  1YHQ 3;  1RN7 A;  3SXX A;  3IMA B;  5IF6 A;  2RFR A;  3NV0 A;  2P0M A;  1K41 A;  1UUV B;  1FGO A;  3O8Y A;  3F7S A;  3EQQ B;  2P0X A;  3KFQ C;  1RKY A;  1ISK A;  1WNH A;  3GZY B;  5LC6 A;  4XDW A;  3CCE 3;  1FGM A;  1GYB A;  3LML A;  3HZP A;  1GD4 A;  4HYZ A;  1OH0 A;  2M7O A;  2PZV A;  2YFL B;  3WDG B;  1PFP A;  3FG1 A;  2FXT A;  3NQZ A;  1N9E A;  2OOV A;  3WOF B;  2GU1 A;  1VQ6 3;  5DRV A;  4MMX B;  2RCD A;  4OUQ A;  1IVW A;  1R4C A;  2D1W A;  3H51 A;  4KZ1 A;  1BUQ A;  5D81 A;  2XGN A;  1QVG 2;  2ZDJ A;  2HMJ B;  1W00 A;  4XBT A;  3K9M C;  1O7H B;  1IVV A;  3KKG A;  1Q82 4;  3GZR A;  2LQV A;  3WOE B;  3F8H A;  1NU3 A;  1ULI B;  1TFO A;  3OXA A;  3RGA A;  4N6M A;  4HZ9 B;  5ELU A;  1N8R 4;  5A0O B;  3UB1 A;  1ZX2 A;  2HML B;  3DGL A;  1N5H A;  1S72 3;  2P05 A;  2BHM A;  4X2O A;  1FGR A;  4HZB B;  3LTA A;  3OWU A;  1FGQ A;  2F99 A;  2CG0 A;  1OAC A;  1IDP A;  3CU3 A;  3FGY A;  2FNQ A;  2XSH B;  5IW9 A;  4HM4 B;  1VQ9 3;  3NBJ A;  3OX9 A;  1YJW 3;  3DMC A;  1SJW A;  3SOY A;  3UNL A;  2W03 A;  4O3V A;  4XB5 A;  5AEU B;  1VQ7 3;  1W6G A;  3ER7 A;  3AMO B;  3NM2 A;  1UI8 A;  4LMI A;  2GEX A;  5IEN A;  3CC2 3;  3EX9 A;  3NQY A;  1EKM A;  2GBX B;  3I0Y A;  1PU4 A;  6STD A;  3FG3 A;  1MOL A;  2XR8 B;  2YFJ B;  3G16 A;  2GBW B;  1D6Z A;  1W4N A;  2WOF A;  3HX8 A;  1W2Z A;  3KII A;  3PCR A;  3UJM A;  5BVB A;  1O7N B;  3Q1C A;  1IQX A;  3T0U A;  3G71 3;  4WYK A;  4CCV A;  1A90 A;  1RRH A;  1QMA A;  3K0Z A;  4EC6 A;  1QVF 2;  1GS3 A;  2HMO B;  2K54 A;  1GY5 A;  4ORL A;  3F14 A;  2JQ5 A;  1NO3 A;  3KSP A;  4FR9 A;  3NHX A;  2YFI B;  4HM8 B;  2CFK A;  2XSO B;  3A76 A;  1ZO2 A;  3B4P A;  4LSO A;  3WMD A;  3EF8 A;  1W7C A;  1DMM A;  4K1U A;  4FCM A;  2MF7 A;  5IG4 A;  3NBR A;  3KSE D;  2W0Q A;  1VQ4 3;  3N9H A;  2Z77 A;  2IUK A;  2GEY A;  5EQL A;  3TDG A;  3CCJ 3;  3BNE A;  3EN1 B;  3K5T A;  1N8Q A;  3V98 A;  3LYG A;  2ML5 A;  4WFO A;  2BT3 A;  2CK3 H;  3X42 A;  1M90 4;  3EHC A;  3E99 A;  1DVC A;  2HMN B;  5STD A;  5BXQ A;  1QAK A;  1EG9 B;  2CFW A;  5AI1 A;  5IEO A;  5JPU A;  3CCV 3;  1NB5 I;  5CXO A;  1RRL A;  2Z76 A;  2UX0 A;  4FMC A;  2B24 B;  2BMR B;  3J7Y d;  1YJN 3;  3FF2 A;  4ZM8 A;  3LT9 A;  1DMQ A;  2GXF A;  4LEH A;  5JBS A;  1G96 A;  4KVH A;  1A67 A;  2K0M A;  4HBR A;  4R80 A;  1WQL B;  1O7P B;  2CIU A;  1CEW I;  2WGO A;  2QGU A;  1YJ9 3;  1E97 A;  3B8L A;  1WMN A;  4RBN A;  4IPB A;  3JUN A;  4O2H A;  3SOA A;  3VSY A;  2V1L A;  3MWZ A;  3CC4 3;  1K8A 4;  3CD6 3;  1FGT A;  4OVM A;  1Q7Y 4;  1EQK A;  2CFG A;  2INX A;  3X3X A;  1O7G B;  2C11 A;  2XFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...