3B7CA

Crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
MPTDDIVQLLKGQEEAWNRGDLDAYMQGYWQNEQLMLISNGKFRNGWDETLAAYKKNYPDKESLGELKFTIKEIKMLSNYAAMVVGRWDLKRLKDTPTGVFTLLVEKIDDRWVITMDHSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF-2 like protein of unknown function (NP_715767.1) from Shewanella oneidensis at 1.70 A resolution
rcsb
source organism Shewanella oneidensis
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b7cA00
3OXAA 1SJWA 3HZPA 1OPYA 5AIGA 1DMNA 4N3VA 4ORLA 1WQLB 3E99A 1W02A 3F40A 3G0KA 2YFJB 4HM5B 2QGUA 3VSYA 2UX0A 5KP3A 1JB5A 4XB5A 4U13A 3G8ZA 3UJMA 3GZYB 5AEWB 1OCVA 1OH0A 3K0ZA 4PEJA 5D83A 3OWYA 1TP6A 1JB4A 4KVHA 4XBYA 5DRVA 1O7MB 3NBRA 4Q53A 4J8TA 3FF0A 3OWSA 5TGNA 2YFLB 4HM6B 1QJGA 3BB9A 4WYKB 4XDVA 5IG5A 3MG3A 3K7CA 1OUNA 2PZVA 5AIHA 1OHSA 3ECFA 3DMCA 1U5OA 5IERA 6STDA 1GS3A 1O7NB 1QMAA 4HZ9B 3B4PA 2HMJB 5JPUA 3EBYA 5KP1A 4X2OA 1O7GB 5AEUB 5CXOA 1VZZA 5BXQA 2QIYA 5FW5A 2CHCA 2STDA 5CLKA 2GEYA 4HM1B 4WP5A 4HM3B 4H3UA 1ULJB 2YFIB 3EJVA 1C7HA 2BMRB 4LGQA 1JKGB 5IEPA 5IG3A 3T8NA 3UNLA 5BVBA 2XR8B 5AIFA 3JUPA 4FCMA 1GY7A 2Z7AA 3MKIA 1AR0A 2GBWB 1ZO2A 3EQQB 3NV0A 1E97A 4GB5A 2GEXA 3H51A 3DUKA 1NDOB 3CPOA 1ULIB 2XSHB 5JPPA 3Q90A 1ZX2A 5DREA 3NHXA 1E3VA 3MSOA 1IDPA 5CF2A 1Q42A 3DZLA 3JUOA 1DMQA 4LEHA 3BLZA 3VGNA 3I0YA 3JUMA 1CQSA 3B4OA 5IEOA 3DXOA 3JUQA 3F14A 1OF5A 1Q40B 1OGXA 3RGRA 2Z77A 3HX8A 2W2CA 1UUWB 1S5AA 5G2GA 3FSDA 3EF8A 1JN5A 3SOYA 3FH1A 1BUQA 2Z76A 3KKGA 3B7CA 1W01A 3MG2A 1O7HB 4I4KA 3GWRA 2F98A 3G16A 3F7XA 4STDA 3HK4A 3OWUA 4LMIA 2HMOB 5CK6A 1A2KA 3KZTA 5KP4A 3FZWA 5EVHA 1GYBA 3NUVA 3WMDA 4R9KA 4K1VA 2BNGA 8CHOA 3T8UA 3EC9A 4L8OA 4R9LA 2RCDA 1UUVB 4OVMA 4L7KA 3LYGA 2F86B 5IG0A 2HMLB 5IG4A 3GZBA 4FCJA 4OUQA 2IMJA 3EHCA 1W00A 1EA2A 3STDA 2HMKB 3FF2A 4XBXA 3DM8A 2K54A 1OGZA 1E3RA 3KSPA 3LZAA 3F7SA 2OWPA 4RZMA 4WYKA 3RGAA 4XM4A 2CKFB 2B24B 3B8LA 3EBTA 3A76A 4HJLB 2INXA 3EN8A 3FLJA 4R1KA 3F8XA 1HKXA 4HM0B 3JUNA 3OV4A 1GY5A 3CU3A 1NU3A 3NV0B 3GZXB 4HM7B 3NM2A 3FGYA 3ROBA 5CF1A 1OHPA 2RFRA 3FKAA 2XRXB 1STDA 1EG9B 4K1UA 5IENA 3M8CA 4MJDA 3EN1B 2HMMB 4HVNA 3SEDA 4XDWA 2BMOB 1JKGA 3MG1A 4HKVB 3F8HA 1K41A 5AIIA 3F9SA 2A15A 4HM2B 3CNMA 3MYTA 4IIAA 1O7PB 1OF5B 4X2HA 2R4IA 5D82A 2GXFA 3S5CA 3NXJA 3ER7A 4XBTA 2I9WA 1OHOA 4HM8B 1GY6A 3GZRA 4L8PA 2XSOB 3MHEA 3D9RA 4J9AA 1TUHA 1JN5B 2GBXB 3SOAA 2F99A 4CDLA 2JQ5A 3CNXA 5STDA 3H3HA 1Z1SA 1JB2A 5AI1A 4WWUC 3IPTA 3KE7A 3EX9A 2RGQA 2B1XB 1NWWA 1O7WB 5HGRA 5D81A 2HMNB 4HZBB 1Q40A 1ISKA 1DMMA 7STDA 5IF6A 1ASKA 1W6YA 3GRDA 3OX9A 4HM4B 2BMQB
chains in the Genus database with same CATH superfamily
1LXEA 3Q3FA 3LMLA 3OXAA 1SJWA 5A0OB 1JNQA 3LXUX 3G713 1LQMB 1MWSA 2L4VA 3HZPA 1IQYA 2W9PA 3LT9A 1OPYA 3V98A 3WHOA 1UW1A 4BL2A 2BU4A 1DMNA 5AIGA 3CCR3 1RMSA 1YJW3 1BNGA 4CCVA 1BGSA 1T5YA 4N3VA 4ORLA 1WQLB 3E99A 1B20A 3PS8A 3URPA 1MWTA 1W02A 1PYLA 3HIGA 1RN1A 3KFQC 1RTUA 1BUJA 1BSDA 4HAAA 3F40A 3G0KA 1BIRA 3NQZA 2YFJB 3PCRA 4HM5B 2QGUA 1IU7A 1LOXA 3VSYA 2SBLA 1RRHA 3WDGB 4EBGA 1VQ53 1RHLA 9RNTA 2UX0A 5KP3A 4RBNA 1JB5A 2P0MA 4XB5A 1UDII 1FGQA 4J5KA 4U13A 2P0XA 1HYFA 1U8CB 3G8ZA 3UJMA 1BSEA 1RGKA 1FZUA 1OCVA 1OH0A 2J8XB 3GZYB 3K0ZA 3LTDA 4PEJA 5AEWB 3I563 2RNTA 5D83A 1NJI4 1EUIC 3CMA3 4MMZB 1BNRA 4FMCA 3OWYA 1TP6A 2BT3A 2V1LA 1T2HA 4FMBA 1JB4A 4KVHA 4GSPA 4NPBA 4ILFA 4XBYA 5DRVA 1I3FA 3AMOB 3BIRA 1O7MB 2MF7A 3KIIA 1LRAA 3NBRA 4Q53A 4J8TA 3FF0A 1LOWA 3LH4A 3OWSA 4JRFA 1VQM3 3I553 1LNIA 5TGNA 1WNHA 2YFLB 1IK3A 4HM6B 4AEQA 1QJGA 3BB9A 1BNFA 4WYKB 1I8VA 5RNTA 4XDVA 5IG5A 1WMNA 3LTCA 3MG3A 1RKYA 3K7CA 1I2GA 4EW5A 1ZS7A 1OUNA 2PZVA 5AIHA 1VQ43 1OHSA 3L0RA 3RNTA 2RBIA 4ZM8A 2W9QA 3ECFA 3U97A 1TIJA 3DMCA 4O2HA 4R80A 4O02B 4NHFA 3KSED 5M18A 1U5OA 3T0UA 4OK0A 5IERA 6STDA 1RGHA 1GS3A 1O7NB 1QMAA 3VF1A 4HZ9B 1RNBA 3LOYA 3B4PA 1UUGB 2IA7A 2HMJB 5JPUA 3EBYA 2CW9A 3PCSA 1ZGXA 1NB5I 3UL6A 5KP1A 2SARA 4X2OA 1O7GB 5AEUB 5CXOA 1W6CA 1STFI 2XF3A 5EQLA 1VZZA 5BXQA 3HIIA 1RGCA 3G4S3 3DGYA 1B3SA 4HBRA 5AYSC 2QIYA 5FW5A 2BIRA 4IPBA 2CHCA 1HU9A 2STDA 5CLKA 1A67A 2GEYA 2WGQA 4HM1B 3CD63 3PYJA 1BSAA 4WP5A 4HM3B 1V74A 5ELJA 4H3UA 2IYJA 3WR2A 4RNZA 3CCS3 1ULJB 1G0TA 3CPW2 4FMAA 3RDEA 1BNIA 2YFIB 3EJVA 1BRIA 1C7HA 2BMRB 1G02A 2JDIH 3IMAB 2GU1A 1K734 4LGQA 1JKGB 3DGOA 4EC6A 1DETA 5JBSA 5IEPA 3BNBA 2FNQA 5IG3A 1MGRA 1SPUA 2CFDA 5FGOA 3T8NA 3TDGA 3UNLA 2ZL8A 1M904 1K9M4 5BVBA 1YI23 1A90A 1IVVA 2XR8B 1BOXA 3JVCA 3V92A 5M19A 2LYXA 5G1KA 2CC3A 3JUPA 2XFTA 1GY7A 2Z7AA 4FCMA 5AIFA 1RGFA 1FUWA 1NO3A 1IT7A 4G1MB 3MKIA 1AR0A 1R4YA 1RCKA 2GBWB 1ZO2A 1RN7A 3EQQB 3X42A 3NV0A 1E97A 2PNCA 1JZOA 2CX1A 1C54A 2CK3H 1B2SA 4MEIA 4GB5A 2AADA 4EV5A 2GEXA 3HI7A 3H51A 1A2PA 1RSNA 3X3XA 2FGTA 3DUKA 1QVF2 1NDOB 2W03A 1RN4A 3CPOA 1ULIB 4O3VA 2RSXA 1YGEA 3KCHA 4WFOA 4EYCA 2W6JH 1JBSA 3NQYA 3CCV3 1RJOA 3S29A 1CH0A 3CC23 1Q9EA 4BTXA 2XSHB 1AV4A 1MOLA 2BHMA 5JPPA 2CX0A 2W04A 3Q90A 4HYZA 1YIJ3 1FYSA 1BU4A 3KN4A 4EXRA 1UCJA 1ZX2A 1LQGC 3HOHA 3EB8A 3NBJA 1B27A 4MMXB 5DREA 3SXXA 3NHXA 3X3YA 6RNTA 1ISKA 1LNHA 2F4YA 1E3VA 3MSOA 1VQQA 2BO9B 1IDPA 5CF2A 1Q42A 1KQS2 3DZLA 2W56B 1KD14 3JUOA 3CCQ3 1DMQA 4MMYB 3CXC2 5I97A 3CC43 4LEHA 3BLZA 2R41A 4FCZA 2OTL3 1GD4A 1FGOA 1FUTA 3VGNA 2H0HA 3PZWA 3UL5A 1VQ73 2C10A 3I0YA 3JUMA 2O9UX 1CQSA 3B4OA 1RRLA 5EEOA 5IEOA 2C11A 2IUKA 3DXOA 1BRNL 1W5ZA 1YHQ3 1W7CA 3JUQA 1S723 3F14A 1SQWA 1OF5A 1QAKA 1Q40B 1X1XA 4N6UA 1OGXA 1UI8A 3RGRA 2Z77A 3HX8A 2W2CA 1I2FA 3BNCA 1UUWB 3LTBA 2FXTA 1D6ZA 1S5AA 5G2GA 1IVXA 2XEPA 2CFGA 2K0MA 3N8BA 1DVDA 1TRQA 3FSDA 1YIT3 3Q2PA 1AQZA 2F56A 2ML6A 2KF6A 3EF8A 1JN5A 2WOHA 3SOYA 3FH1A 3ZFZA 1GOYA 1K8A4 1L5GB 1VQ63 4AKZA 1BUQA 1BSCA 2Z76A 4IT7A 4GHOA 3ALAA 3WOEB 2P38A 3N54B 4KFFA 1GOUA 1DVCA 3U1WA 3KKGA 1I0XA 2YX9A 3B7CA 1W01A 3A5EA 1D6UA 2OQEC 1SIHA 3MG2A 1QALA 1O7HB 4I4KA 2KF5A 3GWRA 2F98A 1VQ93 1W6GA 4FR9A 1IQ8A 3AGNA 4LSOA 1RDSA 2KCDA 3G16A 3F7XA 3G6E3 3UB1A 2ZA4A 3CCU3 2K3DA 4K90B 4STDA 1GMRA 1Q814 3CC73 3ZG0A 1BRGA 2IY2A 2ZDJA 3HK4A 3S27A 3OWUA 3IJEB 2WOFA 1JRQA 1RGLA 1B2UA 1JZDA 1UCLA 1UGHI 3S28A 1KSIA 1QVG2 1N8R4 4LMIA 2F5MA 1VQK3 1EQKA 3PXMA 4RNTA 1Q824 1N5HA 2HMOB 2O3OA 2KF3A 1YVBI 1R4CA 1RGAA 5GSPA 3CCJ3 1WMOA 2CG0A 4KZ1A 1VQP3 1OACA 5CK6A 4CJNA 1A2KA 3KZTA 5KP4A 1UCIA 5BIRA 3FZWA 5EVHA 1VQL3 1GYBA 2F5WA 3AGOA 3NUVA 1N9EA 3BNEA 1YJ93 3WMDA 3Q1CA 3DH2A 1X1YA 4K1VA 4KT3B 4R9KA 4BU4A 2BNGA 8CHOA 1JBRA 3T8UA 3EC9A 1WTHA 1DE3A 1IQXA 1HZ1A 4L8OA 4R9LA 6GSPA 3BNDA 3CCL3 2RCDA 4JF8A 2CFWA 1UUVB 4OVMA 4L7KA 1TTOA 3LYGA 2F86B 5IG0A 1EEJA 2HMLB 4WHAA 3CME3 2XGLA 3DGLA 1BANA 3GSPA 3O8YA 2WO0A 4DKIA 3GZBA 5IG4A 1PY3A 4FCJA 4OUQA 2IMJA 1SIIA 3EHCA 1W00A 1EA2A 1Y4KA 2OOVC 2HMKB 4O8SA 3STDA 1V57A 3FF2A 4XBXA 1QAFA 3DM8A 1IV7A 5HOHA 1JBTA 2K54A 1W4NA 1GOVA 5BU4A 3WA3A 1OGZA 1E3RA 2XGNA 3AMOA 1T2IA 4N6TA 1TFKA 3X40A 7GSPA 4NREA 3KSPA 3LZAA 3F7SA 2MC8A 2OWPA 4RZMA 3X41A 7RNTA 5G1LA 2E2UA 1N5PA 1VQN3 3FG4A 5IW9A 1BVIA 4WYKA 3RGAA 1RGGA 4XM4A 1N8QA 2CKFB 2CWTA 4EV2A 2B24B 3B8LA 1F8NA 4N6OB 2E2VA 1Q7HA 2W0QA 2E2TA 2D42A 3EBTA 3A76A 3X3ZA 3DGNA 3GAXA 2Z6BA 4HJLB 2INXA 1AVLA 4N6LA 2IUJA 1W2B2 1BRSA 3J7Yd 3EN8A 2KRTA 1TRPA 1DYUA 3FLJA 4KFEA 4R1KA 5ELUA 3F8XA 3D5GA 3BU4A 3WODG 3ZG5A 1FW7A 1HKXA 1MWRA 1RLSA 3JUNA 1GY5A 3OV4A 4HM0B 3CU3A 4HOHA 1NU3A 4RNYA 1JV2B 1KWIA 1M9GA 3NV0B 4N6V0 4QWTA 1JJ22 3K9MC 3GZXB 3OW22 1BNEA 2GU3A 1PFPA 4HM7B 4TX4A 4BL3A 1M1K4 1UCKA 4FMDA 1TJDA 3CCM3 2KF4A 1IT8A 1WMPA 2AAEA 1EKMA 3NM7A 2XFSA 3NM2A 1B2MA 1SARA 1I70A 3FGYA 3ROBA 1BNSA 1FUSA 3SX1A 5CF1A 1LOYA 1OHPA 2P09A 1RCLA 2RFRA 3FKAA 1BNJA 1UI7A 4CPKA 2XRXB 1STDA 2QEX3 1A2VA 1B2ZA 1EG9B 2C4BA 4K1UA 5IENA 2OQEA 1K28A 3M8CA 3EN1B 4MJDA 3SLUA 2HMMB 4HVNA 3SEDA 1YVSA 2WGOA 4K61A 2HOHA 1AVKA 3AHSA 1NB3I 3D5IA 1AY7A 1YNVX 4BTYA 4XDWA 1M1XB 1CYUA 3D3LA 1I3IA 1V58A 2BMOB 1LOVA 1JKGA 3QK9A 1VQO3 1KC84 2Y73A 3MG1A 3SVAA 4GL6A 3EE1A 1CYVA 1GSPA 4HKVB 1I0VA 1LVNA 2UUGC 2XH9A 3F8HA 1GMQA 1K41A 5AIIA 1FGTA 1IYYA 1IV9A 1MGWA 2A15A 1B21A 1I2EA 1TFOA 3F9SA 2P05A 3QRDA 4HM2B 1BAOA 1GMPA 3DGMA 1X1UA 2ZHXB 1X1WA 3CNMA 3MYTA 1YGWA 2KXGA 5AYRB 5LC6A 1G96A 4H61A 3LTAA 3AHWA 2OTJ3 1RGEA 4IIAA 3WOFB 1O7PB 1OF5B 4KFDA 3SYUA 1BRKA 4X2HA 3PGBA 2R4IA 3MPHA 5D82A 2GXFA 1FGRA 1ROVA 3S5CA 3NXJA 3ER7A 1CEWI 3FG3A 1NNVA 4XBTA 2I9WA 2CG1A 1OHOA 4HM8B 4N6NB 2CWVA 1N9JA 2LQVA 3S67A 1D6YA 1GY6A 2L1SA 3GZRA 2KAAA 4N6MA 4I5QA 4L8PA 2XSOB 2CFKA 1FGMA 3D9RA 3MHEA 3NX0A 3DY5A 4LYLB 4J9AA 1TUHA 1J2BA 1JN5B 2CWUA 3FCSB 1BRHA 1RNTA 2GBXB 3SOAA 2F99A 2Y74A 2OCTA 3N9HA 3D4AA 4BTWA 2CIUA 2ML5A 2CH9A 4J5GA 4BIRA 5LC7A 4CDLA 2M7OA 1IVUA 2OOVA 2GSPA 2JQ5A 3K5TA 3CNXA 5STDA 3WA2X 3H3HA 3K63A 2Q07A 1PU4A 3NBBA 1Z1SA 2W56A 1BRJA 1JB2A 2CFLA 1ROAA 1T3BA 5AI1A 1W2ZA 3FG1A 5M1AA 4WWUC 3V99A 3IPTA 1Q7Y4 3KE7A 1Q864 1FA3A 3EX9A 2RGQA 2B1XB 1US1A 2QA43 1NWWA 1MNLA 1GD3A 2H0GA 2H0IA 1O7WB 5HGRA 3D79A 3CCE3 1MWUA 5D81A 2HMNB 4HZBB 1UGIA 1Q40A 3LT8A 1B2XA 1DMMA 4R4KA 4AKYA 1TU5A 1YJN3 1IVWA 3MWZA 4LZIA 2UGIA 7STDA 5IF6A 1BSBA 8RNTA 1VQ83 1ASKA 1W6YA 3GRDA 3OX9A 4HM4B 2D1WA 2BMQB
chains in the Genus database with same CATH topology
1LXEA 3LMLA 3OXAA 1SJWA 5A0OB 1JNQA 3LXUX 3G713 2L4VA 3HZPA 1IQYA 2W9PA 3LT9A 1OPYA 3V98A 1UW1A 5AIGA 1DMNA 3CCR3 1YJW3 4CCVA 1T5YA 4N3VA 4ORLA 1WQLB 3E99A 3PS8A 1W02A 3HIGA 3KFQC 3F40A 3G0KA 3NQZA 2YFJB 3PCRA 4HM5B 2QGUA 1IU7A 1LOXA 3VSYA 2SBLA 1RRHA 3WDGB 4EBGA 1VQ53 2UX0A 5KP3A 4RBNA 1JB5A 2P0MA 4XB5A 1FGQA 4U13A 2P0XA 1U8CB 3G8ZA 3UJMA 3GZYB 5AEWB 1OCVA 1OH0A 3K0ZA 4PEJA 3LTDA 1NJI4 3I563 3CMA3 5D83A 4MMZB 4FMCA 3OWYA 1TP6A 2BT3A 2V1LA 4FMBA 1JB4A 4KVHA 4XBYA 5DRVA 3AMOB 1O7MB 2MF7A 3KIIA 3NBRA 4Q53A 4J8TA 3FF0A 3LH4A 3OWSA 4JRFA 1VQM3 3I553 5TGNA 1WNHA 2YFLB 1IK3A 4HM6B 4AEQA 1QJGA 3BB9A 4WYKB 4XDVA 5IG5A 1WMNA 3LTCA 3MG3A 1RKYA 3K7CA 1OUNA 2PZVA 5AIHA 1VQ43 1OHSA 3L0RA 4ZM8A 2W9QA 3ECFA 3U97A 1TIJA 3DMCA 4O2HA 4R80A 4O02B 4NHFA 3KSED 1U5OA 3T0UA 4OK0A 5IERA 6STDA 1GS3A 1O7NB 1QMAA 3VF1A 4HZ9B 3LOYA 3B4PA 2IA7A 2HMJB 5JPUA 3EBYA 2CW9A 3PCSA 1NB5I 3UL6A 5KP1A 4X2OA 1O7GB 5AEUB 5CXOA 1W6CA 1STFI 2XF3A 5EQLA 1VZZA 5BXQA 3HIIA 3G4S3 4HBRA 5AYSC 2QIYA 5FW5A 4IPBA 2CHCA 1HU9A 2STDA 5CLKA 1A67A 2GEYA 2WGQA 4HM1B 3CD63 3PYJA 4WP5A 4HM3B 1V74A 5ELJA 4H3UA 4RNZA 3CCS3 1ULJB 3CPW2 4FMAA 3RDEA 2YFIB 3EJVA 1C7HA 2BMRB 2JDIH 3IMAB 2GU1A 1K734 4LGQA 1JKGB 3DGOA 4EC6A 5JBSA 5IEPA 3BNBA 2FNQA 5IG3A 1SPUA 2CFDA 5FGOA 3T8NA 3TDGA 3UNLA 2ZL8A 1M904 1K9M4 5BVBA 1YI23 1A90A 1IVVA 2XR8B 3JVCA 3V92A 2LYXA 2CC3A 3JUPA 2XFTA 1GY7A 2Z7AA 4FCMA 5AIFA 1FUWA 1NO3A 1IT7A 4G1MB 3MKIA 1AR0A 2GBWB 1ZO2A 1RN7A 3EQQB 3X42A 3NV0A 1E97A 2PNCA 2CK3H 4MEIA 4GB5A 4EV5A 2GEXA 3HI7A 3H51A 3X3XA 2FGTA 3DUKA 1QVF2 1NDOB 2W03A 3CPOA 1ULIB 4O3VA 2RSXA 1YGEA 4WFOA 4EYCA 2W6JH 3NQYA 3CCV3 1RJOA 3S29A 3CC23 4BTXA 2XSHB 1AV4A 1MOLA 2BHMA 5JPPA 2W04A 3Q90A 4HYZA 1YIJ3 3KN4A 4EXRA 1ZX2A 3EB8A 3NBJA 5DREA 4MMXB 3SXXA 3X3YA 3NHXA 1LNHA 1E3VA 3MSOA 2BO9B 1IDPA 5CF2A 1Q42A 1KQS2 3DZLA 2W56B 1KD14 3JUOA 3CCQ3 1DMQA 4MMYB 3CXC2 5I97A 3CC43 4LEHA 3BLZA 4FCZA 2OTL3 1GD4A 1FGOA 3VGNA 3PZWA 3UL5A 1VQ73 2C10A 3I0YA 3JUMA 2O9UX 1CQSA 3B4OA 1RRLA 5EEOA 5IEOA 2C11A 2IUKA 3DXOA 1W5ZA 1YHQ3 1W7CA 3JUQA 1S723 3F14A 1SQWA 1OF5A 1QAKA 1Q40B 4N6UA 1OGXA 1UI8A 3RGRA 2Z77A 3HX8A 2W2CA 3BNCA 1UUWB 3LTBA 2FXTA 1D6ZA 1S5AA 5G2GA 1IVXA 2XEPA 2CFGA 2K0MA 3N8BA 1DVDA 3FSDA 1YIT3 3Q2PA 2ML6A 3EF8A 1JN5A 2WOHA 3SOYA 3FH1A 1K8A4 1L5GB 1VQ63 4AKZA 1BUQA 2Z76A 4IT7A 3WOEB 3ALAA 2P38A 3N54B 4KFFA 1DVCA 3U1WA 3KKGA 2YX9A 3B7CA 1W01A 1D6UA 2OQEC 1SIHA 3MG2A 1QALA 1O7HB 4I4KA 3GWRA 2F98A 1VQ93 1W6GA 4FR9A 1IQ8A 4LSOA 2KCDA 3G16A 3F7XA 3G6E3 3UB1A 3CCU3 4K90B 4STDA 1Q814 3CC73 2ZDJA 3HK4A 3S27A 3OWUA 3IJEB 2WOFA 1JRQA 3S28A 1N8R4 1QVG2 1KSIA 4LMIA 1VQK3 1EQKA 3PXMA 1Q824 1N5HA 2HMOB 2O3OA 1YVBI 1R4CA 3CCJ3 1WMOA 2CG0A 4KZ1A 1VQP3 1OACA 5CK6A 1A2KA 3KZTA 5KP4A 3FZWA 5EVHA 1VQL3 1GYBA 3NUVA 1N9EA 3BNEA 1YJ93 3WMDA 3Q1CA 4R9KA 4K1VA 2BNGA 8CHOA 3T8UA 3EC9A 1WTHA 1IQXA 4L8OA 4R9LA 3BNDA 3CCL3 2RCDA 4JF8A 2CFWA 1UUVB 4OVMA 4L7KA 3LYGA 2F86B 5IG0A 2HMLB 4WHAA 3CME3 2XGLA 3DGLA 3O8YA 2WO0A 5IG4A 3GZBA 4FCJA 4OUQA 2IMJA 1SIIA 3EHCA 1W00A 1EA2A 1Y4KA 2OOVC 2HMKB 4O8SA 3STDA 3FF2A 4XBXA 1QAFA 3DM8A 1IV7A 2K54A 1W4NA 3WA3A 1OGZA 1E3RA 2XGNA 3AMOA 4N6TA 1TFKA 3X40A 4NREA 3KSPA 3LZAA 3F7SA 2MC8A 2OWPA 4RZMA 3X41A 2E2UA 1N5PA 1VQN3 3FG4A 5IW9A 4WYKA 3RGAA 4XM4A 1N8QA 2CKFB 2CWTA 4EV2A 2B24B 3B8LA 1F8NA 4N6OB 2E2VA 2W0QA 2E2TA 2D42A 3EBTA 3A76A 3X3ZA 3DGNA 3GAXA 2Z6BA 4HJLB 2INXA 1AVLA 4N6LA 2IUJA 1W2B2 3J7Yd 3EN8A 2KRTA 1DYUA 3FLJA 4KFEA 4R1KA 5ELUA 3F8XA 3WODG 1HKXA 4HM0B 3JUNA 3OV4A 1GY5A 3CU3A 1NU3A 4RNYA 1JV2B 1KWIA 1M9GA 3NV0B 4N6V0 4QWTA 1JJ22 3K9MC 3GZXB 3OW22 2GU3A 4TX4A 1PFPA 4HM7B 1M1K4 4FMDA 3CCM3 1IT8A 1WMPA 1EKMA 3NM7A 2XFSA 3NM2A 3FGYA 3ROBA 5CF1A 3SX1A 1OHPA 2P09A 2RFRA 3FKAA 1UI7A 2XRXB 1STDA 2QEX3 1A2VA 1EG9B 4K1UA 5IENA 2OQEA 1K28A 3M8CA 3EN1B 4MJDA 3SLUA 2HMMB 4HVNA 3SEDA 4K61A 2WGOA 1AVKA 1NB3I 4BTYA 4XDWA 1M1XB 1CYUA 3D3LA 2BMOB 3QK9A 1VQO3 1JKGA 1KC84 2Y73A 3MG1A 3SVAA 4GL6A 3EE1A 1CYVA 4HKVB 1LVNA 2XH9A 3F8HA 1K41A 5AIIA 1FGTA 1IV9A 3F9SA 2A15A 1TFOA 3QRDA 2P05A 4HM2B 3DGMA 3CNMA 3MYTA 2KXGA 5AYRB 5LC6A 1G96A 4H61A 3LTAA 2OTJ3 4IIAA 3WOFB 1O7PB 1OF5B 4KFDA 4X2HA 3PGBA 2R4IA 3MPHA 5D82A 2GXFA 1FGRA 1ROVA 3S5CA 3NXJA 3ER7A 1CEWI 3FG3A 4XBTA 2I9WA 2CG1A 1OHOA 4HM8B 4N6NB 2CWVA 1N9JA 2LQVA 3S67A 1D6YA 1GY6A 3GZRA 4N6MA 4L8PA 2XSOB 2CFKA 1FGMA 3D9RA 3MHEA 3NX0A 3DY5A 4J9AA 1TUHA 1J2BA 1JN5B 2CWUA 3FCSB 2GBXB 3SOAA 2F99A 2Y74A 2OCTA 3N9HA 4BTWA 2CIUA 2ML5A 2CH9A 5LC7A 4CDLA 2M7OA 1IVUA 2OOVA 2JQ5A 3K5TA 3CNXA 5STDA 3WA2X 3H3HA 3K63A 2Q07A 1PU4A 3NBBA 2W56A 1Z1SA 1JB2A 2CFLA 1ROAA 5AI1A 1W2ZA 3FG1A 3V99A 4WWUC 3IPTA 1Q7Y4 3KE7A 1Q864 1FA3A 3EX9A 2RGQA 2B1XB 1US1A 2QA43 1NWWA 1MNLA 1GD3A 1O7WB 5HGRA 3CCE3 5D81A 2HMNB 4HZBB 1Q40A 3LT8A 1ISKA 1DMMA 4R4KA 1TU5A 4AKYA 1YJN3 1IVWA 3MWZA 4LZIA 7STDA 5IF6A 1VQ83 1ASKA 1W6YA 3GRDA 3OX9A 4HM4B 2D1WA 2BMQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXA A;  1SJW A;  3HZP A;  1OPY A;  5AIG A;  1DMN A;  4N3V A;  4ORL A;  1WQL B;  3E99 A;  1W02 A;  3F40 A;  3G0K A;  2YFJ B;  4HM5 B;  2QGU A;  3VSY A;  2UX0 A;  5KP3 A;  1JB5 A;  4XB5 A;  4U13 A;  3G8Z A;  3UJM A;  3GZY B;  5AEW B;  1OCV A;  1OH0 A;  3K0Z A;  4PEJ A;  5D83 A;  3OWY A;  1TP6 A;  1JB4 A;  4KVH A;  4XBY A;  5DRV A;  1O7M B;  3NBR A;  4Q53 A;  4J8T A;  3FF0 A;  3OWS A;  5TGN A;  2YFL B;  4HM6 B;  1QJG A;  3BB9 A;  4WYK B;  4XDV A;  5IG5 A;  3MG3 A;  3K7C A;  1OUN A;  2PZV A;  5AIH A;  1OHS A;  3ECF A;  3DMC A;  1U5O A;  5IER A;  6STD A;  1GS3 A;  1O7N B;  1QMA A;  4HZ9 B;  3B4P A;  2HMJ B;  5JPU A;  3EBY A;  5KP1 A;  4X2O A;  1O7G B;  5AEU B;  5CXO A;  1VZZ A;  5BXQ A;  2QIY A;  5FW5 A;  2CHC A;  2STD A;  5CLK A;  2GEY A;  4HM1 B;  4WP5 A;  4HM3 B;  4H3U A;  1ULJ B;  2YFI B;  3EJV A;  1C7H A;  2BMR B;  4LGQ A;  1JKG B;  5IEP A;  5IG3 A;  3T8N A;  3UNL A;  5BVB A;  2XR8 B;  5AIF A;  3JUP A;  4FCM A;  1GY7 A;  2Z7A A;  3MKI A;  1AR0 A;  2GBW B;  1ZO2 A;  3EQQ B;  3NV0 A;  1E97 A;  4GB5 A;  2GEX A;  3H51 A;  3DUK A;  1NDO B;  3CPO A;  1ULI B;  2XSH B;  5JPP A;  3Q90 A;  1ZX2 A;  5DRE A;  3NHX A;  1E3V A;  3MSO A;  1IDP A;  5CF2 A;  1Q42 A;  3DZL A;  3JUO A;  1DMQ A;  4LEH A;  3BLZ A;  3VGN A;  3I0Y A;  3JUM A;  1CQS A;  3B4O A;  5IEO A;  3DXO A;  3JUQ A;  3F14 A;  1OF5 A;  1Q40 B;  1OGX A;  3RGR A;  2Z77 A;  3HX8 A;  2W2C A;  1UUW B;  1S5A A;  5G2G A;  3FSD A;  3EF8 A;  1JN5 A;  3SOY A;  3FH1 A;  1BUQ A;  2Z76 A;  3KKG A;  3B7C A;  1W01 A;  3MG2 A;  1O7H B;  4I4K A;  3GWR A;  2F98 A;  3G16 A;  3F7X A;  4STD A;  3HK4 A;  3OWU A;  4LMI A;  2HMO B;  5CK6 A;  1A2K A;  3KZT A;  5KP4 A;  3FZW A;  5EVH A;  1GYB A;  3NUV A;  3WMD A;  4R9K A;  4K1V A;  2BNG A;  8CHO A;  3T8U A;  3EC9 A;  4L8O A;  4R9L A;  2RCD A;  1UUV B;  4OVM A;  4L7K A;  3LYG A;  2F86 B;  5IG0 A;  2HML B;  5IG4 A;  3GZB A;  4FCJ A;  4OUQ A;  2IMJ A;  3EHC A;  1W00 A;  1EA2 A;  3STD A;  2HMK B;  3FF2 A;  4XBX A;  3DM8 A;  2K54 A;  1OGZ A;  1E3R A;  3KSP A;  3LZA A;  3F7S A;  2OWP A;  4RZM A;  4WYK A;  3RGA A;  4XM4 A;  2CKF B;  2B24 B;  3B8L A;  3EBT A;  3A76 A;  4HJL B;  2INX A;  3EN8 A;  3FLJ A;  4R1K A;  3F8X A;  1HKX A;  4HM0 B;  3JUN A;  3OV4 A;  1GY5 A;  3CU3 A;  1NU3 A;  3NV0 B;  3GZX B;  4HM7 B;  3NM2 A;  3FGY A;  3ROB A;  5CF1 A;  1OHP A;  2RFR A;  3FKA A;  2XRX B;  1STD A;  1EG9 B;  4K1U A;  5IEN A;  3M8C A;  4MJD A;  3EN1 B;  2HMM B;  4HVN A;  3SED A;  4XDW A;  2BMO B;  1JKG A;  3MG1 A;  4HKV B;  3F8H A;  1K41 A;  5AII A;  3F9S A;  2A15 A;  4HM2 B;  3CNM A;  3MYT A;  4IIA A;  1O7P B;  1OF5 B;  4X2H A;  2R4I A;  5D82 A;  2GXF A;  3S5C A;  3NXJ A;  3ER7 A;  4XBT A;  2I9W A;  1OHO A;  4HM8 B;  1GY6 A;  3GZR A;  4L8P A;  2XSO B;  3MHE A;  3D9R A;  4J9A A;  1TUH A;  1JN5 B;  2GBX B;  3SOA A;  2F99 A;  4CDL A;  2JQ5 A;  3CNX A;  5STD A;  3H3H A;  1Z1S A;  1JB2 A;  5AI1 A;  4WWU C;  3IPT A;  3KE7 A;  3EX9 A;  2RGQ A;  2B1X B;  1NWW A;  1O7W B;  5HGR A;  5D81 A;  2HMN B;  4HZB B;  1Q40 A;  1ISK A;  1DMM A;  7STD A;  5IF6 A;  1ASK A;  1W6Y A;  3GRD A;  3OX9 A;  4HM4 B;  2BMQ B; 
#chains in the Genus database with same CATH topology
 1LXE A;  3Q3F A;  3LML A;  3OXA A;  1SJW A;  5A0O B;  1JNQ A;  3LXU X;  3G71 3;  1LQM B;  1MWS A;  2L4V A;  3HZP A;  1IQY A;  2W9P A;  3LT9 A;  1OPY A;  3V98 A;  3WHO A;  1UW1 A;  4BL2 A;  2BU4 A;  1DMN A;  5AIG A;  3CCR 3;  1RMS A;  1YJW 3;  1BNG A;  4CCV A;  1BGS A;  1T5Y A;  4N3V A;  4ORL A;  1WQL B;  3E99 A;  1B20 A;  3PS8 A;  3URP A;  1MWT A;  1W02 A;  1PYL A;  3HIG A;  1RN1 A;  3KFQ C;  1RTU A;  1BUJ A;  1BSD A;  4HAA A;  3F40 A;  3G0K A;  1BIR A;  3NQZ A;  2YFJ B;  3PCR A;  4HM5 B;  2QGU A;  1IU7 A;  1LOX A;  3VSY A;  2SBL A;  1RRH A;  3WDG B;  4EBG A;  1VQ5 3;  1RHL A;  9RNT A;  2UX0 A;  5KP3 A;  4RBN A;  1JB5 A;  2P0M A;  4XB5 A;  1UDI I;  1FGQ A;  4J5K A;  4U13 A;  2P0X A;  1HYF A;  1U8C B;  3G8Z A;  3UJM A;  1BSE A;  1RGK A;  1FZU A;  1OCV A;  1OH0 A;  2J8X B;  3GZY B;  3K0Z A;  3LTD A;  4PEJ A;  5AEW B;  3I56 3;  2RNT A;  5D83 A;  1NJI 4;  1EUI C;  3CMA 3;  4MMZ B;  1BNR A;  4FMC A;  3OWY A;  1TP6 A;  2BT3 A;  2V1L A;  1T2H A;  4FMB A;  1JB4 A;  4KVH A;  4GSP A;  4NPB A;  4ILF A;  4XBY A;  5DRV A;  1I3F A;  3AMO B;  3BIR A;  1O7M B;  2MF7 A;  3KII A;  1LRA A;  3NBR A;  4Q53 A;  4J8T A;  3FF0 A;  1LOW A;  3LH4 A;  3OWS A;  4JRF A;  1VQM 3;  3I55 3;  1LNI A;  5TGN A;  1WNH A;  2YFL B;  1IK3 A;  4HM6 B;  4AEQ A;  1QJG A;  3BB9 A;  1BNF A;  4WYK B;  1I8V A;  5RNT A;  4XDV A;  5IG5 A;  1WMN A;  3LTC A;  3MG3 A;  1RKY A;  3K7C A;  1I2G A;  4EW5 A;  1ZS7 A;  1OUN A;  2PZV A;  5AIH A;  1VQ4 3;  1OHS A;  3L0R A;  3RNT A;  2RBI A;  4ZM8 A;  2W9Q A;  3ECF A;  3U97 A;  1TIJ A;  3DMC A;  4O2H A;  4R80 A;  4O02 B;  4NHF A;  3KSE D;  5M18 A;  1U5O A;  3T0U A;  4OK0 A;  5IER A;  6STD A;  1RGH A;  1GS3 A;  1O7N B;  1QMA A;  3VF1 A;  4HZ9 B;  1RNB A;  3LOY A;  3B4P A;  1UUG B;  2IA7 A;  2HMJ B;  5JPU A;  3EBY A;  2CW9 A;  3PCS A;  1ZGX A;  1NB5 I;  3UL6 A;  5KP1 A;  2SAR A;  4X2O A;  1O7G B;  5AEU B;  5CXO A;  1W6C A;  1STF I;  2XF3 A;  5EQL A;  1VZZ A;  5BXQ A;  3HII A;  1RGC A;  3G4S 3;  3DGY A;  1B3S A;  4HBR A;  5AYS C;  2QIY A;  5FW5 A;  2BIR A;  4IPB A;  2CHC A;  1HU9 A;  2STD A;  5CLK A;  1A67 A;  2GEY A;  2WGQ A;  4HM1 B;  3CD6 3;  3PYJ A;  1BSA A;  4WP5 A;  4HM3 B;  1V74 A;  5ELJ A;  4H3U A;  2IYJ A;  3WR2 A;  4RNZ A;  3CCS 3;  1ULJ B;  1G0T A;  3CPW 2;  4FMA A;  3RDE A;  1BNI A;  2YFI B;  3EJV A;  1BRI A;  1C7H A;  2BMR B;  1G02 A;  2JDI H;  3IMA B;  2GU1 A;  1K73 4;  4LGQ A;  1JKG B;  3DGO A;  4EC6 A;  1DET A;  5JBS A;  5IEP A;  3BNB A;  2FNQ A;  5IG3 A;  1MGR A;  1SPU A;  2CFD A;  5FGO A;  3T8N A;  3TDG A;  3UNL A;  2ZL8 A;  1M90 4;  1K9M 4;  5BVB A;  1YI2 3;  1A90 A;  1IVV A;  2XR8 B;  1BOX A;  3JVC A;  3V92 A;  5M19 A;  2LYX A;  5G1K A;  2CC3 A;  3JUP A;  2XFT A;  1GY7 A;  2Z7A A;  4FCM A;  5AIF A;  1RGF A;  1FUW A;  1NO3 A;  1IT7 A;  4G1M B;  3MKI A;  1AR0 A;  1R4Y A;  1RCK A;  2GBW B;  1ZO2 A;  1RN7 A;  3EQQ B;  3X42 A;  3NV0 A;  1E97 A;  2PNC A;  1JZO A;  2CX1 A;  1C54 A;  2CK3 H;  1B2S A;  4MEI A;  4GB5 A;  2AAD A;  4EV5 A;  2GEX A;  3HI7 A;  3H51 A;  1A2P A;  1RSN A;  3X3X A;  2FGT A;  3DUK A;  1QVF 2;  1NDO B;  2W03 A;  1RN4 A;  3CPO A;  1ULI B;  4O3V A;  2RSX A;  1YGE A;  3KCH A;  4WFO A;  4EYC A;  2W6J H;  1JBS A;  3NQY A;  3CCV 3;  1RJO A;  3S29 A;  1CH0 A;  3CC2 3;  1Q9E A;  4BTX A;  2XSH B;  1AV4 A;  1MOL A;  2BHM A;  5JPP A;  2CX0 A;  2W04 A;  3Q90 A;  4HYZ A;  1YIJ 3;  1FYS A;  1BU4 A;  3KN4 A;  4EXR A;  1UCJ A;  1ZX2 A;  1LQG C;  3HOH A;  3EB8 A;  3NBJ A;  1B27 A;  4MMX B;  5DRE A;  3SXX A;  3NHX A;  3X3Y A;  6RNT A;  1ISK A;  1LNH A;  2F4Y A;  1E3V A;  3MSO A;  1VQQ A;  2BO9 B;  1IDP A;  5CF2 A;  1Q42 A;  1KQS 2;  3DZL A;  2W56 B;  1KD1 4;  3JUO A;  3CCQ 3;  1DMQ A;  4MMY B;  3CXC 2;  5I97 A;  3CC4 3;  4LEH A;  3BLZ A;  2R41 A;  4FCZ A;  2OTL 3;  1GD4 A;  1FGO A;  1FUT A;  3VGN A;  2H0H A;  3PZW A;  3UL5 A;  1VQ7 3;  2C10 A;  3I0Y A;  3JUM A;  2O9U X;  1CQS A;  3B4O A;  1RRL A;  5EEO A;  5IEO A;  2C11 A;  2IUK A;  3DXO A;  1BRN L;  1W5Z A;  1YHQ 3;  1W7C A;  3JUQ A;  1S72 3;  3F14 A;  1SQW A;  1OF5 A;  1QAK A;  1Q40 B;  1X1X A;  4N6U A;  1OGX A;  1UI8 A;  3RGR A;  2Z77 A;  3HX8 A;  2W2C A;  1I2F A;  3BNC A;  1UUW B;  3LTB A;  2FXT A;  1D6Z A;  1S5A A;  5G2G A;  1IVX A;  2XEP A;  2CFG A;  2K0M A;  3N8B A;  1DVD A;  1TRQ A;  3FSD A;  1YIT 3;  3Q2P A;  1AQZ A;  2F56 A;  2ML6 A;  2KF6 A;  3EF8 A;  1JN5 A;  2WOH A;  3SOY A;  3FH1 A;  3ZFZ A;  1GOY A;  1K8A 4;  1L5G B;  1VQ6 3;  4AKZ A;  1BUQ A;  1BSC A;  2Z76 A;  4IT7 A;  4GHO A;  3ALA A;  3WOE B;  2P38 A;  3N54 B;  4KFF A;  1GOU A;  1DVC A;  3U1W A;  3KKG A;  1I0X A;  2YX9 A;  3B7C A;  1W01 A;  3A5E A;  1D6U A;  2OQE C;  1SIH A;  3MG2 A;  1QAL A;  1O7H B;  4I4K A;  2KF5 A;  3GWR A;  2F98 A;  1VQ9 3;  1W6G A;  4FR9 A;  1IQ8 A;  3AGN A;  4LSO A;  1RDS A;  2KCD A;  3G16 A;  3F7X A;  3G6E 3;  3UB1 A;  2ZA4 A;  3CCU 3;  2K3D A;  4K90 B;  4STD A;  1GMR A;  1Q81 4;  3CC7 3;  3ZG0 A;  1BRG A;  2IY2 A;  2ZDJ A;  3HK4 A;  3S27 A;  3OWU A;  3IJE B;  2WOF A;  1JRQ A;  1RGL A;  1B2U A;  1JZD A;  1UCL A;  1UGH I;  3S28 A;  1KSI A;  1QVG 2;  1N8R 4;  4LMI A;  2F5M A;  1VQK 3;  1EQK A;  3PXM A;  4RNT A;  1Q82 4;  1N5H A;  2HMO B;  2O3O A;  2KF3 A;  1YVB I;  1R4C A;  1RGA A;  5GSP A;  3CCJ 3;  1WMO A;  2CG0 A;  4KZ1 A;  1VQP 3;  1OAC A;  5CK6 A;  4CJN A;  1A2K A;  3KZT A;  5KP4 A;  1UCI A;  5BIR A;  3FZW A;  5EVH A;  1VQL 3;  1GYB A;  2F5W A;  3AGO A;  3NUV A;  1N9E A;  3BNE A;  1YJ9 3;  3WMD A;  3Q1C A;  3DH2 A;  1X1Y A;  4K1V A;  4KT3 B;  4R9K A;  4BU4 A;  2BNG A;  8CHO A;  1JBR A;  3T8U A;  3EC9 A;  1WTH A;  1DE3 A;  1IQX A;  1HZ1 A;  4L8O A;  4R9L A;  6GSP A;  3BND A;  3CCL 3;  2RCD A;  4JF8 A;  2CFW A;  1UUV B;  4OVM A;  4L7K A;  1TTO A;  3LYG A;  2F86 B;  5IG0 A;  1EEJ A;  2HML B;  4WHA A;  3CME 3;  2XGL A;  3DGL A;  1BAN A;  3GSP A;  3O8Y A;  2WO0 A;  4DKI A;  3GZB A;  5IG4 A;  1PY3 A;  4FCJ A;  4OUQ A;  2IMJ A;  1SII A;  3EHC A;  1W00 A;  1EA2 A;  1Y4K A;  2OOV C;  2HMK B;  4O8S A;  3STD A;  1V57 A;  3FF2 A;  4XBX A;  1QAF A;  3DM8 A;  1IV7 A;  5HOH A;  1JBT A;  2K54 A;  1W4N A;  1GOV A;  5BU4 A;  3WA3 A;  1OGZ A;  1E3R A;  2XGN A;  3AMO A;  1T2I A;  4N6T A;  1TFK A;  3X40 A;  7GSP A;  4NRE A;  3KSP A;  3LZA A;  3F7S A;  2MC8 A;  2OWP A;  4RZM A;  3X41 A;  7RNT A;  5G1L A;  2E2U A;  1N5P A;  1VQN 3;  3FG4 A;  5IW9 A;  1BVI A;  4WYK A;  3RGA A;  1RGG A;  4XM4 A;  1N8Q A;  2CKF B;  2CWT A;  4EV2 A;  2B24 B;  3B8L A;  1F8N A;  4N6O B;  2E2V A;  1Q7H A;  2W0Q A;  2E2T A;  2D42 A;  3EBT A;  3A76 A;  3X3Z A;  3DGN A;  3GAX A;  2Z6B A;  4HJL B;  2INX A;  1AVL A;  4N6L A;  2IUJ A;  1W2B 2;  1BRS A;  3J7Y d;  3EN8 A;  2KRT A;  1TRP A;  1DYU A;  3FLJ A;  4KFE A;  4R1K A;  5ELU A;  3F8X A;  3D5G A;  3BU4 A;  3WOD G;  3ZG5 A;  1FW7 A;  1HKX A;  1MWR A;  1RLS A;  3JUN A;  1GY5 A;  3OV4 A;  4HM0 B;  3CU3 A;  4HOH A;  1NU3 A;  4RNY A;  1JV2 B;  1KWI A;  1M9G A;  3NV0 B;  4N6V 0;  4QWT A;  1JJ2 2;  3K9M C;  3GZX B;  3OW2 2;  1BNE A;  2GU3 A;  1PFP A;  4HM7 B;  4TX4 A;  4BL3 A;  1M1K 4;  1UCK A;  4FMD A;  1TJD A;  3CCM 3;  2KF4 A;  1IT8 A;  1WMP A;  2AAE A;  1EKM A;  3NM7 A;  2XFS A;  3NM2 A;  1B2M A;  1SAR A;  1I70 A;  3FGY A;  3ROB A;  1BNS A;  1FUS A;  3SX1 A;  5CF1 A;  1LOY A;  1OHP A;  2P09 A;  1RCL A;  2RFR A;  3FKA A;  1BNJ A;  1UI7 A;  4CPK A;  2XRX B;  1STD A;  2QEX 3;  1A2V A;  1B2Z A;  1EG9 B;  2C4B A;  4K1U A;  5IEN A;  2OQE A;  1K28 A;  3M8C A;  3EN1 B;  4MJD A;  3SLU A;  2HMM B;  4HVN A;  3SED A;  1YVS A;  2WGO A;  4K61 A;  2HOH A;  1AVK A;  3AHS A;  1NB3 I;  3D5I A;  1AY7 A;  1YNV X;  4BTY A;  4XDW A;  1M1X B;  1CYU A;  3D3L A;  1I3I A;  1V58 A;  2BMO B;  1LOV A;  1JKG A;  3QK9 A;  1VQO 3;  1KC8 4;  2Y73 A;  3MG1 A;  3SVA A;  4GL6 A;  3EE1 A;  1CYV A;  1GSP A;  4HKV B;  1I0V A;  1LVN A;  2UUG C;  2XH9 A;  3F8H A;  1GMQ A;  1K41 A;  5AII A;  1FGT A;  1IYY A;  1IV9 A;  1MGW A;  2A15 A;  1B21 A;  1I2E A;  1TFO A;  3F9S A;  2P05 A;  3QRD A;  4HM2 B;  1BAO A;  1GMP A;  3DGM A;  1X1U A;  2ZHX B;  1X1W A;  3CNM A;  3MYT A;  1YGW A;  2KXG A;  5AYR B;  5LC6 A;  1G96 A;  4H61 A;  3LTA A;  3AHW A;  2OTJ 3;  1RGE A;  4IIA A;  3WOF B;  1O7P B;  1OF5 B;  4KFD A;  3SYU A;  1BRK A;  4X2H A;  3PGB A;  2R4I A;  3MPH A;  5D82 A;  2GXF A;  1FGR A;  1ROV A;  3S5C A;  3NXJ A;  3ER7 A;  1CEW I;  3FG3 A;  1NNV A;  4XBT A;  2I9W A;  2CG1 A;  1OHO A;  4HM8 B;  4N6N B;  2CWV A;  1N9J A;  2LQV A;  3S67 A;  1D6Y A;  1GY6 A;  2L1S A;  3GZR A;  2KAA A;  4N6M A;  4I5Q A;  4L8P A;  2XSO B;  2CFK A;  1FGM A;  3D9R A;  3MHE A;  3NX0 A;  3DY5 A;  4LYL B;  4J9A A;  1TUH A;  1J2B A;  1JN5 B;  2CWU A;  3FCS B;  1BRH A;  1RNT A;  2GBX B;  3SOA A;  2F99 A;  2Y74 A;  2OCT A;  3N9H A;  3D4A A;  4BTW A;  2CIU A;  2ML5 A;  2CH9 A;  4J5G A;  4BIR A;  5LC7 A;  4CDL A;  2M7O A;  1IVU A;  2OOV A;  2GSP A;  2JQ5 A;  3K5T A;  3CNX A;  5STD A;  3WA2 X;  3H3H A;  3K63 A;  2Q07 A;  1PU4 A;  3NBB A;  1Z1S A;  2W56 A;  1BRJ A;  1JB2 A;  2CFL A;  1ROA A;  1T3B A;  5AI1 A;  1W2Z A;  3FG1 A;  5M1A A;  4WWU C;  3V99 A;  3IPT A;  1Q7Y 4;  3KE7 A;  1Q86 4;  1FA3 A;  3EX9 A;  2RGQ A;  2B1X B;  1US1 A;  2QA4 3;  1NWW A;  1MNL A;  1GD3 A;  2H0G A;  2H0I A;  1O7W B;  5HGR A;  3D79 A;  3CCE 3;  1MWU A;  5D81 A;  2HMN B;  4HZB B;  1UGI A;  1Q40 A;  3LT8 A;  1B2X A;  1DMM A;  4R4K A;  4AKY A;  1TU5 A;  1YJN 3;  1IVW A;  3MWZ A;  4LZI A;  2UGI A;  7STD A;  5IF6 A;  1BSB A;  8RNT A;  1VQ8 3;  1ASK A;  1W6Y A;  3GRD A;  3OX9 A;  4HM4 B;  2D1W A;  2BMQ B; 
#chains in the Genus database with same CATH homology
 1LXE A;  3LML A;  3OXA A;  1SJW A;  5A0O B;  1JNQ A;  3LXU X;  3G71 3;  2L4V A;  3HZP A;  1IQY A;  2W9P A;  3LT9 A;  1OPY A;  3V98 A;  1UW1 A;  5AIG A;  1DMN A;  3CCR 3;  1YJW 3;  4CCV A;  1T5Y A;  4N3V A;  4ORL A;  1WQL B;  3E99 A;  3PS8 A;  1W02 A;  3HIG A;  3KFQ C;  3F40 A;  3G0K A;  3NQZ A;  2YFJ B;  3PCR A;  4HM5 B;  2QGU A;  1IU7 A;  1LOX A;  3VSY A;  2SBL A;  1RRH A;  3WDG B;  4EBG A;  1VQ5 3;  2UX0 A;  5KP3 A;  4RBN A;  1JB5 A;  2P0M A;  4XB5 A;  1FGQ A;  4U13 A;  2P0X A;  1U8C B;  3G8Z A;  3UJM A;  3GZY B;  5AEW B;  1OCV A;  1OH0 A;  3K0Z A;  4PEJ A;  3LTD A;  1NJI 4;  3I56 3;  3CMA 3;  5D83 A;  4MMZ B;  4FMC A;  3OWY A;  1TP6 A;  2BT3 A;  2V1L A;  4FMB A;  1JB4 A;  4KVH A;  4XBY A;  5DRV A;  3AMO B;  1O7M B;  2MF7 A;  3KII A;  3NBR A;  4Q53 A;  4J8T A;  3FF0 A;  3LH4 A;  3OWS A;  4JRF A;  1VQM 3;  3I55 3;  5TGN A;  1WNH A;  2YFL B;  1IK3 A;  4HM6 B;  4AEQ A;  1QJG A;  3BB9 A;  4WYK B;  4XDV A;  5IG5 A;  1WMN A;  3LTC A;  3MG3 A;  1RKY A;  3K7C A;  1OUN A;  2PZV A;  5AIH A;  1VQ4 3;  1OHS A;  3L0R A;  4ZM8 A;  2W9Q A;  3ECF A;  3U97 A;  1TIJ A;  3DMC A;  4O2H A;  4R80 A;  4O02 B;  4NHF A;  3KSE D;  1U5O A;  3T0U A;  4OK0 A;  5IER A;  6STD A;  1GS3 A;  1O7N B;  1QMA A;  3VF1 A;  4HZ9 B;  3LOY A;  3B4P A;  2IA7 A;  2HMJ B;  5JPU A;  3EBY A;  2CW9 A;  3PCS A;  1NB5 I;  3UL6 A;  5KP1 A;  4X2O A;  1O7G B;  5AEU B;  5CXO A;  1W6C A;  1STF I;  2XF3 A;  5EQL A;  1VZZ A;  5BXQ A;  3HII A;  3G4S 3;  4HBR A;  5AYS C;  2QIY A;  5FW5 A;  4IPB A;  2CHC A;  1HU9 A;  2STD A;  5CLK A;  1A67 A;  2GEY A;  2WGQ A;  4HM1 B;  3CD6 3;  3PYJ A;  4WP5 A;  4HM3 B;  1V74 A;  5ELJ A;  4H3U A;  4RNZ A;  3CCS 3;  1ULJ B;  3CPW 2;  4FMA A;  3RDE A;  2YFI B;  3EJV A;  1C7H A;  2BMR B;  2JDI H;  3IMA B;  2GU1 A;  1K73 4;  4LGQ A;  1JKG B;  3DGO A;  4EC6 A;  5JBS A;  5IEP A;  3BNB A;  2FNQ A;  5IG3 A;  1SPU A;  2CFD A;  5FGO A;  3T8N A;  3TDG A;  3UNL A;  2ZL8 A;  1M90 4;  1K9M 4;  5BVB A;  1YI2 3;  1A90 A;  1IVV A;  2XR8 B;  3JVC A;  3V92 A;  2LYX A;  2CC3 A;  3JUP A;  2XFT A;  1GY7 A;  2Z7A A;  4FCM A;  5AIF A;  1FUW A;  1NO3 A;  1IT7 A;  4G1M B;  3MKI A;  1AR0 A;  2GBW B;  1ZO2 A;  1RN7 A;  3EQQ B;  3X42 A;  3NV0 A;  1E97 A;  2PNC A;  2CK3 H;  4MEI A;  4GB5 A;  4EV5 A;  2GEX A;  3HI7 A;  3H51 A;  3X3X A;  2FGT A;  3DUK A;  1QVF 2;  1NDO B;  2W03 A;  3CPO A;  1ULI B;  4O3V A;  2RSX A;  1YGE A;  4WFO A;  4EYC A;  2W6J H;  3NQY A;  3CCV 3;  1RJO A;  3S29 A;  3CC2 3;  4BTX A;  2XSH B;  1AV4 A;  1MOL A;  2BHM A;  5JPP A;  2W04 A;  3Q90 A;  4HYZ A;  1YIJ 3;  3KN4 A;  4EXR A;  1ZX2 A;  3EB8 A;  3NBJ A;  5DRE A;  4MMX B;  3SXX A;  3X3Y A;  3NHX A;  1LNH A;  1E3V A;  3MSO A;  2BO9 B;  1IDP A;  5CF2 A;  1Q42 A;  1KQS 2;  3DZL A;  2W56 B;  1KD1 4;  3JUO A;  3CCQ 3;  1DMQ A;  4MMY B;  3CXC 2;  5I97 A;  3CC4 3;  4LEH A;  3BLZ A;  4FCZ A;  2OTL 3;  1GD4 A;  1FGO A;  3VGN A;  3PZW A;  3UL5 A;  1VQ7 3;  2C10 A;  3I0Y A;  3JUM A;  2O9U X;  1CQS A;  3B4O A;  1RRL A;  5EEO A;  5IEO A;  2C11 A;  2IUK A;  3DXO A;  1W5Z A;  1YHQ 3;  1W7C A;  3JUQ A;  1S72 3;  3F14 A;  1SQW A;  1OF5 A;  1QAK A;  1Q40 B;  4N6U A;  1OGX A;  1UI8 A;  3RGR A;  2Z77 A;  3HX8 A;  2W2C A;  3BNC A;  1UUW B;  3LTB A;  2FXT A;  1D6Z A;  1S5A A;  5G2G A;  1IVX A;  2XEP A;  2CFG A;  2K0M A;  3N8B A;  1DVD A;  3FSD A;  1YIT 3;  3Q2P A;  2ML6 A;  3EF8 A;  1JN5 A;  2WOH A;  3SOY A;  3FH1 A;  1K8A 4;  1L5G B;  1VQ6 3;  4AKZ A;  1BUQ A;  2Z76 A;  4IT7 A;  3WOE B;  3ALA A;  2P38 A;  3N54 B;  4KFF A;  1DVC A;  3U1W A;  3KKG A;  2YX9 A;  3B7C A;  1W01 A;  1D6U A;  2OQE C;  1SIH A;  3MG2 A;  1QAL A;  1O7H B;  4I4K A;  3GWR A;  2F98 A;  1VQ9 3;  1W6G A;  4FR9 A;  1IQ8 A;  4LSO A;  2KCD A;  3G16 A;  3F7X A;  3G6E 3;  3UB1 A;  3CCU 3;  4K90 B;  4STD A;  1Q81 4;  3CC7 3;  2ZDJ A;  3HK4 A;  3S27 A;  3OWU A;  3IJE B;  2WOF A;  1JRQ A;  3S28 A;  1N8R 4;  1QVG 2;  1KSI A;  4LMI A;  1VQK 3;  1EQK A;  3PXM A;  1Q82 4;  1N5H A;  2HMO B;  2O3O A;  1YVB I;  1R4C A;  3CCJ 3;  1WMO A;  2CG0 A;  4KZ1 A;  1VQP 3;  1OAC A;  5CK6 A;  1A2K A;  3KZT A;  5KP4 A;  3FZW A;  5EVH A;  1VQL 3;  1GYB A;  3NUV A;  1N9E A;  3BNE A;  1YJ9 3;  3WMD A;  3Q1C A;  4R9K A;  4K1V A;  2BNG A;  8CHO A;  3T8U A;  3EC9 A;  1WTH A;  1IQX A;  4L8O A;  4R9L A;  3BND A;  3CCL 3;  2RCD A;  4JF8 A;  2CFW A;  1UUV B;  4OVM A;  4L7K A;  3LYG A;  2F86 B;  5IG0 A;  2HML B;  4WHA A;  3CME 3;  2XGL A;  3DGL A;  3O8Y A;  2WO0 A;  5IG4 A;  3GZB A;  4FCJ A;  4OUQ A;  2IMJ A;  1SII A;  3EHC A;  1W00 A;  1EA2 A;  1Y4K A;  2OOV C;  2HMK B;  4O8S A;  3STD A;  3FF2 A;  4XBX A;  1QAF A;  3DM8 A;  1IV7 A;  2K54 A;  1W4N A;  3WA3 A;  1OGZ A;  1E3R A;  2XGN A;  3AMO A;  4N6T A;  1TFK A;  3X40 A;  4NRE A;  3KSP A;  3LZA A;  3F7S A;  2MC8 A;  2OWP A;  4RZM A;  3X41 A;  2E2U A;  1N5P A;  1VQN 3;  3FG4 A;  5IW9 A;  4WYK A;  3RGA A;  4XM4 A;  1N8Q A;  2CKF B;  2CWT A;  4EV2 A;  2B24 B;  3B8L A;  1F8N A;  4N6O B;  2E2V A;  2W0Q A;  2E2T A;  2D42 A;  3EBT A;  3A76 A;  3X3Z A;  3DGN A;  3GAX A;  2Z6B A;  4HJL B;  2INX A;  1AVL A;  4N6L A;  2IUJ A;  1W2B 2;  3J7Y d;  3EN8 A;  2KRT A;  1DYU A;  3FLJ A;  4KFE A;  4R1K A;  5ELU A;  3F8X A;  3WOD G;  1HKX A;  4HM0 B;  3JUN A;  3OV4 A;  1GY5 A;  3CU3 A;  1NU3 A;  4RNY A;  1JV2 B;  1KWI A;  1M9G A;  3NV0 B;  4N6V 0;  4QWT A;  1JJ2 2;  3K9M C;  3GZX B;  3OW2 2;  2GU3 A;  4TX4 A;  1PFP A;  4HM7 B;  1M1K 4;  4FMD A;  3CCM 3;  1IT8 A;  1WMP A;  1EKM A;  3NM7 A;  2XFS A;  3NM2 A;  3FGY A;  3ROB A;  5CF1 A;  3SX1 A;  1OHP A;  2P09 A;  2RFR A;  3FKA A;  1UI7 A;  2XRX B;  1STD A;  2QEX 3;  1A2V A;  1EG9 B;  4K1U A;  5IEN A;  2OQE A;  1K28 A;  3M8C A;  3EN1 B;  4MJD A;  3SLU A;  2HMM B;  4HVN A;  3SED A;  4K61 A;  2WGO A;  1AVK A;  1NB3 I;  4BTY A;  4XDW A;  1M1X B;  1CYU A;  3D3L A;  2BMO B;  3QK9 A;  1VQO 3;  1JKG A;  1KC8 4;  2Y73 A;  3MG1 A;  3SVA A;  4GL6 A;  3EE1 A;  1CYV A;  4HKV B;  1LVN A;  2XH9 A;  3F8H A;  1K41 A;  5AII A;  1FGT A;  1IV9 A;  3F9S A;  2A15 A;  1TFO A;  3QRD A;  2P05 A;  4HM2 B;  3DGM A;  3CNM A;  3MYT A;  2KXG A;  5AYR B;  5LC6 A;  1G96 A;  4H61 A;  3LTA A;  2OTJ 3;  4IIA A;  3WOF B;  1O7P B;  1OF5 B;  4KFD A;  4X2H A;  3PGB A;  2R4I A;  3MPH A;  5D82 A;  2GXF A;  1FGR A;  1ROV A;  3S5C A;  3NXJ A;  3ER7 A;  1CEW I;  3FG3 A;  4XBT A;  2I9W A;  2CG1 A;  1OHO A;  4HM8 B;  4N6N B;  2CWV A;  1N9J A;  2LQV A;  3S67 A;  1D6Y A;  1GY6 A;  3GZR A;  4N6M A;  4L8P A;  2XSO B;  2CFK A;  1FGM A;  3D9R A;  3MHE A;  3NX0 A;  3DY5 A;  4J9A A;  1TUH A;  1J2B A;  1JN5 B;  2CWU A;  3FCS B;  2GBX B;  3SOA A;  2F99 A;  2Y74 A;  2OCT A;  3N9H A;  4BTW A;  2CIU A;  2ML5 A;  2CH9 A;  5LC7 A;  4CDL A;  2M7O A;  1IVU A;  2OOV A;  2JQ5 A;  3K5T A;  3CNX A;  5STD A;  3WA2 X;  3H3H A;  3K63 A;  2Q07 A;  1PU4 A;  3NBB A;  2W56 A;  1Z1S A;  1JB2 A;  2CFL A;  1ROA A;  5AI1 A;  1W2Z A;  3FG1 A;  3V99 A;  4WWU C;  3IPT A;  1Q7Y 4;  3KE7 A;  1Q86 4;  1FA3 A;  3EX9 A;  2RGQ A;  2B1X B;  1US1 A;  2QA4 3;  1NWW A;  1MNL A;  1GD3 A;  1O7W B;  5HGR A;  3CCE 3;  5D81 A;  2HMN B;  4HZB B;  1Q40 A;  3LT8 A;  1ISK A;  1DMM A;  4R4K A;  1TU5 A;  4AKY A;  1YJN 3;  1IVW A;  3MWZ A;  4LZI A;  7STD A;  5IF6 A;  1VQ8 3;  1ASK A;  1W6Y A;  3GRD A;  3OX9 A;  4HM4 B;  2D1W A;  2BMQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...