3B7CA

Crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
MPTDDIVQLLKGQEEAWNRGDLDAYMQGYWQNEQLMLISNGKFRNGWDETLAAYKKNYPDKESLGELKFTIKEIKMLSNYAAMVVGRWDLKRLKDTPTGVFTLLVEKIDDRWVITMDHSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF-2 like protein of unknown function (NP_715767.1) from Shewanella oneidensis at 1.70 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b7cA00
1GS3A 2STDA 3VSYA 1OHPA 1ZO2A 1GY5A 3GZYB 1SJWA 3STDA 5IG4A 2RCDA 2F98A 3B8LA 4XBYA 2B1XB 3GZBA 3NV0B 4OVMA 5AI1A 2CHCA 3FSDA 3RGRA 8CHOA 3CU3A 1E97A 1EG9B 3FLJA 2YFLB 5IG0A 2OWPA 5AIFA 4L7KA 3LYGA 3F8XA 7STDA 1O7PB 2A15A 1DMNA 1Q40B 3BB9A 4XBXA 4X2HA 4HM3B 4HM8B 1W02A 3GRDA 4HZBB 5CF2A 3SOAA 1QMAA 2HMKB 3IPTA 1AR0A 3DMCA 5AIHA 1OF5B 2BNGA 3A76A 3I0YA 3EX9A 3Q90A 5DREA 4CDLA 4XBTA 4H3UA 1WQLB 3JUMA 3NM2A 5IF6A 3E99A 3K0ZA 3ECFA 1Q42A 4L8OA 2HMJB 5CLKA 1IDPA 4J9AA 5AIGA 4STDA 3NXJA 1UUVB 2Z77A 4OUQA 1TUHA 2GXFA 4XDVA 4LGQA 2RGQA 2GEYA 2W2CA 1ZX2A 3B4PA 3NBRA 3K7CA 1OHSA 3FF0A 5BVBA 1DMQA 1ULJB 4IIAA 3JUPA 1U5OA 1A2KA 3OX9A 1Z1SA 3EF8A 5IEPA 4HVNA 3EBYA 3OV4A 3JUNA 4HKVB 4MJDA 5D82A 2IMJA 3MG2A 3ROBA 1ULIB 3GZRA 2QIYA 3GZXB 3F14A 2PZVA 5KP4A 4R9KA 3G8ZA 4R9LA 3SEDA 3GWRA 4K1UA 4WYKB 4HJLB 3KE7A 5AEWB 1NWWA 2BMRB 3EHCA 3CNXA 4FCMA 4HM0B 4FCJA 4HM5B 4X2OA 2B24B 1E3RA 4XB5A 1JB2A 4LMIA 5JPUA 2XSHB 3CPOA 1GY6A 2JQ5A 3HK4A 1VZZA 3MYTA 2BMQB 1JKGA 3BLZA 4N3VA 3EN1B 5CXOA 2YFIB 5D81A 4LEHA 1K41A 3DM8A 2XRXB 5IG5A 5IERA 5BXQA 1JN5A 4PEJA 4XDWA 1ISKA 2GEXA 2UX0A 3HZPA 3VGNA 4RZMA 3CNMA 4J8TA 1O7GB 2QGUA 1GYBA 4KVHA 5IENA 3F40A 3F7SA 1JB5A 3MG3A 4WP5A 3DXOA 2Z7AA 3OWYA 4Q53A 5IG3A 2F99A 3NHXA 3NV0A 1OH0A 1W01A 4HM7B 5STDA 1JKGB 3HX8A 3D9RA 4L8PA 1O7NB 5CK6A 3MG1A 3F9SA 3KKGA 3MKIA 3OWUA 1OGZA 4HZ9B 1CQSA 1O7WB 3H3HA 1C7HA 2XSOB 3WMDA 1Q40A 2I9WA 3OXAA 1O7MB 4ORLA 1TP6A 3OWSA 4HM6B 3NUVA 4XM4A 2HMOB 4HM2B 3EBTA 4U13A 3G0KA 1HKXA 1QJGA 4R1KA 5KP3A 4WWUC 1OF5A 3MSOA 2XR8B 5IEOA 1OGXA 3ER7A 3DUKA 3M8CA 4I4KA 2K54A 2YFJB 3FH1A 2R4IA 2F86B 3KSPA 1EA2A 3T8NA 5HGRA 1OHOA 3LZAA 1O7HB 5FW5A 5TGNA 1DMMA 3G16A 5G2GA 1STDA 2GBWB 5DRVA 5D83A 4HM1B 3EQQB 2Z76A 6STDA 3FZWA 1OCVA 3DZLA 5EVHA 2GBXB 5JPPA 3KZTA 4K1VA 3EJVA 4HM4B 2CKFB 3T8UA 1OUNA 1JB4A 2BMOB 2RFRA 2HMLB 3UJMA 3F7XA 1S5AA 3JUOA 3B4OA 3B7CA 1ASKA 1NU3A 1W00A 1NDOB 5KP1A 1E3VA 3F8HA 2HMMB 5AIIA 1OPYA 3MHEA 1W6YA 3FF2A 4WYKA 3EN8A 3FKAA 3S5CA 3FGYA 5AEUB 3H51A 3UNLA 5CF1A 3EC9A 3RGAA 1JN5B 3JUQA 1UUWB 1GY7A 1BUQA 2INXA 2HMNB 4GB5A 3SOYA
chains in the Genus database with same CATH superfamily
3KIIA 4JRFA 3X3ZA 1MOLA 2W56B 1GS3A 1MWSA 2STDA 3VSYA 1OHPA 1KSIA 7RNTA 1G02A 1Y4KA 4MMXB 4RBNA 1FUSA 1FW7A 1UUGB 1ZO2A 1GY5A 3GZYB 1SJWA 4KFDA 2KF3A 1TFKA 3STDA 3D79A 5IG4A 1A2PA 4CJNA 2R41A 2BU4A 2RCDA 1N9EA 1RNTA 2F98A 3B8LA 4XBYA 1UI7A 1G96A 1FA3A 2B1XB 2CWVA 1BNIA 1B2ZA 1FGRA 3NQZA 3WODG 4FMBA 3GZBA 3NV0B 3NX0A 5AYRB 1T2IA 4OVMA 3S29A 1I2GA 1T5YA 1UCLA 5AI1A 3SXXA 2CHCA 3CC73 1YHQ3 1KQS2 3FSDA 3RGRA 1BRNL 8CHOA 2J8XB 2M7OA 1FGTA 1E97A 3CU3A 3K63A 3ZG0A 3CCL3 1EG9B 3FLJA 1EQKA 1BSBA 1BSCA 4EV5A 4N6UA 2YFLB 4BTYA 4WFOA 1GD4A 2W6JH 5IG0A 3LTBA 5HOHA 3CXC2 1GD3A 4BU4A 3WHOA 2OWPA 4FMDA 1IT7A 1WNHA 4J5KA 4LSOA 5AIFA 4JF8A 1RKYA 4R80A 3MWZA 1RN4A 4L7KA 4EW5A 3LYGA 5EQLA 2UUGC 1IQYA 1NB5I 3F8XA 3PCRA 7STDA 2CFLA 4MMZB 1X1UA 1AQZA 1O7PB 1IV9A 9RNTA 1JZOA 2XEPA 3G713 1CYUA 2A15A 1DMNA 5G1KA 1N9JA 3FG1A 3URPA 2CWTA 1I0VA 1Q40B 1UCIA 3BB9A 1DYUA 2WOFA 2OTL3 1UGHI 3S67A 4X2HA 1AVLA 4HM3B 4HM8B 4XBXA 3CCJ3 1UGIA 1W02A 2W04A 3GRDA 5BU4A 3CPW2 1J2BA 1DE3A 4HZBB 1LNHA 1Q814 3LXUX 5CF2A 4O3VA 1QMAA 2HMKB 3SOAA 2ZHXB 1QAFA 3IPTA 1D6YA 1AR0A 3DMCA 1IVVA 1IVWA 4N6V0 1R4YA 1VQ43 3A5EA 1M9GA 5AIHA 1WMNA 2JDIH 3CME3 1S723 1OF5B 2RNTA 1T2HA 2BNGA 2SBLA 3A76A 3I0YA 3EX9A 3BNDA 3Q90A 5ELUA 4ZM8A 1GOVA 3DGNA 1K734 3CMA3 1GMRA 5DREA 4CDLA 1LQGC 4BIRA 4XBTA 1AV4A 4H3UA 2P09A 2QEX3 1TRPA 3SX1A 1W5ZA 1WQLB 1B2SA 1HU9A 1JRQA 3JUMA 3NM2A 5IF6A 3FG4A 1SQWA 2KAAA 1BRSA 1BRJA 1BSAA 1PFPA 2WGQA 3E99A 3JVCA 3D3LA 1IVUA 5LC6A 3K0ZA 1RN1A 2XGLA 1Q42A 3ECFA 2HMJB 4L8OA 3LT8A 3BNBA 1X1XA 2QA43 1VQL3 5CLKA 1V58A 1IDPA 3AHSA 4J9AA 1V74A 5AIGA 1A67A 4STDA 2W03A 4RNYA 3NXJA 3KCHA 1HZ1A 1Q7HA 1UUVB 1RGEA 1NNVA 3S28A 1I0XA 2Z77A 4OUQA 1MWTA 1TUHA 2GXFA 3BU4A 1VQN3 1A90A 1SIIA 3DGLA 1X1YA 4EBGA 2BT3A 4XDVA 1KD14 4LGQA 1RGKA 2RGQA 2GEYA 2W2CA 1ZX2A 2XH9A 5M1AA 4N6TA 3WA2X 3WR2A 3B4PA 2F56A 1D6UA 3NBRA 3ZG5A 1LOVA 3K7CA 3CCQ3 1OHSA 3FF0A 1BRKA 1RTUA 3UL5A 3NQYA 4HBRA 4RNTA 2W9QA 2YX9A 5BVBA 3KSED 1DMQA 1YJ93 1ULJB 2ZL8A 1YGEA 4IIAA 1UCKA 3JUPA 1U5OA 1A2KA 3AGNA 1Z1SA 1NB3I 3HIGA 3OX9A 1N8R4 1UI8A 2CFKA 2H0HA 3EF8A 5IEPA 3N8BA 2GU1A 2XFTA 1MWRA 1RJOA 3EBYA 3OV4A 3JUNA 1YNVX 4HVNA 1YIJ3 1PYLA 1M1XB 2E2VA 3FG3A 1IQXA 2CIUA 4HKVB 4MJDA 1VQO3 2CX0A 3D5IA 2IMJA 5D82A 2CWUA 1DVDA 3EE1A 3MG2A 3ROBA 1ULIB 1VQQA 2Q07A 3GZRA 2Y74A 5AYSC 2QIYA 1W4NA 3GZXB 3F14A 2PZVA 2UGIA 4AKZA 1G0TA 4BL2A 1VQ63 1GMQA 1K28A 1TJDA 2XF3A 3DGYA 4FR9A 1BU4A 3KFQC 3LOYA 4GHOA 1RCLA 4OK0A 5KP4A 2IYJA 1BRHA 1W6GA 2ZA4A 4AKYA 3CC43 1UW1A 1WTHA 2BIRA 3AMOA 4R9KA 1BOXA 2BHMA 1BIRA 1T3BA 3GAXA 3G8ZA 1MGRA 4R9LA 1YI23 3SEDA 3LTDA 3GWRA 4K1UA 1TU5A 3CCU3 4WYKB 3DY5A 4HJLB 2CFWA 1X1WA 3KE7A 3LH4A 3EB8A 3ZFZA 5AEWB 3LTAA 1NWWA 2BMRB 4O02B 4CPKA 1SARA 3HI7A 2IUJA 1PU4A 1OACA 3EHCA 3CNXA 4FCMA 1BNSA 4HM0B 1LOYA 3V98A 3G6E3 4FCJA 3MPHA 2O3OA 1BGSA 4HM5B 4H61A 5EEOA 3K9MC 4BTWA 4N6OB 3G4S3 2CFGA 4X2OA 2B24B 1E3RA 4XB5A 1JB2A 4LMIA 4O8SA 1I8VA 1MGWA 4N6NB 1VQP3 1STFI 5GSPA 5JPUA 1RGLA 1LNIA 1EKMA 1Q7Y4 2FXTA 2XSHB 3CPOA 1K9M4 3CD63 1FZUA 1GY6A 2JQ5A 3TDGA 4WHAA 3T0UA 3HK4A 1IK3A 1FUTA 1GOYA 1VZZA 3MYTA 1LXEA 1GOUA 4J5GA 2P05A 2KF4A 1DVCA 3AGOA 4KT3B 2BMQB 1M1K4 4FCZA 1JKGA 3BLZA 4MEIA 3DGMA 4N3VA 4KFFA 3EN1B 1BNJA 3PGBA 1ROAA 3LMLA 1D6ZA 4IPBA 3X3XA 2V1LA 2MC8A 5CXOA 1M904 2YFIB 3D4AA 3Q1CA 3SLUA 5D81A 2ML6A 3N54B 4LEHA 1K41A 2KCDA 2KRTA 3DM8A 3PZWA 2CG1A 2XRXB 5IG5A 1Q824 5IERA 3BIRA 2E2UA 1SIHA 3WOEB 1JN5A 4RNZA 1RLSA 5BXQA 1N8QA 4PEJA 3PYJA 4XDWA 1VQ93 1SPUA 1CYVA 1ISKA 2GEXA 8RNTA 3WA3A 1I2EA 1V57A 1KWIA 2UX0A 3HZPA 3AMOB 4NHFA 3VGNA 4RZMA 1QVG2 1NJI4 1I70A 2WGOA 4EYCA 3CNMA 4J8TA 1O7GB 2QGUA 3J7Yd 3IMAB 1RSNA 1GYBA 2OOVC 4KVHA 4BTXA 1W2B2 5IENA 2W56A 3F40A 2GSPA 1I2FA 3Q2PA 3F7SA 2L1SA 1JB5A 1RRLA 3VF1A 3I553 4AEQA 3MG3A 1CH0A 1BSEA 2ZDJA 4WP5A 1BNEA 3DXOA 2L4VA 2Z7AA 2W9PA 3OWYA 4Q53A 5IG3A 2AAEA 1EEJA 2F99A 3NHXA 4EC6A 1FGQA 2OQEC 3UL6A 3NV0A 1BANA 1U8CB 1B3SA 3X40A 2CC3A 1OH0A 3HIIA 2CFDA 1IT8A 3CCR3 1W01A 1K8A4 3KN4A 1LOWA 1TRQA 1L5GB 4TX4A 1BNFA 4HM7B 5STDA 1JKGB 3QK9A 4BL3A 4IT7A 2AADA 3HX8A 3AHWA 5G1LA 2P38A 3D9RA 1IQ8A 4L8PA 1LRAA 1B21A 2MF7A 1O7NB 5CK6A 2OQEA 3X41A 1RRHA 1R4CA 1W7CA 3QRDA 4NPBA 3MG1A 3LT9A 2K3DA 3F9SA 3KKGA 3MKIA 3OWUA 1VQ73 2FGTA 1OGZA 4HZ9B 1JJ22 1B2MA 1CQSA 1O7WB 2IY2A 7GSPA 2H0GA 3H3HA 3V92A 1C7HA 2W0QA 1I3IA 5JBSA 1BRGA 2XSOB 1Q40A 3WMDA 1YVBI 2HOHA 2O9UX 4FMCA 2I9WA 3I563 1TFOA 3OXAA 1O7MB 2H0IA 4ORLA 1TP6A 2WO0A 3OWSA 4HM6B 3WDGB 3L0RA 3NUVA 4XM4A 2HMOB 4HM2B 3EBTA 3GSPA 4U13A 1TTOA 1N5HA 4GSPA 4QWTA 1BNGA 2K0MA 3G0KA 1HKXA 1RGHA 4HOHA 2CK3H 1AVKA 2OTJ3 1QJGA 1B2UA 4LYLB 2Z6BA 3N9HA 4R1KA 2F5MA 1YIT3 3O8YA 4HAAA 5KP3A 1VQ53 1ZGXA 4WWUC 4K90B 3BNCA 1OF5A 3MSOA 4R4KA 5I97A 2P0XA 4GL6A 2XR8B 5IW9A 2WOHA 5IEOA 3PXMA 1FGOA 1F8NA 1UDII 3X42A 1JZDA 1DETA 1W6CA 4CCVA 1I3FA 1OGXA 2RBIA 1B2XA 3DUKA 3ER7A 3M8CA 3NBBA 3U1WA 6RNTA 1GSPA 1RCKA 4I4KA 1YJW3 4KFEA 2E2TA 2K54A 1RGAA 2LYXA 2YFJB 3FH1A 2R4IA 4K61A 3CCV3 2F86B 2PNCA 1RHLA 3KSPA 1EA2A 1BAOA 4NREA 2SARA 1YGWA 3T8NA 1JNQA 2RSXA 4LZIA 4FMAA 1FGMA 5HGRA 1OHOA 1BVIA 3LTCA 3D5GA 3LZAA 1O7HB 4MMYB 5A0OB 5M18A 5FW5A 5TGNA 1DMMA 1RGGA 1BRIA 3ALAA 2BO9B 1GMPA 1WMPA 1YJN3 3G16A 5G2GA 3CCE3 1WMOA 1B27A 1MNLA 1STDA 2GBWB 5FGOA 5DRVA 5RNTA 1VQK3 1US1A 5D83A 1BNRA 2IUKA 1W2ZA 4HM1B 3RNTA 1RGFA 2CW9A 4N6MA 3CC23 3EQQB 2Z76A 6STDA 1Q864 2XFSA 1IYYA 1NO3A 3FZWA 1FYSA 1OCVA 2D1WA 3DZLA 3NM7A 3WOFB 1N5PA 5EVHA 2GBXB 5LC7A 1TIJA 2F5WA 1IVXA 5JPPA 2CH9A 2C4BA 1CEWI 2F4YA 4N6LA 3KZTA 4K1VA 1YVSA 3EJVA 4HM4B 2CKFB 3T8UA 1OUNA 2LQVA 2GU3A 3SYUA 3U97A 4DKIA 1JB4A 1RGCA 2BMOB 2RFRA 2HMLB 1QALA 2OCTA 4HYZA 1FUWA 3Q3FA 2ML5A 3UJMA 3OW22 2C10A 1LVNA 3F7XA 4EXRA 1S5AA 3JUOA 1IU7A 3B4OA 3SVAA 1VQ83 3B7CA 1ASKA 1NU3A 1W00A 4KZ1A 3IJEB 1NDOB 2CG0A 1RN7A 3V99A 5BIRA 2IA7A 1RNBA 5KP1A 2KF6A 2OOVA 1E3VA 3F8HA 1KC84 1ROVA 1JBRA 2HMMB 5AIIA 3UB1A 1LQMB 1C54A 1OPYA 1QAKA 5ELJA 6GSPA 3MHEA 3CCM3 1VQM3 1LOXA 1QVF2 1W6YA 1JBSA 3FF2A 4WYKA 3EN8A 3PCSA 1ZS7A 1A2VA 3FKAA 4I5QA 1BUJA 1RMSA 1JV2B 3S5CA 1RDSA 1UCJA 3FGYA 4O2HA 2CX1A 1IV7A 3DH2A 3FCSB 3BNEA 4EV2A 2XGNA 2P0MA 1EUIC 3NBJA 5AEUB 4ILFA 2C11A 3H51A 1JBTA 3UNLA 2Y73A 1HYFA 1AY7A 2FNQA 3K5TA 5CF1A 3EC9A 1B20A 3RGAA 1JN5B 3X3YA 3CCS3 1BSDA 1Q9EA 1PY3A 3DGOA 3HOHA 3S27A 3PS8A 1MWUA 3JUQA 1UUWB 2D42A 2KXGA 3RDEA 2KF5A 1GY7A 1BUQA 5M19A 2INXA 4G1MB 2HMNB 4GB5A 3SOYA
chains in the Genus database with same CATH topology
3KIIA 4JRFA 3X3ZA 1MOLA 2W56B 1GS3A 2STDA 3VSYA 1OHPA 1KSIA 1Y4KA 4MMXB 4RBNA 1ZO2A 1GY5A 3GZYB 1SJWA 4KFDA 1TFKA 3STDA 5IG4A 2RCDA 1N9EA 2F98A 3B8LA 4XBYA 1UI7A 1G96A 1FA3A 2B1XB 2CWVA 1FGRA 3NQZA 3WODG 4FMBA 3GZBA 3NV0B 3NX0A 5AYRB 4OVMA 3S29A 1T5YA 5AI1A 3SXXA 2CHCA 3CC73 1YHQ3 1KQS2 3FSDA 3RGRA 8CHOA 2M7OA 3CU3A 1FGTA 1E97A 3K63A 3CCL3 1EG9B 3FLJA 1EQKA 4EV5A 4N6UA 2YFLB 4BTYA 4WFOA 1GD4A 2W6JH 5IG0A 3LTBA 3CXC2 1GD3A 2OWPA 4FMDA 1IT7A 1WNHA 4LSOA 5AIFA 4JF8A 1RKYA 4R80A 3MWZA 4L7KA 3LYGA 5EQLA 1IQYA 1NB5I 3F8XA 3PCRA 7STDA 2CFLA 4MMZB 1O7PB 1IV9A 3G713 1CYUA 2XEPA 2A15A 1DMNA 1N9JA 3FG1A 2CWTA 1Q40B 3BB9A 1DYUA 2WOFA 2OTL3 3S67A 4X2HA 1AVLA 4HM3B 4HM8B 4XBXA 3CCJ3 1J2BA 1W02A 2W04A 3GRDA 3CPW2 4HZBB 1LNHA 1Q814 3LXUX 5CF2A 4O3VA 1QMAA 2HMKB 3SOAA 1QAFA 3IPTA 1D6YA 1AR0A 3DMCA 1IVVA 1IVWA 4N6V0 1VQ43 1M9GA 5AIHA 1WMNA 2JDIH 3CME3 1S723 1OF5B 2BNGA 2SBLA 3A76A 3I0YA 3EX9A 3BNDA 3Q90A 5ELUA 4ZM8A 3DGNA 1K734 3CMA3 5DREA 4CDLA 4XBTA 1AV4A 4H3UA 2P09A 2QEX3 3SX1A 1W5ZA 1WQLB 1HU9A 1JRQA 3JUMA 3NM2A 5IF6A 3FG4A 1SQWA 3JVCA 1PFPA 3E99A 2WGQA 3D3LA 1IVUA 5LC6A 3K0ZA 2XGLA 1Q42A 3ECFA 2HMJB 4L8OA 3LT8A 3BNBA 2QA43 1VQL3 5CLKA 1IDPA 4J9AA 5AIGA 1V74A 1A67A 4STDA 2W03A 4RNYA 3NXJA 1UUVB 3S28A 2Z77A 4OUQA 1TUHA 2GXFA 1VQN3 1A90A 1SIIA 3DGLA 4EBGA 2BT3A 4XDVA 1KD14 4LGQA 2RGQA 2GEYA 2W2CA 1ZX2A 2XH9A 4N6TA 3WA2X 3B4PA 1D6UA 3NBRA 3K7CA 3CCQ3 1OHSA 3FF0A 3UL5A 3NQYA 4HBRA 2W9QA 2YX9A 5BVBA 3KSED 1DMQA 1YJ93 1ULJB 2ZL8A 1YGEA 4IIAA 3JUPA 1U5OA 1A2KA 3OX9A 1Z1SA 1NB3I 3HIGA 1N8R4 1UI8A 2CFKA 3EF8A 5IEPA 3N8BA 2GU1A 2XFTA 1RJOA 3EBYA 3OV4A 4HVNA 3JUNA 1YIJ3 4HKVB 1M1XB 2E2VA 3FG3A 1IQXA 2CIUA 4MJDA 1VQO3 5D82A 2IMJA 2CWUA 1DVDA 3EE1A 3MG2A 3ROBA 1ULIB 2Q07A 3GZRA 2Y74A 5AYSC 2QIYA 1W4NA 3GZXB 3F14A 2PZVA 4AKZA 1VQ63 1K28A 2XF3A 4FR9A 3KFQC 3LOYA 4OK0A 5KP4A 1W6GA 4AKYA 3CC43 1UW1A 1WTHA 3AMOA 4R9KA 2BHMA 3GAXA 3G8ZA 4R9LA 1YI23 3SEDA 3LTDA 3GWRA 4K1UA 1TU5A 3CCU3 4WYKB 3DY5A 4HJLB 2CFWA 3KE7A 3LH4A 3EB8A 5AEWB 3LTAA 1NWWA 2BMRB 4O02B 3HI7A 2IUJA 1PU4A 1OACA 3EHCA 3CNXA 4FCMA 4HM0B 3G6E3 3V98A 4FCJA 3MPHA 2O3OA 4HM5B 4H61A 5EEOA 3K9MC 4BTWA 4N6OB 3G4S3 2CFGA 4X2OA 2B24B 1E3RA 4XB5A 1JB2A 4LMIA 4O8SA 4N6NB 1VQP3 1STFI 5JPUA 1Q7Y4 1EKMA 3CD63 2FXTA 2XSHB 3CPOA 1K9M4 1GY6A 2JQ5A 3TDGA 4WHAA 3T0UA 3HK4A 1IK3A 1VZZA 3MYTA 1LXEA 2P05A 1DVCA 2BMQB 1M1K4 4FCZA 1JKGA 3BLZA 4MEIA 3DGMA 4N3VA 4KFFA 3EN1B 3PGBA 1ROAA 3LMLA 1D6ZA 4IPBA 3X3XA 2V1LA 2MC8A 5CXOA 1M904 2YFIB 3Q1CA 3SLUA 5D81A 2ML6A 3N54B 4LEHA 2KCDA 1K41A 2KRTA 3DM8A 3PZWA 2CG1A 2XRXB 5IG5A 1Q824 5IERA 2E2UA 1SIHA 3WOEB 1JN5A 4RNZA 5BXQA 1N8QA 4PEJA 3PYJA 4XDWA 1VQ93 1SPUA 1CYVA 1ISKA 2GEXA 3WA3A 1KWIA 2UX0A 3HZPA 3AMOB 4NHFA 3VGNA 4RZMA 1QVG2 1NJI4 2WGOA 4EYCA 3CNMA 4J8TA 1O7GB 2QGUA 3J7Yd 3IMAB 1GYBA 2OOVC 4KVHA 4BTXA 1W2B2 5IENA 2W56A 3F40A 3Q2PA 3F7SA 1JB5A 1RRLA 3VF1A 3I553 4AEQA 3MG3A 2ZDJA 4WP5A 3DXOA 2L4VA 2Z7AA 2W9PA 3OWYA 4Q53A 5IG3A 2F99A 3NHXA 4EC6A 1FGQA 2OQEC 3UL6A 3NV0A 1U8CB 3X40A 2CC3A 1OH0A 3HIIA 2CFDA 1IT8A 3CCR3 1W01A 1K8A4 3KN4A 1L5GB 4TX4A 4HM7B 5STDA 1JKGB 3QK9A 4IT7A 3HX8A 2P38A 3D9RA 1IQ8A 4L8PA 2MF7A 1O7NB 5CK6A 2OQEA 3X41A 1RRHA 1R4CA 1W7CA 3QRDA 3MG1A 3LT9A 3F9SA 3KKGA 3MKIA 3OWUA 1VQ73 2FGTA 1OGZA 4HZ9B 1JJ22 1CQSA 1O7WB 3H3HA 3V92A 1C7HA 2W0QA 5JBSA 2XSOB 3WMDA 1Q40A 1YVBI 2O9UX 4FMCA 2I9WA 3I563 1TFOA 3OXAA 1O7MB 4ORLA 1TP6A 2WO0A 3OWSA 4HM6B 3WDGB 3L0RA 3NUVA 4XM4A 2HMOB 4HM2B 3EBTA 4U13A 1N5HA 4QWTA 2K0MA 3G0KA 1HKXA 2CK3H 1AVKA 2OTJ3 1QJGA 4R1KA 2Z6BA 3N9HA 1VQ53 1YIT3 3O8YA 5KP3A 4WWUC 4K90B 3BNCA 1OF5A 3MSOA 4R4KA 5I97A 2P0XA 4GL6A 2XR8B 5IW9A 2WOHA 5IEOA 3PXMA 1FGOA 1F8NA 3X42A 1W6CA 4CCVA 1OGXA 3DUKA 3ER7A 3U1WA 3M8CA 3NBBA 1YJW3 4I4KA 4KFEA 2E2TA 2K54A 2LYXA 2YFJB 3FH1A 2R4IA 4K61A 3CCV3 2F86B 2PNCA 3KSPA 1EA2A 4NREA 3T8NA 1JNQA 2RSXA 4LZIA 4FMAA 1FGMA 5HGRA 1OHOA 3LTCA 3LZAA 1O7HB 4MMYB 5A0OB 5FW5A 5TGNA 1DMMA 3ALAA 2BO9B 1WMPA 1YJN3 3G16A 5G2GA 3CCE3 1WMOA 1MNLA 1STDA 2GBWB 5FGOA 5DRVA 1VQK3 1US1A 5D83A 2IUKA 1W2ZA 4HM1B 2CW9A 4N6MA 3CC23 3EQQB 2Z76A 6STDA 1Q864 2XFSA 1NO3A 3FZWA 1OCVA 2D1WA 3DZLA 3NM7A 3WOFB 1N5PA 5EVHA 2GBXB 5LC7A 1TIJA 1IVXA 5JPPA 2CH9A 1CEWI 4N6LA 3KZTA 4K1VA 3EJVA 4HM4B 2CKFB 3T8UA 1OUNA 2LQVA 2GU3A 3U97A 1JB4A 2BMOB 2RFRA 2HMLB 1QALA 2OCTA 4HYZA 1FUWA 3OW22 2ML5A 3UJMA 2C10A 1LVNA 3F7XA 4EXRA 1S5AA 3JUOA 1IU7A 3B4OA 3SVAA 1VQ83 3B7CA 1ASKA 1NU3A 1W00A 4KZ1A 3IJEB 1NDOB 2CG0A 1RN7A 3V99A 2IA7A 5KP1A 2OOVA 1E3VA 3F8HA 1KC84 1ROVA 2HMMB 5AIIA 3UB1A 1OPYA 1QAKA 5ELJA 3MHEA 3CCM3 1VQM3 1LOXA 1QVF2 1W6YA 3FF2A 4WYKA 3EN8A 3PCSA 1A2VA 3FKAA 1JV2B 3S5CA 3FGYA 4O2HA 3FCSB 1IV7A 3BNEA 4EV2A 2XGNA 2P0MA 3NBJA 5AEUB 2C11A 3H51A 3UNLA 2Y73A 2FNQA 3K5TA 5CF1A 3EC9A 3RGAA 1JN5B 3X3YA 3CCS3 3DGOA 3S27A 3PS8A 3JUQA 1UUWB 2D42A 2KXGA 3RDEA 1GY7A 1BUQA 2INXA 4G1MB 2HMNB 4GB5A 3SOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GS3 A;  2STD A;  3VSY A;  1OHP A;  1ZO2 A;  1GY5 A;  3GZY B;  1SJW A;  3STD A;  5IG4 A;  2RCD A;  2F98 A;  3B8L A;  4XBY A;  2B1X B;  3GZB A;  3NV0 B;  4OVM A;  5AI1 A;  2CHC A;  3FSD A;  3RGR A;  8CHO A;  3CU3 A;  1E97 A;  1EG9 B;  3FLJ A;  2YFL B;  5IG0 A;  2OWP A;  5AIF A;  4L7K A;  3LYG A;  3F8X A;  7STD A;  1O7P B;  2A15 A;  1DMN A;  1Q40 B;  3BB9 A;  4XBX A;  4X2H A;  4HM3 B;  4HM8 B;  1W02 A;  3GRD A;  4HZB B;  5CF2 A;  3SOA A;  1QMA A;  2HMK B;  3IPT A;  1AR0 A;  3DMC A;  5AIH A;  1OF5 B;  2BNG A;  3A76 A;  3I0Y A;  3EX9 A;  3Q90 A;  5DRE A;  4CDL A;  4XBT A;  4H3U A;  1WQL B;  3JUM A;  3NM2 A;  5IF6 A;  3E99 A;  3K0Z A;  3ECF A;  1Q42 A;  4L8O A;  2HMJ B;  5CLK A;  1IDP A;  4J9A A;  5AIG A;  4STD A;  3NXJ A;  1UUV B;  2Z77 A;  4OUQ A;  1TUH A;  2GXF A;  4XDV A;  4LGQ A;  2RGQ A;  2GEY A;  2W2C A;  1ZX2 A;  3B4P A;  3NBR A;  3K7C A;  1OHS A;  3FF0 A;  5BVB A;  1DMQ A;  1ULJ B;  4IIA A;  3JUP A;  1U5O A;  1A2K A;  3OX9 A;  1Z1S A;  3EF8 A;  5IEP A;  4HVN A;  3EBY A;  3OV4 A;  3JUN A;  4HKV B;  4MJD A;  5D82 A;  2IMJ A;  3MG2 A;  3ROB A;  1ULI B;  3GZR A;  2QIY A;  3GZX B;  3F14 A;  2PZV A;  5KP4 A;  4R9K A;  3G8Z A;  4R9L A;  3SED A;  3GWR A;  4K1U A;  4WYK B;  4HJL B;  3KE7 A;  5AEW B;  1NWW A;  2BMR B;  3EHC A;  3CNX A;  4FCM A;  4HM0 B;  4FCJ A;  4HM5 B;  4X2O A;  2B24 B;  1E3R A;  4XB5 A;  1JB2 A;  4LMI A;  5JPU A;  2XSH B;  3CPO A;  1GY6 A;  2JQ5 A;  3HK4 A;  1VZZ A;  3MYT A;  2BMQ B;  1JKG A;  3BLZ A;  4N3V A;  3EN1 B;  5CXO A;  2YFI B;  5D81 A;  4LEH A;  1K41 A;  3DM8 A;  2XRX B;  5IG5 A;  5IER A;  5BXQ A;  1JN5 A;  4PEJ A;  4XDW A;  1ISK A;  2GEX A;  2UX0 A;  3HZP A;  3VGN A;  4RZM A;  3CNM A;  4J8T A;  1O7G B;  2QGU A;  1GYB A;  4KVH A;  5IEN A;  3F40 A;  3F7S A;  1JB5 A;  3MG3 A;  4WP5 A;  3DXO A;  2Z7A A;  3OWY A;  4Q53 A;  5IG3 A;  2F99 A;  3NHX A;  3NV0 A;  1OH0 A;  1W01 A;  4HM7 B;  5STD A;  1JKG B;  3HX8 A;  3D9R A;  4L8P A;  1O7N B;  5CK6 A;  3MG1 A;  3F9S A;  3KKG A;  3MKI A;  3OWU A;  1OGZ A;  4HZ9 B;  1CQS A;  1O7W B;  3H3H A;  1C7H A;  2XSO B;  3WMD A;  1Q40 A;  2I9W A;  3OXA A;  1O7M B;  4ORL A;  1TP6 A;  3OWS A;  4HM6 B;  3NUV A;  4XM4 A;  2HMO B;  4HM2 B;  3EBT A;  4U13 A;  3G0K A;  1HKX A;  1QJG A;  4R1K A;  5KP3 A;  4WWU C;  1OF5 A;  3MSO A;  2XR8 B;  5IEO A;  1OGX A;  3ER7 A;  3DUK A;  3M8C A;  4I4K A;  2K54 A;  2YFJ B;  3FH1 A;  2R4I A;  2F86 B;  3KSP A;  1EA2 A;  3T8N A;  5HGR A;  1OHO A;  3LZA A;  1O7H B;  5FW5 A;  5TGN A;  1DMM A;  3G16 A;  5G2G A;  1STD A;  2GBW B;  5DRV A;  5D83 A;  4HM1 B;  3EQQ B;  2Z76 A;  6STD A;  3FZW A;  1OCV A;  3DZL A;  5EVH A;  2GBX B;  5JPP A;  3KZT A;  4K1V A;  3EJV A;  4HM4 B;  2CKF B;  3T8U A;  1OUN A;  1JB4 A;  2BMO B;  2RFR A;  2HML B;  3UJM A;  3F7X A;  1S5A A;  3JUO A;  3B4O A;  3B7C A;  1ASK A;  1NU3 A;  1W00 A;  1NDO B;  5KP1 A;  1E3V A;  3F8H A;  2HMM B;  5AII A;  1OPY A;  3MHE A;  1W6Y A;  3FF2 A;  4WYK A;  3EN8 A;  3FKA A;  3S5C A;  3FGY A;  5AEU B;  3H51 A;  3UNL A;  5CF1 A;  3EC9 A;  3RGA A;  1JN5 B;  3JUQ A;  1UUW B;  1GY7 A;  1BUQ A;  2INX A;  2HMN B;  4GB5 A;  3SOY A; 
#chains in the Genus database with same CATH topology
 3KII A;  4JRF A;  3X3Z A;  1MOL A;  2W56 B;  1GS3 A;  1MWS A;  2STD A;  3VSY A;  1OHP A;  1KSI A;  7RNT A;  1G02 A;  1Y4K A;  4MMX B;  4RBN A;  1FUS A;  1FW7 A;  1UUG B;  1ZO2 A;  1GY5 A;  3GZY B;  1SJW A;  4KFD A;  2KF3 A;  1TFK A;  3STD A;  3D79 A;  5IG4 A;  1A2P A;  4CJN A;  2R41 A;  2BU4 A;  2RCD A;  1N9E A;  1RNT A;  2F98 A;  3B8L A;  4XBY A;  1UI7 A;  1G96 A;  1FA3 A;  2B1X B;  2CWV A;  1BNI A;  1B2Z A;  1FGR A;  3NQZ A;  3WOD G;  4FMB A;  3GZB A;  3NV0 B;  3NX0 A;  5AYR B;  1T2I A;  4OVM A;  3S29 A;  1I2G A;  1T5Y A;  1UCL A;  5AI1 A;  3SXX A;  2CHC A;  3CC7 3;  1YHQ 3;  1KQS 2;  3FSD A;  3RGR A;  1BRN L;  8CHO A;  2J8X B;  2M7O A;  1FGT A;  1E97 A;  3CU3 A;  3K63 A;  3ZG0 A;  3CCL 3;  1EG9 B;  3FLJ A;  1EQK A;  1BSB A;  1BSC A;  4EV5 A;  4N6U A;  2YFL B;  4BTY A;  4WFO A;  1GD4 A;  2W6J H;  5IG0 A;  3LTB A;  5HOH A;  3CXC 2;  1GD3 A;  4BU4 A;  3WHO A;  2OWP A;  4FMD A;  1IT7 A;  1WNH A;  4J5K A;  4LSO A;  5AIF A;  4JF8 A;  1RKY A;  4R80 A;  3MWZ A;  1RN4 A;  4L7K A;  4EW5 A;  3LYG A;  5EQL A;  2UUG C;  1IQY A;  1NB5 I;  3F8X A;  3PCR A;  7STD A;  2CFL A;  4MMZ B;  1X1U A;  1AQZ A;  1O7P B;  1IV9 A;  9RNT A;  1JZO A;  2XEP A;  3G71 3;  1CYU A;  2A15 A;  1DMN A;  5G1K A;  1N9J A;  3FG1 A;  3URP A;  2CWT A;  1I0V A;  1Q40 B;  1UCI A;  3BB9 A;  1DYU A;  2WOF A;  2OTL 3;  1UGH I;  3S67 A;  4X2H A;  1AVL A;  4HM3 B;  4HM8 B;  4XBX A;  3CCJ 3;  1UGI A;  1W02 A;  2W04 A;  3GRD A;  5BU4 A;  3CPW 2;  1J2B A;  1DE3 A;  4HZB B;  1LNH A;  1Q81 4;  3LXU X;  5CF2 A;  4O3V A;  1QMA A;  2HMK B;  3SOA A;  2ZHX B;  1QAF A;  3IPT A;  1D6Y A;  1AR0 A;  3DMC A;  1IVV A;  1IVW A;  4N6V 0;  1R4Y A;  1VQ4 3;  3A5E A;  1M9G A;  5AIH A;  1WMN A;  2JDI H;  3CME 3;  1S72 3;  1OF5 B;  2RNT A;  1T2H A;  2BNG A;  2SBL A;  3A76 A;  3I0Y A;  3EX9 A;  3BND A;  3Q90 A;  5ELU A;  4ZM8 A;  1GOV A;  3DGN A;  1K73 4;  3CMA 3;  1GMR A;  5DRE A;  4CDL A;  1LQG C;  4BIR A;  4XBT A;  1AV4 A;  4H3U A;  2P09 A;  2QEX 3;  1TRP A;  3SX1 A;  1W5Z A;  1WQL B;  1B2S A;  1HU9 A;  1JRQ A;  3JUM A;  3NM2 A;  5IF6 A;  3FG4 A;  1SQW A;  2KAA A;  1BRS A;  1BRJ A;  1BSA A;  1PFP A;  2WGQ A;  3E99 A;  3JVC A;  3D3L A;  1IVU A;  5LC6 A;  3K0Z A;  1RN1 A;  2XGL A;  1Q42 A;  3ECF A;  2HMJ B;  4L8O A;  3LT8 A;  3BNB A;  1X1X A;  2QA4 3;  1VQL 3;  5CLK A;  1V58 A;  1IDP A;  3AHS A;  4J9A A;  1V74 A;  5AIG A;  1A67 A;  4STD A;  2W03 A;  4RNY A;  3NXJ A;  3KCH A;  1HZ1 A;  1Q7H A;  1UUV B;  1RGE A;  1NNV A;  3S28 A;  1I0X A;  2Z77 A;  4OUQ A;  1MWT A;  1TUH A;  2GXF A;  3BU4 A;  1VQN 3;  1A90 A;  1SII A;  3DGL A;  1X1Y A;  4EBG A;  2BT3 A;  4XDV A;  1KD1 4;  4LGQ A;  1RGK A;  2RGQ A;  2GEY A;  2W2C A;  1ZX2 A;  2XH9 A;  5M1A A;  4N6T A;  3WA2 X;  3WR2 A;  3B4P A;  2F56 A;  1D6U A;  3NBR A;  3ZG5 A;  1LOV A;  3K7C A;  3CCQ 3;  1OHS A;  3FF0 A;  1BRK A;  1RTU A;  3UL5 A;  3NQY A;  4HBR A;  4RNT A;  2W9Q A;  2YX9 A;  5BVB A;  3KSE D;  1DMQ A;  1YJ9 3;  1ULJ B;  2ZL8 A;  1YGE A;  4IIA A;  1UCK A;  3JUP A;  1U5O A;  1A2K A;  3AGN A;  1Z1S A;  1NB3 I;  3HIG A;  3OX9 A;  1N8R 4;  1UI8 A;  2CFK A;  2H0H A;  3EF8 A;  5IEP A;  3N8B A;  2GU1 A;  2XFT A;  1MWR A;  1RJO A;  3EBY A;  3OV4 A;  3JUN A;  1YNV X;  4HVN A;  1YIJ 3;  1PYL A;  1M1X B;  2E2V A;  3FG3 A;  1IQX A;  2CIU A;  4HKV B;  4MJD A;  1VQO 3;  2CX0 A;  3D5I A;  2IMJ A;  5D82 A;  2CWU A;  1DVD A;  3EE1 A;  3MG2 A;  3ROB A;  1ULI B;  1VQQ A;  2Q07 A;  3GZR A;  2Y74 A;  5AYS C;  2QIY A;  1W4N A;  3GZX B;  3F14 A;  2PZV A;  2UGI A;  4AKZ A;  1G0T A;  4BL2 A;  1VQ6 3;  1GMQ A;  1K28 A;  1TJD A;  2XF3 A;  3DGY A;  4FR9 A;  1BU4 A;  3KFQ C;  3LOY A;  4GHO A;  1RCL A;  4OK0 A;  5KP4 A;  2IYJ A;  1BRH A;  1W6G A;  2ZA4 A;  4AKY A;  3CC4 3;  1UW1 A;  1WTH A;  2BIR A;  3AMO A;  4R9K A;  1BOX A;  2BHM A;  1BIR A;  1T3B A;  3GAX A;  3G8Z A;  1MGR A;  4R9L A;  1YI2 3;  3SED A;  3LTD A;  3GWR A;  4K1U A;  1TU5 A;  3CCU 3;  4WYK B;  3DY5 A;  4HJL B;  2CFW A;  1X1W A;  3KE7 A;  3LH4 A;  3EB8 A;  3ZFZ A;  5AEW B;  3LTA A;  1NWW A;  2BMR B;  4O02 B;  4CPK A;  1SAR A;  3HI7 A;  2IUJ A;  1PU4 A;  1OAC A;  3EHC A;  3CNX A;  4FCM A;  1BNS A;  4HM0 B;  1LOY A;  3V98 A;  3G6E 3;  4FCJ A;  3MPH A;  2O3O A;  1BGS A;  4HM5 B;  4H61 A;  5EEO A;  3K9M C;  4BTW A;  4N6O B;  3G4S 3;  2CFG A;  4X2O A;  2B24 B;  1E3R A;  4XB5 A;  1JB2 A;  4LMI A;  4O8S A;  1I8V A;  1MGW A;  4N6N B;  1VQP 3;  1STF I;  5GSP A;  5JPU A;  1RGL A;  1LNI A;  1EKM A;  1Q7Y 4;  2FXT A;  2XSH B;  3CPO A;  1K9M 4;  3CD6 3;  1FZU A;  1GY6 A;  2JQ5 A;  3TDG A;  4WHA A;  3T0U A;  3HK4 A;  1IK3 A;  1FUT A;  1GOY A;  1VZZ A;  3MYT A;  1LXE A;  1GOU A;  4J5G A;  2P05 A;  2KF4 A;  1DVC A;  3AGO A;  4KT3 B;  2BMQ B;  1M1K 4;  4FCZ A;  1JKG A;  3BLZ A;  4MEI A;  3DGM A;  4N3V A;  4KFF A;  3EN1 B;  1BNJ A;  3PGB A;  1ROA A;  3LML A;  1D6Z A;  4IPB A;  3X3X A;  2V1L A;  2MC8 A;  5CXO A;  1M90 4;  2YFI B;  3D4A A;  3Q1C A;  3SLU A;  5D81 A;  2ML6 A;  3N54 B;  4LEH A;  1K41 A;  2KCD A;  2KRT A;  3DM8 A;  3PZW A;  2CG1 A;  2XRX B;  5IG5 A;  1Q82 4;  5IER A;  3BIR A;  2E2U A;  1SIH A;  3WOE B;  1JN5 A;  4RNZ A;  1RLS A;  5BXQ A;  1N8Q A;  4PEJ A;  3PYJ A;  4XDW A;  1VQ9 3;  1SPU A;  1CYV A;  1ISK A;  2GEX A;  8RNT A;  3WA3 A;  1I2E A;  1V57 A;  1KWI A;  2UX0 A;  3HZP A;  3AMO B;  4NHF A;  3VGN A;  4RZM A;  1QVG 2;  1NJI 4;  1I70 A;  2WGO A;  4EYC A;  3CNM A;  4J8T A;  1O7G B;  2QGU A;  3J7Y d;  3IMA B;  1RSN A;  1GYB A;  2OOV C;  4KVH A;  4BTX A;  1W2B 2;  5IEN A;  2W56 A;  3F40 A;  2GSP A;  1I2F A;  3Q2P A;  3F7S A;  2L1S A;  1JB5 A;  1RRL A;  3VF1 A;  3I55 3;  4AEQ A;  3MG3 A;  1CH0 A;  1BSE A;  2ZDJ A;  4WP5 A;  1BNE A;  3DXO A;  2L4V A;  2Z7A A;  2W9P A;  3OWY A;  4Q53 A;  5IG3 A;  2AAE A;  1EEJ A;  2F99 A;  3NHX A;  4EC6 A;  1FGQ A;  2OQE C;  3UL6 A;  3NV0 A;  1BAN A;  1U8C B;  1B3S A;  3X40 A;  2CC3 A;  1OH0 A;  3HII A;  2CFD A;  1IT8 A;  3CCR 3;  1W01 A;  1K8A 4;  3KN4 A;  1LOW A;  1TRQ A;  1L5G B;  4TX4 A;  1BNF A;  4HM7 B;  5STD A;  1JKG B;  3QK9 A;  4BL3 A;  4IT7 A;  2AAD A;  3HX8 A;  3AHW A;  5G1L A;  2P38 A;  3D9R A;  1IQ8 A;  4L8P A;  1LRA A;  1B21 A;  2MF7 A;  1O7N B;  5CK6 A;  2OQE A;  3X41 A;  1RRH A;  1R4C A;  1W7C A;  3QRD A;  4NPB A;  3MG1 A;  3LT9 A;  2K3D A;  3F9S A;  3KKG A;  3MKI A;  3OWU A;  1VQ7 3;  2FGT A;  1OGZ A;  4HZ9 B;  1JJ2 2;  1B2M A;  1CQS A;  1O7W B;  2IY2 A;  7GSP A;  2H0G A;  3H3H A;  3V92 A;  1C7H A;  2W0Q A;  1I3I A;  5JBS A;  1BRG A;  2XSO B;  1Q40 A;  3WMD A;  1YVB I;  2HOH A;  2O9U X;  4FMC A;  2I9W A;  3I56 3;  1TFO A;  3OXA A;  1O7M B;  2H0I A;  4ORL A;  1TP6 A;  2WO0 A;  3OWS A;  4HM6 B;  3WDG B;  3L0R A;  3NUV A;  4XM4 A;  2HMO B;  4HM2 B;  3EBT A;  3GSP A;  4U13 A;  1TTO A;  1N5H A;  4GSP A;  4QWT A;  1BNG A;  2K0M A;  3G0K A;  1HKX A;  1RGH A;  4HOH A;  2CK3 H;  1AVK A;  2OTJ 3;  1QJG A;  1B2U A;  4LYL B;  2Z6B A;  3N9H A;  4R1K A;  2F5M A;  1YIT 3;  3O8Y A;  4HAA A;  5KP3 A;  1VQ5 3;  1ZGX A;  4WWU C;  4K90 B;  3BNC A;  1OF5 A;  3MSO A;  4R4K A;  5I97 A;  2P0X A;  4GL6 A;  2XR8 B;  5IW9 A;  2WOH A;  5IEO A;  3PXM A;  1FGO A;  1F8N A;  1UDI I;  3X42 A;  1JZD A;  1DET A;  1W6C A;  4CCV A;  1I3F A;  1OGX A;  2RBI A;  1B2X A;  3DUK A;  3ER7 A;  3M8C A;  3NBB A;  3U1W A;  6RNT A;  1GSP A;  1RCK A;  4I4K A;  1YJW 3;  4KFE A;  2E2T A;  2K54 A;  1RGA A;  2LYX A;  2YFJ B;  3FH1 A;  2R4I A;  4K61 A;  3CCV 3;  2F86 B;  2PNC A;  1RHL A;  3KSP A;  1EA2 A;  1BAO A;  4NRE A;  2SAR A;  1YGW A;  3T8N A;  1JNQ A;  2RSX A;  4LZI A;  4FMA A;  1FGM A;  5HGR A;  1OHO A;  1BVI A;  3LTC A;  3D5G A;  3LZA A;  1O7H B;  4MMY B;  5A0O B;  5M18 A;  5FW5 A;  5TGN A;  1DMM A;  1RGG A;  1BRI A;  3ALA A;  2BO9 B;  1GMP A;  1WMP A;  1YJN 3;  3G16 A;  5G2G A;  3CCE 3;  1WMO A;  1B27 A;  1MNL A;  1STD A;  2GBW B;  5FGO A;  5DRV A;  5RNT A;  1VQK 3;  1US1 A;  5D83 A;  1BNR A;  2IUK A;  1W2Z A;  4HM1 B;  3RNT A;  1RGF A;  2CW9 A;  4N6M A;  3CC2 3;  3EQQ B;  2Z76 A;  6STD A;  1Q86 4;  2XFS A;  1IYY A;  1NO3 A;  3FZW A;  1FYS A;  1OCV A;  2D1W A;  3DZL A;  3NM7 A;  3WOF B;  1N5P A;  5EVH A;  2GBX B;  5LC7 A;  1TIJ A;  2F5W A;  1IVX A;  5JPP A;  2CH9 A;  2C4B A;  1CEW I;  2F4Y A;  4N6L A;  3KZT A;  4K1V A;  1YVS A;  3EJV A;  4HM4 B;  2CKF B;  3T8U A;  1OUN A;  2LQV A;  2GU3 A;  3SYU A;  3U97 A;  4DKI A;  1JB4 A;  1RGC A;  2BMO B;  2RFR A;  2HML B;  1QAL A;  2OCT A;  4HYZ A;  1FUW A;  3Q3F A;  2ML5 A;  3UJM A;  3OW2 2;  2C10 A;  1LVN A;  3F7X A;  4EXR A;  1S5A A;  3JUO A;  1IU7 A;  3B4O A;  3SVA A;  1VQ8 3;  3B7C A;  1ASK A;  1NU3 A;  1W00 A;  4KZ1 A;  3IJE B;  1NDO B;  2CG0 A;  1RN7 A;  3V99 A;  5BIR A;  2IA7 A;  1RNB A;  5KP1 A;  2KF6 A;  2OOV A;  1E3V A;  3F8H A;  1KC8 4;  1ROV A;  1JBR A;  2HMM B;  5AII A;  3UB1 A;  1LQM B;  1C54 A;  1OPY A;  1QAK A;  5ELJ A;  6GSP A;  3MHE A;  3CCM 3;  1VQM 3;  1LOX A;  1QVF 2;  1W6Y A;  1JBS A;  3FF2 A;  4WYK A;  3EN8 A;  3PCS A;  1ZS7 A;  1A2V A;  3FKA A;  4I5Q A;  1BUJ A;  1RMS A;  1JV2 B;  3S5C A;  1RDS A;  1UCJ A;  3FGY A;  4O2H A;  2CX1 A;  1IV7 A;  3DH2 A;  3FCS B;  3BNE A;  4EV2 A;  2XGN A;  2P0M A;  1EUI C;  3NBJ A;  5AEU B;  4ILF A;  2C11 A;  3H51 A;  1JBT A;  3UNL A;  2Y73 A;  1HYF A;  1AY7 A;  2FNQ A;  3K5T A;  5CF1 A;  3EC9 A;  1B20 A;  3RGA A;  1JN5 B;  3X3Y A;  3CCS 3;  1BSD A;  1Q9E A;  1PY3 A;  3DGO A;  3HOH A;  3S27 A;  3PS8 A;  1MWU A;  3JUQ A;  1UUW B;  2D42 A;  2KXG A;  3RDE A;  2KF5 A;  1GY7 A;  1BUQ A;  5M19 A;  2INX A;  4G1M B;  2HMN B;  4GB5 A;  3SOY A; 
#chains in the Genus database with same CATH homology
 3KII A;  4JRF A;  3X3Z A;  1MOL A;  2W56 B;  1GS3 A;  2STD A;  3VSY A;  1OHP A;  1KSI A;  1Y4K A;  4MMX B;  4RBN A;  1ZO2 A;  1GY5 A;  3GZY B;  1SJW A;  4KFD A;  1TFK A;  3STD A;  5IG4 A;  2RCD A;  1N9E A;  2F98 A;  3B8L A;  4XBY A;  1UI7 A;  1G96 A;  1FA3 A;  2B1X B;  2CWV A;  1FGR A;  3NQZ A;  3WOD G;  4FMB A;  3GZB A;  3NV0 B;  3NX0 A;  5AYR B;  4OVM A;  3S29 A;  1T5Y A;  5AI1 A;  3SXX A;  2CHC A;  3CC7 3;  1YHQ 3;  1KQS 2;  3FSD A;  3RGR A;  8CHO A;  2M7O A;  3CU3 A;  1FGT A;  1E97 A;  3K63 A;  3CCL 3;  1EG9 B;  3FLJ A;  1EQK A;  4EV5 A;  4N6U A;  2YFL B;  4BTY A;  4WFO A;  1GD4 A;  2W6J H;  5IG0 A;  3LTB A;  3CXC 2;  1GD3 A;  2OWP A;  4FMD A;  1IT7 A;  1WNH A;  4LSO A;  5AIF A;  4JF8 A;  1RKY A;  4R80 A;  3MWZ A;  4L7K A;  3LYG A;  5EQL A;  1IQY A;  1NB5 I;  3F8X A;  3PCR A;  7STD A;  2CFL A;  4MMZ B;  1O7P B;  1IV9 A;  3G71 3;  1CYU A;  2XEP A;  2A15 A;  1DMN A;  1N9J A;  3FG1 A;  2CWT A;  1Q40 B;  3BB9 A;  1DYU A;  2WOF A;  2OTL 3;  3S67 A;  4X2H A;  1AVL A;  4HM3 B;  4HM8 B;  4XBX A;  3CCJ 3;  1J2B A;  1W02 A;  2W04 A;  3GRD A;  3CPW 2;  4HZB B;  1LNH A;  1Q81 4;  3LXU X;  5CF2 A;  4O3V A;  1QMA A;  2HMK B;  3SOA A;  1QAF A;  3IPT A;  1D6Y A;  1AR0 A;  3DMC A;  1IVV A;  1IVW A;  4N6V 0;  1VQ4 3;  1M9G A;  5AIH A;  1WMN A;  2JDI H;  3CME 3;  1S72 3;  1OF5 B;  2BNG A;  2SBL A;  3A76 A;  3I0Y A;  3EX9 A;  3BND A;  3Q90 A;  5ELU A;  4ZM8 A;  3DGN A;  1K73 4;  3CMA 3;  5DRE A;  4CDL A;  4XBT A;  1AV4 A;  4H3U A;  2P09 A;  2QEX 3;  3SX1 A;  1W5Z A;  1WQL B;  1HU9 A;  1JRQ A;  3JUM A;  3NM2 A;  5IF6 A;  3FG4 A;  1SQW A;  3JVC A;  1PFP A;  3E99 A;  2WGQ A;  3D3L A;  1IVU A;  5LC6 A;  3K0Z A;  2XGL A;  1Q42 A;  3ECF A;  2HMJ B;  4L8O A;  3LT8 A;  3BNB A;  2QA4 3;  1VQL 3;  5CLK A;  1IDP A;  4J9A A;  5AIG A;  1V74 A;  1A67 A;  4STD A;  2W03 A;  4RNY A;  3NXJ A;  1UUV B;  3S28 A;  2Z77 A;  4OUQ A;  1TUH A;  2GXF A;  1VQN 3;  1A90 A;  1SII A;  3DGL A;  4EBG A;  2BT3 A;  4XDV A;  1KD1 4;  4LGQ A;  2RGQ A;  2GEY A;  2W2C A;  1ZX2 A;  2XH9 A;  4N6T A;  3WA2 X;  3B4P A;  1D6U A;  3NBR A;  3K7C A;  3CCQ 3;  1OHS A;  3FF0 A;  3UL5 A;  3NQY A;  4HBR A;  2W9Q A;  2YX9 A;  5BVB A;  3KSE D;  1DMQ A;  1YJ9 3;  1ULJ B;  2ZL8 A;  1YGE A;  4IIA A;  3JUP A;  1U5O A;  1A2K A;  3OX9 A;  1Z1S A;  1NB3 I;  3HIG A;  1N8R 4;  1UI8 A;  2CFK A;  3EF8 A;  5IEP A;  3N8B A;  2GU1 A;  2XFT A;  1RJO A;  3EBY A;  3OV4 A;  4HVN A;  3JUN A;  1YIJ 3;  4HKV B;  1M1X B;  2E2V A;  3FG3 A;  1IQX A;  2CIU A;  4MJD A;  1VQO 3;  5D82 A;  2IMJ A;  2CWU A;  1DVD A;  3EE1 A;  3MG2 A;  3ROB A;  1ULI B;  2Q07 A;  3GZR A;  2Y74 A;  5AYS C;  2QIY A;  1W4N A;  3GZX B;  3F14 A;  2PZV A;  4AKZ A;  1VQ6 3;  1K28 A;  2XF3 A;  4FR9 A;  3KFQ C;  3LOY A;  4OK0 A;  5KP4 A;  1W6G A;  4AKY A;  3CC4 3;  1UW1 A;  1WTH A;  3AMO A;  4R9K A;  2BHM A;  3GAX A;  3G8Z A;  4R9L A;  1YI2 3;  3SED A;  3LTD A;  3GWR A;  4K1U A;  1TU5 A;  3CCU 3;  4WYK B;  3DY5 A;  4HJL B;  2CFW A;  3KE7 A;  3LH4 A;  3EB8 A;  5AEW B;  3LTA A;  1NWW A;  2BMR B;  4O02 B;  3HI7 A;  2IUJ A;  1PU4 A;  1OAC A;  3EHC A;  3CNX A;  4FCM A;  4HM0 B;  3G6E 3;  3V98 A;  4FCJ A;  3MPH A;  2O3O A;  4HM5 B;  4H61 A;  5EEO A;  3K9M C;  4BTW A;  4N6O B;  3G4S 3;  2CFG A;  4X2O A;  2B24 B;  1E3R A;  4XB5 A;  1JB2 A;  4LMI A;  4O8S A;  4N6N B;  1VQP 3;  1STF I;  5JPU A;  1Q7Y 4;  1EKM A;  3CD6 3;  2FXT A;  2XSH B;  3CPO A;  1K9M 4;  1GY6 A;  2JQ5 A;  3TDG A;  4WHA A;  3T0U A;  3HK4 A;  1IK3 A;  1VZZ A;  3MYT A;  1LXE A;  2P05 A;  1DVC A;  2BMQ B;  1M1K 4;  4FCZ A;  1JKG A;  3BLZ A;  4MEI A;  3DGM A;  4N3V A;  4KFF A;  3EN1 B;  3PGB A;  1ROA A;  3LML A;  1D6Z A;  4IPB A;  3X3X A;  2V1L A;  2MC8 A;  5CXO A;  1M90 4;  2YFI B;  3Q1C A;  3SLU A;  5D81 A;  2ML6 A;  3N54 B;  4LEH A;  2KCD A;  1K41 A;  2KRT A;  3DM8 A;  3PZW A;  2CG1 A;  2XRX B;  5IG5 A;  1Q82 4;  5IER A;  2E2U A;  1SIH A;  3WOE B;  1JN5 A;  4RNZ A;  5BXQ A;  1N8Q A;  4PEJ A;  3PYJ A;  4XDW A;  1VQ9 3;  1SPU A;  1CYV A;  1ISK A;  2GEX A;  3WA3 A;  1KWI A;  2UX0 A;  3HZP A;  3AMO B;  4NHF A;  3VGN A;  4RZM A;  1QVG 2;  1NJI 4;  2WGO A;  4EYC A;  3CNM A;  4J8T A;  1O7G B;  2QGU A;  3J7Y d;  3IMA B;  1GYB A;  2OOV C;  4KVH A;  4BTX A;  1W2B 2;  5IEN A;  2W56 A;  3F40 A;  3Q2P A;  3F7S A;  1JB5 A;  1RRL A;  3VF1 A;  3I55 3;  4AEQ A;  3MG3 A;  2ZDJ A;  4WP5 A;  3DXO A;  2L4V A;  2Z7A A;  2W9P A;  3OWY A;  4Q53 A;  5IG3 A;  2F99 A;  3NHX A;  4EC6 A;  1FGQ A;  2OQE C;  3UL6 A;  3NV0 A;  1U8C B;  3X40 A;  2CC3 A;  1OH0 A;  3HII A;  2CFD A;  1IT8 A;  3CCR 3;  1W01 A;  1K8A 4;  3KN4 A;  1L5G B;  4TX4 A;  4HM7 B;  5STD A;  1JKG B;  3QK9 A;  4IT7 A;  3HX8 A;  2P38 A;  3D9R A;  1IQ8 A;  4L8P A;  2MF7 A;  1O7N B;  5CK6 A;  2OQE A;  3X41 A;  1RRH A;  1R4C A;  1W7C A;  3QRD A;  3MG1 A;  3LT9 A;  3F9S A;  3KKG A;  3MKI A;  3OWU A;  1VQ7 3;  2FGT A;  1OGZ A;  4HZ9 B;  1JJ2 2;  1CQS A;  1O7W B;  3H3H A;  3V92 A;  1C7H A;  2W0Q A;  5JBS A;  2XSO B;  3WMD A;  1Q40 A;  1YVB I;  2O9U X;  4FMC A;  2I9W A;  3I56 3;  1TFO A;  3OXA A;  1O7M B;  4ORL A;  1TP6 A;  2WO0 A;  3OWS A;  4HM6 B;  3WDG B;  3L0R A;  3NUV A;  4XM4 A;  2HMO B;  4HM2 B;  3EBT A;  4U13 A;  1N5H A;  4QWT A;  2K0M A;  3G0K A;  1HKX A;  2CK3 H;  1AVK A;  2OTJ 3;  1QJG A;  4R1K A;  2Z6B A;  3N9H A;  1VQ5 3;  1YIT 3;  3O8Y A;  5KP3 A;  4WWU C;  4K90 B;  3BNC A;  1OF5 A;  3MSO A;  4R4K A;  5I97 A;  2P0X A;  4GL6 A;  2XR8 B;  5IW9 A;  2WOH A;  5IEO A;  3PXM A;  1FGO A;  1F8N A;  3X42 A;  1W6C A;  4CCV A;  1OGX A;  3DUK A;  3ER7 A;  3U1W A;  3M8C A;  3NBB A;  1YJW 3;  4I4K A;  4KFE A;  2E2T A;  2K54 A;  2LYX A;  2YFJ B;  3FH1 A;  2R4I A;  4K61 A;  3CCV 3;  2F86 B;  2PNC A;  3KSP A;  1EA2 A;  4NRE A;  3T8N A;  1JNQ A;  2RSX A;  4LZI A;  4FMA A;  1FGM A;  5HGR A;  1OHO A;  3LTC A;  3LZA A;  1O7H B;  4MMY B;  5A0O B;  5FW5 A;  5TGN A;  1DMM A;  3ALA A;  2BO9 B;  1WMP A;  1YJN 3;  3G16 A;  5G2G A;  3CCE 3;  1WMO A;  1MNL A;  1STD A;  2GBW B;  5FGO A;  5DRV A;  1VQK 3;  1US1 A;  5D83 A;  2IUK A;  1W2Z A;  4HM1 B;  2CW9 A;  4N6M A;  3CC2 3;  3EQQ B;  2Z76 A;  6STD A;  1Q86 4;  2XFS A;  1NO3 A;  3FZW A;  1OCV A;  2D1W A;  3DZL A;  3NM7 A;  3WOF B;  1N5P A;  5EVH A;  2GBX B;  5LC7 A;  1TIJ A;  1IVX A;  5JPP A;  2CH9 A;  1CEW I;  4N6L A;  3KZT A;  4K1V A;  3EJV A;  4HM4 B;  2CKF B;  3T8U A;  1OUN A;  2LQV A;  2GU3 A;  3U97 A;  1JB4 A;  2BMO B;  2RFR A;  2HML B;  1QAL A;  2OCT A;  4HYZ A;  1FUW A;  3OW2 2;  2ML5 A;  3UJM A;  2C10 A;  1LVN A;  3F7X A;  4EXR A;  1S5A A;  3JUO A;  1IU7 A;  3B4O A;  3SVA A;  1VQ8 3;  3B7C A;  1ASK A;  1NU3 A;  1W00 A;  4KZ1 A;  3IJE B;  1NDO B;  2CG0 A;  1RN7 A;  3V99 A;  2IA7 A;  5KP1 A;  2OOV A;  1E3V A;  3F8H A;  1KC8 4;  1ROV A;  2HMM B;  5AII A;  3UB1 A;  1OPY A;  1QAK A;  5ELJ A;  3MHE A;  3CCM 3;  1VQM 3;  1LOX A;  1QVF 2;  1W6Y A;  3FF2 A;  4WYK A;  3EN8 A;  3PCS A;  1A2V A;  3FKA A;  1JV2 B;  3S5C A;  3FGY A;  4O2H A;  3FCS B;  1IV7 A;  3BNE A;  4EV2 A;  2XGN A;  2P0M A;  3NBJ A;  5AEU B;  2C11 A;  3H51 A;  3UNL A;  2Y73 A;  2FNQ A;  3K5T A;  5CF1 A;  3EC9 A;  3RGA A;  1JN5 B;  3X3Y A;  3CCS 3;  3DGO A;  3S27 A;  3PS8 A;  3JUQ A;  1UUW B;  2D42 A;  2KXG A;  3RDE A;  1GY7 A;  1BUQ A;  2INX A;  4G1M B;  2HMN B;  4GB5 A;  3SOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...