3B7CA

Crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
b'MPTDDIVQLLKGQEEAWNRGDLDAYMQGYWQNEQLMLISNGKFRNGWDETLAAYKKNYPDKESLGELKFTIKEIKMLSNYAAMVVGRWDLKRLKDTPTGVFTLLVEKIDDRWVITMDHSSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF-2 like protein of unknown function (NP_715767.1) from Shewanella oneidensis at 1.70 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b7cA00
4XDWA 3VGNA 5IEPA 1E3VA 5KP1A 3G0KA 3B4PA 1STDA 4HM3B 1ULIB 2YFIB 1EA2A 2B24B 4STDA 4R9LA 4MJDA 1ASKA 2UX0A 2GEXA 4J8TA 5JPPA 4RZMA 2GBXB 3EJVA 3JUNA 3BLZA 1OGXA 3JUOA 2XSOB 3GRDA 2BMRB 5IG4A 1JKGB 1JB2A 3LZAA 4R9KA 1ZO2A 1E3RA 3FKAA 2Z76A 1Q40B 3A76A 1W02A 3GWRA 3F8XA 3EQQB 3F7SA 5AIIA 3CNXA 4XBYA 8CHOA 4LEHA 4XBTA 2JQ5A 1C7HA 2Z77A 3F40A 3NV0A 5CF1A 3FH1A 2BNGA 4HJLB 4CDLA 3EC9A 1OPYA 3UJMA 2IMJA 3OWYA 4HM8B 4K1UA 3OX9A 2HMMB 1JB5A 4WYKA 2XR8B 1OGZA 3G8ZA 5IF6A 4WP5A 3F14A 3MG2A 3K7CA 4J9AA 3DMCA 3JUPA 1OF5B 5BVBA 1GY5A 3B8LA 2GEYA 4HM1B 5CK6A 3DZLA 1K41A 5AIGA 2HMLB 5IEOA 3H3HA 5HGRA 1UUWB 1TP6A 4HKVB 3OXAA 3STDA 5CXOA 3JUMA 4IIAA 3MYTA 4OVMA 4HZ9B 1W6YA 4X2OA 3UNLA 1NU3A 2RGQA 6STDA 1BUQA 3SOAA 5AEUB 3KSPA 3OWSA 4OUQA 3KZTA 4KVHA 5AIFA 2QIYA 1UUVB 2CKFB 4ORLA 3NUVA 5FW5A 1ISKA 3NM2A 2I9WA 3FGYA 4K1VA 1OHSA 1NDOB 1O7PB 4N3VA 3MHEA 4LGQA 1O7WB 4HM4B 4I4KA 3SEDA 3F8HA 1TUHA 4L8PA 3NXJA 4XM4A 1JN5A 2HMJB 3H51A 5D82A 3EN8A 3NV0B 5EVHA 3F7XA 2QGUA 3F9SA 1NWWA 3FLJA 3EX9A 5BXQA 2XSHB 4R1KA 1QJGA 5G2GA 1DMMA 1S5AA 4LMIA 4HM2B 3EF8A 2W2CA 2GBWB 1ULJB 1SJWA 3D9RA 1OHPA 3K0ZA 3RGRA 2R4IA 3MG3A 5DRVA 3LYGA 3OV4A 3DUKA 1OUNA 3HZPA 3MSOA 4GB5A 2YFJB 1GY6A 1Z1SA 2F99A 2HMOB 4HZBB 2A15A 4PEJA 7STDA 2STDA 3EBTA 5D81A 1DMNA 2PZVA 3NBRA 1GYBA 3S5CA 4X2HA 3EHCA 4HM5B 4WWUC 5STDA 2INXA 1O7HB 5AI1A 3GZXB 4FCMA 4HM6B 3FF2A 4XBXA 1VZZA 1GY7A 3FZWA 4HM0B 3ECFA 2CHCA 4L7KA 1CQSA 5CLKA 3M8CA 3NHXA 5TGNA 1JB4A 3CPOA 3KE7A 5IG3A 1OH0A 3T8UA 1GS3A 5D83A 5IENA 1U5OA 3ROBA 1O7GB 3MG1A 3CU3A 1JKGA 5JPUA 1IDPA 3GZBA 4U13A 4HVNA 2Z7AA 1O7NB 4XDVA 5AEWB 5KP3A 5CF2A 1Q40A 1DMQA 3WMDA 1JN5B 1Q42A 2RFRA 1HKXA 2RCDA 1WQLB 3FSDA 4XB5A 3DM8A 1OCVA 3Q90A 3JUQA 3HK4A 5IERA 3KKGA 1EG9B 5IG0A 4WYKB 2XRXB 3FF0A 4Q53A 3MKIA 5DREA 3B7CA 5AIHA 3VSYA 3T8NA 2OWPA 2BMOB 1O7MB 2K54A 2HMKB 3DXOA 1ZX2A 1W01A 2B1XB 3BB9A 4L8OA 3CNMA 3GZRA 5IG5A 3G16A 4FCJA 4H3UA 3RGAA 1OF5A 1OHOA 3EN1B 1A2KA 2HMNB 3GZYB 3SOYA 3I0YA 4HM7B 3B4OA 3E99A 1W00A 5KP4A 1AR0A 3IPTA 2F98A 3EBYA 2F86B 2GXFA 1QMAA 3HX8A 2YFLB 2BMQB 1E97A 3ER7A 3OWUA
chains in the Genus database with same CATH superfamily
4XDWA 3VGNA 5IEPA 1E3VA 1BRKA 1JZDA 5KP1A 5AYRB 5AYSC 1BSDA 1JBRA 3G0KA 4I5QA 4WFOA 2OCTA 1W6GA 4EW5A 1BRJA 5M19A 2BIRA 5IW9A 1BNSA 2BU4A 3FCSB 1G96A 1AY7A 1PY3A 3B4PA 5EQLA 1UUGB 1W5ZA 1STDA 4HM3B 1ULIB 3FG3A 2YFIB 1EA2A 1YGWA 3DGLA 1V74A 5G1LA 2Q07A 3I553 4FMBA 3LTBA 2B24B 3LTDA 3UL5A 1RGCA 4STDA 3NBBA 4R9LA 1BNJA 7RNTA 4MJDA 2WO0A 2CW9A 1RLSA 2D1WA 2XFSA 1KQS2 3D3LA 4N6V0 3CXC2 1ASKA 1B2UA 1BNFA 2CFDA 2KF6A 1SIHA 2UX0A 1I3FA 4N6MA 1RTUA 2GEXA 1GOYA 4J8TA 5JPPA 4RZMA 1YI23 1UI8A 2GBXB 2QA43 1FGTA 1X1XA 4MMZB 3ZFZA 1RDSA 3LTCA 3BNDA 1V57A 3EJVA 1AV4A 3JUNA 1LOWA 3BLZA 1OGXA 2P09A 4CJNA 3RNTA 1RRLA 3JUOA 1BGSA 1BSCA 2XSOB 3GRDA 3GAXA 3V99A 2BMRB 3CCR3 5M18A 5IG4A 1JKGB 4RNYA 1JB2A 3LZAA 2PNCA 5LC7A 4R9KA 1ZO2A 1E3RA 1A67A 1I2FA 2KF5A 1KD14 3FKAA 2Z76A 4JRFA 3D5GA 1FYSA 3DH2A 1Q40B 3T0UA 3A76A 4KFFA 3CCJ3 1W02A 3GWRA 3F8XA 1BRNL 2CK3H 1R4YA 1G02A 3EQQB 4GHOA 3F7SA 5AIIA 3CNXA 4MEIA 2Z6BA 4XBYA 8CHOA 1N8R4 2CWVA 3DGOA 4LEHA 1N9JA 5ELUA 3CCE3 3LT9A 4XBTA 2JQ5A 2L1SA 1TFOA 1C7HA 1W4NA 3CMA3 1GSPA 2Z77A 1BNEA 1CYUA 1BSBA 1KWIA 2KAAA 1IYYA 1B2MA 4O02B 1N5HA 1I2EA 1VQN3 2W04A 4O2HA 3F40A 1X1YA 3KSED 2AAEA 3Q3FA 3NV0A 5CF1A 1GD4A 1I0VA 1IQYA 2M7OA 3ALAA 3X3YA 1ISKA 1IT8A 2CX0A 2V1LA 3CME3 3FH1A 2BNGA 4HJLB 2BO9B 3NQZA 3BNCA 3WA3A 4CDLA 2JDIH 1OPYA 3EC9A 4NREA 3UJMA 1YIT3 2CFGA 1V58A 2IMJA 3OWYA 4HM8B 4K1UA 1MOLA 3OX9A 2HMMB 1IV7A 4NHFA 4RBNA 1UDII 1JB5A 4WYKA 2OQEA 3KN4A 4GSPA 3BU4A 3KCHA 3G6E3 1RGLA 2CIUA 2XR8B 1T2HA 1OGZA 3CC73 3G8ZA 2CG0A 2WOFA 5IF6A 3AMOB 2MF7A 4WP5A 1SIIA 2P38A 3F14A 3MG2A 1RMSA 1BAOA 2P05A 3K7CA 4J9AA 3DMCA 1KSIA 3JUPA 3U1WA 1NNVA 3CD63 3PXMA 1OF5B 4K90B 5BVBA 2H0HA 1GY5A 3PCSA 3B8LA 1LVNA 1QAKA 1X1WA 5G1KA 2GEYA 1K9M4 4BL2A 4HM1B 1JJ22 2XH9A 1K734 1VQ43 1J2BA 5CK6A 1YIJ3 9RNTA 2XFTA 6RNTA 1EUIC 1NB3I 2ZDJA 3DZLA 4GL6A 3SLUA 1Y4KA 3NX0A 1RCKA 4EV5A 2RNTA 3ZG5A 4HYZA 1VQK3 1RGGA 3WODG 1K41A 1N9EA 5AIGA 1A2VA 2QEX3 3CCQ3 1LRAA 4FCZA 1BANA 2HMLB 1FGMA 3CC23 1VQP3 2OOVC 4N6LA 1LOVA 5IEOA 2MC8A 1PU4A 3H3HA 5HGRA 1UUWB 5A0OB 1M9GA 1TP6A 1X1UA 3K5TA 4HKVB 3OXAA 2F4YA 3U97A 2CX1A 3D79A 5CXOA 3STDA 3HIGA 4R80A 1HU9A 1CH0A 2AADA 4N6NB 1A90A 3S27A 1YVSA 1JV2B 1RGEA 1W2ZA 3DGMA 4IT7A 3OW22 1YGEA 3A5EA 3JUMA 3MYTA 4IIAA 4OVMA 4HZ9B 1W6YA 1TFKA 2XEPA 1BRIA 1ZGXA 4G1MB 2CWUA 2XGLA 4X2OA 3UNLA 3G4S3 1NU3A 1UCLA 2CFWA 3K9MC 2RGQA 3PS8A 6STDA 1R4CA 1BUQA 1Q814 4FMAA 3SOAA 5AEUB 2E2UA 2W6JH 4KT3B 3X41A 4O8SA 1YJN3 2XGNA 3KSPA 5I97A 2IA7A 3V98A 1PYLA 3OWSA 2W56A 4OUQA 1QAFA 3AGNA 3KZTA 1BU4A 4KVHA 1IK3A 5AIFA 3LOYA 4WHAA 1GOVA 1TU5A 4EYCA 3S28A 3WR2A 2QIYA 1BNRA 3QRDA 1UUVB 2CFKA 1TRQA 2CKFB 3IJEB 3NUVA 2BHMA 4KFEA 2C4BA 2GU1A 3NM2A 1K28A 5FW5A 1HZ1A 1LNIA 2I9WA 2O9UX 4AKYA 3CCV3 1HYFA 3D5IA 2K3DA 3FGYA 1IU7A 1LXEA 3LXUX 4K1VA 2CG1A 3QK9A 3URPA 1BSAA 1OHSA 3WDGB 1SPUA 4JF8A 1NB5I 1NDOB 3S29A 1O7PB 1RN7A 4BIRA 4N3VA 2KF4A 4ORLA 1N5PA 1QALA 1RN1A 1MGRA 1UGIA 3MHEA 1US1A 4K61A 3X42A 5GSPA 3X40A 2Y74A 2LYXA 4ZM8A 3BNEA 4LGQA 1D6UA 4AEQA 4BU4A 3V92A 1O7WB 1FA3A 4HM4B 3DGNA 4I4KA 1FUTA 3SEDA 3F8HA 2CC3A 1YVBI 1TUHA 4L8PA 2L4VA 3NXJA 4XM4A 1JN5A 2HMJB 1RNTA 3CCU3 3EN8A 3H51A 5D82A 1IV9A 1UCJA 3NV0B 5EVHA 3F7XA 4J5GA 1EKMA 2QGUA 1B2XA 1MWRA 1NWWA 3F9SA 3DGYA 3FLJA 3EX9A 3AHSA 1VQ63 1B2ZA 2F56A 1B3SA 2ZHXB 5BXQA 2XSHB 1FGQA 4R1KA 1MNLA 1QJGA 1YJW3 3X3ZA 5G2GA 1WNHA 1GD3A 2F5MA 1GMQA 1FGRA 1DMMA 1JNQA 1M904 1S5AA 1BNGA 4HBRA 4LMIA 3PGBA 1F8NA 1M1XB 2D42A 1IVVA 4HM2B 3EF8A 2W2CA 3JVCA 1LOYA 2GBWB 2W9PA 1D6ZA 1ULJB 1VQQA 1SJWA 3TDGA 7GSPA 2XF3A 1M1K4 4BTXA 1DETA 2OQEC 2ZA4A 3D9RA 3KFQC 1UW1A 1OHPA 4FMCA 3IMAB 5EEOA 1I0XA 4EC6A 2J8XB 1S723 3K0ZA 3RGRA 1DE3A 1Q7HA 2R4IA 3MG3A 4R4KA 5DRVA 1VQ73 3CC43 3LYGA 2F5WA 2KXGA 1N8QA 5BIRA 2O3OA 1Q7Y4 1IQXA 1RGKA 4EV2A 3N8BA 1JRQA 2UGIA 1SQWA 3MPHA 4IPBA 3OV4A 1BUJA 3DUKA 1OUNA 3HZPA 3MSOA 4MMYB 4GB5A 4OK0A 1I3IA 3K63A 4N6OB 3N9HA 4O3VA 2YFJB 3MWZA 1GY6A 5RNTA 1Z1SA 2F99A 1RN4A 2GSPA 1I8VA 2HMOB 4HZBB 2A15A 3WOEB 1VQ93 1I70A 3VF1A 4BTWA 4PEJA 7STDA 1D6YA 4EBGA 1RRHA 2ZL8A 2STDA 4LZIA 3EBTA 3PYJA 2SARA 2WGOA 3HOHA 1CEWI 1ROVA 5D81A 3S67A 3AHWA 1VQL3 1DMNA 3HI7A 1FUSA 2PZVA 3NBRA 1VQM3 1GYBA 1STFI 3S5CA 4NPBA 4X2HA 3WA2X 1WMPA 4QWTA 3EHCA 1TIJA 2E2TA 2YX9A 1IT7A 4HM5B 4WWUC 5M1AA 2INXA 1O7HB 5AI1A 5STDA 1BRSA 4H61A 3J7Yd 3GZXB 1ROAA 1B2SA 3KIIA 1LQGC 3HIIA 4CCVA 2KCDA 4FCMA 1OACA 2CWTA 1BVIA 4HM6B 4HOHA 2W56B 3FF2A 3N54B 2RBIA 1MWSA 3PCRA 1VZZA 4N6UA 4XBXA 1FW7A 1ZS7A 1GY7A 3FZWA 4HM0B 3ECFA 1RHLA 1TTOA 2CHCA 2ML5A 3LTAA 1MWUA 5LC6A 4L7KA 1CQSA 5CLKA 3M8CA 3NHXA 1MWTA 5TGNA 2WGQA 1W7CA 3PZWA 4AKZA 3Q2PA 2CFLA 1MGWA 2OTJ3 2WOHA 4RNZA 1B21A 1JB4A 3CPOA 1T5YA 2R41A 2IUKA 3KE7A 4HAAA 1UGHI 2IUJA 2C10A 5IG3A 1W2B2 2ML6A 1WMNA 1FUWA 1FZUA 1OH0A 3T8UA 1GS3A 1DVDA 5D83A 1G0TA 3FG4A 1U5OA 3ROBA 5IENA 1LQMB 1BIRA 3UL6A 1T2IA 2IY2A 1RGAA 1O7GB 1GOUA 1L5GB 2OTL3 1KC84 1FGOA 1RSNA 4LYLB 1VQ53 1B20A 3MG1A 3L0RA 3NM7A 1QVF2 2P0XA 3CU3A 2RSXA 1JKGA 2FNQA 3NBJA 1IDPA 3X3XA 5JPUA 5JBSA 4BL3A 1UCKA 3GZBA 2FGTA 1VQO3 4U13A 3SYUA 4HVNA 4EXRA 1LOXA 2Z7AA 3SX1A 1O7NB 4XDVA 5AEWB 5KP3A 3LT8A 5CF2A 1JBTA 1Q40A 3SXXA 1DMQA 3WMDA 3CCS3 1JN5B 4RNTA 2Y73A 1Q42A 2RFRA 1W6CA 3EB8A 1UI7A 1RGFA 1HKXA 1IVUA 1NJI4 1YNVX 2CH9A 2RCDA 8RNTA 1WQLB 3FSDA 3NQYA 4XB5A 1BNIA 4FR9A 2IYJA 3DM8A 1AVLA 1TJDA 1YHQ3 1OCVA 3Q90A 2W03A 3JUQA 3HK4A 5IERA 3KKGA 1EG9B 5IG0A 2C11A 2W0QA 2KF3A 4WYKB 1IVWA 2H0IA 2XRXB 3FF0A 3GSPA 1RKYA 1JZOA 4BTYA 1AQZA 3BNBA 3ZG0A 2BT3A 1PFPA 4Q53A 3MKIA 5DREA 2LQVA 3B7CA 4LSOA 5AIHA 3AGOA 3VSYA 3Q1CA 1RJOA 2OWPA 1GMRA 3T8NA 3G713 1YJ93 2HOHA 2BMOB 1Q9EA 1O7MB 2K54A 1B27A 1DYUA 1WTHA 3WHOA 2HMKB 2K0MA 3DXOA 3O8YA 4KFDA 1BOXA 1ZX2A 3BIRA 1WMOA 3LMLA 1W01A 1BRHA 2W9QA 1BSEA 2B1XB 3WOFB 2KRTA 3BB9A 4L8OA 3I563 2UUGC 2FXTA 3CNMA 3D4AA 3AMOA 4ILFA 3UB1A 4DKIA 1K8A4 3CCM3 3GZRA 1BRGA 5IG5A 1JBSA 2P0MA 1SARA 3G16A 4FMDA 4FCJA 4H3UA 5ELJA 2E2VA 3RGAA 1OF5A 1OHOA 1DVCA 1T3BA 1U8CB 2H0GA 1GMPA 2OOVA 3EN1B 3DY5A 1A2KA 2SBLA 1NO3A 1RNBA 1CYVA 2HMNB 3GZYB 3SOYA 1EQKA 3I0YA 4MMXB 1LNHA 1A2PA 3B4OA 3E99A 3FG1A 4HM7B 4N6TA 1C54A 1W00A 5HOHA 1Q824 5KP4A 1AR0A 3IPTA 3LH4A 2F98A 1AVKA 3CPW2 3CCL3 3RDEA 1VQ83 4CPKA 3EBYA 1EEJA 1RCLA 2F86B 4J5KA 4KZ1A 5BU4A 1RGHA 2GXFA 1IQ8A 1IVXA 1QMAA 1UCIA 3HX8A 4TX4A 2YFLB 5FGOA 6GSPA 1Q864 1QVG2 1I2GA 3EE1A 2BMQB 1E97A 3ER7A 1TRPA 2GU3A 3SVAA 3OWUA
chains in the Genus database with same CATH topology
4XDWA 3VGNA 5IEPA 1E3VA 5KP1A 5AYRB 5AYSC 3G0KA 4WFOA 2OCTA 1W6GA 5IW9A 3FCSB 1G96A 3B4PA 5EQLA 1W5ZA 1STDA 4HM3B 1ULIB 3FG3A 2YFIB 1EA2A 3DGLA 1V74A 2Q07A 3I553 4FMBA 3LTBA 2B24B 3LTDA 3UL5A 4STDA 3NBBA 4R9LA 4MJDA 2WO0A 2CW9A 2D1WA 2XFSA 1KQS2 3D3LA 4N6V0 3CXC2 1ASKA 2CFDA 2UX0A 1SIHA 4N6MA 2GEXA 4J8TA 5JPPA 4RZMA 1YI23 1UI8A 2GBXB 2QA43 1FGTA 4MMZB 3LTCA 3BNDA 3EJVA 1AV4A 3JUNA 3BLZA 1OGXA 2P09A 1RRLA 3JUOA 2XSOB 3GRDA 3GAXA 3V99A 2BMRB 3CCR3 5IG4A 1JKGB 4RNYA 1JB2A 3LZAA 2PNCA 5LC7A 4R9KA 1ZO2A 1E3RA 1A67A 1KD14 3FKAA 2Z76A 4JRFA 1Q40B 3T0UA 3A76A 4KFFA 3CCJ3 1W02A 3GWRA 3F8XA 2CK3H 3EQQB 3F7SA 5AIIA 3CNXA 4MEIA 2Z6BA 4XBYA 8CHOA 1N8R4 2CWVA 3DGOA 4LEHA 1N9JA 5ELUA 3CCE3 3LT9A 4XBTA 2JQ5A 1TFOA 1C7HA 1W4NA 3CMA3 2Z77A 1CYUA 1KWIA 4O02B 1N5HA 1VQN3 2W04A 4O2HA 3F40A 3KSED 3NV0A 5CF1A 1GD4A 2M7OA 1IQYA 3ALAA 3X3YA 1IT8A 2V1LA 3CME3 3FH1A 2BNGA 4HJLB 2BO9B 3NQZA 3BNCA 3WA3A 4CDLA 2JDIH 1OPYA 3EC9A 4NREA 3UJMA 1YIT3 2CFGA 2IMJA 3OWYA 4HM8B 4K1UA 1MOLA 3OX9A 2HMMB 1IV7A 4NHFA 4RBNA 1JB5A 4WYKA 2OQEA 3KN4A 3G6E3 2CIUA 2XR8B 1OGZA 3CC73 3G8ZA 2CG0A 2WOFA 5IF6A 3AMOB 2MF7A 4WP5A 1SIIA 2P38A 3F14A 3MG2A 2P05A 3K7CA 4J9AA 3DMCA 1KSIA 3JUPA 3U1WA 3CD63 3PXMA 1OF5B 4K90B 5BVBA 3PCSA 1GY5A 3B8LA 1LVNA 1QAKA 1K9M4 2GEYA 4HM1B 1JJ22 2XH9A 1K734 1VQ43 1J2BA 5CK6A 1YIJ3 2XFTA 1NB3I 2ZDJA 3SLUA 3DZLA 4GL6A 4EV5A 1Y4KA 3NX0A 4HYZA 1VQK3 3WODG 1K41A 1N9EA 5AIGA 1A2VA 2QEX3 3CCQ3 4FCZA 2HMLB 3CC23 1FGMA 1VQP3 2OOVC 4N6LA 5IEOA 2MC8A 1PU4A 3H3HA 5HGRA 1UUWB 5A0OB 1M9GA 1TP6A 3K5TA 4HKVB 3OXAA 3U97A 3STDA 5CXOA 3HIGA 4R80A 1HU9A 4N6NB 1A90A 3S27A 1JV2B 1W2ZA 3DGMA 4IT7A 3OW22 1YGEA 3JUMA 4IIAA 3MYTA 4OVMA 4HZ9B 1W6YA 1TFKA 2XEPA 4X2OA 4G1MB 2CWUA 2XGLA 3UNLA 3G4S3 1NU3A 2CFWA 3K9MC 2RGQA 3PS8A 6STDA 1R4CA 1BUQA 1Q814 4FMAA 3SOAA 5AEUB 2E2UA 2W6JH 3X41A 4O8SA 1YJN3 2XGNA 3KSPA 5I97A 2IA7A 3V98A 3OWSA 2W56A 4OUQA 1QAFA 3KZTA 4KVHA 1IK3A 5AIFA 3LOYA 4WHAA 1TU5A 4EYCA 3S28A 2QIYA 3QRDA 1UUVB 2CFKA 2CKFB 3IJEB 3NUVA 4KFEA 2BHMA 4ORLA 5FW5A 2GU1A 3NM2A 1K28A 3I563 2I9WA 1Q824 1ISKA 2O9UX 4AKYA 3CCV3 3FGYA 1IU7A 1LXEA 3LXUX 4K1VA 2CG1A 3QK9A 1OHSA 3WDGB 1SPUA 4JF8A 1NB5I 1NDOB 3S29A 1O7PB 1RN7A 4N3VA 1N5PA 1QALA 3MHEA 1US1A 4K61A 3X42A 3X40A 2Y74A 2LYXA 4ZM8A 3BNEA 4LGQA 1D6UA 4AEQA 3V92A 1O7WB 1FA3A 4HM4B 3DGNA 4I4KA 3SEDA 3F8HA 2CC3A 1YVBI 1TUHA 4L8PA 2L4VA 3NXJA 4XM4A 1JN5A 2HMJB 3CCU3 3EN8A 3H51A 5D82A 1IV9A 3NV0B 5EVHA 3F7XA 1EKMA 2QGUA 3F9SA 1NWWA 3FLJA 3EX9A 1VQ63 5BXQA 2XSHB 1FGQA 4R1KA 1MNLA 1QJGA 1YJW3 3X3ZA 5G2GA 1WNHA 1GD3A 1M904 1FGRA 1DMMA 1JNQA 1S5AA 4HBRA 4LMIA 3PGBA 1F8NA 1M1XB 2D42A 1IVVA 4HM2B 3EF8A 2W2CA 3JVCA 2GBWB 2W9PA 1D6ZA 1ULJB 1SJWA 3TDGA 2XF3A 1M1K4 4BTXA 2OQEC 3D9RA 3KFQC 1UW1A 1OHPA 4FMCA 3IMAB 5EEOA 4EC6A 1S723 3K0ZA 3RGRA 2R4IA 3MG3A 4R4KA 5DRVA 1VQ73 3CC43 3LYGA 2KXGA 1N8QA 2O3OA 1Q7Y4 1IQXA 4EV2A 3N8BA 1JRQA 1SQWA 3MPHA 4IPBA 3OV4A 3DUKA 1OUNA 3HZPA 3MSOA 4MMYB 4GB5A 4OK0A 3K63A 4N6OB 3N9HA 4O3VA 2YFJB 3MWZA 1GY6A 1Z1SA 2F99A 2HMOB 4HZBB 2A15A 3WOEB 1VQ93 3VF1A 4BTWA 4PEJA 7STDA 1D6YA 4EBGA 1RRHA 2ZL8A 2STDA 4LZIA 3EBTA 3PYJA 2WGOA 3S67A 1CEWI 1ROVA 5D81A 1VQL3 1DMNA 3HI7A 2PZVA 3NBRA 1VQM3 1GYBA 1STFI 3S5CA 4X2HA 1WMPA 4QWTA 3EHCA 1TIJA 2E2TA 2YX9A 1IT7A 4HM5B 4WWUC 5STDA 2INXA 1O7HB 5AI1A 3WA2X 4H61A 3J7Yd 3GZXB 1ROAA 3KIIA 3HIIA 4CCVA 2KCDA 4FCMA 1OACA 2CWTA 4HM6B 2W56B 3FF2A 3N54B 3PCRA 4N6UA 1VZZA 4XBXA 1GY7A 3FZWA 4HM0B 3ECFA 2ML5A 2CHCA 3LTAA 5LC6A 4L7KA 1CQSA 5CLKA 3M8CA 3NHXA 5TGNA 2WGQA 1W7CA 3PZWA 4AKZA 3Q2PA 2CFLA 2OTJ3 2WOHA 4RNZA 1JB4A 3CPOA 1T5YA 2IUKA 3KE7A 2IUJA 2C10A 5IG3A 1W2B2 2ML6A 1WMNA 1FUWA 1OH0A 3T8UA 1GS3A 1DVDA 5D83A 5IENA 3FG4A 1U5OA 3ROBA 3UL6A 1O7GB 1L5GB 2OTL3 1KC84 1FGOA 1VQ53 3MG1A 3L0RA 3NM7A 1QVF2 2P0XA 3CU3A 2RSXA 1JKGA 2FNQA 3NBJA 1IDPA 3X3XA 5JPUA 5JBSA 1VQO3 3GZBA 2FGTA 4U13A 4HVNA 4EXRA 1LOXA 2Z7AA 3SX1A 1O7NB 4XDVA 5AEWB 5KP3A 3LT8A 5CF2A 1Q40A 3SXXA 1DMQA 3WMDA 3CCS3 1JN5B 2Y73A 1Q42A 2RFRA 1W6CA 3EB8A 1UI7A 1HKXA 1IVUA 1NJI4 2CH9A 2RCDA 1WQLB 3FSDA 3NQYA 4XB5A 4FR9A 3DM8A 1AVLA 1YHQ3 1OCVA 3Q90A 2W03A 3JUQA 3HK4A 5IERA 3KKGA 1EG9B 5IG0A 2C11A 2W0QA 4WYKB 1IVWA 2XRXB 3FF0A 1RKYA 4BTYA 3BNBA 2BT3A 1PFPA 4Q53A 3MKIA 5DREA 2LQVA 3B7CA 4LSOA 5AIHA 3VSYA 1YJ93 3Q1CA 1RJOA 2OWPA 3T8NA 3G713 2BMOB 1O7MB 2K54A 1DYUA 1WTHA 2HMKB 2K0MA 3DXOA 3O8YA 4KFDA 1ZX2A 1WMOA 3LMLA 1W01A 2W9QA 2B1XB 3WOFB 2KRTA 3BB9A 4L8OA 2FXTA 3CNMA 3UB1A 3AMOA 1K8A4 3CCM3 3GZRA 5IG5A 2P0MA 3G16A 4FMDA 4FCJA 4H3UA 5ELJA 2E2VA 3RGAA 1OF5A 1OHOA 1DVCA 1U8CB 2OOVA 3EN1B 3DY5A 1A2KA 2SBLA 1NO3A 1CYVA 2HMNB 3GZYB 3SOYA 1EQKA 3I0YA 4MMXB 1LNHA 4HM7B 3B4OA 3E99A 3FG1A 4N6TA 1W00A 5KP4A 1AR0A 3IPTA 3LH4A 2F98A 1AVKA 3CPW2 3CCL3 3RDEA 1VQ83 3EBYA 2F86B 4KZ1A 2GXFA 1IQ8A 1IVXA 1QMAA 3HX8A 4TX4A 5FGOA 2YFLB 1Q864 1QVG2 3EE1A 2BMQB 1E97A 3ER7A 3SVAA 2GU3A 3OWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDW A;  3VGN A;  5IEP A;  1E3V A;  5KP1 A;  3G0K A;  3B4P A;  1STD A;  4HM3 B;  1ULI B;  2YFI B;  1EA2 A;  2B24 B;  4STD A;  4R9L A;  4MJD A;  1ASK A;  2UX0 A;  2GEX A;  4J8T A;  5JPP A;  4RZM A;  2GBX B;  3EJV A;  3JUN A;  3BLZ A;  1OGX A;  3JUO A;  2XSO B;  3GRD A;  2BMR B;  5IG4 A;  1JKG B;  1JB2 A;  3LZA A;  4R9K A;  1ZO2 A;  1E3R A;  3FKA A;  2Z76 A;  1Q40 B;  3A76 A;  1W02 A;  3GWR A;  3F8X A;  3EQQ B;  3F7S A;  5AII A;  3CNX A;  4XBY A;  8CHO A;  4LEH A;  4XBT A;  2JQ5 A;  1C7H A;  2Z77 A;  3F40 A;  3NV0 A;  5CF1 A;  3FH1 A;  2BNG A;  4HJL B;  4CDL A;  3EC9 A;  1OPY A;  3UJM A;  2IMJ A;  3OWY A;  4HM8 B;  4K1U A;  3OX9 A;  2HMM B;  1JB5 A;  4WYK A;  2XR8 B;  1OGZ A;  3G8Z A;  5IF6 A;  4WP5 A;  3F14 A;  3MG2 A;  3K7C A;  4J9A A;  3DMC A;  3JUP A;  1OF5 B;  5BVB A;  1GY5 A;  3B8L A;  2GEY A;  4HM1 B;  5CK6 A;  3DZL A;  1K41 A;  5AIG A;  2HML B;  5IEO A;  3H3H A;  5HGR A;  1UUW B;  1TP6 A;  4HKV B;  3OXA A;  3STD A;  5CXO A;  3JUM A;  4IIA A;  3MYT A;  4OVM A;  4HZ9 B;  1W6Y A;  4X2O A;  3UNL A;  1NU3 A;  2RGQ A;  6STD A;  1BUQ A;  3SOA A;  5AEU B;  3KSP A;  3OWS A;  4OUQ A;  3KZT A;  4KVH A;  5AIF A;  2QIY A;  1UUV B;  2CKF B;  4ORL A;  3NUV A;  5FW5 A;  1ISK A;  3NM2 A;  2I9W A;  3FGY A;  4K1V A;  1OHS A;  1NDO B;  1O7P B;  4N3V A;  3MHE A;  4LGQ A;  1O7W B;  4HM4 B;  4I4K A;  3SED A;  3F8H A;  1TUH A;  4L8P A;  3NXJ A;  4XM4 A;  1JN5 A;  2HMJ B;  3H51 A;  5D82 A;  3EN8 A;  3NV0 B;  5EVH A;  3F7X A;  2QGU A;  3F9S A;  1NWW A;  3FLJ A;  3EX9 A;  5BXQ A;  2XSH B;  4R1K A;  1QJG A;  5G2G A;  1DMM A;  1S5A A;  4LMI A;  4HM2 B;  3EF8 A;  2W2C A;  2GBW B;  1ULJ B;  1SJW A;  3D9R A;  1OHP A;  3K0Z A;  3RGR A;  2R4I A;  3MG3 A;  5DRV A;  3LYG A;  3OV4 A;  3DUK A;  1OUN A;  3HZP A;  3MSO A;  4GB5 A;  2YFJ B;  1GY6 A;  1Z1S A;  2F99 A;  2HMO B;  4HZB B;  2A15 A;  4PEJ A;  7STD A;  2STD A;  3EBT A;  5D81 A;  1DMN A;  2PZV A;  3NBR A;  1GYB A;  3S5C A;  4X2H A;  3EHC A;  4HM5 B;  4WWU C;  5STD A;  2INX A;  1O7H B;  5AI1 A;  3GZX B;  4FCM A;  4HM6 B;  3FF2 A;  4XBX A;  1VZZ A;  1GY7 A;  3FZW A;  4HM0 B;  3ECF A;  2CHC A;  4L7K A;  1CQS A;  5CLK A;  3M8C A;  3NHX A;  5TGN A;  1JB4 A;  3CPO A;  3KE7 A;  5IG3 A;  1OH0 A;  3T8U A;  1GS3 A;  5D83 A;  5IEN A;  1U5O A;  3ROB A;  1O7G B;  3MG1 A;  3CU3 A;  1JKG A;  5JPU A;  1IDP A;  3GZB A;  4U13 A;  4HVN A;  2Z7A A;  1O7N B;  4XDV A;  5AEW B;  5KP3 A;  5CF2 A;  1Q40 A;  1DMQ A;  3WMD A;  1JN5 B;  1Q42 A;  2RFR A;  1HKX A;  2RCD A;  1WQL B;  3FSD A;  4XB5 A;  3DM8 A;  1OCV A;  3Q90 A;  3JUQ A;  3HK4 A;  5IER A;  3KKG A;  1EG9 B;  5IG0 A;  4WYK B;  2XRX B;  3FF0 A;  4Q53 A;  3MKI A;  5DRE A;  3B7C A;  5AIH A;  3VSY A;  3T8N A;  2OWP A;  2BMO B;  1O7M B;  2K54 A;  2HMK B;  3DXO A;  1ZX2 A;  1W01 A;  2B1X B;  3BB9 A;  4L8O A;  3CNM A;  3GZR A;  5IG5 A;  3G16 A;  4FCJ A;  4H3U A;  3RGA A;  1OF5 A;  1OHO A;  3EN1 B;  1A2K A;  2HMN B;  3GZY B;  3SOY A;  3I0Y A;  4HM7 B;  3B4O A;  3E99 A;  1W00 A;  5KP4 A;  1AR0 A;  3IPT A;  2F98 A;  3EBY A;  2F86 B;  2GXF A;  1QMA A;  3HX8 A;  2YFL B;  2BMQ B;  1E97 A;  3ER7 A;  3OWU A; 
#chains in the Genus database with same CATH topology
 4XDW A;  3VGN A;  5IEP A;  1E3V A;  1BRK A;  1JZD A;  5KP1 A;  5AYR B;  5AYS C;  1BSD A;  1JBR A;  3G0K A;  4I5Q A;  4WFO A;  2OCT A;  1W6G A;  4EW5 A;  1BRJ A;  5M19 A;  2BIR A;  5IW9 A;  1BNS A;  2BU4 A;  3FCS B;  1G96 A;  1AY7 A;  1PY3 A;  3B4P A;  5EQL A;  1UUG B;  1W5Z A;  1STD A;  4HM3 B;  1ULI B;  3FG3 A;  2YFI B;  1EA2 A;  1YGW A;  3DGL A;  1V74 A;  5G1L A;  2Q07 A;  3I55 3;  4FMB A;  3LTB A;  2B24 B;  3LTD A;  3UL5 A;  1RGC A;  4STD A;  3NBB A;  4R9L A;  1BNJ A;  7RNT A;  4MJD A;  2WO0 A;  2CW9 A;  1RLS A;  2D1W A;  2XFS A;  1KQS 2;  3D3L A;  4N6V 0;  3CXC 2;  1ASK A;  1B2U A;  1BNF A;  2CFD A;  2KF6 A;  1SIH A;  2UX0 A;  1I3F A;  4N6M A;  1RTU A;  2GEX A;  1GOY A;  4J8T A;  5JPP A;  4RZM A;  1YI2 3;  1UI8 A;  2GBX B;  2QA4 3;  1FGT A;  1X1X A;  4MMZ B;  3ZFZ A;  1RDS A;  3LTC A;  3BND A;  1V57 A;  3EJV A;  1AV4 A;  3JUN A;  1LOW A;  3BLZ A;  1OGX A;  2P09 A;  4CJN A;  3RNT A;  1RRL A;  3JUO A;  1BGS A;  1BSC A;  2XSO B;  3GRD A;  3GAX A;  3V99 A;  2BMR B;  3CCR 3;  5M18 A;  5IG4 A;  1JKG B;  4RNY A;  1JB2 A;  3LZA A;  2PNC A;  5LC7 A;  4R9K A;  1ZO2 A;  1E3R A;  1A67 A;  1I2F A;  2KF5 A;  1KD1 4;  3FKA A;  2Z76 A;  4JRF A;  3D5G A;  1FYS A;  3DH2 A;  1Q40 B;  3T0U A;  3A76 A;  4KFF A;  3CCJ 3;  1W02 A;  3GWR A;  3F8X A;  1BRN L;  2CK3 H;  1R4Y A;  1G02 A;  3EQQ B;  4GHO A;  3F7S A;  5AII A;  3CNX A;  4MEI A;  2Z6B A;  4XBY A;  8CHO A;  1N8R 4;  2CWV A;  3DGO A;  4LEH A;  1N9J A;  5ELU A;  3CCE 3;  3LT9 A;  4XBT A;  2JQ5 A;  2L1S A;  1TFO A;  1C7H A;  1W4N A;  3CMA 3;  1GSP A;  2Z77 A;  1BNE A;  1CYU A;  1BSB A;  1KWI A;  2KAA A;  1IYY A;  1B2M A;  4O02 B;  1N5H A;  1I2E A;  1VQN 3;  2W04 A;  4O2H A;  3F40 A;  1X1Y A;  3KSE D;  2AAE A;  3Q3F A;  3NV0 A;  5CF1 A;  1GD4 A;  1I0V A;  1IQY A;  2M7O A;  3ALA A;  3X3Y A;  1ISK A;  1IT8 A;  2CX0 A;  2V1L A;  3CME 3;  3FH1 A;  2BNG A;  4HJL B;  2BO9 B;  3NQZ A;  3BNC A;  3WA3 A;  4CDL A;  2JDI H;  1OPY A;  3EC9 A;  4NRE A;  3UJM A;  1YIT 3;  2CFG A;  1V58 A;  2IMJ A;  3OWY A;  4HM8 B;  4K1U A;  1MOL A;  3OX9 A;  2HMM B;  1IV7 A;  4NHF A;  4RBN A;  1UDI I;  1JB5 A;  4WYK A;  2OQE A;  3KN4 A;  4GSP A;  3BU4 A;  3KCH A;  3G6E 3;  1RGL A;  2CIU A;  2XR8 B;  1T2H A;  1OGZ A;  3CC7 3;  3G8Z A;  2CG0 A;  2WOF A;  5IF6 A;  3AMO B;  2MF7 A;  4WP5 A;  1SII A;  2P38 A;  3F14 A;  3MG2 A;  1RMS A;  1BAO A;  2P05 A;  3K7C A;  4J9A A;  3DMC A;  1KSI A;  3JUP A;  3U1W A;  1NNV A;  3CD6 3;  3PXM A;  1OF5 B;  4K90 B;  5BVB A;  2H0H A;  1GY5 A;  3PCS A;  3B8L A;  1LVN A;  1QAK A;  1X1W A;  5G1K A;  2GEY A;  1K9M 4;  4BL2 A;  4HM1 B;  1JJ2 2;  2XH9 A;  1K73 4;  1VQ4 3;  1J2B A;  5CK6 A;  1YIJ 3;  9RNT A;  2XFT A;  6RNT A;  1EUI C;  1NB3 I;  2ZDJ A;  3DZL A;  4GL6 A;  3SLU A;  1Y4K A;  3NX0 A;  1RCK A;  4EV5 A;  2RNT A;  3ZG5 A;  4HYZ A;  1VQK 3;  1RGG A;  3WOD G;  1K41 A;  1N9E A;  5AIG A;  1A2V A;  2QEX 3;  3CCQ 3;  1LRA A;  4FCZ A;  1BAN A;  2HML B;  1FGM A;  3CC2 3;  1VQP 3;  2OOV C;  4N6L A;  1LOV A;  5IEO A;  2MC8 A;  1PU4 A;  3H3H A;  5HGR A;  1UUW B;  5A0O B;  1M9G A;  1TP6 A;  1X1U A;  3K5T A;  4HKV B;  3OXA A;  2F4Y A;  3U97 A;  2CX1 A;  3D79 A;  5CXO A;  3STD A;  3HIG A;  4R80 A;  1HU9 A;  1CH0 A;  2AAD A;  4N6N B;  1A90 A;  3S27 A;  1YVS A;  1JV2 B;  1RGE A;  1W2Z A;  3DGM A;  4IT7 A;  3OW2 2;  1YGE A;  3A5E A;  3JUM A;  3MYT A;  4IIA A;  4OVM A;  4HZ9 B;  1W6Y A;  1TFK A;  2XEP A;  1BRI A;  1ZGX A;  4G1M B;  2CWU A;  2XGL A;  4X2O A;  3UNL A;  3G4S 3;  1NU3 A;  1UCL A;  2CFW A;  3K9M C;  2RGQ A;  3PS8 A;  6STD A;  1R4C A;  1BUQ A;  1Q81 4;  4FMA A;  3SOA A;  5AEU B;  2E2U A;  2W6J H;  4KT3 B;  3X41 A;  4O8S A;  1YJN 3;  2XGN A;  3KSP A;  5I97 A;  2IA7 A;  3V98 A;  1PYL A;  3OWS A;  2W56 A;  4OUQ A;  1QAF A;  3AGN A;  3KZT A;  1BU4 A;  4KVH A;  1IK3 A;  5AIF A;  3LOY A;  4WHA A;  1GOV A;  1TU5 A;  4EYC A;  3S28 A;  3WR2 A;  2QIY A;  1BNR A;  3QRD A;  1UUV B;  2CFK A;  1TRQ A;  2CKF B;  3IJE B;  3NUV A;  2BHM A;  4KFE A;  2C4B A;  2GU1 A;  3NM2 A;  1K28 A;  5FW5 A;  1HZ1 A;  1LNI A;  2I9W A;  2O9U X;  4AKY A;  3CCV 3;  1HYF A;  3D5I A;  2K3D A;  3FGY A;  1IU7 A;  1LXE A;  3LXU X;  4K1V A;  2CG1 A;  3QK9 A;  3URP A;  1BSA A;  1OHS A;  3WDG B;  1SPU A;  4JF8 A;  1NB5 I;  1NDO B;  3S29 A;  1O7P B;  1RN7 A;  4BIR A;  4N3V A;  2KF4 A;  4ORL A;  1N5P A;  1QAL A;  1RN1 A;  1MGR A;  1UGI A;  3MHE A;  1US1 A;  4K61 A;  3X42 A;  5GSP A;  3X40 A;  2Y74 A;  2LYX A;  4ZM8 A;  3BNE A;  4LGQ A;  1D6U A;  4AEQ A;  4BU4 A;  3V92 A;  1O7W B;  1FA3 A;  4HM4 B;  3DGN A;  4I4K A;  1FUT A;  3SED A;  3F8H A;  2CC3 A;  1YVB I;  1TUH A;  4L8P A;  2L4V A;  3NXJ A;  4XM4 A;  1JN5 A;  2HMJ B;  1RNT A;  3CCU 3;  3EN8 A;  3H51 A;  5D82 A;  1IV9 A;  1UCJ A;  3NV0 B;  5EVH A;  3F7X A;  4J5G A;  1EKM A;  2QGU A;  1B2X A;  1MWR A;  1NWW A;  3F9S A;  3DGY A;  3FLJ A;  3EX9 A;  3AHS A;  1VQ6 3;  1B2Z A;  2F56 A;  1B3S A;  2ZHX B;  5BXQ A;  2XSH B;  1FGQ A;  4R1K A;  1MNL A;  1QJG A;  1YJW 3;  3X3Z A;  5G2G A;  1WNH A;  1GD3 A;  2F5M A;  1GMQ A;  1FGR A;  1DMM A;  1JNQ A;  1M90 4;  1S5A A;  1BNG A;  4HBR A;  4LMI A;  3PGB A;  1F8N A;  1M1X B;  2D42 A;  1IVV A;  4HM2 B;  3EF8 A;  2W2C A;  3JVC A;  1LOY A;  2GBW B;  2W9P A;  1D6Z A;  1ULJ B;  1VQQ A;  1SJW A;  3TDG A;  7GSP A;  2XF3 A;  1M1K 4;  4BTX A;  1DET A;  2OQE C;  2ZA4 A;  3D9R A;  3KFQ C;  1UW1 A;  1OHP A;  4FMC A;  3IMA B;  5EEO A;  1I0X A;  4EC6 A;  2J8X B;  1S72 3;  3K0Z A;  3RGR A;  1DE3 A;  1Q7H A;  2R4I A;  3MG3 A;  4R4K A;  5DRV A;  1VQ7 3;  3CC4 3;  3LYG A;  2F5W A;  2KXG A;  1N8Q A;  5BIR A;  2O3O A;  1Q7Y 4;  1IQX A;  1RGK A;  4EV2 A;  3N8B A;  1JRQ A;  2UGI A;  1SQW A;  3MPH A;  4IPB A;  3OV4 A;  1BUJ A;  3DUK A;  1OUN A;  3HZP A;  3MSO A;  4MMY B;  4GB5 A;  4OK0 A;  1I3I A;  3K63 A;  4N6O B;  3N9H A;  4O3V A;  2YFJ B;  3MWZ A;  1GY6 A;  5RNT A;  1Z1S A;  2F99 A;  1RN4 A;  2GSP A;  1I8V A;  2HMO B;  4HZB B;  2A15 A;  3WOE B;  1VQ9 3;  1I70 A;  3VF1 A;  4BTW A;  4PEJ A;  7STD A;  1D6Y A;  4EBG A;  1RRH A;  2ZL8 A;  2STD A;  4LZI A;  3EBT A;  3PYJ A;  2SAR A;  2WGO A;  3HOH A;  1CEW I;  1ROV A;  5D81 A;  3S67 A;  3AHW A;  1VQL 3;  1DMN A;  3HI7 A;  1FUS A;  2PZV A;  3NBR A;  1VQM 3;  1GYB A;  1STF I;  3S5C A;  4NPB A;  4X2H A;  3WA2 X;  1WMP A;  4QWT A;  3EHC A;  1TIJ A;  2E2T A;  2YX9 A;  1IT7 A;  4HM5 B;  4WWU C;  5M1A A;  2INX A;  1O7H B;  5AI1 A;  5STD A;  1BRS A;  4H61 A;  3J7Y d;  3GZX B;  1ROA A;  1B2S A;  3KII A;  1LQG C;  3HII A;  4CCV A;  2KCD A;  4FCM A;  1OAC A;  2CWT A;  1BVI A;  4HM6 B;  4HOH A;  2W56 B;  3FF2 A;  3N54 B;  2RBI A;  1MWS A;  3PCR A;  1VZZ A;  4N6U A;  4XBX A;  1FW7 A;  1ZS7 A;  1GY7 A;  3FZW A;  4HM0 B;  3ECF A;  1RHL A;  1TTO A;  2CHC A;  2ML5 A;  3LTA A;  1MWU A;  5LC6 A;  4L7K A;  1CQS A;  5CLK A;  3M8C A;  3NHX A;  1MWT A;  5TGN A;  2WGQ A;  1W7C A;  3PZW A;  4AKZ A;  3Q2P A;  2CFL A;  1MGW A;  2OTJ 3;  2WOH A;  4RNZ A;  1B21 A;  1JB4 A;  3CPO A;  1T5Y A;  2R41 A;  2IUK A;  3KE7 A;  4HAA A;  1UGH I;  2IUJ A;  2C10 A;  5IG3 A;  1W2B 2;  2ML6 A;  1WMN A;  1FUW A;  1FZU A;  1OH0 A;  3T8U A;  1GS3 A;  1DVD A;  5D83 A;  1G0T A;  3FG4 A;  1U5O A;  3ROB A;  5IEN A;  1LQM B;  1BIR A;  3UL6 A;  1T2I A;  2IY2 A;  1RGA A;  1O7G B;  1GOU A;  1L5G B;  2OTL 3;  1KC8 4;  1FGO A;  1RSN A;  4LYL B;  1VQ5 3;  1B20 A;  3MG1 A;  3L0R A;  3NM7 A;  1QVF 2;  2P0X A;  3CU3 A;  2RSX A;  1JKG A;  2FNQ A;  3NBJ A;  1IDP A;  3X3X A;  5JPU A;  5JBS A;  4BL3 A;  1UCK A;  3GZB A;  2FGT A;  1VQO 3;  4U13 A;  3SYU A;  4HVN A;  4EXR A;  1LOX A;  2Z7A A;  3SX1 A;  1O7N B;  4XDV A;  5AEW B;  5KP3 A;  3LT8 A;  5CF2 A;  1JBT A;  1Q40 A;  3SXX A;  1DMQ A;  3WMD A;  3CCS 3;  1JN5 B;  4RNT A;  2Y73 A;  1Q42 A;  2RFR A;  1W6C A;  3EB8 A;  1UI7 A;  1RGF A;  1HKX A;  1IVU A;  1NJI 4;  1YNV X;  2CH9 A;  2RCD A;  8RNT A;  1WQL B;  3FSD A;  3NQY A;  4XB5 A;  1BNI A;  4FR9 A;  2IYJ A;  3DM8 A;  1AVL A;  1TJD A;  1YHQ 3;  1OCV A;  3Q90 A;  2W03 A;  3JUQ A;  3HK4 A;  5IER A;  3KKG A;  1EG9 B;  5IG0 A;  2C11 A;  2W0Q A;  2KF3 A;  4WYK B;  1IVW A;  2H0I A;  2XRX B;  3FF0 A;  3GSP A;  1RKY A;  1JZO A;  4BTY A;  1AQZ A;  3BNB A;  3ZG0 A;  2BT3 A;  1PFP A;  4Q53 A;  3MKI A;  5DRE A;  2LQV A;  3B7C A;  4LSO A;  5AIH A;  3AGO A;  3VSY A;  3Q1C A;  1RJO A;  2OWP A;  1GMR A;  3T8N A;  3G71 3;  1YJ9 3;  2HOH A;  2BMO B;  1Q9E A;  1O7M B;  2K54 A;  1B27 A;  1DYU A;  1WTH A;  3WHO A;  2HMK B;  2K0M A;  3DXO A;  3O8Y A;  4KFD A;  1BOX A;  1ZX2 A;  3BIR A;  1WMO A;  3LML A;  1W01 A;  1BRH A;  2W9Q A;  1BSE A;  2B1X B;  3WOF B;  2KRT A;  3BB9 A;  4L8O A;  3I56 3;  2UUG C;  2FXT A;  3CNM A;  3D4A A;  3AMO A;  4ILF A;  3UB1 A;  4DKI A;  1K8A 4;  3CCM 3;  3GZR A;  1BRG A;  5IG5 A;  1JBS A;  2P0M A;  1SAR A;  3G16 A;  4FMD A;  4FCJ A;  4H3U A;  5ELJ A;  2E2V A;  3RGA A;  1OF5 A;  1OHO A;  1DVC A;  1T3B A;  1U8C B;  2H0G A;  1GMP A;  2OOV A;  3EN1 B;  3DY5 A;  1A2K A;  2SBL A;  1NO3 A;  1RNB A;  1CYV A;  2HMN B;  3GZY B;  3SOY A;  1EQK A;  3I0Y A;  4MMX B;  1LNH A;  1A2P A;  3B4O A;  3E99 A;  3FG1 A;  4HM7 B;  4N6T A;  1C54 A;  1W00 A;  5HOH A;  1Q82 4;  5KP4 A;  1AR0 A;  3IPT A;  3LH4 A;  2F98 A;  1AVK A;  3CPW 2;  3CCL 3;  3RDE A;  1VQ8 3;  4CPK A;  3EBY A;  1EEJ A;  1RCL A;  2F86 B;  4J5K A;  4KZ1 A;  5BU4 A;  1RGH A;  2GXF A;  1IQ8 A;  1IVX A;  1QMA A;  1UCI A;  3HX8 A;  4TX4 A;  2YFL B;  5FGO A;  6GSP A;  1Q86 4;  1QVG 2;  1I2G A;  3EE1 A;  2BMQ B;  1E97 A;  3ER7 A;  1TRP A;  2GU3 A;  3SVA A;  3OWU A; 
#chains in the Genus database with same CATH homology
 4XDW A;  3VGN A;  5IEP A;  1E3V A;  5KP1 A;  5AYR B;  5AYS C;  3G0K A;  4WFO A;  2OCT A;  1W6G A;  5IW9 A;  3FCS B;  1G96 A;  3B4P A;  5EQL A;  1W5Z A;  1STD A;  4HM3 B;  1ULI B;  3FG3 A;  2YFI B;  1EA2 A;  3DGL A;  1V74 A;  2Q07 A;  3I55 3;  4FMB A;  3LTB A;  2B24 B;  3LTD A;  3UL5 A;  4STD A;  3NBB A;  4R9L A;  4MJD A;  2WO0 A;  2CW9 A;  2D1W A;  2XFS A;  1KQS 2;  3D3L A;  4N6V 0;  3CXC 2;  1ASK A;  2CFD A;  2UX0 A;  1SIH A;  4N6M A;  2GEX A;  4J8T A;  5JPP A;  4RZM A;  1YI2 3;  1UI8 A;  2GBX B;  2QA4 3;  1FGT A;  4MMZ B;  3LTC A;  3BND A;  3EJV A;  1AV4 A;  3JUN A;  3BLZ A;  1OGX A;  2P09 A;  1RRL A;  3JUO A;  2XSO B;  3GRD A;  3GAX A;  3V99 A;  2BMR B;  3CCR 3;  5IG4 A;  1JKG B;  4RNY A;  1JB2 A;  3LZA A;  2PNC A;  5LC7 A;  4R9K A;  1ZO2 A;  1E3R A;  1A67 A;  1KD1 4;  3FKA A;  2Z76 A;  4JRF A;  1Q40 B;  3T0U A;  3A76 A;  4KFF A;  3CCJ 3;  1W02 A;  3GWR A;  3F8X A;  2CK3 H;  3EQQ B;  3F7S A;  5AII A;  3CNX A;  4MEI A;  2Z6B A;  4XBY A;  8CHO A;  1N8R 4;  2CWV A;  3DGO A;  4LEH A;  1N9J A;  5ELU A;  3CCE 3;  3LT9 A;  4XBT A;  2JQ5 A;  1TFO A;  1C7H A;  1W4N A;  3CMA 3;  2Z77 A;  1CYU A;  1KWI A;  4O02 B;  1N5H A;  1VQN 3;  2W04 A;  4O2H A;  3F40 A;  3KSE D;  3NV0 A;  5CF1 A;  1GD4 A;  2M7O A;  1IQY A;  3ALA A;  3X3Y A;  1IT8 A;  2V1L A;  3CME 3;  3FH1 A;  2BNG A;  4HJL B;  2BO9 B;  3NQZ A;  3BNC A;  3WA3 A;  4CDL A;  2JDI H;  1OPY A;  3EC9 A;  4NRE A;  3UJM A;  1YIT 3;  2CFG A;  2IMJ A;  3OWY A;  4HM8 B;  4K1U A;  1MOL A;  3OX9 A;  2HMM B;  1IV7 A;  4NHF A;  4RBN A;  1JB5 A;  4WYK A;  2OQE A;  3KN4 A;  3G6E 3;  2CIU A;  2XR8 B;  1OGZ A;  3CC7 3;  3G8Z A;  2CG0 A;  2WOF A;  5IF6 A;  3AMO B;  2MF7 A;  4WP5 A;  1SII A;  2P38 A;  3F14 A;  3MG2 A;  2P05 A;  3K7C A;  4J9A A;  3DMC A;  1KSI A;  3JUP A;  3U1W A;  3CD6 3;  3PXM A;  1OF5 B;  4K90 B;  5BVB A;  3PCS A;  1GY5 A;  3B8L A;  1LVN A;  1QAK A;  1K9M 4;  2GEY A;  4HM1 B;  1JJ2 2;  2XH9 A;  1K73 4;  1VQ4 3;  1J2B A;  5CK6 A;  1YIJ 3;  2XFT A;  1NB3 I;  2ZDJ A;  3SLU A;  3DZL A;  4GL6 A;  4EV5 A;  1Y4K A;  3NX0 A;  4HYZ A;  1VQK 3;  3WOD G;  1K41 A;  1N9E A;  5AIG A;  1A2V A;  2QEX 3;  3CCQ 3;  4FCZ A;  2HML B;  3CC2 3;  1FGM A;  1VQP 3;  2OOV C;  4N6L A;  5IEO A;  2MC8 A;  1PU4 A;  3H3H A;  5HGR A;  1UUW B;  5A0O B;  1M9G A;  1TP6 A;  3K5T A;  4HKV B;  3OXA A;  3U97 A;  3STD A;  5CXO A;  3HIG A;  4R80 A;  1HU9 A;  4N6N B;  1A90 A;  3S27 A;  1JV2 B;  1W2Z A;  3DGM A;  4IT7 A;  3OW2 2;  1YGE A;  3JUM A;  4IIA A;  3MYT A;  4OVM A;  4HZ9 B;  1W6Y A;  1TFK A;  2XEP A;  4X2O A;  4G1M B;  2CWU A;  2XGL A;  3UNL A;  3G4S 3;  1NU3 A;  2CFW A;  3K9M C;  2RGQ A;  3PS8 A;  6STD A;  1R4C A;  1BUQ A;  1Q81 4;  4FMA A;  3SOA A;  5AEU B;  2E2U A;  2W6J H;  3X41 A;  4O8S A;  1YJN 3;  2XGN A;  3KSP A;  5I97 A;  2IA7 A;  3V98 A;  3OWS A;  2W56 A;  4OUQ A;  1QAF A;  3KZT A;  4KVH A;  1IK3 A;  5AIF A;  3LOY A;  4WHA A;  1TU5 A;  4EYC A;  3S28 A;  2QIY A;  3QRD A;  1UUV B;  2CFK A;  2CKF B;  3IJE B;  3NUV A;  4KFE A;  2BHM A;  4ORL A;  5FW5 A;  2GU1 A;  3NM2 A;  1K28 A;  3I56 3;  2I9W A;  1Q82 4;  1ISK A;  2O9U X;  4AKY A;  3CCV 3;  3FGY A;  1IU7 A;  1LXE A;  3LXU X;  4K1V A;  2CG1 A;  3QK9 A;  1OHS A;  3WDG B;  1SPU A;  4JF8 A;  1NB5 I;  1NDO B;  3S29 A;  1O7P B;  1RN7 A;  4N3V A;  1N5P A;  1QAL A;  3MHE A;  1US1 A;  4K61 A;  3X42 A;  3X40 A;  2Y74 A;  2LYX A;  4ZM8 A;  3BNE A;  4LGQ A;  1D6U A;  4AEQ A;  3V92 A;  1O7W B;  1FA3 A;  4HM4 B;  3DGN A;  4I4K A;  3SED A;  3F8H A;  2CC3 A;  1YVB I;  1TUH A;  4L8P A;  2L4V A;  3NXJ A;  4XM4 A;  1JN5 A;  2HMJ B;  3CCU 3;  3EN8 A;  3H51 A;  5D82 A;  1IV9 A;  3NV0 B;  5EVH A;  3F7X A;  1EKM A;  2QGU A;  3F9S A;  1NWW A;  3FLJ A;  3EX9 A;  1VQ6 3;  5BXQ A;  2XSH B;  1FGQ A;  4R1K A;  1MNL A;  1QJG A;  1YJW 3;  3X3Z A;  5G2G A;  1WNH A;  1GD3 A;  1M90 4;  1FGR A;  1DMM A;  1JNQ A;  1S5A A;  4HBR A;  4LMI A;  3PGB A;  1F8N A;  1M1X B;  2D42 A;  1IVV A;  4HM2 B;  3EF8 A;  2W2C A;  3JVC A;  2GBW B;  2W9P A;  1D6Z A;  1ULJ B;  1SJW A;  3TDG A;  2XF3 A;  1M1K 4;  4BTX A;  2OQE C;  3D9R A;  3KFQ C;  1UW1 A;  1OHP A;  4FMC A;  3IMA B;  5EEO A;  4EC6 A;  1S72 3;  3K0Z A;  3RGR A;  2R4I A;  3MG3 A;  4R4K A;  5DRV A;  1VQ7 3;  3CC4 3;  3LYG A;  2KXG A;  1N8Q A;  2O3O A;  1Q7Y 4;  1IQX A;  4EV2 A;  3N8B A;  1JRQ A;  1SQW A;  3MPH A;  4IPB A;  3OV4 A;  3DUK A;  1OUN A;  3HZP A;  3MSO A;  4MMY B;  4GB5 A;  4OK0 A;  3K63 A;  4N6O B;  3N9H A;  4O3V A;  2YFJ B;  3MWZ A;  1GY6 A;  1Z1S A;  2F99 A;  2HMO B;  4HZB B;  2A15 A;  3WOE B;  1VQ9 3;  3VF1 A;  4BTW A;  4PEJ A;  7STD A;  1D6Y A;  4EBG A;  1RRH A;  2ZL8 A;  2STD A;  4LZI A;  3EBT A;  3PYJ A;  2WGO A;  3S67 A;  1CEW I;  1ROV A;  5D81 A;  1VQL 3;  1DMN A;  3HI7 A;  2PZV A;  3NBR A;  1VQM 3;  1GYB A;  1STF I;  3S5C A;  4X2H A;  1WMP A;  4QWT A;  3EHC A;  1TIJ A;  2E2T A;  2YX9 A;  1IT7 A;  4HM5 B;  4WWU C;  5STD A;  2INX A;  1O7H B;  5AI1 A;  3WA2 X;  4H61 A;  3J7Y d;  3GZX B;  1ROA A;  3KII A;  3HII A;  4CCV A;  2KCD A;  4FCM A;  1OAC A;  2CWT A;  4HM6 B;  2W56 B;  3FF2 A;  3N54 B;  3PCR A;  4N6U A;  1VZZ A;  4XBX A;  1GY7 A;  3FZW A;  4HM0 B;  3ECF A;  2ML5 A;  2CHC A;  3LTA A;  5LC6 A;  4L7K A;  1CQS A;  5CLK A;  3M8C A;  3NHX A;  5TGN A;  2WGQ A;  1W7C A;  3PZW A;  4AKZ A;  3Q2P A;  2CFL A;  2OTJ 3;  2WOH A;  4RNZ A;  1JB4 A;  3CPO A;  1T5Y A;  2IUK A;  3KE7 A;  2IUJ A;  2C10 A;  5IG3 A;  1W2B 2;  2ML6 A;  1WMN A;  1FUW A;  1OH0 A;  3T8U A;  1GS3 A;  1DVD A;  5D83 A;  5IEN A;  3FG4 A;  1U5O A;  3ROB A;  3UL6 A;  1O7G B;  1L5G B;  2OTL 3;  1KC8 4;  1FGO A;  1VQ5 3;  3MG1 A;  3L0R A;  3NM7 A;  1QVF 2;  2P0X A;  3CU3 A;  2RSX A;  1JKG A;  2FNQ A;  3NBJ A;  1IDP A;  3X3X A;  5JPU A;  5JBS A;  1VQO 3;  3GZB A;  2FGT A;  4U13 A;  4HVN A;  4EXR A;  1LOX A;  2Z7A A;  3SX1 A;  1O7N B;  4XDV A;  5AEW B;  5KP3 A;  3LT8 A;  5CF2 A;  1Q40 A;  3SXX A;  1DMQ A;  3WMD A;  3CCS 3;  1JN5 B;  2Y73 A;  1Q42 A;  2RFR A;  1W6C A;  3EB8 A;  1UI7 A;  1HKX A;  1IVU A;  1NJI 4;  2CH9 A;  2RCD A;  1WQL B;  3FSD A;  3NQY A;  4XB5 A;  4FR9 A;  3DM8 A;  1AVL A;  1YHQ 3;  1OCV A;  3Q90 A;  2W03 A;  3JUQ A;  3HK4 A;  5IER A;  3KKG A;  1EG9 B;  5IG0 A;  2C11 A;  2W0Q A;  4WYK B;  1IVW A;  2XRX B;  3FF0 A;  1RKY A;  4BTY A;  3BNB A;  2BT3 A;  1PFP A;  4Q53 A;  3MKI A;  5DRE A;  2LQV A;  3B7C A;  4LSO A;  5AIH A;  3VSY A;  1YJ9 3;  3Q1C A;  1RJO A;  2OWP A;  3T8N A;  3G71 3;  2BMO B;  1O7M B;  2K54 A;  1DYU A;  1WTH A;  2HMK B;  2K0M A;  3DXO A;  3O8Y A;  4KFD A;  1ZX2 A;  1WMO A;  3LML A;  1W01 A;  2W9Q A;  2B1X B;  3WOF B;  2KRT A;  3BB9 A;  4L8O A;  2FXT A;  3CNM A;  3UB1 A;  3AMO A;  1K8A 4;  3CCM 3;  3GZR A;  5IG5 A;  2P0M A;  3G16 A;  4FMD A;  4FCJ A;  4H3U A;  5ELJ A;  2E2V A;  3RGA A;  1OF5 A;  1OHO A;  1DVC A;  1U8C B;  2OOV A;  3EN1 B;  3DY5 A;  1A2K A;  2SBL A;  1NO3 A;  1CYV A;  2HMN B;  3GZY B;  3SOY A;  1EQK A;  3I0Y A;  4MMX B;  1LNH A;  4HM7 B;  3B4O A;  3E99 A;  3FG1 A;  4N6T A;  1W00 A;  5KP4 A;  1AR0 A;  3IPT A;  3LH4 A;  2F98 A;  1AVK A;  3CPW 2;  3CCL 3;  3RDE A;  1VQ8 3;  3EBY A;  2F86 B;  4KZ1 A;  2GXF A;  1IQ8 A;  1IVX A;  1QMA A;  3HX8 A;  4TX4 A;  5FGO A;  2YFL B;  1Q86 4;  1QVG 2;  3EE1 A;  2BMQ B;  1E97 A;  3ER7 A;  3SVA A;  2GU3 A;  3OWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...