3B7CA

Crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
MPTDDIVQLLKGQEEAWNRGDLDAYMQGYWQNEQLMLISNGKFRNGWDETLAAYKKNYPDKESLGELKFTIKEIKMLSNYAAMVVGRWDLKRLKDTPTGVFTLLVEKIDDRWVITMDHSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF-2 like protein of unknown function (NP_715767.1) from Shewanella oneidensis at 1.70 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b7cA00
2F98A 3K0ZA 3ECFA 4Q53A 3ER7A 4XBXA 1NU3A 3JUMA 1DMQA 1OPYA 2XSHB 1U5OA 2YFLB 3OWYA 3JUQA 3GZRA 5G2GA 3MKIA 1O7GB 3ROBA 3JUPA 1OCVA 4X2HA 4L7KA 4GB5A 5IG4A 3RGRA 3FGYA 5HGRA 4HM4B 4K1VA 3E99A 5EVHA 4LEHA 1GYBA 1ZX2A 2HMNB 1E97A 1OHPA 4L8OA 5IEPA 3GZXB 3KKGA 3T8NA 3I0YA 3B8LA 3B4OA 3Q90A 4STDA 1W00A 5IG5A 5DRVA 5D82A 1JB5A 1BUQA 3CU3A 4X2OA 2HMOB 3A76A 3EQQB 4J8TA 4HM2B 4OUQA 4WYKB 3H51A 4XDWA 5CF1A 1W01A 3T8UA 3DZLA 4HZ9B 3G8ZA 4OVMA 1O7WB 2UX0A 3MSOA 4HKVB 4H3UA 2Z7AA 5CF2A 4HZBB 4XBTA 3F8HA 1ULIB 4J9AA 4XBYA 3VSYA 3NHXA 3EJVA 1VZZA 3OWUA 3D9RA 4LMIA 5CLKA 3KE7A 3DUKA 3NM2A 1W6YA 1Z1SA 3STDA 1E3RA 3EC9A 4WYKA 3GRDA 3NUVA 3EN1B 5KP4A 1ULJB 2B24B 3LZAA 1W02A 1O7MB 5CXOA 2GEYA 3CNMA 1UUVB 4HM0B 3SOAA 3OX9A 3LYGA 4R1KA 3B7CA 1QMAA 2GXFA 1C7HA 3WMDA 2JQ5A 3K7CA 3FF2A 5IEOA 3HZPA 5IENA 6STDA 3JUNA 3NXJA 3GZYB 2YFIB 2BMOB 3MG2A 4HM8B 3RGAA 3OWSA 3UJMA 2XR8B 1OUNA 3EF8A 2GBWB 4FCMA 5IF6A 3EBYA 2I9WA 1OF5B 1EA2A 3DM8A 1TUHA 2RGQA 4KVHA 4FCJA 1O7HB 2PZVA 2OWPA 2GBXB 4HM5B 4WWUC 3NV0B 2K54A 3IPTA 3HX8A 5IERA 2QIYA 3GZBA 3FKAA 4HM7B 7STDA 3F40A 3MHEA 2F86B 1K41A 3EHCA 5TGNA 3OV4A 1NDOB 1DMNA 3OXAA 3S5CA 3EX9A 3DMCA 3FF0A 4K1UA 1OF5A 5BXQA 5STDA 3F7XA 2B1XB 4R9LA 1GY7A 5KP3A 2BMRB 5AEUB 4U13A 1O7NB 1AR0A 3EN8A 3NV0A 1A2KA 5AIFA 3H3HA 2HMLB 3UNLA 3FH1A 1WQLB 4L8PA 5JPUA 3G16A 3KZTA 1Q40B 5BVBA 1ISKA 5D83A 2RCDA 4PEJA 1GY5A 5AEWB 1GY6A 1TP6A 8CHOA 3VGNA 2YFJB 2HMKB 5AIHA 1EG9B 4WP5A 3MG3A 3F9SA 4ORLA 1O7PB 1IDPA 1S5AA 3MG1A 3MYTA 1ASKA 4XB5A 3CNXA 1JB4A 3NBRA 1STDA 3SOYA 2IMJA 1OH0A 1Q40A 4HM1B 1SJWA 3SEDA 2Z76A 1DMMA 3HK4A 4HM6B 1JB2A 2HMMB 3FLJA 1JKGB 4XDVA 3F8XA 3FZWA 1JN5A 3BB9A 5FW5A 4HJLB 2F99A 1Q42A 2GEXA 4MJDA 1OHSA 5AIGA 2Z77A 4RZMA 1E3VA 2QGUA 5AI1A 1ZO2A 3F14A 3FSDA 4HVNA 2CHCA 3F7SA 5CK6A 5DREA 1GS3A 5D81A 2W2CA 3JUOA 1JKGA 1OGXA 5JPPA 3B4PA 4N3VA 2BMQB 1OHOA 3EBTA 2RFRA 1NWWA 2CKFB 4CDLA 3GWRA 3M8CA 3DXOA 5AIIA 4R9KA 3CPOA 1CQSA 4XM4A 4IIAA 1UUWB 4I4KA 4HM3B 2BNGA 2HMJB 3G0KA 1QJGA 2R4IA 2XRXB 4LGQA 3KSPA 1HKXA 2A15A 2INXA 5IG3A 2XSOB 3BLZA 5IG0A 1JN5B 2STDA 1OGZA 5KP1A
chains in the Genus database with same CATH superfamily
3GAXA 7GSPA 2F98A 3K0ZA 1W7CA 3ECFA 1KD14 4Q53A 1U8CB 1BNSA 3FCSB 3GSPA 3ER7A 4RNYA 4XBXA 1TRQA 1V74A 2MC8A 1UGHI 1NU3A 2AAEA 3JUMA 2M7OA 1DMQA 2D1WA 4EXRA 3HIGA 1OPYA 2XSHB 4NPBA 1U5OA 2YFLB 3OWYA 3JUQA 5A0OB 3CC23 1FW7A 1M1XB 2UGIA 3GZRA 5G2GA 3MKIA 2CW9A 1O7GB 3ROBA 5RNTA 3JUPA 3DGYA 1OCVA 3L0RA 4X2HA 1C54A 1W5ZA 1HYFA 4L7KA 1GMPA 4GB5A 2E2VA 1NJI4 1GOYA 4O8SA 9RNTA 5IG4A 3RGRA 1I2FA 3FGYA 1AY7A 1RGGA 3FG4A 5HGRA 1K9M4 1RGLA 4HM4B 3AHSA 1GOUA 1QAFA 4K1VA 1T5YA 3E99A 1B2SA 2F4YA 5EVHA 2C10A 4ZM8A 1RSNA 4LEHA 1GYBA 1WMOA 1ZX2A 1RN1A 4RNZA 3IMAB 2HMNB 3DGOA 3WODG 1E97A 1BOXA 1OHPA 4QWTA 3NQZA 4L8OA 3SX1A 1MWSA 4JRFA 2Z6BA 5IEPA 3GZXB 3KKGA 3T8NA 3I0YA 3B8LA 1TRPA 3PCSA 3B4OA 1LVNA 4OK0A 1BRJA 3FG3A 3Q90A 4STDA 3U97A 1W00A 2BHMA 5IG5A 5DRVA 5D82A 1N5PA 1BU4A 1IT7A 1JB5A 1BUQA 2KCDA 3CU3A 4X2OA 2HMOB 1LNIA 3A76A 2KF6A 2Y74A 3EQQB 4J8TA 1S723 3WR2A 1FGRA 3AHWA 1X1YA 2KXGA 2F5WA 3DGNA 4HM2B 4NREA 4OUQA 5M1AA 3X41A 3G6E3 1KC84 2BT3A 4WYKB 3K5TA 2AADA 1GD4A 3H51A 4XDWA 3V98A 1UUGB 2XH9A 1K8A4 2XGNA 5CF1A 6GSPA 1WMNA 1W01A 2W9QA 4GSPA 1UCKA 3T8UA 4IPBA 3DZLA 4EBGA 4HZ9B 1B2UA 3G8ZA 4OVMA 1YVSA 1YGEA 1ROVA 1AV4A 1B27A 1KSIA 1O7WB 1NO3A 1IV7A 2CFLA 2UX0A 3MSOA 2KRTA 4H3UA 4HKVB 1BVIA 2LYXA 2IY2A 2SBLA 2Z7AA 4HZBB 4RNTA 4GHOA 4XBTA 4MEIA 3F8HA 4MMXB 3ZFZA 1ULIB 2OTL3 2QEX3 4J9AA 3WA3A 1MGRA 5LC6A 4XBYA 4BIRA 3VSYA 3NHXA 3EJVA 3Q1CA 1Y4KA 1VZZA 1IVXA 3OWUA 1N9EA 1VQN3 3D9RA 2ZDJA 2SARA 1BSCA 4HYZA 2ZL8A 4LMIA 1I0XA 2F56A 1TU5A 2P0XA 1W2ZA 1YIJ3 1M9GA 1BNIA 5CLKA 3CCM3 3KE7A 4N6NB 3DGMA 3X42A 1T2IA 3DUKA 3NM2A 3U1WA 4MMZB 3EB8A 1BSAA 1V57A 1FUSA 3NQYA 4O3VA 1W2B2 3DGLA 1W6YA 1M1K4 1RNTA 1GMQA 1Z1SA 4N6LA 3LTAA 3STDA 1E3RA 1BANA 3D5IA 1IU7A 3CCL3 3EC9A 2P05A 1JBTA 4WYKA 1WNHA 3GRDA 3NUVA 1EEJA 2P09A 3EN1B 5KP4A 1RCKA 3QRDA 1SARA 1ULJB 2B24B 3S29A 2D42A 4EYCA 3LZAA 3MWZA 1W02A 1EUIC 4I5QA 1RLSA 4JF8A 1O7MB 2Q07A 5CXOA 3PYJA 4IT7A 1RN4A 4WFOA 3RNTA 1X1WA 1BNEA 5BU4A 2CH9A 2GEYA 1JZDA 2CG1A 1VQQA 1UUVB 3CNMA 3PCRA 1BUJA 4HM0B 3SOAA 3WHOA 1DETA 1YVBI 1UI8A 3OX9A 3LYGA 4R1KA 4J5GA 1G96A 3CC73 4K90B 3MPHA 2Y73A 3B7CA 1VQM3 5KP1A 1MWRA 1QMAA 3LT9A 6RNTA 1RN7A 1ZGXA 1A2PA 2GXFA 1C7HA 1FYSA 4LSOA 2RBIA 1LQMB 2CWUA 1ROAA 3O8YA 3T0UA 3WA2X 1Q7HA 3WMDA 1RGCA 1YJN3 1SPUA 2JQ5A 1BNFA 1D6YA 1RGHA 3X40A 3K7CA 2GSPA 1FGTA 3FF2A 3CCR3 2UUGC 5IEOA 1A90A 3HZPA 1YJ93 1N9JA 1BSBA 1G02A 5IENA 6STDA 1JRQA 3JUNA 3NXJA 1NNVA 2OOVC 4KFDA 4CJNA 2F5MA 1TFOA 1TFKA 3LTCA 3GZYB 4RBNA 3K9MC 1TTOA 1HZ1A 2YFIB 2BMOB 3MG2A 4HM8B 3RGAA 3S67A 2MF7A 3OW22 1BRNL 3OWSA 3UJMA 2XR8B 1PFPA 1OUNA 4G1MB 2K3DA 3EF8A 2GBWB 3PXMA 2WO0A 7RNTA 4FCMA 4N6TA 1X1XA 3AMOB 1IYYA 5IF6A 3EBYA 3ZG5A 2I9WA 4O2HA 1W6CA 1OF5B 2E2TA 2HOHA 1EA2A 3ALAA 1TUHA 3DM8A 4FMDA 4N6OB 2RGQA 3PZWA 4KVHA 3WDGB 4FCJA 1O7HB 4O02B 5AYSC 1PYLA 2PZVA 2XF3A 2OWPA 1FGMA 3KN4A 4BTWA 1B2MA 2GBXB 1BAOA 4WHAA 5CF2A 1J2BA 2RNTA 1VQ63 1BRHA 3CCJ3 2IYJA 1GOVA 3NM7A 4HM5B 3CMA3 1I0VA 3D5GA 4WWUC 2OTJ3 2BIRA 4HOHA 2CWVA 3NV0B 2K54A 4KFFA 1D6UA 1I70A 3IPTA 1EQKA 1VQ73 2ML5A 4HBRA 2W9PA 2IUKA 3HX8A 5IERA 1CYVA 2QIYA 1LRAA 2W03A 3FKAA 3GZBA 1NB5I 1VQP3 3CPW2 4HM7B 3D79A 5GSPA 7STDA 3DY5A 3F40A 5LC7A 3MHEA 2F86B 1K41A 1BRKA 1UGIA 3AGNA 3CCQ3 1YIT3 1BRGA 3SYUA 3UL6A 3EHCA 5TGNA 1BSEA 3PS8A 3OV4A 1RGKA 1Q814 1MWTA 1Q7Y4 1NDOB 3SVAA 1DMNA 5M19A 1HU9A 3OXAA 3S5CA 1N8R4 3EX9A 1R4YA 3DMCA 3LXUX 5AYRB 3AMOA 4N6UA 3UL5A 3FF0A 3LMLA 4GL6A 1K734 4K1UA 1STFI 2C4BA 3BNDA 1JJ22 1OF5A 1BNGA 5BXQA 5STDA 2W04A 3F7XA 4K61A 1DVDA 2CWTA 2V1LA 2XEPA 2B1XB 4R9LA 1I3IA 2CK3H 1N8QA 2WGQA 3LH4A 1IVWA 1JBSA 1GY7A 3X3YA 3G713 3CME3 4HAAA 1WMPA 2FNQA 5KP3A 2BMRB 2CG0A 5AEUB 3BNBA 4U13A 1O7NB 1W6GA 1B20A 3BU4A 1W4NA 1AR0A 3KFQC 4KZ1A 1I2EA 3EN8A 1MGWA 3NV0A 1MNLA 1A2KA 5AIFA 3H3HA 1QVF2 1UCIA 5ELJA 4MMYB 1VQL3 1VQK3 2HMLB 1N5HA 2OCTA 3UNLA 3FH1A 1GD3A 5HOHA 1WQLB 1YGWA 1ZS7A 3HOHA 3CXC2 4L8PA 3V92A 1GSPA 1RMSA 1RGFA 2GU1A 2KF3A 4FR9A 3G16A 3KZTA 2H0GA 3IJEB 1Q40B 4KFEA 5JPUA 1L5GB 1FGOA 1JZOA 5BVBA 1ISKA 5D83A 3HI7A 5I97A 1BNRA 3TDGA 2OQEA 1RGAA 2RCDA 4NHFA 3I553 1Q9EA 4PEJA 1GY5A 4EC6A 4N6V0 1R4CA 3KCHA 3FG1A 2CX0A 1GY6A 3S28A 3WOFB 5AEWB 3X3ZA 4J5KA 3N9HA 1Q824 5IW9A 2O9UX 1TP6A 2WGOA 1X1UA 8CHOA 1RJOA 2KF4A 4FMCA 3VGNA 1SQWA 2YFJB 1BIRA 1RDSA 3URPA 2HMKB 5AIHA 2QA43 1EG9B 4WP5A 3LTDA 3CCE3 1FUWA 1AVLA 3MG3A 1FGQA 3F9SA 5FGOA 2CIUA 5BIRA 1A67A 1A2VA 4AKZA 5ELUA 1WTHA 1QALA 2IUJA 3J7Yd 3AGOA 1FZUA 3NX0A 1MOLA 2L1SA 2P0MA 1O7PB 1IDPA 1S5AA 4ORLA 3Q2PA 3MG1A 3MYTA 3S27A 2YX9A 1IK3A 1ASKA 2C11A 4XB5A 3CNXA 1CH0A 1LOYA 2XGLA 8RNTA 1BGSA 2XFSA 1BNJA 1JB4A 1STDA 1PY3A 2RSXA 3NBRA 3SOYA 2IMJA 2ML6A 1BSDA 3QK9A 1RHLA 1BRSA 1KWIA 1LOVA 1OH0A 2FXTA 1IVVA 1DVCA 1Q40A 2PNCA 4HM1B 1SJWA 1RRHA 3SEDA 1T2HA 1LQGC 2Z76A 1NB3I 1DMMA 2CFKA 1IVUA 3HK4A 3BIRA 1M904 1TJDA 4HM6B 3ZG0A 1JB2A 2ZHXB 2L4VA 1QAKA 2HMMB 3FLJA 1I2GA 2W6JH 1VQ53 5G1LA 1JV2B 3NBBA 1RRLA 5G1KA 1JKGB 2IA7A 4XDVA 3DH2A 3F8XA 3BNEA 5M18A 3FZWA 1JN5A 3WOEB 2XFTA 1YNVX 1B2ZA 2W56B 2CFWA 4LYLB 4KT3B 1RKYA 3D4AA 1DYUA 4BL2A 3BB9A 5FW5A 2OOVA 1BRIA 3Q3FA 4HJLB 1LXEA 2F99A 1Q42A 2GEXA 2WOFA 4MJDA 1OHSA 1T3BA 2CFGA 3LT8A 3N54B 3KIIA 5AIGA 1YJW3 1AVKA 4R4KA 1YHQ3 3D3LA 2Z77A 3X3XA 1CEWI 4R80A 4RZMA 1E3VA 4AEQA 2E2UA 3JVCA 2P38A 4BTYA 2QGUA 1V58A 2FGTA 1G0TA 1SIHA 5AI1A 1PU4A 1ZO2A 2H0IA 2W0QA 4BU4A 1IV9A 3LOYA 3F14A 1JBRA 3FSDA 3A5EA 3CCU3 4EW5A 2GU3A 2CHCA 2R41A 3N8BA 4HVNA 1IT8A 3F7SA 4CCVA 1RGEA 1KQS2 3PGBA 1VQ83 1I3FA 2ZA4A 1IQXA 1IQ8A 3BNCA 5CK6A 2CFDA 5DREA 3CD63 3KSED 1GS3A 4N6MA 5D81A 4EV5A 1OACA 1B3SA 2CX1A 2W2CA 3JUOA 1JKGA 3RDEA 4CPKA 1JNQA 1UCJA 1RTUA 4FCZA 1OGXA 5JPPA 3B4PA 4N3VA 2BU4A 5EQLA 1LNHA 2BMQB 2W56A 1I8VA 1LOWA 2WOHA 1OHOA 3EBTA 2RFRA 2OQEC 5EEOA 4BL3A 3CCV3 1NWWA 3LTBA 1GMRA 3SLUA 1RCLA 3VF1A 4BTXA 3I563 1TIJA 1FA3A 2CKFB 4CDLA 1UI7A 3GWRA 3M8CA 1RNBA 1UW1A 4FMBA 3DXOA 1DE3A 1SIIA 2H0HA 4FMAA 2KF5A 5AIIA 1UDII 4R9KA 1Q864 1K28A 3CPOA 1LOXA 1CQSA 2CC3A 4XM4A 4IIAA 1UUWB 4I4KA 4HM3B 2BNGA 3CC43 1F8NA 4DKIA 3CCS3 2BO9B 3EE1A 2KAAA 1FUTA 1D6ZA 2JDIH 2HMJB 1QVG2 3UB1A 3G0KA 1QJGA 3NBJA 2R4IA 4EV2A 4TX4A 3K63A 4ILFA 2XRXB 2J8XB 4LGQA 3KSPA 1CYUA 1HKXA 1YI23 5JBSA 4LZIA 4AKYA 2A15A 2INXA 1EKMA 5IG3A 2K0MA 2LQVA 3SXXA 2XSOB 3BLZA 1VQ43 3V99A 3G4S3 3HIIA 4H61A 5IG0A 1JN5B 1VQ93 1B21A 1UCLA 1AQZA 2O3OA 2STDA 1MWUA 1OGZA 1US1A 1IQYA 1B2XA 1VQO3
chains in the Genus database with same CATH topology
3GAXA 2F98A 3K0ZA 1W7CA 3ECFA 1KD14 4Q53A 1U8CB 3FCSB 3ER7A 4RNYA 4XBXA 1V74A 2MC8A 1NU3A 3JUMA 2M7OA 1DMQA 2D1WA 4EXRA 3HIGA 1OPYA 2XSHB 5A0OB 1U5OA 2YFLB 3OWYA 3JUQA 3CC23 1M1XB 3GZRA 5G2GA 3MKIA 2CW9A 1O7GB 3ROBA 3JUPA 1OCVA 3L0RA 4X2HA 1W5ZA 4L7KA 4GB5A 2E2VA 1NJI4 5IG4A 4O8SA 3RGRA 3FGYA 3FG4A 5HGRA 1K9M4 4HM4B 1QAFA 4K1VA 1T5YA 3E99A 4ZM8A 5EVHA 2C10A 4LEHA 1GYBA 1WMOA 1ZX2A 4RNZA 3IMAB 2HMNB 3DGOA 3WODG 1E97A 1OHPA 4QWTA 3NQZA 4L8OA 3SX1A 4JRFA 2Z6BA 5IEPA 3GZXB 3KKGA 3T8NA 3I0YA 3B8LA 3PCSA 3B4OA 1LVNA 4OK0A 3FG3A 3Q90A 4STDA 3U97A 1W00A 2BHMA 5IG5A 5DRVA 5D82A 1N5PA 1IT7A 1JB5A 1BUQA 2KCDA 3CU3A 4X2OA 2HMOB 3A76A 3EQQB 2Y74A 4J8TA 1S723 1FGRA 2KXGA 3DGNA 3G6E3 4HM2B 4NREA 4OUQA 3X41A 1QVF2 1KC84 2BT3A 4WYKB 3K5TA 1GD4A 3H51A 4XDWA 3V98A 2XH9A 1K8A4 2XGNA 5CF1A 1WMNA 1W01A 2W9QA 3T8UA 4IPBA 3DZLA 4EBGA 4HZ9B 3G8ZA 4OVMA 1ROVA 1AV4A 1KSIA 1O7WB 1NO3A 1YGEA 2CFLA 1IV7A 2UX0A 3MSOA 4HKVB 2KRTA 4H3UA 2LYXA 2SBLA 2Z7AA 5CF2A 4HZBB 4XBTA 4MEIA 3F8HA 4MMXB 1ULIB 2OTL3 2QEX3 4J9AA 3WA3A 5LC6A 4XBYA 3VSYA 3NHXA 3EJVA 3Q1CA 1Y4KA 1VZZA 1IVXA 3OWUA 1N9EA 1VQN3 3D9RA 2ZDJA 4HYZA 2ZL8A 4LMIA 1TU5A 2P0XA 1W2ZA 1YIJ3 1M9GA 5CLKA 3CCM3 3KE7A 4N6NB 3DGMA 3X42A 3DUKA 3NM2A 3U1WA 4MMZB 3EB8A 3NQYA 4O3VA 1W2B2 3DGLA 1W6YA 1M1K4 1Z1SA 4N6LA 3STDA 3LTAA 1E3RA 1IU7A 3CCL3 3EC9A 2P05A 4WYKA 1WNHA 3GRDA 3NUVA 2P09A 3EN1B 5KP4A 3QRDA 1ULJB 2B24B 3S29A 4EYCA 2D42A 3LZAA 3MWZA 1W02A 4JF8A 1O7MB 2Q07A 5CXOA 3PYJA 4IT7A 4WFOA 2CH9A 2GEYA 2CG1A 3CNMA 1UUVB 3PCRA 4HM0B 3SOAA 1YVBI 1UI8A 3OX9A 3LYGA 4R1KA 1G96A 3CC73 4K90B 3MPHA 2Y73A 3B7CA 1VQM3 1QMAA 3LT9A 1RN7A 2GXFA 1C7HA 4LSOA 3O8YA 2CWUA 1ROAA 3T0UA 3WA2X 3WMDA 1YJN3 1SPUA 2JQ5A 1D6YA 3X40A 3K7CA 3FF2A 1FGTA 3CCR3 5IEOA 1A90A 3HZPA 1YJ93 1N9JA 5IENA 6STDA 1JRQA 3JUNA 3NXJA 2OOVC 4KFDA 1TFOA 1TFKA 3LTCA 3GZYB 4RBNA 3K9MC 2YFIB 2BMOB 3MG2A 4HM8B 3RGAA 3S67A 2MF7A 3OW22 3OWSA 3UJMA 2XR8B 1PFPA 1OUNA 4G1MB 3EF8A 2GBWB 3PXMA 2WO0A 4FCMA 4N6TA 3AMOB 5IF6A 3EBYA 2I9WA 4O2HA 1W6CA 1OF5B 2E2TA 3ALAA 1EA2A 3DM8A 1TUHA 4FMDA 4N6OB 3WDGB 2RGQA 3PZWA 4KVHA 1N8R4 4FCJA 1O7HB 4O02B 5AYSC 2PZVA 2XF3A 2OWPA 1FGMA 3KN4A 4BTWA 2GBXB 4WHAA 1J2BA 1VQ63 3CCJ3 3NM7A 4HM5B 3CMA3 4WWUC 2OTJ3 2CWVA 3NV0B 2K54A 4KFFA 1D6UA 3IPTA 1EQKA 1VQ73 2ML5A 4HBRA 2W9PA 2IUKA 3HX8A 5IERA 1CYVA 2QIYA 3GZBA 2W03A 3FKAA 1NB5I 1VQP3 3CPW2 4HM7B 7STDA 3DY5A 3F40A 5LC7A 3MHEA 2F86B 1K41A 3CCQ3 1YIT3 3UL6A 3EHCA 5TGNA 3PS8A 3OV4A 1Q814 1Q7Y4 1NDOB 3SVAA 1DMNA 1HU9A 3OXAA 3S5CA 3EX9A 3DMCA 3LXUX 5AYRB 3AMOA 4N6UA 3UL5A 3FF0A 3LMLA 4GL6A 1K734 4K1UA 1STFI 3BNDA 1JJ22 1OF5A 5BXQA 5STDA 2W04A 3F7XA 4K61A 1DVDA 2CWTA 2V1LA 2XEPA 2B1XB 4R9LA 2CK3H 3LH4A 1N8QA 2WGQA 1IVWA 1GY7A 3X3YA 3G713 3CME3 1WMPA 2FNQA 5KP3A 2BMRB 2CG0A 5AEUB 3BNBA 4U13A 1O7NB 1W6GA 1W4NA 1AR0A 3KFQC 4KZ1A 3EN8A 3NV0A 1MNLA 1A2KA 5AIFA 3H3HA 5ELJA 4MMYB 1VQL3 1VQK3 2HMLB 1N5HA 2OCTA 3UNLA 3FH1A 1GD3A 1WQLB 3CXC2 4L8PA 3V92A 2GU1A 4FR9A 3G16A 3KZTA 3IJEB 4KFEA 1Q40B 5JPUA 1L5GB 1FGOA 5BVBA 1ISKA 5D83A 3HI7A 5I97A 3TDGA 2OQEA 2RCDA 4NHFA 3I553 4PEJA 1GY5A 4EC6A 4N6V0 1R4CA 3FG1A 3S28A 1GY6A 5AEWB 3WOFB 3X3ZA 3N9HA 1Q824 5IW9A 2O9UX 1TP6A 2WGOA 8CHOA 1RJOA 3VGNA 4FMCA 1SQWA 2YFJB 2HMKB 5AIHA 2QA43 1EG9B 4WP5A 3LTDA 3CCE3 1FUWA 1AVLA 3MG3A 1FGQA 3F9SA 5FGOA 2CIUA 1A67A 1A2VA 4AKZA 5ELUA 1WTHA 1QALA 2IUJA 3J7Yd 3NX0A 1MOLA 2P0MA 4ORLA 1O7PB 1IDPA 1S5AA 3Q2PA 3MG1A 3MYTA 3S27A 2YX9A 1IK3A 1ASKA 2C11A 4XB5A 3CNXA 2XGLA 2XFSA 1JB4A 2RSXA 1STDA 3NBRA 3SOYA 2IMJA 2ML6A 3QK9A 1OH0A 1KWIA 2PNCA 2FXTA 1IVVA 1DVCA 1Q40A 4HM1B 1SJWA 1RRHA 3SEDA 2Z76A 1NB3I 1DMMA 2CFKA 1IVUA 3HK4A 1M904 4HM6B 1JB2A 2L4VA 1QAKA 2HMMB 3FLJA 2W6JH 1VQ53 1JV2B 3NBBA 1RRLA 1JKGB 2IA7A 4XDVA 3F8XA 3BNEA 3FZWA 1JN5A 3WOEB 2XFTA 1RKYA 2W56B 2CFWA 1DYUA 3BB9A 5FW5A 2OOVA 4HJLB 1LXEA 2F99A 1Q42A 2GEXA 2WOFA 4MJDA 1OHSA 3N54B 2CFGA 3LT8A 3KIIA 5AIGA 1YJW3 1AVKA 4R4KA 1YHQ3 3D3LA 2Z77A 3X3XA 1CEWI 4R80A 4RZMA 1E3VA 4AEQA 2E2UA 3JVCA 2P38A 4BTYA 2QGUA 2FGTA 1SIHA 5AI1A 1PU4A 1ZO2A 2W0QA 1IV9A 3LOYA 3F14A 3FSDA 3CCU3 2GU3A 2CHCA 4HVNA 3N8BA 1KQS2 1IT8A 3F7SA 4CCVA 3PGBA 1VQ83 3BNCA 1IQXA 1IQ8A 5CK6A 2CFDA 5DREA 3CD63 3KSED 1GS3A 4N6MA 5D81A 4EV5A 1OACA 2W2CA 3JUOA 1JKGA 3RDEA 1JNQA 4FCZA 1OGXA 5JPPA 3B4PA 4N3VA 5EQLA 1LNHA 2BMQB 2W56A 2WOHA 1OHOA 3EBTA 2RFRA 2OQEC 5EEOA 3CCV3 1NWWA 3LTBA 3SLUA 4BTXA 3VF1A 1FA3A 3I563 1TIJA 2CKFB 4CDLA 1UI7A 3GWRA 3M8CA 1UW1A 4FMBA 3DXOA 1SIIA 4FMAA 5AIIA 4R9KA 1Q864 1K28A 3CPOA 1LOXA 1CQSA 2CC3A 4XM4A 4IIAA 1UUWB 4I4KA 4HM3B 2BNGA 3CC43 1F8NA 3CCS3 2BO9B 3EE1A 1D6ZA 2JDIH 2HMJB 1QVG2 3UB1A 3G0KA 1QJGA 3NBJA 2R4IA 4EV2A 4TX4A 3K63A 2XRXB 4LGQA 3KSPA 1CYUA 1HKXA 1YI23 5JBSA 4LZIA 4AKYA 2A15A 2INXA 1EKMA 5IG3A 2K0MA 2LQVA 3SXXA 2XSOB 3BLZA 1VQ43 3V99A 3G4S3 3HIIA 4H61A 5IG0A 1JN5B 1VQ93 2O3OA 2STDA 1OGZA 1US1A 1IQYA 5KP1A 1VQO3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F98 A;  3K0Z A;  3ECF A;  4Q53 A;  3ER7 A;  4XBX A;  1NU3 A;  3JUM A;  1DMQ A;  1OPY A;  2XSH B;  1U5O A;  2YFL B;  3OWY A;  3JUQ A;  3GZR A;  5G2G A;  3MKI A;  1O7G B;  3ROB A;  3JUP A;  1OCV A;  4X2H A;  4L7K A;  4GB5 A;  5IG4 A;  3RGR A;  3FGY A;  5HGR A;  4HM4 B;  4K1V A;  3E99 A;  5EVH A;  4LEH A;  1GYB A;  1ZX2 A;  2HMN B;  1E97 A;  1OHP A;  4L8O A;  5IEP A;  3GZX B;  3KKG A;  3T8N A;  3I0Y A;  3B8L A;  3B4O A;  3Q90 A;  4STD A;  1W00 A;  5IG5 A;  5DRV A;  5D82 A;  1JB5 A;  1BUQ A;  3CU3 A;  4X2O A;  2HMO B;  3A76 A;  3EQQ B;  4J8T A;  4HM2 B;  4OUQ A;  4WYK B;  3H51 A;  4XDW A;  5CF1 A;  1W01 A;  3T8U A;  3DZL A;  4HZ9 B;  3G8Z A;  4OVM A;  1O7W B;  2UX0 A;  3MSO A;  4HKV B;  4H3U A;  2Z7A A;  5CF2 A;  4HZB B;  4XBT A;  3F8H A;  1ULI B;  4J9A A;  4XBY A;  3VSY A;  3NHX A;  3EJV A;  1VZZ A;  3OWU A;  3D9R A;  4LMI A;  5CLK A;  3KE7 A;  3DUK A;  3NM2 A;  1W6Y A;  1Z1S A;  3STD A;  1E3R A;  3EC9 A;  4WYK A;  3GRD A;  3NUV A;  3EN1 B;  5KP4 A;  1ULJ B;  2B24 B;  3LZA A;  1W02 A;  1O7M B;  5CXO A;  2GEY A;  3CNM A;  1UUV B;  4HM0 B;  3SOA A;  3OX9 A;  3LYG A;  4R1K A;  3B7C A;  1QMA A;  2GXF A;  1C7H A;  3WMD A;  2JQ5 A;  3K7C A;  3FF2 A;  5IEO A;  3HZP A;  5IEN A;  6STD A;  3JUN A;  3NXJ A;  3GZY B;  2YFI B;  2BMO B;  3MG2 A;  4HM8 B;  3RGA A;  3OWS A;  3UJM A;  2XR8 B;  1OUN A;  3EF8 A;  2GBW B;  4FCM A;  5IF6 A;  3EBY A;  2I9W A;  1OF5 B;  1EA2 A;  3DM8 A;  1TUH A;  2RGQ A;  4KVH A;  4FCJ A;  1O7H B;  2PZV A;  2OWP A;  2GBX B;  4HM5 B;  4WWU C;  3NV0 B;  2K54 A;  3IPT A;  3HX8 A;  5IER A;  2QIY A;  3GZB A;  3FKA A;  4HM7 B;  7STD A;  3F40 A;  3MHE A;  2F86 B;  1K41 A;  3EHC A;  5TGN A;  3OV4 A;  1NDO B;  1DMN A;  3OXA A;  3S5C A;  3EX9 A;  3DMC A;  3FF0 A;  4K1U A;  1OF5 A;  5BXQ A;  5STD A;  3F7X A;  2B1X B;  4R9L A;  1GY7 A;  5KP3 A;  2BMR B;  5AEU B;  4U13 A;  1O7N B;  1AR0 A;  3EN8 A;  3NV0 A;  1A2K A;  5AIF A;  3H3H A;  2HML B;  3UNL A;  3FH1 A;  1WQL B;  4L8P A;  5JPU A;  3G16 A;  3KZT A;  1Q40 B;  5BVB A;  1ISK A;  5D83 A;  2RCD A;  4PEJ A;  1GY5 A;  5AEW B;  1GY6 A;  1TP6 A;  8CHO A;  3VGN A;  2YFJ B;  2HMK B;  5AIH A;  1EG9 B;  4WP5 A;  3MG3 A;  3F9S A;  4ORL A;  1O7P B;  1IDP A;  1S5A A;  3MG1 A;  3MYT A;  1ASK A;  4XB5 A;  3CNX A;  1JB4 A;  3NBR A;  1STD A;  3SOY A;  2IMJ A;  1OH0 A;  1Q40 A;  4HM1 B;  1SJW A;  3SED A;  2Z76 A;  1DMM A;  3HK4 A;  4HM6 B;  1JB2 A;  2HMM B;  3FLJ A;  1JKG B;  4XDV A;  3F8X A;  3FZW A;  1JN5 A;  3BB9 A;  5FW5 A;  4HJL B;  2F99 A;  1Q42 A;  2GEX A;  4MJD A;  1OHS A;  5AIG A;  2Z77 A;  4RZM A;  1E3V A;  2QGU A;  5AI1 A;  1ZO2 A;  3F14 A;  3FSD A;  4HVN A;  2CHC A;  3F7S A;  5CK6 A;  5DRE A;  1GS3 A;  5D81 A;  2W2C A;  3JUO A;  1JKG A;  1OGX A;  5JPP A;  3B4P A;  4N3V A;  2BMQ B;  1OHO A;  3EBT A;  2RFR A;  1NWW A;  2CKF B;  4CDL A;  3GWR A;  3M8C A;  3DXO A;  5AII A;  4R9K A;  3CPO A;  1CQS A;  4XM4 A;  4IIA A;  1UUW B;  4I4K A;  4HM3 B;  2BNG A;  2HMJ B;  3G0K A;  1QJG A;  2R4I A;  2XRX B;  4LGQ A;  3KSP A;  1HKX A;  2A15 A;  2INX A;  5IG3 A;  2XSO B;  3BLZ A;  5IG0 A;  1JN5 B;  2STD A;  1OGZ A;  5KP1 A; 
#chains in the Genus database with same CATH topology
 3GAX A;  7GSP A;  2F98 A;  3K0Z A;  1W7C A;  3ECF A;  1KD1 4;  4Q53 A;  1U8C B;  1BNS A;  3FCS B;  3GSP A;  3ER7 A;  4RNY A;  4XBX A;  1TRQ A;  1V74 A;  2MC8 A;  1UGH I;  1NU3 A;  2AAE A;  3JUM A;  2M7O A;  1DMQ A;  2D1W A;  4EXR A;  3HIG A;  1OPY A;  2XSH B;  4NPB A;  1U5O A;  2YFL B;  3OWY A;  3JUQ A;  5A0O B;  3CC2 3;  1FW7 A;  1M1X B;  2UGI A;  3GZR A;  5G2G A;  3MKI A;  2CW9 A;  1O7G B;  3ROB A;  5RNT A;  3JUP A;  3DGY A;  1OCV A;  3L0R A;  4X2H A;  1C54 A;  1W5Z A;  1HYF A;  4L7K A;  1GMP A;  4GB5 A;  2E2V A;  1NJI 4;  1GOY A;  4O8S A;  9RNT A;  5IG4 A;  3RGR A;  1I2F A;  3FGY A;  1AY7 A;  1RGG A;  3FG4 A;  5HGR A;  1K9M 4;  1RGL A;  4HM4 B;  3AHS A;  1GOU A;  1QAF A;  4K1V A;  1T5Y A;  3E99 A;  1B2S A;  2F4Y A;  5EVH A;  2C10 A;  4ZM8 A;  1RSN A;  4LEH A;  1GYB A;  1WMO A;  1ZX2 A;  1RN1 A;  4RNZ A;  3IMA B;  2HMN B;  3DGO A;  3WOD G;  1E97 A;  1BOX A;  1OHP A;  4QWT A;  3NQZ A;  4L8O A;  3SX1 A;  1MWS A;  4JRF A;  2Z6B A;  5IEP A;  3GZX B;  3KKG A;  3T8N A;  3I0Y A;  3B8L A;  1TRP A;  3PCS A;  3B4O A;  1LVN A;  4OK0 A;  1BRJ A;  3FG3 A;  3Q90 A;  4STD A;  3U97 A;  1W00 A;  2BHM A;  5IG5 A;  5DRV A;  5D82 A;  1N5P A;  1BU4 A;  1IT7 A;  1JB5 A;  1BUQ A;  2KCD A;  3CU3 A;  4X2O A;  2HMO B;  1LNI A;  3A76 A;  2KF6 A;  2Y74 A;  3EQQ B;  4J8T A;  1S72 3;  3WR2 A;  1FGR A;  3AHW A;  1X1Y A;  2KXG A;  2F5W A;  3DGN A;  4HM2 B;  4NRE A;  4OUQ A;  5M1A A;  3X41 A;  3G6E 3;  1KC8 4;  2BT3 A;  4WYK B;  3K5T A;  2AAD A;  1GD4 A;  3H51 A;  4XDW A;  3V98 A;  1UUG B;  2XH9 A;  1K8A 4;  2XGN A;  5CF1 A;  6GSP A;  1WMN A;  1W01 A;  2W9Q A;  4GSP A;  1UCK A;  3T8U A;  4IPB A;  3DZL A;  4EBG A;  4HZ9 B;  1B2U A;  3G8Z A;  4OVM A;  1YVS A;  1YGE A;  1ROV A;  1AV4 A;  1B27 A;  1KSI A;  1O7W B;  1NO3 A;  1IV7 A;  2CFL A;  2UX0 A;  3MSO A;  2KRT A;  4H3U A;  4HKV B;  1BVI A;  2LYX A;  2IY2 A;  2SBL A;  2Z7A A;  4HZB B;  4RNT A;  4GHO A;  4XBT A;  4MEI A;  3F8H A;  4MMX B;  3ZFZ A;  1ULI B;  2OTL 3;  2QEX 3;  4J9A A;  3WA3 A;  1MGR A;  5LC6 A;  4XBY A;  4BIR A;  3VSY A;  3NHX A;  3EJV A;  3Q1C A;  1Y4K A;  1VZZ A;  1IVX A;  3OWU A;  1N9E A;  1VQN 3;  3D9R A;  2ZDJ A;  2SAR A;  1BSC A;  4HYZ A;  2ZL8 A;  4LMI A;  1I0X A;  2F56 A;  1TU5 A;  2P0X A;  1W2Z A;  1YIJ 3;  1M9G A;  1BNI A;  5CLK A;  3CCM 3;  3KE7 A;  4N6N B;  3DGM A;  3X42 A;  1T2I A;  3DUK A;  3NM2 A;  3U1W A;  4MMZ B;  3EB8 A;  1BSA A;  1V57 A;  1FUS A;  3NQY A;  4O3V A;  1W2B 2;  3DGL A;  1W6Y A;  1M1K 4;  1RNT A;  1GMQ A;  1Z1S A;  4N6L A;  3LTA A;  3STD A;  1E3R A;  1BAN A;  3D5I A;  1IU7 A;  3CCL 3;  3EC9 A;  2P05 A;  1JBT A;  4WYK A;  1WNH A;  3GRD A;  3NUV A;  1EEJ A;  2P09 A;  3EN1 B;  5KP4 A;  1RCK A;  3QRD A;  1SAR A;  1ULJ B;  2B24 B;  3S29 A;  2D42 A;  4EYC A;  3LZA A;  3MWZ A;  1W02 A;  1EUI C;  4I5Q A;  1RLS A;  4JF8 A;  1O7M B;  2Q07 A;  5CXO A;  3PYJ A;  4IT7 A;  1RN4 A;  4WFO A;  3RNT A;  1X1W A;  1BNE A;  5BU4 A;  2CH9 A;  2GEY A;  1JZD A;  2CG1 A;  1VQQ A;  1UUV B;  3CNM A;  3PCR A;  1BUJ A;  4HM0 B;  3SOA A;  3WHO A;  1DET A;  1YVB I;  1UI8 A;  3OX9 A;  3LYG A;  4R1K A;  4J5G A;  1G96 A;  3CC7 3;  4K90 B;  3MPH A;  2Y73 A;  3B7C A;  1VQM 3;  5KP1 A;  1MWR A;  1QMA A;  3LT9 A;  6RNT A;  1RN7 A;  1ZGX A;  1A2P A;  2GXF A;  1C7H A;  1FYS A;  4LSO A;  2RBI A;  1LQM B;  2CWU A;  1ROA A;  3O8Y A;  3T0U A;  3WA2 X;  1Q7H A;  3WMD A;  1RGC A;  1YJN 3;  1SPU A;  2JQ5 A;  1BNF A;  1D6Y A;  1RGH A;  3X40 A;  3K7C A;  2GSP A;  1FGT A;  3FF2 A;  3CCR 3;  2UUG C;  5IEO A;  1A90 A;  3HZP A;  1YJ9 3;  1N9J A;  1BSB A;  1G02 A;  5IEN A;  6STD A;  1JRQ A;  3JUN A;  3NXJ A;  1NNV A;  2OOV C;  4KFD A;  4CJN A;  2F5M A;  1TFO A;  1TFK A;  3LTC A;  3GZY B;  4RBN A;  3K9M C;  1TTO A;  1HZ1 A;  2YFI B;  2BMO B;  3MG2 A;  4HM8 B;  3RGA A;  3S67 A;  2MF7 A;  3OW2 2;  1BRN L;  3OWS A;  3UJM A;  2XR8 B;  1PFP A;  1OUN A;  4G1M B;  2K3D A;  3EF8 A;  2GBW B;  3PXM A;  2WO0 A;  7RNT A;  4FCM A;  4N6T A;  1X1X A;  3AMO B;  1IYY A;  5IF6 A;  3EBY A;  3ZG5 A;  2I9W A;  4O2H A;  1W6C A;  1OF5 B;  2E2T A;  2HOH A;  1EA2 A;  3ALA A;  1TUH A;  3DM8 A;  4FMD A;  4N6O B;  2RGQ A;  3PZW A;  4KVH A;  3WDG B;  4FCJ A;  1O7H B;  4O02 B;  5AYS C;  1PYL A;  2PZV A;  2XF3 A;  2OWP A;  1FGM A;  3KN4 A;  4BTW A;  1B2M A;  2GBX B;  1BAO A;  4WHA A;  5CF2 A;  1J2B A;  2RNT A;  1VQ6 3;  1BRH A;  3CCJ 3;  2IYJ A;  1GOV A;  3NM7 A;  4HM5 B;  3CMA 3;  1I0V A;  3D5G A;  4WWU C;  2OTJ 3;  2BIR A;  4HOH A;  2CWV A;  3NV0 B;  2K54 A;  4KFF A;  1D6U A;  1I70 A;  3IPT A;  1EQK A;  1VQ7 3;  2ML5 A;  4HBR A;  2W9P A;  2IUK A;  3HX8 A;  5IER A;  1CYV A;  2QIY A;  1LRA A;  2W03 A;  3FKA A;  3GZB A;  1NB5 I;  1VQP 3;  3CPW 2;  4HM7 B;  3D79 A;  5GSP A;  7STD A;  3DY5 A;  3F40 A;  5LC7 A;  3MHE A;  2F86 B;  1K41 A;  1BRK A;  1UGI A;  3AGN A;  3CCQ 3;  1YIT 3;  1BRG A;  3SYU A;  3UL6 A;  3EHC A;  5TGN A;  1BSE A;  3PS8 A;  3OV4 A;  1RGK A;  1Q81 4;  1MWT A;  1Q7Y 4;  1NDO B;  3SVA A;  1DMN A;  5M19 A;  1HU9 A;  3OXA A;  3S5C A;  1N8R 4;  3EX9 A;  1R4Y A;  3DMC A;  3LXU X;  5AYR B;  3AMO A;  4N6U A;  3UL5 A;  3FF0 A;  3LML A;  4GL6 A;  1K73 4;  4K1U A;  1STF I;  2C4B A;  3BND A;  1JJ2 2;  1OF5 A;  1BNG A;  5BXQ A;  5STD A;  2W04 A;  3F7X A;  4K61 A;  1DVD A;  2CWT A;  2V1L A;  2XEP A;  2B1X B;  4R9L A;  1I3I A;  2CK3 H;  1N8Q A;  2WGQ A;  3LH4 A;  1IVW A;  1JBS A;  1GY7 A;  3X3Y A;  3G71 3;  3CME 3;  4HAA A;  1WMP A;  2FNQ A;  5KP3 A;  2BMR B;  2CG0 A;  5AEU B;  3BNB A;  4U13 A;  1O7N B;  1W6G A;  1B20 A;  3BU4 A;  1W4N A;  1AR0 A;  3KFQ C;  4KZ1 A;  1I2E A;  3EN8 A;  1MGW A;  3NV0 A;  1MNL A;  1A2K A;  5AIF A;  3H3H A;  1QVF 2;  1UCI A;  5ELJ A;  4MMY B;  1VQL 3;  1VQK 3;  2HML B;  1N5H A;  2OCT A;  3UNL A;  3FH1 A;  1GD3 A;  5HOH A;  1WQL B;  1YGW A;  1ZS7 A;  3HOH A;  3CXC 2;  4L8P A;  3V92 A;  1GSP A;  1RMS A;  1RGF A;  2GU1 A;  2KF3 A;  4FR9 A;  3G16 A;  3KZT A;  2H0G A;  3IJE B;  1Q40 B;  4KFE A;  5JPU A;  1L5G B;  1FGO A;  1JZO A;  5BVB A;  1ISK A;  5D83 A;  3HI7 A;  5I97 A;  1BNR A;  3TDG A;  2OQE A;  1RGA A;  2RCD A;  4NHF A;  3I55 3;  1Q9E A;  4PEJ A;  1GY5 A;  4EC6 A;  4N6V 0;  1R4C A;  3KCH A;  3FG1 A;  2CX0 A;  1GY6 A;  3S28 A;  3WOF B;  5AEW B;  3X3Z A;  4J5K A;  3N9H A;  1Q82 4;  5IW9 A;  2O9U X;  1TP6 A;  2WGO A;  1X1U A;  8CHO A;  1RJO A;  2KF4 A;  4FMC A;  3VGN A;  1SQW A;  2YFJ B;  1BIR A;  1RDS A;  3URP A;  2HMK B;  5AIH A;  2QA4 3;  1EG9 B;  4WP5 A;  3LTD A;  3CCE 3;  1FUW A;  1AVL A;  3MG3 A;  1FGQ A;  3F9S A;  5FGO A;  2CIU A;  5BIR A;  1A67 A;  1A2V A;  4AKZ A;  5ELU A;  1WTH A;  1QAL A;  2IUJ A;  3J7Y d;  3AGO A;  1FZU A;  3NX0 A;  1MOL A;  2L1S A;  2P0M A;  1O7P B;  1IDP A;  1S5A A;  4ORL A;  3Q2P A;  3MG1 A;  3MYT A;  3S27 A;  2YX9 A;  1IK3 A;  1ASK A;  2C11 A;  4XB5 A;  3CNX A;  1CH0 A;  1LOY A;  2XGL A;  8RNT A;  1BGS A;  2XFS A;  1BNJ A;  1JB4 A;  1STD A;  1PY3 A;  2RSX A;  3NBR A;  3SOY A;  2IMJ A;  2ML6 A;  1BSD A;  3QK9 A;  1RHL A;  1BRS A;  1KWI A;  1LOV A;  1OH0 A;  2FXT A;  1IVV A;  1DVC A;  1Q40 A;  2PNC A;  4HM1 B;  1SJW A;  1RRH A;  3SED A;  1T2H A;  1LQG C;  2Z76 A;  1NB3 I;  1DMM A;  2CFK A;  1IVU A;  3HK4 A;  3BIR A;  1M90 4;  1TJD A;  4HM6 B;  3ZG0 A;  1JB2 A;  2ZHX B;  2L4V A;  1QAK A;  2HMM B;  3FLJ A;  1I2G A;  2W6J H;  1VQ5 3;  5G1L A;  1JV2 B;  3NBB A;  1RRL A;  5G1K A;  1JKG B;  2IA7 A;  4XDV A;  3DH2 A;  3F8X A;  3BNE A;  5M18 A;  3FZW A;  1JN5 A;  3WOE B;  2XFT A;  1YNV X;  1B2Z A;  2W56 B;  2CFW A;  4LYL B;  4KT3 B;  1RKY A;  3D4A A;  1DYU A;  4BL2 A;  3BB9 A;  5FW5 A;  2OOV A;  1BRI A;  3Q3F A;  4HJL B;  1LXE A;  2F99 A;  1Q42 A;  2GEX A;  2WOF A;  4MJD A;  1OHS A;  1T3B A;  2CFG A;  3LT8 A;  3N54 B;  3KII A;  5AIG A;  1YJW 3;  1AVK A;  4R4K A;  1YHQ 3;  3D3L A;  2Z77 A;  3X3X A;  1CEW I;  4R80 A;  4RZM A;  1E3V A;  4AEQ A;  2E2U A;  3JVC A;  2P38 A;  4BTY A;  2QGU A;  1V58 A;  2FGT A;  1G0T A;  1SIH A;  5AI1 A;  1PU4 A;  1ZO2 A;  2H0I A;  2W0Q A;  4BU4 A;  1IV9 A;  3LOY A;  3F14 A;  1JBR A;  3FSD A;  3A5E A;  3CCU 3;  4EW5 A;  2GU3 A;  2CHC A;  2R41 A;  3N8B A;  4HVN A;  1IT8 A;  3F7S A;  4CCV A;  1RGE A;  1KQS 2;  3PGB A;  1VQ8 3;  1I3F A;  2ZA4 A;  1IQX A;  1IQ8 A;  3BNC A;  5CK6 A;  2CFD A;  5DRE A;  3CD6 3;  3KSE D;  1GS3 A;  4N6M A;  5D81 A;  4EV5 A;  1OAC A;  1B3S A;  2CX1 A;  2W2C A;  3JUO A;  1JKG A;  3RDE A;  4CPK A;  1JNQ A;  1UCJ A;  1RTU A;  4FCZ A;  1OGX A;  5JPP A;  3B4P A;  4N3V A;  2BU4 A;  5EQL A;  1LNH A;  2BMQ B;  2W56 A;  1I8V A;  1LOW A;  2WOH A;  1OHO A;  3EBT A;  2RFR A;  2OQE C;  5EEO A;  4BL3 A;  3CCV 3;  1NWW A;  3LTB A;  1GMR A;  3SLU A;  1RCL A;  3VF1 A;  4BTX A;  3I56 3;  1TIJ A;  1FA3 A;  2CKF B;  4CDL A;  1UI7 A;  3GWR A;  3M8C A;  1RNB A;  1UW1 A;  4FMB A;  3DXO A;  1DE3 A;  1SII A;  2H0H A;  4FMA A;  2KF5 A;  5AII A;  1UDI I;  4R9K A;  1Q86 4;  1K28 A;  3CPO A;  1LOX A;  1CQS A;  2CC3 A;  4XM4 A;  4IIA A;  1UUW B;  4I4K A;  4HM3 B;  2BNG A;  3CC4 3;  1F8N A;  4DKI A;  3CCS 3;  2BO9 B;  3EE1 A;  2KAA A;  1FUT A;  1D6Z A;  2JDI H;  2HMJ B;  1QVG 2;  3UB1 A;  3G0K A;  1QJG A;  3NBJ A;  2R4I A;  4EV2 A;  4TX4 A;  3K63 A;  4ILF A;  2XRX B;  2J8X B;  4LGQ A;  3KSP A;  1CYU A;  1HKX A;  1YI2 3;  5JBS A;  4LZI A;  4AKY A;  2A15 A;  2INX A;  1EKM A;  5IG3 A;  2K0M A;  2LQV A;  3SXX A;  2XSO B;  3BLZ A;  1VQ4 3;  3V99 A;  3G4S 3;  3HII A;  4H61 A;  5IG0 A;  1JN5 B;  1VQ9 3;  1B21 A;  1UCL A;  1AQZ A;  2O3O A;  2STD A;  1MWU A;  1OGZ A;  1US1 A;  1IQY A;  1B2X A;  1VQO 3; 
#chains in the Genus database with same CATH homology
 3GAX A;  2F98 A;  3K0Z A;  1W7C A;  3ECF A;  1KD1 4;  4Q53 A;  1U8C B;  3FCS B;  3ER7 A;  4RNY A;  4XBX A;  1V74 A;  2MC8 A;  1NU3 A;  3JUM A;  2M7O A;  1DMQ A;  2D1W A;  4EXR A;  3HIG A;  1OPY A;  2XSH B;  5A0O B;  1U5O A;  2YFL B;  3OWY A;  3JUQ A;  3CC2 3;  1M1X B;  3GZR A;  5G2G A;  3MKI A;  2CW9 A;  1O7G B;  3ROB A;  3JUP A;  1OCV A;  3L0R A;  4X2H A;  1W5Z A;  4L7K A;  4GB5 A;  2E2V A;  1NJI 4;  5IG4 A;  4O8S A;  3RGR A;  3FGY A;  3FG4 A;  5HGR A;  1K9M 4;  4HM4 B;  1QAF A;  4K1V A;  1T5Y A;  3E99 A;  4ZM8 A;  5EVH A;  2C10 A;  4LEH A;  1GYB A;  1WMO A;  1ZX2 A;  4RNZ A;  3IMA B;  2HMN B;  3DGO A;  3WOD G;  1E97 A;  1OHP A;  4QWT A;  3NQZ A;  4L8O A;  3SX1 A;  4JRF A;  2Z6B A;  5IEP A;  3GZX B;  3KKG A;  3T8N A;  3I0Y A;  3B8L A;  3PCS A;  3B4O A;  1LVN A;  4OK0 A;  3FG3 A;  3Q90 A;  4STD A;  3U97 A;  1W00 A;  2BHM A;  5IG5 A;  5DRV A;  5D82 A;  1N5P A;  1IT7 A;  1JB5 A;  1BUQ A;  2KCD A;  3CU3 A;  4X2O A;  2HMO B;  3A76 A;  3EQQ B;  2Y74 A;  4J8T A;  1S72 3;  1FGR A;  2KXG A;  3DGN A;  3G6E 3;  4HM2 B;  4NRE A;  4OUQ A;  3X41 A;  1QVF 2;  1KC8 4;  2BT3 A;  4WYK B;  3K5T A;  1GD4 A;  3H51 A;  4XDW A;  3V98 A;  2XH9 A;  1K8A 4;  2XGN A;  5CF1 A;  1WMN A;  1W01 A;  2W9Q A;  3T8U A;  4IPB A;  3DZL A;  4EBG A;  4HZ9 B;  3G8Z A;  4OVM A;  1ROV A;  1AV4 A;  1KSI A;  1O7W B;  1NO3 A;  1YGE A;  2CFL A;  1IV7 A;  2UX0 A;  3MSO A;  4HKV B;  2KRT A;  4H3U A;  2LYX A;  2SBL A;  2Z7A A;  5CF2 A;  4HZB B;  4XBT A;  4MEI A;  3F8H A;  4MMX B;  1ULI B;  2OTL 3;  2QEX 3;  4J9A A;  3WA3 A;  5LC6 A;  4XBY A;  3VSY A;  3NHX A;  3EJV A;  3Q1C A;  1Y4K A;  1VZZ A;  1IVX A;  3OWU A;  1N9E A;  1VQN 3;  3D9R A;  2ZDJ A;  4HYZ A;  2ZL8 A;  4LMI A;  1TU5 A;  2P0X A;  1W2Z A;  1YIJ 3;  1M9G A;  5CLK A;  3CCM 3;  3KE7 A;  4N6N B;  3DGM A;  3X42 A;  3DUK A;  3NM2 A;  3U1W A;  4MMZ B;  3EB8 A;  3NQY A;  4O3V A;  1W2B 2;  3DGL A;  1W6Y A;  1M1K 4;  1Z1S A;  4N6L A;  3STD A;  3LTA A;  1E3R A;  1IU7 A;  3CCL 3;  3EC9 A;  2P05 A;  4WYK A;  1WNH A;  3GRD A;  3NUV A;  2P09 A;  3EN1 B;  5KP4 A;  3QRD A;  1ULJ B;  2B24 B;  3S29 A;  4EYC A;  2D42 A;  3LZA A;  3MWZ A;  1W02 A;  4JF8 A;  1O7M B;  2Q07 A;  5CXO A;  3PYJ A;  4IT7 A;  4WFO A;  2CH9 A;  2GEY A;  2CG1 A;  3CNM A;  1UUV B;  3PCR A;  4HM0 B;  3SOA A;  1YVB I;  1UI8 A;  3OX9 A;  3LYG A;  4R1K A;  1G96 A;  3CC7 3;  4K90 B;  3MPH A;  2Y73 A;  3B7C A;  1VQM 3;  1QMA A;  3LT9 A;  1RN7 A;  2GXF A;  1C7H A;  4LSO A;  3O8Y A;  2CWU A;  1ROA A;  3T0U A;  3WA2 X;  3WMD A;  1YJN 3;  1SPU A;  2JQ5 A;  1D6Y A;  3X40 A;  3K7C A;  3FF2 A;  1FGT A;  3CCR 3;  5IEO A;  1A90 A;  3HZP A;  1YJ9 3;  1N9J A;  5IEN A;  6STD A;  1JRQ A;  3JUN A;  3NXJ A;  2OOV C;  4KFD A;  1TFO A;  1TFK A;  3LTC A;  3GZY B;  4RBN A;  3K9M C;  2YFI B;  2BMO B;  3MG2 A;  4HM8 B;  3RGA A;  3S67 A;  2MF7 A;  3OW2 2;  3OWS A;  3UJM A;  2XR8 B;  1PFP A;  1OUN A;  4G1M B;  3EF8 A;  2GBW B;  3PXM A;  2WO0 A;  4FCM A;  4N6T A;  3AMO B;  5IF6 A;  3EBY A;  2I9W A;  4O2H A;  1W6C A;  1OF5 B;  2E2T A;  3ALA A;  1EA2 A;  3DM8 A;  1TUH A;  4FMD A;  4N6O B;  3WDG B;  2RGQ A;  3PZW A;  4KVH A;  1N8R 4;  4FCJ A;  1O7H B;  4O02 B;  5AYS C;  2PZV A;  2XF3 A;  2OWP A;  1FGM A;  3KN4 A;  4BTW A;  2GBX B;  4WHA A;  1J2B A;  1VQ6 3;  3CCJ 3;  3NM7 A;  4HM5 B;  3CMA 3;  4WWU C;  2OTJ 3;  2CWV A;  3NV0 B;  2K54 A;  4KFF A;  1D6U A;  3IPT A;  1EQK A;  1VQ7 3;  2ML5 A;  4HBR A;  2W9P A;  2IUK A;  3HX8 A;  5IER A;  1CYV A;  2QIY A;  3GZB A;  2W03 A;  3FKA A;  1NB5 I;  1VQP 3;  3CPW 2;  4HM7 B;  7STD A;  3DY5 A;  3F40 A;  5LC7 A;  3MHE A;  2F86 B;  1K41 A;  3CCQ 3;  1YIT 3;  3UL6 A;  3EHC A;  5TGN A;  3PS8 A;  3OV4 A;  1Q81 4;  1Q7Y 4;  1NDO B;  3SVA A;  1DMN A;  1HU9 A;  3OXA A;  3S5C A;  3EX9 A;  3DMC A;  3LXU X;  5AYR B;  3AMO A;  4N6U A;  3UL5 A;  3FF0 A;  3LML A;  4GL6 A;  1K73 4;  4K1U A;  1STF I;  3BND A;  1JJ2 2;  1OF5 A;  5BXQ A;  5STD A;  2W04 A;  3F7X A;  4K61 A;  1DVD A;  2CWT A;  2V1L A;  2XEP A;  2B1X B;  4R9L A;  2CK3 H;  3LH4 A;  1N8Q A;  2WGQ A;  1IVW A;  1GY7 A;  3X3Y A;  3G71 3;  3CME 3;  1WMP A;  2FNQ A;  5KP3 A;  2BMR B;  2CG0 A;  5AEU B;  3BNB A;  4U13 A;  1O7N B;  1W6G A;  1W4N A;  1AR0 A;  3KFQ C;  4KZ1 A;  3EN8 A;  3NV0 A;  1MNL A;  1A2K A;  5AIF A;  3H3H A;  5ELJ A;  4MMY B;  1VQL 3;  1VQK 3;  2HML B;  1N5H A;  2OCT A;  3UNL A;  3FH1 A;  1GD3 A;  1WQL B;  3CXC 2;  4L8P A;  3V92 A;  2GU1 A;  4FR9 A;  3G16 A;  3KZT A;  3IJE B;  4KFE A;  1Q40 B;  5JPU A;  1L5G B;  1FGO A;  5BVB A;  1ISK A;  5D83 A;  3HI7 A;  5I97 A;  3TDG A;  2OQE A;  2RCD A;  4NHF A;  3I55 3;  4PEJ A;  1GY5 A;  4EC6 A;  4N6V 0;  1R4C A;  3FG1 A;  3S28 A;  1GY6 A;  5AEW B;  3WOF B;  3X3Z A;  3N9H A;  1Q82 4;  5IW9 A;  2O9U X;  1TP6 A;  2WGO A;  8CHO A;  1RJO A;  3VGN A;  4FMC A;  1SQW A;  2YFJ B;  2HMK B;  5AIH A;  2QA4 3;  1EG9 B;  4WP5 A;  3LTD A;  3CCE 3;  1FUW A;  1AVL A;  3MG3 A;  1FGQ A;  3F9S A;  5FGO A;  2CIU A;  1A67 A;  1A2V A;  4AKZ A;  5ELU A;  1WTH A;  1QAL A;  2IUJ A;  3J7Y d;  3NX0 A;  1MOL A;  2P0M A;  4ORL A;  1O7P B;  1IDP A;  1S5A A;  3Q2P A;  3MG1 A;  3MYT A;  3S27 A;  2YX9 A;  1IK3 A;  1ASK A;  2C11 A;  4XB5 A;  3CNX A;  2XGL A;  2XFS A;  1JB4 A;  2RSX A;  1STD A;  3NBR A;  3SOY A;  2IMJ A;  2ML6 A;  3QK9 A;  1OH0 A;  1KWI A;  2PNC A;  2FXT A;  1IVV A;  1DVC A;  1Q40 A;  4HM1 B;  1SJW A;  1RRH A;  3SED A;  2Z76 A;  1NB3 I;  1DMM A;  2CFK A;  1IVU A;  3HK4 A;  1M90 4;  4HM6 B;  1JB2 A;  2L4V A;  1QAK A;  2HMM B;  3FLJ A;  2W6J H;  1VQ5 3;  1JV2 B;  3NBB A;  1RRL A;  1JKG B;  2IA7 A;  4XDV A;  3F8X A;  3BNE A;  3FZW A;  1JN5 A;  3WOE B;  2XFT A;  1RKY A;  2W56 B;  2CFW A;  1DYU A;  3BB9 A;  5FW5 A;  2OOV A;  4HJL B;  1LXE A;  2F99 A;  1Q42 A;  2GEX A;  2WOF A;  4MJD A;  1OHS A;  3N54 B;  2CFG A;  3LT8 A;  3KII A;  5AIG A;  1YJW 3;  1AVK A;  4R4K A;  1YHQ 3;  3D3L A;  2Z77 A;  3X3X A;  1CEW I;  4R80 A;  4RZM A;  1E3V A;  4AEQ A;  2E2U A;  3JVC A;  2P38 A;  4BTY A;  2QGU A;  2FGT A;  1SIH A;  5AI1 A;  1PU4 A;  1ZO2 A;  2W0Q A;  1IV9 A;  3LOY A;  3F14 A;  3FSD A;  3CCU 3;  2GU3 A;  2CHC A;  4HVN A;  3N8B A;  1KQS 2;  1IT8 A;  3F7S A;  4CCV A;  3PGB A;  1VQ8 3;  3BNC A;  1IQX A;  1IQ8 A;  5CK6 A;  2CFD A;  5DRE A;  3CD6 3;  3KSE D;  1GS3 A;  4N6M A;  5D81 A;  4EV5 A;  1OAC A;  2W2C A;  3JUO A;  1JKG A;  3RDE A;  1JNQ A;  4FCZ A;  1OGX A;  5JPP A;  3B4P A;  4N3V A;  5EQL A;  1LNH A;  2BMQ B;  2W56 A;  2WOH A;  1OHO A;  3EBT A;  2RFR A;  2OQE C;  5EEO A;  3CCV 3;  1NWW A;  3LTB A;  3SLU A;  4BTX A;  3VF1 A;  1FA3 A;  3I56 3;  1TIJ A;  2CKF B;  4CDL A;  1UI7 A;  3GWR A;  3M8C A;  1UW1 A;  4FMB A;  3DXO A;  1SII A;  4FMA A;  5AII A;  4R9K A;  1Q86 4;  1K28 A;  3CPO A;  1LOX A;  1CQS A;  2CC3 A;  4XM4 A;  4IIA A;  1UUW B;  4I4K A;  4HM3 B;  2BNG A;  3CC4 3;  1F8N A;  3CCS 3;  2BO9 B;  3EE1 A;  1D6Z A;  2JDI H;  2HMJ B;  1QVG 2;  3UB1 A;  3G0K A;  1QJG A;  3NBJ A;  2R4I A;  4EV2 A;  4TX4 A;  3K63 A;  2XRX B;  4LGQ A;  3KSP A;  1CYU A;  1HKX A;  1YI2 3;  5JBS A;  4LZI A;  4AKY A;  2A15 A;  2INX A;  1EKM A;  5IG3 A;  2K0M A;  2LQV A;  3SXX A;  2XSO B;  3BLZ A;  1VQ4 3;  3V99 A;  3G4S 3;  3HII A;  4H61 A;  5IG0 A;  1JN5 B;  1VQ9 3;  2O3O A;  2STD A;  1OGZ A;  1US1 A;  1IQY A;  5KP1 A;  1VQO 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...