3B7CA

Crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
MPTDDIVQLLKGQEEAWNRGDLDAYMQGYWQNEQLMLISNGKFRNGWDETLAAYKKNYPDKESLGELKFTIKEIKMLSNYAAMVVGRWDLKRLKDTPTGVFTLLVEKIDDRWVITMDHSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF-2 like protein of unknown function (NP_715767.1) from Shewanella oneidensis at 1.70 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b7cA00
1GY6A 4GB5A 1W01A 3CNMA 3F7SA 2IMJA 3FGYA 2STDA 3NHXA 5KP3A 5D81A 5KP1A 2XSOB 3JUQA 3CU3A 3DUKA 2JQ5A 3EBYA 1OHSA 2HMOB 3F9SA 3KZTA 5AIHA 5IG4A 2A15A 1A2KA 2RGQA 2QIYA 3JUPA 3NV0A 2BMRB 4HM8B 4LGQA 1O7NB 2F99A 3FKAA 1W00A 8CHOA 3EJVA 4XDVA 4L7KA 3DMCA 1E3RA 2BMOB 3HK4A 4STDA 1ZO2A 4K1UA 5AIIA 1K41A 5BXQA 1ASKA 1JN5A 3LZAA 1NWWA 3IPTA 1OCVA 2XR8B 1OGZA 4HM0B 2QGUA 2K54A 1WQLB 3GRDA 1SJWA 2RFRA 4HZBB 5AIGA 3UNLA 3SOYA 3MG1A 1OH0A 4K1VA 4MJDA 3SEDA 3E99A 4HZ9B 3DZLA 3K0ZA 5CF2A 1DMQA 4WWUC 1ISKA 3NXJA 3A76A 1STDA 1OF5B 3OXAA 1ULIB 1W6YA 4WP5A 3SOAA 1O7GB 5CF1A 4L8PA 7STDA 2YFIB 1O7WB 3EHCA 4Q53A 4HJLB 5IENA 1TP6A 2BMQB 1AR0A 1Q40B 3BLZA 4HM6B 4J9AA 3FF2A 1JB4A 1DMNA 1O7HB 1E3VA 1U5OA 3K7CA 4HM3B 3M8CA 5CXOA 3FSDA 1GYBA 1DMMA 3GWRA 3EX9A 4HM2B 4LMIA 5AIFA 3S5CA 3NM2A 3NV0B 5JPUA 3GZBA 3VGNA 2W2CA 3KSPA 3T8NA 3DM8A 3NUVA 3FLJA 5AEUB 4U13A 1GY7A 3VSYA 5EVHA 5BVBA 1CQSA 2CKFB 5G2GA 4ORLA 3F8HA 5IG5A 3FH1A 3HX8A 4HM7B 2GBWB 2GEYA 2F86B 4PEJA 4XBXA 3F14A 3EN1B 3F40A 4WYKA 5IEPA 5IG3A 1Q42A 2HMJB 3B8LA 3FZWA 3GZXB 3OWYA 1GY5A 3JUOA 3MHEA 5FW5A 3I0YA 1OUNA 3T8UA 1JB5A 3EBTA 4HVNA 4J8TA 5CLKA 5AI1A 1VZZA 3STDA 5TGNA 2B24B 3FF0A 3UJMA 2INXA 4X2HA 4XDWA 1OHPA 4IIAA 4OVMA 2Z7AA 3CNXA 3ER7A 5STDA 4H3UA 4FCJA 3OV4A 3OX9A 1JKGA 2PZVA 5HGRA 1OGXA 3BB9A 3EQQB 4OUQA 5IG0A 3WMDA 4RZMA 2B1XB 4R1KA 1JB2A 2XSHB 4I4KA 3LYGA 1OHOA 1UUVB 2HMNB 1O7PB 3B7CA 1Z1SA 3DXOA 2OWPA 1EA2A 1TUHA 4N3VA 4R9LA 3MKIA 4XBYA 5IF6A 1QJGA 2YFJB 2UX0A 3ECFA 4R9KA 2GXFA 2CHCA 4FCMA 3JUMA 3OWUA 2Z77A 3KE7A 3H3HA 2BNGA 3EF8A 1E97A 4WYKB 2I9WA 4L8OA 3D9RA 3Q90A 3GZYB 1EG9B 3ROBA 4HM4B 1BUQA 1OF5A 4XB5A 1JN5B 1ZX2A 2HMMB 4KVHA 2XRXB 2HMKB 1ULJB 2YFLB 3CPOA 1NU3A 1O7MB 4HKVB 1IDPA 2F98A 2RCDA 1NDOB 4HM1B 3MYTA 3JUNA 4CDLA 3B4OA 3RGRA 3MG3A 5KP4A 6STDA 4XBTA 1OPYA 1QMAA 2GBXB 3OWSA 4X2OA 3RGAA 5IEOA 1UUWB 5IERA 1W02A 3HZPA 3MG2A 4HM5B 5DRVA 5AEWB 4XM4A 1S5AA 2GEXA 2R4IA 3F7XA 3KKGA 3EC9A 5D82A 5JPPA 5DREA 3G16A 3H51A 3B4PA 1HKXA 3GZRA 2HMLB 1JKGB 4LEHA 3G8ZA 3MSOA 1Q40A 3F8XA 3NBRA 3G0KA 1GS3A 2Z76A 1C7HA 5CK6A 3EN8A 5D83A
chains in the Genus database with same CATH superfamily
4GB5A 2CWVA 2O9UX 1LVNA 1FGMA 2IMJA 3FGYA 1W6GA 3DH2A 3NHXA 5G1LA 2ZA4A 5M1AA 2J8XB 3JUQA 4KT3B 2JQ5A 1JBSA 1OHSA 3F9SA 3NQZA 1BAOA 1FZUA 3LT9A 2CFKA 4HM8B 1N5HA 2D42A 1W00A 2Z6BA 1T2HA 1YVBI 2CFGA 3NQYA 4XDVA 4L7KA 3HOHA 1E3RA 1GOUA 8RNTA 5BU4A 3NBJA 1QAKA 1BIRA 1UI7A 2XR8B 4HM0B 2QGUA 3G6E3 1RN4A 1WQLB 2W03A 4BTWA 3G713 4FR9A 1G02A 3MG1A 3SLUA 1RGEA 4K1VA 1KD14 2OCTA 3AHSA 2OQEA 1S723 1BRHA 2OTL3 4WWUC 1FUSA 1ISKA 1IVUA 2W6JH 1BNIA 1N9EA 4WP5A 3SOAA 5CF1A 1X1WA 3K63A 2YFIB 2BMQB 1AR0A 4J9AA 3FF2A 3K7CA 1O7HB 1U5OA 5IG4A 2KF5A 2RBIA 3FSDA 1GYBA 2CIUA 3GWRA 3M8CA 4HM2B 1RGKA 3PGBA 1JBTA 5JPUA 2FGTA 1C54A 1BANA 1GOVA 1UGIA 3L0RA 5ELJA 3CCQ3 4U13A 2F5WA 1RGAA 2KF3A 5BVBA 3ZG5A 5M18A 2C10A 4LSOA 3FCSB 1BVIA 3U97A 2Y73A 1W2B2 4XBXA 3EN1B 4GHOA 1BRKA 3SX1A 6GSPA 5IEPA 3S28A 3FZWA 1BRJA 3RDEA 3JUOA 3I0YA 2OOVC 4HVNA 3WODG 5AI1A 1HYFA 1CH0A 1TFKA 4RBNA 4WHAA 1VQ53 1RGCA 2B24B 4FMDA 2XGLA 1LXEA 1B2MA 1ROAA 1OHPA 2P09A 1VQ43 4RNZA 2CH9A 2FXTA 2JDIH 2ZHXB 3OV4A 3OX9A 2PZVA 2C11A 1OGXA 2E2TA 3BB9A 3EQQB 4NPBA 5IG0A 1M9GA 4RZMA 2XSHB 4I4KA 4EV2A 1UUVB 2SBLA 3A5EA 1FGQA 1VQO3 4IPBA 4R9LA 1TUHA 2Q07A 4GSPA 3MKIA 3NX0A 1NO3A 1N5PA 3JUMA 1W5ZA 3OWUA 3PXMA 3KE7A 3I553 3EF8A 2P05A 4N6UA 1BRGA 1EG9B 5FGOA 4XB5A 1LRAA 1ZX2A 1UCKA 2P0XA 2HMKB 1ULJB 4HKVB 4HAAA 4TX4A 3AMOA 1IDPA 1ROVA 1AY7A 1NDOB 3KFQC 3MYTA 2BT3A 3UB1A 3CME3 2CG1A 3LOYA 3RGRA 3CXC2 1UUGB 1OPYA 3RGAA 5IERA 4CJNA 3DY5A 2CG0A 3URPA 3KCHA 1YJW3 2IY2A 2GEXA 5D82A 3D4AA 5JPPA 3K9MC 1IVVA 1Q824 1FGTA 3G16A 1I3FA 2GSPA 2K3DA 1RCLA 2RSXA 5AYSC 1RN1A 3G0KA 2ZDJA 3Q1CA 4R80A 3UL6A 1GY6A 3NBBA 3D3LA 3F7SA 1I0VA 2W0QA 2F56A 5KP3A 1T5YA 1VQQA 2CX0A 4J5KA 2OTJ3 5M19A 2KF6A 3DUKA 3JVCA 3KZTA 4R4KA 1X1UA 1K9M4 2QIYA 1FGOA 1WMNA 2KRTA 8CHOA 1UGHI 3EJVA 4N6TA 3AHWA 3ZFZA 1N9JA 2BMOB 2WO0A 1RRLA 3QK9A 1K41A 1KWIA 1ASKA 1BRIA 1BSDA 1YGWA 3N54B 5I97A 2QA43 3IJEB 1B3SA 1TRPA 2GU3A 2K54A 1SJWA 2RFRA 3UNLA 3CCL3 1CYUA 2P0MA 1NJI4 3E99A 1RJOA 1VQ63 1IT7A 1DMQA 3CCV3 1YNVX 1STDA 3LXUX 3OXAA 3PCRA 2C4BA 7STDA 3CCR3 1J2BA 1B21A 1D6UA 4L8PA 1V74A 4FMBA 1YI23 3PS8A 3EHCA 4HJLB 1YJN3 1TP6A 1Q40B 1IVXA 3BLZA 1LQMB 1TFOA 4HM6B 4HM3B 1DMNA 4JRFA 1E3VA 5CXOA 5AEWB 3TDGA 2WGOA 4LMIA 1RGHA 2MC8A 2IUKA 3SXXA 1BNFA 3FLJA 1BOXA 4AKZA 3LTCA 5BIRA 3X41A 4I5QA 3X3YA 4ORLA 3FH1A 3S67A 4HM7B 2RNTA 3LH4A 4PEJA 1FA3A 4WYKA 3B8LA 3MHEA 4EXRA 3UL5A 1EUIC 3T8UA 1JB5A 1UCJA 5CLKA 3STDA 1FW7A 3WA3A 4FCZA 1BNRA 1F8NA 1AVKA 1SIHA 1LQGC 2L4VA 2LQVA 4MEIA 4X2HA 1K8A4 4XDWA 1LOWA 4OVMA 1IK3A 4HYZA 1CEWI 1TRQA 1B2UA 1QALA 4OUQA 1KQS2 3PYJA 3EE1A 3GAXA 2B1XB 7GSPA 1JB2A 3DGYA 3LT8A 1OHOA 4KZ1A 1O7PB 1NB3I 3B7CA 3X3ZA 1RLSA 4NHFA 2OWPA 1OACA 2H0GA 4XBYA 1BNGA 1VQL3 1QJGA 2YFJB 4R9KA 3ECFA 3HIGA 3V99A 2CHCA 3AMOB 4FCMA 1UW1A 4O3VA 2Z77A 3H3HA 1E97A 4MMYB 3AGNA 3IMAB 2F5MA 3GZYB 1BUQA 1I70A 1JNQA 4RNTA 3Q3FA 2XRXB 4FMCA 1QVF2 2YFLB 2CW9A 1NU3A 1O7MB 4QWTA 4HM1B 3LTAA 3JUNA 4EW5A 4AEQA 1N8R4 3MG3A 5JBSA 3PZWA 4BU4A 2D1WA 1VQ83 2CFDA 1SIIA 1I8VA 1W02A 3CCU3 1CYVA 1V58A 4DKIA 1S5AA 2R4IA 4KFDA 1I2EA 3CD63 1DE3A 1A2VA 1I3IA 1JKGB 2BIRA 1TJDA 3MSOA 3PCSA 4LYLB 3MPHA 3WDGB 3G4S3 3NM7A 1NB5I 1RTUA 1YIT3 2UGIA 5D83A 1WMOA 1RN7A 3CNMA 5KP1A 1PY3A 2XF3A 2XH9A 5D81A 3CU3A 3WR2A 3EBYA 2HMOB 1WMPA 3HIIA 1Q864 3CCM3 2A15A 1A2KA 2RGQA 4XM4A 1UI8A 2WOHA 3NV0A 4O02B 1O7NB 2F99A 3FKAA 1TTOA 3BU4A 4BIRA 3DMCA 2E2UA 1IT8A 3HK4A 4STDA 1ZO2A 4K1UA 2BHMA 5AIIA 2IUJA 1NNVA 1JN5A 1DYUA 5BXQA 3LZAA 3ALAA 3IPTA 1OCVA 3T0UA 2AADA 1DVDA 1IQXA 1M1XB 1IYYA 1DETA 1RCKA 1SARA 4GL6A 4N6NB 5AIGA 1OH0A 2MF7A 5EEOA 3SEDA 1RSNA 4HZ9B 1JV2B 1DVCA 1W4NA 3K0ZA 3X3XA 5HOHA 3KIIA 3NXJA 1OF5B 2W56B 4O2HA 3WOEB 1RMSA 1O7WB 1A90A 1I2GA 2OOVA 4EBGA 1JRQA 1JB4A 1Y4KA 3WA2X 2IA7A 3KN4A 1DMMA 4ILFA 3EX9A 4KFEA 5AIFA 3S5CA 1FYSA 3OW22 1B2XA 3GZBA 1BSAA 2IYJA 3KSPA 3T8NA 3DM8A 3VF1A 3NUVA 1GMQA 1RNTA 1B2SA 2W9QA 5AEUB 1GY7A 3U1WA 3VSYA 5EVHA 3WHOA 2CWTA 1N8QA 3S27A 2LYXA 1LOXA 3HX8A 1YJ93 1G0TA 2GBWB 1VQP3 1SQWA 2GEYA 2K0MA 3F14A 3F40A 1IV7A 3DGLA 1Q42A 3OWYA 5FW5A 5IG3A 1RDSA 2WGQA 3DGOA 3LMLA 7RNTA 1VZZA 5TGNA 2W04A 3UJMA 3FG1A 4J5GA 2F4YA 1BU4A 1KSIA 1BSBA 2XFTA 3HI7A 1TU5A 1Q7HA 6RNTA 4O8SA 2Z7AA 4FCJA 1MWTA 4OK0A 3D5IA 1BUJA 1HU9A 3DGNA 2CFWA 1MWSA 4H61A 3BNDA 5GSPA 3LTDA 1IQ8A 1UCIA 2PNCA 1EA2A 2CFLA 3DXOA 5IF6A 1AVLA 5LC7A 4IT7A 2XGNA 1EQKA 3O8YA 1QVG2 1FUTA 2BNGA 4WYKB 1BNEA 3BIRA 3D9RA 3Q90A 4L8OA 1EEJA 3GSPA 5G1KA 1OF5A 2W56A 1STFI 1RKYA 4BL2A 3J7Yd 1I0XA 4KVHA 4JF8A 3CPW2 3CCS3 1BGSA 1W2ZA 2F98A 2RCDA 3KSED 5AYRB 1IVWA 2H0HA 2KCDA 2WOFA 3WOFB 1QAFA 4CDLA 4CPKA 4XBTA 3CCJ3 1QMAA 1EKMA 1R4CA 2GBXB 3K5TA 4X2OA 4EC6A 3HZPA 5DRVA 4N6LA 4BTXA 5RNTA 3KKGA 3F7XA 1SPUA 2M7OA 5DREA 4NREA 1PFPA 1RRHA 1Q9EA 1L5GB 3BNEA 1Q40A 3F8XA 1PU4A 2Z76A 4HM4B 3EN8A 1HZ1A 4HOHA 1W01A 2YX9A 1MWUA 2H0IA 5IW9A 2STDA 1KC84 2XSOB 1B2ZA 1BNSA 1K28A 5ELUA 5AIHA 3RNTA 1PYLA 1X1XA 2O3OA 1GOYA 1ZGXA 3JUPA 2BMRB 4LGQA 4RNYA 3X40A 5LC6A 2KAAA 1BSEA 5EQLA 1WNHA 1VQK3 2CX1A 1YIJ3 2ML6A 1RGLA 4MMXB 2P38A 1B27A 3BNCA 1UDII 1NWWA 1YGEA 1IU7A 1AQZA 1OGZA 1JZOA 3GRDA 1BNJA 1BSCA 2GU1A 4HZBB 3FG3A 3SOYA 1TIJA 4N6MA 4EV5A 3DZLA 5CF2A 3SVAA 1W7CA 1MGRA 1MOLA 3A76A 1MWRA 2HOHA 1W6YA 1ULIB 2UUGC 1LNIA 1LOYA 1O7GB 4KFFA 4MMZB 2SARA 2Y74A 4WFOA 1RNBA 4Q53A 3AGOA 5IENA 1I2FA 3CC73 1Q814 1RHLA 3D5GA 1GSPA 1D6YA 5A0OB 1A67A 2R41A 3NM2A 3NV0B 1FUWA 3VGNA 2W2CA 1ZS7A 3CMA3 3X42A 3S29A 2ZL8A 4N6OB 1UCLA 1CQSA 3FG4A 2CKFB 1JJ22 2XFSA 5G2GA 2XEPA 3F8HA 5IG5A 3QRDA 3I563 1IQYA 3N9HA 1RGGA 1BRSA 4ZM8A 2F86B 3LTBA 2KF4A 4BL3A 2HMJB 3GZXB 1GY5A 3CC23 4EYCA 9RNTA 1OUNA 3EBTA 1WTHA 3ZG0A 4J8TA 3DGMA 2BO9B 2KXGA 1W6CA 2E2VA 2FNQA 1US1A 3FF0A 2INXA 1VQ73 2ML5A 4IIAA 1VQM3 3CNXA 3ER7A 5STDA 4H3UA 3D79A 1V57A 1GMPA 1JKGA 4K61A 4N6V0 1AV4A 5HGRA 1LNHA 2CC3A 2V1LA 3SYUA 1MGWA 4HBRA 3V98A 1T3BA 4R1KA 3WMDA 3CC43 1VQN3 3LYGA 4G1MB 3BNBA 3MWZA 1T2IA 2HMNB 1Q7Y4 4LZIA 2L1SA 1RGFA 1Z1SA 4N3VA 4BTYA 3Q2PA 3N8BA 2UX0A 1GD4A 4K90B 2GXFA 1VQ93 1IV9A 1LOVA 1X1YA 4CCVA 2QEX3 2I9WA 1D6ZA 1GD3A 1A2PA 3ROBA 1YVSA 1JN5B 2HMMB 1G96A 3CPOA 2W9PA 2AAEA 1JZDA 3B4OA 1YHQ3 5KP4A 6STDA 1BRNL 3OWSA 4FMAA 3EB8A 1UUWB 5IEOA 1MNLA 2CK3H 3MG2A 4HM5B 4AKYA 1K734 2CWUA 1B20A 3EC9A 1GMRA 1U8CB 3H51A 3B4PA 1HKXA 3GZRA 2HMLB 3CCE3 4LEHA 1M904 3G8ZA 3NBRA 1M1K4 2BU4A 1JBRA 1GS3A 1R4YA 2OQEC 3V92A 1C7HA 1FGRA 5CK6A 4MJDA
chains in the Genus database with same CATH topology
4GB5A 2CWVA 2O9UX 1LVNA 1FGMA 2IMJA 3FGYA 1W6GA 3NHXA 3JUQA 2JQ5A 1OHSA 3F9SA 3NQZA 3LT9A 2CFKA 4HM8B 1N5HA 2D42A 1W00A 2Z6BA 1YVBI 2CFGA 3NQYA 4XDVA 4L7KA 1E3RA 3NBJA 1QAKA 1UI7A 2XR8B 4HM0B 2QGUA 3G6E3 1WQLB 2W03A 3G713 4FR9A 3MG1A 3SLUA 4K1VA 1KD14 2OCTA 2OQEA 2OTL3 1S723 4WWUC 1ISKA 1IVUA 2W6JH 1N9EA 4WP5A 3SOAA 5CF1A 3K63A 2YFIB 2BMQB 1AR0A 4J9AA 3FF2A 3K7CA 1O7HB 1U5OA 5IG4A 3M8CA 3FSDA 1GYBA 2CIUA 3GWRA 4HM2B 3PGBA 5JPUA 2FGTA 3L0RA 5ELJA 3CCQ3 4U13A 5BVBA 2C10A 4LSOA 3FCSB 3U97A 2Y73A 1W2B2 4XBXA 3EN1B 5IEPA 3SX1A 3S28A 3FZWA 3RDEA 3JUOA 3I0YA 2OOVC 4HVNA 3WODG 5AI1A 1TFKA 4RBNA 4WHAA 1VQ53 2B24B 4FMDA 2XGLA 1LXEA 1ROAA 1OHPA 2P09A 1VQ43 4RNZA 2CH9A 2FXTA 2JDIH 3OV4A 3OX9A 2PZVA 2C11A 1OGXA 2E2TA 3BB9A 3EQQB 5IG0A 1M9GA 4RZMA 2XSHB 4I4KA 4EV2A 1UUVB 2SBLA 1FGQA 1VQO3 4IPBA 4R9LA 1TUHA 2Q07A 3MKIA 3NX0A 1NO3A 1N5PA 3JUMA 1W5ZA 3OWUA 3PXMA 3KE7A 3I553 3EF8A 2P05A 4N6UA 1EG9B 5FGOA 4XB5A 1ZX2A 2P0XA 2HMKB 1ULJB 4HKVB 4TX4A 3AMOA 1IDPA 1ROVA 1NDOB 3KFQC 3MYTA 2BT3A 3UB1A 3CME3 2CG1A 3LOYA 3RGRA 3CXC2 1OPYA 3RGAA 5IERA 3DY5A 2CG0A 1YJW3 2GEXA 5D82A 5JPPA 3K9MC 1IVVA 1Q824 1FGTA 3G16A 2RSXA 5AYSC 3G0KA 2ZDJA 3Q1CA 4R80A 3UL6A 1GY6A 3NBBA 3D3LA 3F7SA 2W0QA 5KP3A 1T5YA 2OTJ3 3DUKA 3JVCA 3KZTA 4R4KA 1K9M4 2QIYA 1FGOA 1WMNA 2KRTA 8CHOA 3EJVA 4N6TA 1N9JA 2BMOB 2WO0A 1RRLA 3QK9A 1K41A 1KWIA 1ASKA 5I97A 3N54B 2QA43 3IJEB 2GU3A 2K54A 1SJWA 2RFRA 3UNLA 3CCL3 1CYUA 2P0MA 1NJI4 3E99A 1RJOA 1VQ63 1IT7A 1DMQA 3CCV3 1STDA 3LXUX 3OXAA 3PCRA 7STDA 3CCR3 1J2BA 1D6UA 4L8PA 1V74A 4FMBA 1YI23 3PS8A 3EHCA 4HJLB 1YJN3 1TP6A 1Q40B 1IVXA 3BLZA 1TFOA 4HM6B 4KFEA 4HM3B 1DMNA 4JRFA 1E3VA 5CXOA 5AEWB 3TDGA 2WGOA 4LMIA 2MC8A 2IUKA 3SXXA 3FLJA 4AKZA 3LTCA 3X41A 3X3YA 4ORLA 3FH1A 3S67A 4HM7B 3LH4A 4PEJA 1FA3A 4WYKA 3B8LA 3MHEA 4EXRA 3UL5A 3T8UA 1JB5A 5CLKA 3STDA 3WA3A 4FCZA 1F8NA 1AVKA 1SIHA 2L4VA 2LQVA 4MEIA 4X2HA 1K8A4 4XDWA 4OVMA 1IK3A 4HYZA 1CEWI 1QALA 4OUQA 1KQS2 3PYJA 3EE1A 3GAXA 2B1XB 1JB2A 3LT8A 1OHOA 4KZ1A 1O7PB 1NB3I 3B7CA 3X3ZA 4NHFA 2OWPA 1OACA 1VQL3 4XBYA 1QJGA 2YFJB 4R9KA 3ECFA 3HIGA 3V99A 2CHCA 3AMOB 4FCMA 1UW1A 4O3VA 2Z77A 3H3HA 1E97A 4MMYB 3IMAB 3GZYB 1BUQA 1JNQA 4FMCA 2XRXB 1QVF2 2YFLB 2CW9A 1NU3A 1O7MB 4QWTA 4HM1B 3LTAA 3JUNA 4AEQA 1N8R4 3MG3A 5JBSA 3PZWA 2D1WA 1VQ83 2CFDA 1SIIA 1W02A 3CCU3 1CYVA 1S5AA 2R4IA 4KFDA 3CD63 1A2VA 1JKGB 3MSOA 3PCSA 3MPHA 3WDGB 3G4S3 3NM7A 1NB5I 1YIT3 5D83A 1WMOA 1RN7A 3CNMA 5KP1A 2XF3A 2XH9A 5D81A 3CU3A 1Q864 3EBYA 2HMOB 1WMPA 3HIIA 3CCM3 2A15A 1A2KA 2RGQA 4XM4A 1UI8A 2WOHA 3NV0A 4O02B 1O7NB 2F99A 3FKAA 3DMCA 2E2UA 1IT8A 3HK4A 4STDA 1ZO2A 4K1UA 2BHMA 5AIIA 2IUJA 5BXQA 1JN5A 1DYUA 3LZAA 3ALAA 3IPTA 1OCVA 3T0UA 1DVDA 1IQXA 1M1XB 5AIGA 4GL6A 4N6NB 1OH0A 2MF7A 5EEOA 3SEDA 4HZ9B 1JV2B 1DVCA 1W4NA 3K0ZA 3X3XA 3KIIA 3NXJA 1OF5B 2W56B 4O2HA 3WOEB 1A90A 1O7WB 2OOVA 4EBGA 1JRQA 1JB4A 1Y4KA 3WA2X 2IA7A 3KN4A 1DMMA 3S5CA 3EX9A 5AIFA 3OW22 3GZBA 3KSPA 3T8NA 1M904 3DM8A 3VF1A 3NUVA 2W9QA 5AEUB 1GY7A 3U1WA 3VSYA 5EVHA 2CWTA 1N8QA 3S27A 2LYXA 1LOXA 3HX8A 1YJ93 2GBWB 1VQP3 1SQWA 2GEYA 2K0MA 3F14A 3F40A 1IV7A 3DGLA 1Q42A 3OWYA 5FW5A 5IG3A 2WGQA 3DGOA 3LMLA 1VZZA 5TGNA 2W04A 3UJMA 3FG1A 1KSIA 2XFTA 3HI7A 1TU5A 4O8SA 2Z7AA 4FCJA 4OK0A 1HU9A 3DGNA 2CFWA 4H61A 3BNDA 3LTDA 1IQ8A 3DXOA 2PNCA 1EA2A 2CFLA 5IF6A 1AVLA 5LC7A 4IT7A 2XGNA 1EQKA 3O8YA 1QVG2 2BNGA 4WYKB 4L8OA 3D9RA 3Q90A 3J7Yd 1OF5A 2W56A 1STFI 1RKYA 3CPW2 4KVHA 4JF8A 3CCS3 1W2ZA 3KSED 2F98A 2RCDA 5AYRB 1IVWA 2KCDA 2WOFA 3WOFB 1QAFA 4CDLA 4XBTA 3CCJ3 1QMAA 1EKMA 1R4CA 2GBXB 3K5TA 4X2OA 4EC6A 3HZPA 5DRVA 4N6LA 4BTXA 3KKGA 3F7XA 1SPUA 2M7OA 5DREA 4NREA 1PFPA 1RRHA 1L5GB 3BNEA 1Q40A 3F8XA 2Z76A 4HM4B 3EN8A 1W01A 2YX9A 5IW9A 2STDA 1KC84 2XSOB 1K28A 5ELUA 5AIHA 2O3OA 3JUPA 3X40A 4RNYA 2BMRB 4LGQA 5LC6A 5EQLA 1WNHA 1VQK3 1YIJ3 2ML6A 4MMXB 2P38A 3BNCA 1NWWA 1YGEA 1IU7A 1OGZA 3GRDA 4HZBB 2GU1A 3FG3A 3SOYA 1TIJA 4N6MA 4EV5A 3DZLA 5CF2A 3SVAA 1W7CA 1MOLA 3A76A 1ULIB 1W6YA 1O7GB 4KFFA 4MMZB 2Y74A 4WFOA 4Q53A 5IENA 3CC73 1Q814 1D6YA 5A0OB 1A67A 3NM2A 3NV0B 1FUWA 3VGNA 2W2CA 3CMA3 3X42A 3S29A 2ZL8A 4N6OB 1CQSA 3FG4A 2CKFB 1JJ22 2XFSA 5G2GA 2XEPA 3F8HA 5IG5A 3QRDA 3I563 1IQYA 3N9HA 4ZM8A 2F86B 3LTBA 2HMJB 3GZXB 1GY5A 3CC23 4EYCA 1OUNA 3EBTA 1WTHA 4J8TA 3DGMA 2BO9B 2KXGA 1W6CA 2E2VA 2FNQA 1US1A 3FF0A 2INXA 1VQ73 2ML5A 4IIAA 1VQM3 3CNXA 3ER7A 5STDA 4H3UA 4N6V0 1JKGA 4K61A 5HGRA 1AV4A 4BTWA 1LNHA 2CC3A 2V1LA 3V98A 3WMDA 4HBRA 1PU4A 4R1KA 3CC43 1VQN3 3LYGA 4G1MB 3BNBA 3MWZA 2HMNB 1Q7Y4 4LZIA 1Z1SA 4N3VA 4BTYA 3Q2PA 3N8BA 2UX0A 1GD4A 4K90B 2GXFA 1VQ93 1IV9A 4CCVA 2QEX3 2I9WA 1D6ZA 1GD3A 3ROBA 1JN5B 2HMMB 1G96A 3CPOA 2W9PA 3B4OA 1YHQ3 5KP4A 6STDA 3OWSA 4FMAA 3EB8A 1UUWB 5IEOA 1MNLA 2CK3H 3MG2A 4HM5B 4AKYA 1K734 2CWUA 3EC9A 1U8CB 3H51A 3B4PA 1HKXA 3GZRA 2HMLB 3CCE3 4LEHA 3G8ZA 3NBRA 1M1K4 1GS3A 2OQEC 3V92A 1C7HA 1FGRA 5CK6A 4MJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY6 A;  4GB5 A;  1W01 A;  3CNM A;  3F7S A;  2IMJ A;  3FGY A;  2STD A;  3NHX A;  5KP3 A;  5D81 A;  5KP1 A;  2XSO B;  3JUQ A;  3CU3 A;  3DUK A;  2JQ5 A;  3EBY A;  1OHS A;  2HMO B;  3F9S A;  3KZT A;  5AIH A;  5IG4 A;  2A15 A;  1A2K A;  2RGQ A;  2QIY A;  3JUP A;  3NV0 A;  2BMR B;  4HM8 B;  4LGQ A;  1O7N B;  2F99 A;  3FKA A;  1W00 A;  8CHO A;  3EJV A;  4XDV A;  4L7K A;  3DMC A;  1E3R A;  2BMO B;  3HK4 A;  4STD A;  1ZO2 A;  4K1U A;  5AII A;  1K41 A;  5BXQ A;  1ASK A;  1JN5 A;  3LZA A;  1NWW A;  3IPT A;  1OCV A;  2XR8 B;  1OGZ A;  4HM0 B;  2QGU A;  2K54 A;  1WQL B;  3GRD A;  1SJW A;  2RFR A;  4HZB B;  5AIG A;  3UNL A;  3SOY A;  3MG1 A;  1OH0 A;  4K1V A;  4MJD A;  3SED A;  3E99 A;  4HZ9 B;  3DZL A;  3K0Z A;  5CF2 A;  1DMQ A;  4WWU C;  1ISK A;  3NXJ A;  3A76 A;  1STD A;  1OF5 B;  3OXA A;  1ULI B;  1W6Y A;  4WP5 A;  3SOA A;  1O7G B;  5CF1 A;  4L8P A;  7STD A;  2YFI B;  1O7W B;  3EHC A;  4Q53 A;  4HJL B;  5IEN A;  1TP6 A;  2BMQ B;  1AR0 A;  1Q40 B;  3BLZ A;  4HM6 B;  4J9A A;  3FF2 A;  1JB4 A;  1DMN A;  1O7H B;  1E3V A;  1U5O A;  3K7C A;  4HM3 B;  3M8C A;  5CXO A;  3FSD A;  1GYB A;  1DMM A;  3GWR A;  3EX9 A;  4HM2 B;  4LMI A;  5AIF A;  3S5C A;  3NM2 A;  3NV0 B;  5JPU A;  3GZB A;  3VGN A;  2W2C A;  3KSP A;  3T8N A;  3DM8 A;  3NUV A;  3FLJ A;  5AEU B;  4U13 A;  1GY7 A;  3VSY A;  5EVH A;  5BVB A;  1CQS A;  2CKF B;  5G2G A;  4ORL A;  3F8H A;  5IG5 A;  3FH1 A;  3HX8 A;  4HM7 B;  2GBW B;  2GEY A;  2F86 B;  4PEJ A;  4XBX A;  3F14 A;  3EN1 B;  3F40 A;  4WYK A;  5IEP A;  5IG3 A;  1Q42 A;  2HMJ B;  3B8L A;  3FZW A;  3GZX B;  3OWY A;  1GY5 A;  3JUO A;  3MHE A;  5FW5 A;  3I0Y A;  1OUN A;  3T8U A;  1JB5 A;  3EBT A;  4HVN A;  4J8T A;  5CLK A;  5AI1 A;  1VZZ A;  3STD A;  5TGN A;  2B24 B;  3FF0 A;  3UJM A;  2INX A;  4X2H A;  4XDW A;  1OHP A;  4IIA A;  4OVM A;  2Z7A A;  3CNX A;  3ER7 A;  5STD A;  4H3U A;  4FCJ A;  3OV4 A;  3OX9 A;  1JKG A;  2PZV A;  5HGR A;  1OGX A;  3BB9 A;  3EQQ B;  4OUQ A;  5IG0 A;  3WMD A;  4RZM A;  2B1X B;  4R1K A;  1JB2 A;  2XSH B;  4I4K A;  3LYG A;  1OHO A;  1UUV B;  2HMN B;  1O7P B;  3B7C A;  1Z1S A;  3DXO A;  2OWP A;  1EA2 A;  1TUH A;  4N3V A;  4R9L A;  3MKI A;  4XBY A;  5IF6 A;  1QJG A;  2YFJ B;  2UX0 A;  3ECF A;  4R9K A;  2GXF A;  2CHC A;  4FCM A;  3JUM A;  3OWU A;  2Z77 A;  3KE7 A;  3H3H A;  2BNG A;  3EF8 A;  1E97 A;  4WYK B;  2I9W A;  4L8O A;  3D9R A;  3Q90 A;  3GZY B;  1EG9 B;  3ROB A;  4HM4 B;  1BUQ A;  1OF5 A;  4XB5 A;  1JN5 B;  1ZX2 A;  2HMM B;  4KVH A;  2XRX B;  2HMK B;  1ULJ B;  2YFL B;  3CPO A;  1NU3 A;  1O7M B;  4HKV B;  1IDP A;  2F98 A;  2RCD A;  1NDO B;  4HM1 B;  3MYT A;  3JUN A;  4CDL A;  3B4O A;  3RGR A;  3MG3 A;  5KP4 A;  6STD A;  4XBT A;  1OPY A;  1QMA A;  2GBX B;  3OWS A;  4X2O A;  3RGA A;  5IEO A;  1UUW B;  5IER A;  1W02 A;  3HZP A;  3MG2 A;  4HM5 B;  5DRV A;  5AEW B;  4XM4 A;  1S5A A;  2GEX A;  2R4I A;  3F7X A;  3KKG A;  3EC9 A;  5D82 A;  5JPP A;  5DRE A;  3G16 A;  3H51 A;  3B4P A;  1HKX A;  3GZR A;  2HML B;  1JKG B;  4LEH A;  3G8Z A;  3MSO A;  1Q40 A;  3F8X A;  3NBR A;  3G0K A;  1GS3 A;  2Z76 A;  1C7H A;  5CK6 A;  3EN8 A;  5D83 A; 
#chains in the Genus database with same CATH topology
 4GB5 A;  2CWV A;  2O9U X;  1LVN A;  1FGM A;  2IMJ A;  3FGY A;  1W6G A;  3DH2 A;  3NHX A;  5G1L A;  2ZA4 A;  5M1A A;  2J8X B;  3JUQ A;  4KT3 B;  2JQ5 A;  1JBS A;  1OHS A;  3F9S A;  3NQZ A;  1BAO A;  1FZU A;  3LT9 A;  2CFK A;  4HM8 B;  1N5H A;  2D42 A;  1W00 A;  2Z6B A;  1T2H A;  1YVB I;  2CFG A;  3NQY A;  4XDV A;  4L7K A;  3HOH A;  1E3R A;  1GOU A;  8RNT A;  5BU4 A;  3NBJ A;  1QAK A;  1BIR A;  1UI7 A;  2XR8 B;  4HM0 B;  2QGU A;  3G6E 3;  1RN4 A;  1WQL B;  2W03 A;  4BTW A;  3G71 3;  4FR9 A;  1G02 A;  3MG1 A;  3SLU A;  1RGE A;  4K1V A;  1KD1 4;  2OCT A;  3AHS A;  2OQE A;  1S72 3;  1BRH A;  2OTL 3;  4WWU C;  1FUS A;  1ISK A;  1IVU A;  2W6J H;  1BNI A;  1N9E A;  4WP5 A;  3SOA A;  5CF1 A;  1X1W A;  3K63 A;  2YFI B;  2BMQ B;  1AR0 A;  4J9A A;  3FF2 A;  3K7C A;  1O7H B;  1U5O A;  5IG4 A;  2KF5 A;  2RBI A;  3FSD A;  1GYB A;  2CIU A;  3GWR A;  3M8C A;  4HM2 B;  1RGK A;  3PGB A;  1JBT A;  5JPU A;  2FGT A;  1C54 A;  1BAN A;  1GOV A;  1UGI A;  3L0R A;  5ELJ A;  3CCQ 3;  4U13 A;  2F5W A;  1RGA A;  2KF3 A;  5BVB A;  3ZG5 A;  5M18 A;  2C10 A;  4LSO A;  3FCS B;  1BVI A;  3U97 A;  2Y73 A;  1W2B 2;  4XBX A;  3EN1 B;  4GHO A;  1BRK A;  3SX1 A;  6GSP A;  5IEP A;  3S28 A;  3FZW A;  1BRJ A;  3RDE A;  3JUO A;  3I0Y A;  2OOV C;  4HVN A;  3WOD G;  5AI1 A;  1HYF A;  1CH0 A;  1TFK A;  4RBN A;  4WHA A;  1VQ5 3;  1RGC A;  2B24 B;  4FMD A;  2XGL A;  1LXE A;  1B2M A;  1ROA A;  1OHP A;  2P09 A;  1VQ4 3;  4RNZ A;  2CH9 A;  2FXT A;  2JDI H;  2ZHX B;  3OV4 A;  3OX9 A;  2PZV A;  2C11 A;  1OGX A;  2E2T A;  3BB9 A;  3EQQ B;  4NPB A;  5IG0 A;  1M9G A;  4RZM A;  2XSH B;  4I4K A;  4EV2 A;  1UUV B;  2SBL A;  3A5E A;  1FGQ A;  1VQO 3;  4IPB A;  4R9L A;  1TUH A;  2Q07 A;  4GSP A;  3MKI A;  3NX0 A;  1NO3 A;  1N5P A;  3JUM A;  1W5Z A;  3OWU A;  3PXM A;  3KE7 A;  3I55 3;  3EF8 A;  2P05 A;  4N6U A;  1BRG A;  1EG9 B;  5FGO A;  4XB5 A;  1LRA A;  1ZX2 A;  1UCK A;  2P0X A;  2HMK B;  1ULJ B;  4HKV B;  4HAA A;  4TX4 A;  3AMO A;  1IDP A;  1ROV A;  1AY7 A;  1NDO B;  3KFQ C;  3MYT A;  2BT3 A;  3UB1 A;  3CME 3;  2CG1 A;  3LOY A;  3RGR A;  3CXC 2;  1UUG B;  1OPY A;  3RGA A;  5IER A;  4CJN A;  3DY5 A;  2CG0 A;  3URP A;  3KCH A;  1YJW 3;  2IY2 A;  2GEX A;  5D82 A;  3D4A A;  5JPP A;  3K9M C;  1IVV A;  1Q82 4;  1FGT A;  3G16 A;  1I3F A;  2GSP A;  2K3D A;  1RCL A;  2RSX A;  5AYS C;  1RN1 A;  3G0K A;  2ZDJ A;  3Q1C A;  4R80 A;  3UL6 A;  1GY6 A;  3NBB A;  3D3L A;  3F7S A;  1I0V A;  2W0Q A;  2F56 A;  5KP3 A;  1T5Y A;  1VQQ A;  2CX0 A;  4J5K A;  2OTJ 3;  5M19 A;  2KF6 A;  3DUK A;  3JVC A;  3KZT A;  4R4K A;  1X1U A;  1K9M 4;  2QIY A;  1FGO A;  1WMN A;  2KRT A;  8CHO A;  1UGH I;  3EJV A;  4N6T A;  3AHW A;  3ZFZ A;  1N9J A;  2BMO B;  2WO0 A;  1RRL A;  3QK9 A;  1K41 A;  1KWI A;  1ASK A;  1BRI A;  1BSD A;  1YGW A;  3N54 B;  5I97 A;  2QA4 3;  3IJE B;  1B3S A;  1TRP A;  2GU3 A;  2K54 A;  1SJW A;  2RFR A;  3UNL A;  3CCL 3;  1CYU A;  2P0M A;  1NJI 4;  3E99 A;  1RJO A;  1VQ6 3;  1IT7 A;  1DMQ A;  3CCV 3;  1YNV X;  1STD A;  3LXU X;  3OXA A;  3PCR A;  2C4B A;  7STD A;  3CCR 3;  1J2B A;  1B21 A;  1D6U A;  4L8P A;  1V74 A;  4FMB A;  1YI2 3;  3PS8 A;  3EHC A;  4HJL B;  1YJN 3;  1TP6 A;  1Q40 B;  1IVX A;  3BLZ A;  1LQM B;  1TFO A;  4HM6 B;  4HM3 B;  1DMN A;  4JRF A;  1E3V A;  5CXO A;  5AEW B;  3TDG A;  2WGO A;  4LMI A;  1RGH A;  2MC8 A;  2IUK A;  3SXX A;  1BNF A;  3FLJ A;  1BOX A;  4AKZ A;  3LTC A;  5BIR A;  3X41 A;  4I5Q A;  3X3Y A;  4ORL A;  3FH1 A;  3S67 A;  4HM7 B;  2RNT A;  3LH4 A;  4PEJ A;  1FA3 A;  4WYK A;  3B8L A;  3MHE A;  4EXR A;  3UL5 A;  1EUI C;  3T8U A;  1JB5 A;  1UCJ A;  5CLK A;  3STD A;  1FW7 A;  3WA3 A;  4FCZ A;  1BNR A;  1F8N A;  1AVK A;  1SIH A;  1LQG C;  2L4V A;  2LQV A;  4MEI A;  4X2H A;  1K8A 4;  4XDW A;  1LOW A;  4OVM A;  1IK3 A;  4HYZ A;  1CEW I;  1TRQ A;  1B2U A;  1QAL A;  4OUQ A;  1KQS 2;  3PYJ A;  3EE1 A;  3GAX A;  2B1X B;  7GSP A;  1JB2 A;  3DGY A;  3LT8 A;  1OHO A;  4KZ1 A;  1O7P B;  1NB3 I;  3B7C A;  3X3Z A;  1RLS A;  4NHF A;  2OWP A;  1OAC A;  2H0G A;  4XBY A;  1BNG A;  1VQL 3;  1QJG A;  2YFJ B;  4R9K A;  3ECF A;  3HIG A;  3V99 A;  2CHC A;  3AMO B;  4FCM A;  1UW1 A;  4O3V A;  2Z77 A;  3H3H A;  1E97 A;  4MMY B;  3AGN A;  3IMA B;  2F5M A;  3GZY B;  1BUQ A;  1I70 A;  1JNQ A;  4RNT A;  3Q3F A;  2XRX B;  4FMC A;  1QVF 2;  2YFL B;  2CW9 A;  1NU3 A;  1O7M B;  4QWT A;  4HM1 B;  3LTA A;  3JUN A;  4EW5 A;  4AEQ A;  1N8R 4;  3MG3 A;  5JBS A;  3PZW A;  4BU4 A;  2D1W A;  1VQ8 3;  2CFD A;  1SII A;  1I8V A;  1W02 A;  3CCU 3;  1CYV A;  1V58 A;  4DKI A;  1S5A A;  2R4I A;  4KFD A;  1I2E A;  3CD6 3;  1DE3 A;  1A2V A;  1I3I A;  1JKG B;  2BIR A;  1TJD A;  3MSO A;  3PCS A;  4LYL B;  3MPH A;  3WDG B;  3G4S 3;  3NM7 A;  1NB5 I;  1RTU A;  1YIT 3;  2UGI A;  5D83 A;  1WMO A;  1RN7 A;  3CNM A;  5KP1 A;  1PY3 A;  2XF3 A;  2XH9 A;  5D81 A;  3CU3 A;  3WR2 A;  3EBY A;  2HMO B;  1WMP A;  3HII A;  1Q86 4;  3CCM 3;  2A15 A;  1A2K A;  2RGQ A;  4XM4 A;  1UI8 A;  2WOH A;  3NV0 A;  4O02 B;  1O7N B;  2F99 A;  3FKA A;  1TTO A;  3BU4 A;  4BIR A;  3DMC A;  2E2U A;  1IT8 A;  3HK4 A;  4STD A;  1ZO2 A;  4K1U A;  2BHM A;  5AII A;  2IUJ A;  1NNV A;  1JN5 A;  1DYU A;  5BXQ A;  3LZA A;  3ALA A;  3IPT A;  1OCV A;  3T0U A;  2AAD A;  1DVD A;  1IQX A;  1M1X B;  1IYY A;  1DET A;  1RCK A;  1SAR A;  4GL6 A;  4N6N B;  5AIG A;  1OH0 A;  2MF7 A;  5EEO A;  3SED A;  1RSN A;  4HZ9 B;  1JV2 B;  1DVC A;  1W4N A;  3K0Z A;  3X3X A;  5HOH A;  3KII A;  3NXJ A;  1OF5 B;  2W56 B;  4O2H A;  3WOE B;  1RMS A;  1O7W B;  1A90 A;  1I2G A;  2OOV A;  4EBG A;  1JRQ A;  1JB4 A;  1Y4K A;  3WA2 X;  2IA7 A;  3KN4 A;  1DMM A;  4ILF A;  3EX9 A;  4KFE A;  5AIF A;  3S5C A;  1FYS A;  3OW2 2;  1B2X A;  3GZB A;  1BSA A;  2IYJ A;  3KSP A;  3T8N A;  3DM8 A;  3VF1 A;  3NUV A;  1GMQ A;  1RNT A;  1B2S A;  2W9Q A;  5AEU B;  1GY7 A;  3U1W A;  3VSY A;  5EVH A;  3WHO A;  2CWT A;  1N8Q A;  3S27 A;  2LYX A;  1LOX A;  3HX8 A;  1YJ9 3;  1G0T A;  2GBW B;  1VQP 3;  1SQW A;  2GEY A;  2K0M A;  3F14 A;  3F40 A;  1IV7 A;  3DGL A;  1Q42 A;  3OWY A;  5FW5 A;  5IG3 A;  1RDS A;  2WGQ A;  3DGO A;  3LML A;  7RNT A;  1VZZ A;  5TGN A;  2W04 A;  3UJM A;  3FG1 A;  4J5G A;  2F4Y A;  1BU4 A;  1KSI A;  1BSB A;  2XFT A;  3HI7 A;  1TU5 A;  1Q7H A;  6RNT A;  4O8S A;  2Z7A A;  4FCJ A;  1MWT A;  4OK0 A;  3D5I A;  1BUJ A;  1HU9 A;  3DGN A;  2CFW A;  1MWS A;  4H61 A;  3BND A;  5GSP A;  3LTD A;  1IQ8 A;  1UCI A;  2PNC A;  1EA2 A;  2CFL A;  3DXO A;  5IF6 A;  1AVL A;  5LC7 A;  4IT7 A;  2XGN A;  1EQK A;  3O8Y A;  1QVG 2;  1FUT A;  2BNG A;  4WYK B;  1BNE A;  3BIR A;  3D9R A;  3Q90 A;  4L8O A;  1EEJ A;  3GSP A;  5G1K A;  1OF5 A;  2W56 A;  1STF I;  1RKY A;  4BL2 A;  3J7Y d;  1I0X A;  4KVH A;  4JF8 A;  3CPW 2;  3CCS 3;  1BGS A;  1W2Z A;  2F98 A;  2RCD A;  3KSE D;  5AYR B;  1IVW A;  2H0H A;  2KCD A;  2WOF A;  3WOF B;  1QAF A;  4CDL A;  4CPK A;  4XBT A;  3CCJ 3;  1QMA A;  1EKM A;  1R4C A;  2GBX B;  3K5T A;  4X2O A;  4EC6 A;  3HZP A;  5DRV A;  4N6L A;  4BTX A;  5RNT A;  3KKG A;  3F7X A;  1SPU A;  2M7O A;  5DRE A;  4NRE A;  1PFP A;  1RRH A;  1Q9E A;  1L5G B;  3BNE A;  1Q40 A;  3F8X A;  1PU4 A;  2Z76 A;  4HM4 B;  3EN8 A;  1HZ1 A;  4HOH A;  1W01 A;  2YX9 A;  1MWU A;  2H0I A;  5IW9 A;  2STD A;  1KC8 4;  2XSO B;  1B2Z A;  1BNS A;  1K28 A;  5ELU A;  5AIH A;  3RNT A;  1PYL A;  1X1X A;  2O3O A;  1GOY A;  1ZGX A;  3JUP A;  2BMR B;  4LGQ A;  4RNY A;  3X40 A;  5LC6 A;  2KAA A;  1BSE A;  5EQL A;  1WNH A;  1VQK 3;  2CX1 A;  1YIJ 3;  2ML6 A;  1RGL A;  4MMX B;  2P38 A;  1B27 A;  3BNC A;  1UDI I;  1NWW A;  1YGE A;  1IU7 A;  1AQZ A;  1OGZ A;  1JZO A;  3GRD A;  1BNJ A;  1BSC A;  2GU1 A;  4HZB B;  3FG3 A;  3SOY A;  1TIJ A;  4N6M A;  4EV5 A;  3DZL A;  5CF2 A;  3SVA A;  1W7C A;  1MGR A;  1MOL A;  3A76 A;  1MWR A;  2HOH A;  1W6Y A;  1ULI B;  2UUG C;  1LNI A;  1LOY A;  1O7G B;  4KFF A;  4MMZ B;  2SAR A;  2Y74 A;  4WFO A;  1RNB A;  4Q53 A;  3AGO A;  5IEN A;  1I2F A;  3CC7 3;  1Q81 4;  1RHL A;  3D5G A;  1GSP A;  1D6Y A;  5A0O B;  1A67 A;  2R41 A;  3NM2 A;  3NV0 B;  1FUW A;  3VGN A;  2W2C A;  1ZS7 A;  3CMA 3;  3X42 A;  3S29 A;  2ZL8 A;  4N6O B;  1UCL A;  1CQS A;  3FG4 A;  2CKF B;  1JJ2 2;  2XFS A;  5G2G A;  2XEP A;  3F8H A;  5IG5 A;  3QRD A;  3I56 3;  1IQY A;  3N9H A;  1RGG A;  1BRS A;  4ZM8 A;  2F86 B;  3LTB A;  2KF4 A;  4BL3 A;  2HMJ B;  3GZX B;  1GY5 A;  3CC2 3;  4EYC A;  9RNT A;  1OUN A;  3EBT A;  1WTH A;  3ZG0 A;  4J8T A;  3DGM A;  2BO9 B;  2KXG A;  1W6C A;  2E2V A;  2FNQ A;  1US1 A;  3FF0 A;  2INX A;  1VQ7 3;  2ML5 A;  4IIA A;  1VQM 3;  3CNX A;  3ER7 A;  5STD A;  4H3U A;  3D79 A;  1V57 A;  1GMP A;  1JKG A;  4K61 A;  4N6V 0;  1AV4 A;  5HGR A;  1LNH A;  2CC3 A;  2V1L A;  3SYU A;  1MGW A;  4HBR A;  3V98 A;  1T3B A;  4R1K A;  3WMD A;  3CC4 3;  1VQN 3;  3LYG A;  4G1M B;  3BNB A;  3MWZ A;  1T2I A;  2HMN B;  1Q7Y 4;  4LZI A;  2L1S A;  1RGF A;  1Z1S A;  4N3V A;  4BTY A;  3Q2P A;  3N8B A;  2UX0 A;  1GD4 A;  4K90 B;  2GXF A;  1VQ9 3;  1IV9 A;  1LOV A;  1X1Y A;  4CCV A;  2QEX 3;  2I9W A;  1D6Z A;  1GD3 A;  1A2P A;  3ROB A;  1YVS A;  1JN5 B;  2HMM B;  1G96 A;  3CPO A;  2W9P A;  2AAE A;  1JZD A;  3B4O A;  1YHQ 3;  5KP4 A;  6STD A;  1BRN L;  3OWS A;  4FMA A;  3EB8 A;  1UUW B;  5IEO A;  1MNL A;  2CK3 H;  3MG2 A;  4HM5 B;  4AKY A;  1K73 4;  2CWU A;  1B20 A;  3EC9 A;  1GMR A;  1U8C B;  3H51 A;  3B4P A;  1HKX A;  3GZR A;  2HML B;  3CCE 3;  4LEH A;  1M90 4;  3G8Z A;  3NBR A;  1M1K 4;  2BU4 A;  1JBR A;  1GS3 A;  1R4Y A;  2OQE C;  3V92 A;  1C7H A;  1FGR A;  5CK6 A;  4MJD A; 
#chains in the Genus database with same CATH homology
 4GB5 A;  2CWV A;  2O9U X;  1LVN A;  1FGM A;  2IMJ A;  3FGY A;  1W6G A;  3NHX A;  3JUQ A;  2JQ5 A;  1OHS A;  3F9S A;  3NQZ A;  3LT9 A;  2CFK A;  4HM8 B;  1N5H A;  2D42 A;  1W00 A;  2Z6B A;  1YVB I;  2CFG A;  3NQY A;  4XDV A;  4L7K A;  1E3R A;  3NBJ A;  1QAK A;  1UI7 A;  2XR8 B;  4HM0 B;  2QGU A;  3G6E 3;  1WQL B;  2W03 A;  3G71 3;  4FR9 A;  3MG1 A;  3SLU A;  4K1V A;  1KD1 4;  2OCT A;  2OQE A;  2OTL 3;  1S72 3;  4WWU C;  1ISK A;  1IVU A;  2W6J H;  1N9E A;  4WP5 A;  3SOA A;  5CF1 A;  3K63 A;  2YFI B;  2BMQ B;  1AR0 A;  4J9A A;  3FF2 A;  3K7C A;  1O7H B;  1U5O A;  5IG4 A;  3M8C A;  3FSD A;  1GYB A;  2CIU A;  3GWR A;  4HM2 B;  3PGB A;  5JPU A;  2FGT A;  3L0R A;  5ELJ A;  3CCQ 3;  4U13 A;  5BVB A;  2C10 A;  4LSO A;  3FCS B;  3U97 A;  2Y73 A;  1W2B 2;  4XBX A;  3EN1 B;  5IEP A;  3SX1 A;  3S28 A;  3FZW A;  3RDE A;  3JUO A;  3I0Y A;  2OOV C;  4HVN A;  3WOD G;  5AI1 A;  1TFK A;  4RBN A;  4WHA A;  1VQ5 3;  2B24 B;  4FMD A;  2XGL A;  1LXE A;  1ROA A;  1OHP A;  2P09 A;  1VQ4 3;  4RNZ A;  2CH9 A;  2FXT A;  2JDI H;  3OV4 A;  3OX9 A;  2PZV A;  2C11 A;  1OGX A;  2E2T A;  3BB9 A;  3EQQ B;  5IG0 A;  1M9G A;  4RZM A;  2XSH B;  4I4K A;  4EV2 A;  1UUV B;  2SBL A;  1FGQ A;  1VQO 3;  4IPB A;  4R9L A;  1TUH A;  2Q07 A;  3MKI A;  3NX0 A;  1NO3 A;  1N5P A;  3JUM A;  1W5Z A;  3OWU A;  3PXM A;  3KE7 A;  3I55 3;  3EF8 A;  2P05 A;  4N6U A;  1EG9 B;  5FGO A;  4XB5 A;  1ZX2 A;  2P0X A;  2HMK B;  1ULJ B;  4HKV B;  4TX4 A;  3AMO A;  1IDP A;  1ROV A;  1NDO B;  3KFQ C;  3MYT A;  2BT3 A;  3UB1 A;  3CME 3;  2CG1 A;  3LOY A;  3RGR A;  3CXC 2;  1OPY A;  3RGA A;  5IER A;  3DY5 A;  2CG0 A;  1YJW 3;  2GEX A;  5D82 A;  5JPP A;  3K9M C;  1IVV A;  1Q82 4;  1FGT A;  3G16 A;  2RSX A;  5AYS C;  3G0K A;  2ZDJ A;  3Q1C A;  4R80 A;  3UL6 A;  1GY6 A;  3NBB A;  3D3L A;  3F7S A;  2W0Q A;  5KP3 A;  1T5Y A;  2OTJ 3;  3DUK A;  3JVC A;  3KZT A;  4R4K A;  1K9M 4;  2QIY A;  1FGO A;  1WMN A;  2KRT A;  8CHO A;  3EJV A;  4N6T A;  1N9J A;  2BMO B;  2WO0 A;  1RRL A;  3QK9 A;  1K41 A;  1KWI A;  1ASK A;  5I97 A;  3N54 B;  2QA4 3;  3IJE B;  2GU3 A;  2K54 A;  1SJW A;  2RFR A;  3UNL A;  3CCL 3;  1CYU A;  2P0M A;  1NJI 4;  3E99 A;  1RJO A;  1VQ6 3;  1IT7 A;  1DMQ A;  3CCV 3;  1STD A;  3LXU X;  3OXA A;  3PCR A;  7STD A;  3CCR 3;  1J2B A;  1D6U A;  4L8P A;  1V74 A;  4FMB A;  1YI2 3;  3PS8 A;  3EHC A;  4HJL B;  1YJN 3;  1TP6 A;  1Q40 B;  1IVX A;  3BLZ A;  1TFO A;  4HM6 B;  4KFE A;  4HM3 B;  1DMN A;  4JRF A;  1E3V A;  5CXO A;  5AEW B;  3TDG A;  2WGO A;  4LMI A;  2MC8 A;  2IUK A;  3SXX A;  3FLJ A;  4AKZ A;  3LTC A;  3X41 A;  3X3Y A;  4ORL A;  3FH1 A;  3S67 A;  4HM7 B;  3LH4 A;  4PEJ A;  1FA3 A;  4WYK A;  3B8L A;  3MHE A;  4EXR A;  3UL5 A;  3T8U A;  1JB5 A;  5CLK A;  3STD A;  3WA3 A;  4FCZ A;  1F8N A;  1AVK A;  1SIH A;  2L4V A;  2LQV A;  4MEI A;  4X2H A;  1K8A 4;  4XDW A;  4OVM A;  1IK3 A;  4HYZ A;  1CEW I;  1QAL A;  4OUQ A;  1KQS 2;  3PYJ A;  3EE1 A;  3GAX A;  2B1X B;  1JB2 A;  3LT8 A;  1OHO A;  4KZ1 A;  1O7P B;  1NB3 I;  3B7C A;  3X3Z A;  4NHF A;  2OWP A;  1OAC A;  1VQL 3;  4XBY A;  1QJG A;  2YFJ B;  4R9K A;  3ECF A;  3HIG A;  3V99 A;  2CHC A;  3AMO B;  4FCM A;  1UW1 A;  4O3V A;  2Z77 A;  3H3H A;  1E97 A;  4MMY B;  3IMA B;  3GZY B;  1BUQ A;  1JNQ A;  4FMC A;  2XRX B;  1QVF 2;  2YFL B;  2CW9 A;  1NU3 A;  1O7M B;  4QWT A;  4HM1 B;  3LTA A;  3JUN A;  4AEQ A;  1N8R 4;  3MG3 A;  5JBS A;  3PZW A;  2D1W A;  1VQ8 3;  2CFD A;  1SII A;  1W02 A;  3CCU 3;  1CYV A;  1S5A A;  2R4I A;  4KFD A;  3CD6 3;  1A2V A;  1JKG B;  3MSO A;  3PCS A;  3MPH A;  3WDG B;  3G4S 3;  3NM7 A;  1NB5 I;  1YIT 3;  5D83 A;  1WMO A;  1RN7 A;  3CNM A;  5KP1 A;  2XF3 A;  2XH9 A;  5D81 A;  3CU3 A;  1Q86 4;  3EBY A;  2HMO B;  1WMP A;  3HII A;  3CCM 3;  2A15 A;  1A2K A;  2RGQ A;  4XM4 A;  1UI8 A;  2WOH A;  3NV0 A;  4O02 B;  1O7N B;  2F99 A;  3FKA A;  3DMC A;  2E2U A;  1IT8 A;  3HK4 A;  4STD A;  1ZO2 A;  4K1U A;  2BHM A;  5AII A;  2IUJ A;  5BXQ A;  1JN5 A;  1DYU A;  3LZA A;  3ALA A;  3IPT A;  1OCV A;  3T0U A;  1DVD A;  1IQX A;  1M1X B;  5AIG A;  4GL6 A;  4N6N B;  1OH0 A;  2MF7 A;  5EEO A;  3SED A;  4HZ9 B;  1JV2 B;  1DVC A;  1W4N A;  3K0Z A;  3X3X A;  3KII A;  3NXJ A;  1OF5 B;  2W56 B;  4O2H A;  3WOE B;  1A90 A;  1O7W B;  2OOV A;  4EBG A;  1JRQ A;  1JB4 A;  1Y4K A;  3WA2 X;  2IA7 A;  3KN4 A;  1DMM A;  3S5C A;  3EX9 A;  5AIF A;  3OW2 2;  3GZB A;  3KSP A;  3T8N A;  1M90 4;  3DM8 A;  3VF1 A;  3NUV A;  2W9Q A;  5AEU B;  1GY7 A;  3U1W A;  3VSY A;  5EVH A;  2CWT A;  1N8Q A;  3S27 A;  2LYX A;  1LOX A;  3HX8 A;  1YJ9 3;  2GBW B;  1VQP 3;  1SQW A;  2GEY A;  2K0M A;  3F14 A;  3F40 A;  1IV7 A;  3DGL A;  1Q42 A;  3OWY A;  5FW5 A;  5IG3 A;  2WGQ A;  3DGO A;  3LML A;  1VZZ A;  5TGN A;  2W04 A;  3UJM A;  3FG1 A;  1KSI A;  2XFT A;  3HI7 A;  1TU5 A;  4O8S A;  2Z7A A;  4FCJ A;  4OK0 A;  1HU9 A;  3DGN A;  2CFW A;  4H61 A;  3BND A;  3LTD A;  1IQ8 A;  3DXO A;  2PNC A;  1EA2 A;  2CFL A;  5IF6 A;  1AVL A;  5LC7 A;  4IT7 A;  2XGN A;  1EQK A;  3O8Y A;  1QVG 2;  2BNG A;  4WYK B;  4L8O A;  3D9R A;  3Q90 A;  3J7Y d;  1OF5 A;  2W56 A;  1STF I;  1RKY A;  3CPW 2;  4KVH A;  4JF8 A;  3CCS 3;  1W2Z A;  3KSE D;  2F98 A;  2RCD A;  5AYR B;  1IVW A;  2KCD A;  2WOF A;  3WOF B;  1QAF A;  4CDL A;  4XBT A;  3CCJ 3;  1QMA A;  1EKM A;  1R4C A;  2GBX B;  3K5T A;  4X2O A;  4EC6 A;  3HZP A;  5DRV A;  4N6L A;  4BTX A;  3KKG A;  3F7X A;  1SPU A;  2M7O A;  5DRE A;  4NRE A;  1PFP A;  1RRH A;  1L5G B;  3BNE A;  1Q40 A;  3F8X A;  2Z76 A;  4HM4 B;  3EN8 A;  1W01 A;  2YX9 A;  5IW9 A;  2STD A;  1KC8 4;  2XSO B;  1K28 A;  5ELU A;  5AIH A;  2O3O A;  3JUP A;  3X40 A;  4RNY A;  2BMR B;  4LGQ A;  5LC6 A;  5EQL A;  1WNH A;  1VQK 3;  1YIJ 3;  2ML6 A;  4MMX B;  2P38 A;  3BNC A;  1NWW A;  1YGE A;  1IU7 A;  1OGZ A;  3GRD A;  4HZB B;  2GU1 A;  3FG3 A;  3SOY A;  1TIJ A;  4N6M A;  4EV5 A;  3DZL A;  5CF2 A;  3SVA A;  1W7C A;  1MOL A;  3A76 A;  1ULI B;  1W6Y A;  1O7G B;  4KFF A;  4MMZ B;  2Y74 A;  4WFO A;  4Q53 A;  5IEN A;  3CC7 3;  1Q81 4;  1D6Y A;  5A0O B;  1A67 A;  3NM2 A;  3NV0 B;  1FUW A;  3VGN A;  2W2C A;  3CMA 3;  3X42 A;  3S29 A;  2ZL8 A;  4N6O B;  1CQS A;  3FG4 A;  2CKF B;  1JJ2 2;  2XFS A;  5G2G A;  2XEP A;  3F8H A;  5IG5 A;  3QRD A;  3I56 3;  1IQY A;  3N9H A;  4ZM8 A;  2F86 B;  3LTB A;  2HMJ B;  3GZX B;  1GY5 A;  3CC2 3;  4EYC A;  1OUN A;  3EBT A;  1WTH A;  4J8T A;  3DGM A;  2BO9 B;  2KXG A;  1W6C A;  2E2V A;  2FNQ A;  1US1 A;  3FF0 A;  2INX A;  1VQ7 3;  2ML5 A;  4IIA A;  1VQM 3;  3CNX A;  3ER7 A;  5STD A;  4H3U A;  4N6V 0;  1JKG A;  4K61 A;  5HGR A;  1AV4 A;  4BTW A;  1LNH A;  2CC3 A;  2V1L A;  3V98 A;  3WMD A;  4HBR A;  1PU4 A;  4R1K A;  3CC4 3;  1VQN 3;  3LYG A;  4G1M B;  3BNB A;  3MWZ A;  2HMN B;  1Q7Y 4;  4LZI A;  1Z1S A;  4N3V A;  4BTY A;  3Q2P A;  3N8B A;  2UX0 A;  1GD4 A;  4K90 B;  2GXF A;  1VQ9 3;  1IV9 A;  4CCV A;  2QEX 3;  2I9W A;  1D6Z A;  1GD3 A;  3ROB A;  1JN5 B;  2HMM B;  1G96 A;  3CPO A;  2W9P A;  3B4O A;  1YHQ 3;  5KP4 A;  6STD A;  3OWS A;  4FMA A;  3EB8 A;  1UUW B;  5IEO A;  1MNL A;  2CK3 H;  3MG2 A;  4HM5 B;  4AKY A;  1K73 4;  2CWU A;  3EC9 A;  1U8C B;  3H51 A;  3B4P A;  1HKX A;  3GZR A;  2HML B;  3CCE 3;  4LEH A;  3G8Z A;  3NBR A;  1M1K 4;  1GS3 A;  2OQE C;  3V92 A;  1C7H A;  1FGR A;  5CK6 A;  4MJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...