3B7CA

Crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
MPTDDIVQLLKGQEEAWNRGDLDAYMQGYWQNEQLMLISNGKFRNGWDETLAAYKKNYPDKESLGELKFTIKEIKMLSNYAAMVVGRWDLKRLKDTPTGVFTLLVEKIDDRWVITMDHSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF-2 like protein of unknown function (NP_715767.1) from Shewanella oneidensis at 1.70 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b7cA00
3NM2A 2R4IA 3GWRA 4HM2B 1OF5A 3MSOA 4K1VA 5AIFA 2CKFB 4HM1B 1GY7A 3KE7A 2F86B 1SJWA 4HM4B 4FCJA 1E3RA 1QJGA 1OF5B 1Z1SA 3G16A 5CLKA 3VGNA 4U13A 1OCVA 1OUNA 3MG3A 3EJVA 3EBYA 4HM5B 3FLJA 4R1KA 5HGRA 5STDA 1GYBA 4XDVA 5CF2A 3CNMA 1C7HA 1UUVB 3CNXA 3EN1B 2BMOB 3MG2A 1DMNA 3UNLA 5BVBA 2RCDA 3Q90A 4J9AA 2K54A 1W00A 4HM8B 2QGUA 1TUHA 2XRXB 3A76A 4H3UA 5D82A 1OGXA 2HMKB 2GEXA 4HKVB 4Q53A 1UUWB 1HKXA 3MG1A 2YFJB 1DMQA 3OV4A 4PEJA 3F7XA 3HK4A 3M8CA 2PZVA 3KSPA 2GEYA 2B1XB 4LGQA 5AEWB 1U5OA 3KZTA 3F8XA 4WYKB 1AR0A 5DRVA 5IG4A 4RZMA 3MHEA 3K0ZA 5TGNA 3H51A 3ROBA 3G8ZA 2HMJB 5DREA 5CF1A 3CU3A 4LMIA 1GY6A 4XM4A 5IG0A 1JN5A 3SOAA 1IDPA 5JPUA 3B7CA 1GY5A 1OGZA 4X2HA 5FW5A 4MJDA 1JN5B 3D9RA 1Q42A 3EF8A 1ASKA 3HX8A 3LYGA 3NUVA 4OUQA 1OHOA 2JQ5A 3WMDA 1K41A 1O7PB 1NWWA 2BMRB 3GRDA 5G2GA 1O7NB 3OXAA 4WP5A 3NV0A 5IG3A 4I4KA 4R9KA 3DMCA 3T8NA 1S5AA 1VZZA 1TP6A 1OHSA 2I9WA 2YFLB 2Z77A 3EQQB 3GZRA 3IPTA 1O7MB 3KKGA 2QIYA 2XR8B 4HZBB 4L7KA 4N3VA 4XB5A 2INXA 5IEOA 3STDA 3T8UA 1ISKA 3F7SA 3DXOA 1ZX2A 3I0YA 3MKIA 3FGYA 4HM3B 5BXQA 1E3VA 2GXFA 3B4OA 4HJLB 5IEPA 1JB4A 1E97A 3JUOA 3F9SA 2BNGA 3JUQA 2OWPA 3OX9A 3NXJA 1JKGB 2STDA 3BLZA 3OWUA 1JB2A 3OWSA 3F40A 3B8LA 3FF0A 1GS3A 4XBYA 5D81A 7STDA 5IG5A 4IIAA 3VSYA 2HMMB 2Z76A 3FSDA 1WQLB 1DMMA 2RFRA 2UX0A 5CXOA 2CHCA 3GZXB 2B24B 3G0KA 5AIGA 5KP1A 4HVNA 3E99A 3DUKA 3CPOA 2F98A 3BB9A 4XBXA 3UJMA 3EHCA 3GZBA 4K1UA 5AI1A 2W2CA 1CQSA 1NDOB 3FKAA 3LZAA 1OH0A 4X2OA 1ULJB 3SOYA 2GBXB 5AEUB 2XSOB 1BUQA 2IMJA 5D83A 2BMQB 1A2KA 5EVHA 5IENA 5KP3A 4KVHA 4LEHA 1Q40B 4STDA 1ZO2A 2GBWB 1W6YA 3F8HA 4OVMA 3FH1A 3S5CA 3JUPA 3RGRA 2YFIB 4HZ9B 3RGAA 2A15A 2F99A 3H3HA 1W02A 3B4PA 3DM8A 2HMOB 3EBTA 5CK6A 4WWUC 6STDA 1NU3A 3NV0B 3FF2A 2RGQA 3NHXA 2Z7AA 2XSHB 3JUMA 3K7CA 4R9LA 1QMAA 4ORLA 4WYKA 3F14A 1JKGA 3JUNA 5AIIA 3MYTA 4L8PA 3SEDA 4HM7B 3GZYB 1EA2A 1Q40A 3HZPA 5AIHA 8CHOA 3EN8A 1O7HB 5JPPA 3EX9A 3ER7A 4HM0B 3ECFA 2HMNB 3DZLA 3EC9A 4FCMA 4XDWA 4CDLA 5IF6A 1O7GB 1OPYA 3OWYA 1EG9B 1OHPA 4XBTA 4GB5A 1STDA 3NBRA 4J8TA 5IERA 4L8OA 2HMLB 1JB5A 5KP4A 1W01A 4HM6B 1O7WB 3FZWA 1ULIB
chains in the Genus database with same CATH superfamily
1FUTA 1SIHA 2K3DA 4HM2B 1KSIA 1RGHA 2SBLA 1GMPA 1GY7A 3KE7A 4AKZA 4RNYA 3Q3FA 2F86B 2D1WA 2OQEA 1LRAA 4BTWA 1BRNL 2FNQA 4U13A 1OCVA 3NQYA 4N6MA 3FLJA 3LMLA 3PXMA 4R1KA 1JBSA 1SPUA 4EC6A 2W04A 2ML5A 5CF2A 1LOVA 1STFI 5EEOA 3BNCA 2K54A 4BIRA 1VQ93 4KFFA 1RGGA 1BGSA 5D82A 2XEPA 2CX1A 1YNVX 1N5PA 3PCRA 1HKXA 2YFJB 2HOHA 3OV4A 4OK0A 1GOUA 3QK9A 1UCJA 1AR0A 2IUKA 1M9GA 3K0ZA 7GSPA 3CCM3 4K61A 3G8ZA 3CC23 3CU3A 4TX4A 6GSPA 1YJ93 5IG0A 1T3BA 4BTXA 3EF8A 3LT8A 3HX8A 4GHOA 1NB3I 4N6V0 1HYFA 1N9JA 1Q7Y4 3WOFB 2RBIA 1PYLA 2RNTA 1MNLA 1NWWA 3GRDA 1O7NB 3OXAA 1QALA 1LOYA 1L5GB 4FMCA 9RNTA 3IMAB 3N54B 3CD63 2GU3A 2W9QA 3HIIA 3DMCA 8RNTA 1OHSA 5IF6A 2P0XA 3GZRA 3WA2X 5CXOA 1VQ63 3KKGA 1M1XB 1YGWA 4O3VA 1G02A 3GAXA 1TU5A 5RNTA 3LT9A 1JBTA 1IQYA 5BXQA 5IEPA 1D6UA 2H0GA 2XGNA 1CH0A 2GXFA 3NBBA 4HJLB 3F9SA 1UCKA 3S29A 1VQ73 1YGEA 2JDIH 3IJEB 3F40A 1GS3A 1BU4A 1YVSA 2CWUA 3LTAA 1VQO3 1I3IA 3VSYA 2HMMB 2Z76A 1BAOA 5AYRB 2O3OA 1G96A 1DMMA 1JBRA 1K9M4 2B24B 1D6ZA 1I2EA 3KFQC 1BNRA 4ILFA 3GZBA 5BU4A 1GOVA 1N5HA 3SOYA 5AEUB 2XSOB 1BUQA 1IT7A 1EQKA 1BRHA 1A2KA 1IQXA 2D42A 5A0OB 1F8NA 1Y4KA 1W6YA 3X41A 1BSEA 2M7OA 5LC7A 1DE3A 1IVVA 3RGRA 1PFPA 2YFIB 4HZ9B 5I97A 3I553 1W02A 3K63A 1VQL3 2E2VA 3NV0B 1QAFA 2Z7AA 4R4KA 4R9LA 1RRHA 3K7CA 1WMNA 4K90B 4WYKA 2W56A 1BRSA 3HI7A 5M18A 1JKGA 3JUNA 1RN7A 5AIIA 3NQZA 3MYTA 5AIHA 1EA2A 1VQQA 2ZA4A 1DYUA 1FGOA 3N9HA 4MEIA 3DGNA 5JPPA 4HM0B 1A2VA 3DZLA 1R4CA 3KN4A 1BNIA 1IU7A 1Q814 1DVCA 4GB5A 1WNHA 2CX0A 3NBRA 2HMLB 1JB5A 1W01A 3Q2PA 4HM6B 5ELUA 4MMYB 4O2HA 3DGLA 3KSED 4NREA 1OF5A 1JV2B 1UGIA 1W6GA 1B2ZA 2K0MA 3FG1A 3NX0A 3I563 1SJWA 1B2UA 2BO9B 2AAEA 1Z1SA 5CLKA 2KF6A 3G713 2O9UX 1AVKA 1BSBA 1RGFA 3X40A 4HBRA 1GYBA 3WHOA 1BVIA 1GD3A 1N9EA 1IYYA 2BHMA 3KCHA 2RCDA 3Q90A 1W00A 5IW9A 4HM8B 1YIJ3 2P38A 4N6UA 2Y73A 3NM7A 2XRXB 2WOFA 1FGTA 1ROAA 2GEXA 1UUWB 3UL6A 1NB5I 3F7XA 1T2IA 3HK4A 3M8CA 2GEYA 2GSPA 2PNCA 3DH2A 3AMOA 3O8YA 3CPW2 3F8XA 2CWTA 1SQWA 1V58A 1LQGC 2ZL8A 3AGOA 3QRDA 2KCDA 2HMJB 1LOXA 1MWUA 1RSNA 3PYJA 1T5YA 5CF1A 4LMIA 1BRJA 1GY6A 3AHWA 1IDPA 3D4AA 2MC8A 1GY5A 1I2GA 1NNVA 1LNHA 5JPUA 1JN5B 3D9RA 3DGMA 2OOVA 4DKIA 1B2MA 1W6CA 3FZWA 2JQ5A 1US1A 3D5IA 5G2GA 1K28A 3X3YA 1QAKA 4WFOA 5IG3A 1K734 3LTDA 4I4KA 3L0RA 1S5AA 5IENA 4HZBB 4L7KA 4XB5A 5IEOA 1B2XA 2QIYA 2XR8B 1BUJA 4JRFA 4IPBA 1LNIA 1AV4A 2YX9A 2BU4A 3F7SA 3LH4A 3DXOA 3D79A 4AEQA 3FGYA 1TRPA 3EB8A 2OWPA 1KWIA 3BLZA 3MWZA 1JB2A 1FW7A 1SIIA 2P09A 3B8LA 3FF0A 1I3FA 1S723 2OOVC 1UCLA 2CFLA 5IG5A 3FSDA 2F4YA 3LXUX 1RKYA 4LYLB 2WO0A 5KP1A 3GZXB 1GMRA 2L1SA 3E99A 4G1MB 3K5TA 3CPOA 4N6TA 1VQN3 4XBXA 1A67A 1NDOB 2CFDA 3FKAA 1C54A 3AHSA 4X2OA 1BNSA 3PCSA 1YVBI 2IMJA 5D83A 1VQ83 2CFGA 2C4BA 3CCL3 5FGOA 1KD14 2BT3A 4EXRA 2W03A 3F8HA 4OVMA 3JUPA 2BIRA 3GSPA 3HOHA 4MMXB 3BU4A 1IVWA 4O02B 3B4PA 2WGOA 2ML6A 2HMOB 3DM8A 5CK6A 1FA3A 1B2SA 2RSXA 3J7Yd 1W5ZA 1QVG2 1ZS7A 1BRIA 1RCLA 4L8PA 1B20A 3D3LA 3GZYB 3HZPA 4FCZA 3EN8A 4EW5A 3SYUA 4CDLA 2WOHA 4XDWA 2CW9A 1Q824 1EG9B 1OHPA 4AKYA 3LTBA 5JBSA 1STDA 3N8BA 1K8A4 1RMSA 1IV7A 2CFWA 3FG3A 5KP4A 1FGRA 3CCQ3 1O7WB 3JUOA 1RN1A 1ULIB 2R4IA 4K1VA 5AIFA 3MSOA 1GSPA 2E2TA 4HM1B 1VQP3 2W56B 1MWSA 3CC43 1MWRA 1OF5B 1TFOA 3G16A 3VGNA 4FMAA 4FMDA 1OUNA 3EJVA 4HM5B 1V74A 3JVCA 1RJOA 1A90A 3EN1B 4CJNA 3Q1CA 1J2BA 1DMNA 1M904 5BVBA 4J9AA 2W0QA 1FGQA 1Q7HA 1YIT3 3CCE3 1VQ43 2QGUA 1TUHA 3A76A 1YJW3 1OGXA 2OTJ3 2HMKB 4HKVB 1G0TA 4Q53A 3S28A 4QWTA 3MG1A 1IT8A 4PEJA 1FUSA 4LGQA 2PZVA 4RBNA 3ZG5A 1UI8A 1Q9EA 2B1XB 2CC3A 1U5OA 5HOHA 5IG4A 4BTYA 2Z6BA 4RZMA 1RTUA 5M1AA 2XGLA 3EE1A 5TGNA 3FG4A 5DREA 2CG1A 1IV9A 1I8VA 4BL2A 3B7CA 4X2HA 5FW5A 4R80A 2KF3A 1HZ1A 1RNTA 1Q42A 3LYGA 1ASKA 1OACA 1A2PA 1OHOA 4MMZB 2C11A 3WMDA 1DETA 1BSCA 1LVNA 3NV0A 4WP5A 3U97A 1FUWA 1GOYA 4R9KA 1NJI4 3V99A 1LXEA 3T8NA 1BOXA 2XFTA 1VZZA 2Z77A 2P0MA 1B27A 3EQQB 2GU1A 2W6JH 3IPTA 3MPHA 2IUJA 3S5CA 3STDA 1R4YA 4HOHA 3T8UA 1T2HA 1ISKA 4J5GA 1TTOA 4KT3B 2WGQA 1ZX2A 3MKIA 1CYVA 4LSOA 3B4OA 3G6E3 3LOYA 1JB4A 1E97A 2R41A 3JUQA 3UB1A 3OX9A 3X42A 3CMA3 1BNGA 1JKGB 1TJDA 3OWUA 3URPA 1B21A 3OWSA 2H0IA 1UUGB 4XBYA 7STDA 2CG0A 1JRQA 1W4NA 3WR2A 1FGMA 2UX0A 4FR9A 3G0KA 1RN4A 4N6NB 1N8QA 3BB9A 4K1UA 3VF1A 1TIJA 2W2CA 3BNDA 3RDEA 1SARA 1RRLA 1RGAA 4GL6A 1LOWA 4LEHA 4J5KA 1MWTA 5KP3A 3WDGB 4EBGA 1BRKA 1TRQA 1ZO2A 1KC84 3CCS3 1VQK3 1IVUA 1BRGA 1NO3A 2IYJA 1PY3A 3BIRA 3FH1A 3G4S3 1YJN3 3CME3 2V1LA 3RGAA 3D5GA 2A15A 3PGBA 3EBTA 4BU4A 6STDA 1CYUA 1NU3A 3FF2A 3HIGA 3NHXA 1BNFA 1X1UA 2IY2A 4NHFA 3JUMA 1RDSA 2CH9A 4RNZA 2H0HA 4ORLA 2IA7A 3X3XA 1UI7A 2Y74A 3F14A 3CC73 2KF5A 4WHAA 3U1WA 4HM7B 8CHOA 3EX9A 3ER7A 4FCMA 2HMNB 3BNBA 1ROVA 4GSPA 1YI23 5AYSC 1O7GB 1RGLA 2XH9A 3OWYA 2CFKA 2KRTA 2L4VA 3S67A 4XBTA 2OTL3 4EV5A 4J8TA 2ZDJA 1YHQ3 4I5QA 4EV2A 3KIIA 1QMAA 3NM2A 1I70A 2SARA 3GWRA 1AY7A 2CKFB 1W2ZA 2FXTA 1ZGXA 1VQ53 1EUIC 4FCJA 4HM4B 1E3RA 1QJGA 2P05A 1I0XA 3MG3A 3EBYA 3S27A 1AQZA 2F56A 5HGRA 4XDVA 4N6LA 1IK3A 3CNMA 1C7HA 1UUVB 3CNXA 2BMOB 3MG2A 1RNBA 2KAAA 3UNLA 5G1KA 3CXC2 1I0VA 1WMOA 4H3UA 3SX1A 2MF7A 2FGTA 1EEJA 2LQVA 1BSDA 1UW1A 3SOAA 1DMQA 2J8XB 3A5EA 3AMOB 3FCSB 3KSPA 3LTCA 1RLSA 5AEWB 1BIRA 3KZTA 4WYKB 3BNEA 1V57A 5DRVA 3SVAA 3MHEA 1UGHI 1VQM3 1IQ8A 3H51A 3PZWA 3ROBA 1B3SA 1BANA 3ZG0A 1W2B2 2UUGC 4XM4A 3WODG 1JN5A 2AADA 1D6YA 1OGZA 5BIRA 4HYZA 4MJDA 4OUQA 3UL5A 1UDII 3NUVA 3SXXA 3DY5A 1K41A 2XF3A 3DGOA 6RNTA 1O7PB 2BMRB 4O8SA 1BNJA 1N8R4 1TFKA 4CCVA 3T0UA 1RGCA 3TDGA 3V98A 1MOLA 5STDA 1TP6A 2I9WA 5AI1A 1RHLA 2YFLB 1O7MB 4N3VA 1CEWI 1I2FA 4KFDA 4RNTA 5EQLA 2INXA 1JZOA 1MGRA 4ZM8A 1KQS2 3ZFZA 3I0YA 4HM3B 3OW22 1E3VA 1JZDA 2OCTA 3X3ZA 2BNGA 2ZHXB 1JJ22 3NXJA 1X1XA 2STDA 4N6OB 5D81A 2XFSA 5LC6A 4IT7A 1DVDA 2F5MA 1LQMB 4H61A 4IIAA 3CCJ3 3ALAA 4KZ1A 1FYSA 4CPKA 1WQLB 2RFRA 1IVXA 2CHCA 5AIGA 1UCIA 3CCV3 2QA43 4HVNA 3DUKA 2F98A 1AVLA 2OQEC 3UJMA 7RNTA 3EHCA 2CWVA 4KFEA 1CQSA 1WTHA 5GSPA 1PU4A 3SLUA 1GD4A 3LZAA 1OH0A 1ULJB 2W9PA 2F5WA 2GBXB 1RCKA 2BMQB 5EVHA 4EYCA 4KVHA 1Q40B 4STDA 2GBWB 3PS8A 1GMQA 4BL3A 1U8CB 1RGEA 4JF8A 3RNTA 3NBJA 3WOEB 4NPBA 5G1LA 2QEX3 1FZUA 3CCU3 2F99A 3H3HA 2CK3H 2E2UA 2UGIA 2KF4A 4WWUC 1EKMA 1W7CA 4FMBA 1M1K4 2RGQA 5M19A 4HAAA 2XSHB 1X1WA 3AGNA 3CCR3 2Q07A 2C10A 3K9MC 2LYXA 3WA3A 1JNQA 3SEDA 1Q40A 1X1YA 1BSAA 5ELJA 4LZIA 1O7HB 1WMPA 1BNEA 3ECFA 3EC9A 1Q864 1HU9A 1RGKA 1OPYA 3V92A 1QVF2 2KXGA 5IERA 4L8OA 1MGWA 3DGYA 2CIUA
chains in the Genus database with same CATH topology
1SIHA 4HM2B 1KSIA 2SBLA 1GY7A 3KE7A 4AKZA 4RNYA 2F86B 2D1WA 2OQEA 4BTWA 2FNQA 4U13A 1OCVA 3NQYA 4N6MA 3FLJA 3LMLA 3PXMA 4R1KA 1SPUA 4EC6A 2W04A 2ML5A 5CF2A 1STFI 5EEOA 3BNCA 2K54A 1VQ93 4KFFA 5D82A 2XEPA 1N5PA 3PCRA 1HKXA 2YFJB 3OV4A 4OK0A 3QK9A 1AR0A 2IUKA 1M9GA 3K0ZA 3CCM3 4K61A 3G8ZA 3CU3A 4TX4A 1YJ93 5IG0A 4BTXA 3EF8A 3LT8A 3HX8A 1Q7Y4 1NB3I 4N6V0 1N9JA 3WOFB 1MNLA 1NWWA 3GRDA 1O7NB 3OXAA 1QALA 1L5GB 4FMCA 3IMAB 3N54B 3CD63 2GU3A 2W9QA 3HIIA 3DMCA 1OHSA 5IF6A 2P0XA 3GZRA 3WA2X 5CXOA 1VQ63 3KKGA 1M1XB 4O3VA 3GAXA 1TU5A 3LT9A 1IQYA 5BXQA 5IEPA 1D6UA 2XGNA 4HJLB 2GXFA 3NBBA 3F9SA 3S29A 1VQ73 1YGEA 2JDIH 3IJEB 3F40A 1GS3A 2CWUA 3LTAA 1VQO3 3VSYA 2HMMB 2Z76A 5AYRB 2O3OA 1G96A 1DMMA 1K9M4 2B24B 1D6ZA 3KFQC 3GZBA 1N5HA 3SOYA 5AEUB 2XSOB 1BUQA 1IT7A 1EQKA 1A2KA 1IQXA 2D42A 5A0OB 1F8NA 1Y4KA 1W6YA 3X41A 5LC7A 2M7OA 1IVVA 3RGRA 1PFPA 2YFIB 4HZ9B 5I97A 3I553 1W02A 3K63A 1VQL3 2E2VA 3NV0B 1QAFA 2Z7AA 4R4KA 4R9LA 1RRHA 3K7CA 1WMNA 4K90B 4WYKA 2W56A 3HI7A 1JKGA 3JUNA 1RN7A 5AIIA 3NQZA 3MYTA 5AIHA 1EA2A 1DYUA 1FGOA 3N9HA 4MEIA 3DGNA 5JPPA 4HM0B 1A2VA 3DZLA 1R4CA 3KN4A 1IU7A 1Q814 1DVCA 4GB5A 1WNHA 3NBRA 2HMLB 1JB5A 1W01A 3Q2PA 4HM6B 5ELUA 4MMYB 4O2HA 3DGLA 3KSED 4NREA 1OF5A 1JV2B 1W6GA 3FG1A 2K0MA 3NX0A 3I563 1SJWA 2BO9B 1Z1SA 5CLKA 3G713 2O9UX 1AVKA 3X40A 4HBRA 1GYBA 1N9EA 1GD3A 2BHMA 2RCDA 3Q90A 1W00A 5IW9A 4HM8B 1YIJ3 2P38A 4N6UA 2Y73A 3NM7A 2XRXB 2WOFA 1FGTA 1ROAA 2GEXA 1UUWB 3UL6A 1NB5I 3F7XA 3HK4A 3M8CA 2GEYA 2PNCA 3AMOA 3O8YA 3CPW2 3F8XA 2CWTA 1SQWA 2ZL8A 3QRDA 2KCDA 2HMJB 1LOXA 3PYJA 5CF1A 1T5YA 4LMIA 1GY6A 1IDPA 2MC8A 5JPUA 1GY5A 1LNHA 1JN5B 3D9RA 3DGMA 2OOVA 1W6CA 3FZWA 2JQ5A 1US1A 5G2GA 1K28A 3X3YA 1QAKA 4WFOA 5IG3A 1K734 3LTDA 4I4KA 3L0RA 1S5AA 5IENA 4HZBB 4L7KA 4XB5A 5IEOA 2QIYA 2XR8B 4JRFA 4IPBA 1AV4A 2YX9A 3F7SA 3LH4A 3DXOA 4AEQA 3FGYA 3EB8A 2OWPA 1KWIA 3BLZA 3MWZA 1JB2A 1SIIA 2P09A 3B8LA 3FF0A 1S723 2OOVC 2CFLA 5IG5A 3FSDA 1RKYA 3LXUX 2WO0A 5KP1A 3GZXB 3E99A 4G1MB 3K5TA 3CPOA 4N6TA 1VQN3 4XBXA 1A67A 1NDOB 2CFDA 3FKAA 4X2OA 3PCSA 1YVBI 2IMJA 5D83A 1VQ83 2CFGA 3CCL3 5FGOA 1KD14 2BT3A 4EXRA 2W03A 3F8HA 4OVMA 3JUPA 4MMXB 1IVWA 4O02B 3B4PA 2WGOA 2ML6A 2HMOB 3DM8A 5CK6A 1FA3A 2RSXA 3J7Yd 1W5ZA 1QVG2 4L8PA 3D3LA 3GZYB 4FCZA 3HZPA 3EN8A 4CDLA 2WOHA 4XDWA 2CW9A 1Q824 1EG9B 1OHPA 4AKYA 3LTBA 5JBSA 1STDA 3N8BA 1K8A4 1IV7A 2CFWA 3FG3A 5KP4A 1FGRA 3CCQ3 1O7WB 3JUOA 1ULIB 2R4IA 4K1VA 5AIFA 3MSOA 2E2TA 4HM1B 1VQP3 2W56B 3CC43 1OF5B 1TFOA 3G16A 3VGNA 4FMAA 4FMDA 1OUNA 3EJVA 4HM5B 1V74A 3JVCA 1RJOA 1A90A 3EN1B 3Q1CA 1J2BA 1DMNA 1M904 5BVBA 4J9AA 2W0QA 1FGQA 1YIT3 1VQ43 3CCE3 2QGUA 1TUHA 3A76A 1YJW3 1OGXA 2OTJ3 2HMKB 4HKVB 3S28A 4QWTA 3MG1A 1IT8A 4PEJA 4LGQA 2PZVA 4RBNA 1UI8A 2B1XB 2CC3A 1U5OA 5IG4A 4BTYA 2Z6BA 4RZMA 2XGLA 3EE1A 5TGNA 3FG4A 5DREA 2CG1A 1IV9A 3B7CA 4X2HA 5FW5A 4R80A 3LYGA 1Q42A 1ASKA 1OACA 1OHOA 4MMZB 2C11A 3WMDA 1LVNA 4WP5A 3NV0A 3U97A 1FUWA 4R9KA 1NJI4 3V99A 1LXEA 3T8NA 2XFTA 2Z77A 1VZZA 2P0MA 3IPTA 3EQQB 2GU1A 2W6JH 3MPHA 2IUJA 3S5CA 3STDA 3T8UA 1ISKA 2WGQA 1ZX2A 3MKIA 1CYVA 4LSOA 3B4OA 3G6E3 3LOYA 1JB4A 1E97A 3JUQA 3UB1A 3CC23 3OX9A 3X42A 3CMA3 1JKGB 3OWUA 3OWSA 4XBYA 7STDA 2CG0A 1JRQA 1W4NA 1FGMA 2UX0A 4FR9A 3G0KA 4N6NB 1N8QA 3BB9A 4K1UA 3VF1A 1TIJA 2W2CA 3BNDA 3RDEA 1RRLA 4GL6A 5KP3A 4LEHA 4EBGA 3WDGB 1KC84 1ZO2A 3CCS3 1VQK3 1IVUA 3G4S3 1NO3A 3FH1A 1YJN3 3CME3 2V1LA 3RGAA 2A15A 3PGBA 3EBTA 6STDA 1CYUA 1NU3A 3FF2A 3HIGA 3NHXA 4NHFA 3JUMA 2CH9A 4RNZA 4ORLA 2IA7A 3X3XA 1UI7A 2Y74A 3F14A 3CC73 4WHAA 3U1WA 4HM7B 8CHOA 3EX9A 3ER7A 4FCMA 2HMNB 3BNBA 1ROVA 1YI23 5AYSC 1O7GB 2XH9A 3OWYA 2CFKA 2KRTA 2L4VA 3S67A 4XBTA 2OTL3 4EV5A 4J8TA 2ZDJA 1YHQ3 4EV2A 3KIIA 1QMAA 3NM2A 3GWRA 2CKFB 1W2ZA 2FXTA 1VQ53 4HM4B 4FCJA 1E3RA 1QJGA 2P05A 3MG3A 3EBYA 3S27A 5HGRA 1IK3A 4XDVA 4N6LA 3CNMA 1C7HA 1UUVB 3CNXA 2BMOB 3MG2A 3UNLA 3CXC2 1WMOA 4H3UA 3SX1A 2MF7A 2FGTA 2LQVA 1UW1A 3SOAA 1DMQA 3AMOB 3FCSB 3KSPA 3LTCA 5AEWB 3KZTA 4WYKB 3BNEA 5DRVA 3SVAA 3MHEA 1VQM3 1IQ8A 3H51A 3PZWA 3ROBA 1W2B2 4XM4A 3WODG 1JN5A 1D6YA 1OGZA 4HYZA 4MJDA 4OUQA 3UL5A 3NUVA 3SXXA 3DY5A 1K41A 2XF3A 3DGOA 1O7PB 2BMRB 4O8SA 1N8R4 1TFKA 4CCVA 3T0UA 3V98A 3TDGA 1MOLA 5STDA 1TP6A 2I9WA 5AI1A 2YFLB 1O7MB 4N3VA 1CEWI 4KFDA 5EQLA 2INXA 4ZM8A 1KQS2 3I0YA 4HM3B 3OW22 1E3VA 2OCTA 3X3ZA 2BNGA 1JJ22 3NXJA 2STDA 4N6OB 5D81A 2XFSA 5LC6A 4IT7A 1DVDA 4IIAA 4H61A 3CCJ3 3ALAA 4KZ1A 1WQLB 2RFRA 1IVXA 2CHCA 5AIGA 3CCV3 2QA43 4HVNA 3DUKA 2F98A 1AVLA 2OQEC 3UJMA 3EHCA 2CWVA 4KFEA 1CQSA 1WTHA 1PU4A 3SLUA 1GD4A 3LZAA 1OH0A 1ULJB 2W9PA 2GBXB 5EVHA 2BMQB 4EYCA 4KVHA 1Q40B 4STDA 2GBWB 3PS8A 1U8CB 3WOEB 4JF8A 3NBJA 2QEX3 3CCU3 2F99A 3H3HA 2CK3H 2E2UA 4WWUC 1EKMA 1W7CA 4FMBA 1M1K4 2RGQA 2XSHB 3CCR3 2Q07A 2C10A 3K9MC 2LYXA 3WA3A 1JNQA 3SEDA 1Q40A 5ELJA 4LZIA 1O7HB 1WMPA 3ECFA 3EC9A 1Q864 1HU9A 1OPYA 3V92A 1QVF2 2KXGA 5IERA 4L8OA 4Q53A 2CIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NM2 A;  2R4I A;  3GWR A;  4HM2 B;  1OF5 A;  3MSO A;  4K1V A;  5AIF A;  2CKF B;  4HM1 B;  1GY7 A;  3KE7 A;  2F86 B;  1SJW A;  4HM4 B;  4FCJ A;  1E3R A;  1QJG A;  1OF5 B;  1Z1S A;  3G16 A;  5CLK A;  3VGN A;  4U13 A;  1OCV A;  1OUN A;  3MG3 A;  3EJV A;  3EBY A;  4HM5 B;  3FLJ A;  4R1K A;  5HGR A;  5STD A;  1GYB A;  4XDV A;  5CF2 A;  3CNM A;  1C7H A;  1UUV B;  3CNX A;  3EN1 B;  2BMO B;  3MG2 A;  1DMN A;  3UNL A;  5BVB A;  2RCD A;  3Q90 A;  4J9A A;  2K54 A;  1W00 A;  4HM8 B;  2QGU A;  1TUH A;  2XRX B;  3A76 A;  4H3U A;  5D82 A;  1OGX A;  2HMK B;  2GEX A;  4HKV B;  4Q53 A;  1UUW B;  1HKX A;  3MG1 A;  2YFJ B;  1DMQ A;  3OV4 A;  4PEJ A;  3F7X A;  3HK4 A;  3M8C A;  2PZV A;  3KSP A;  2GEY A;  2B1X B;  4LGQ A;  5AEW B;  1U5O A;  3KZT A;  3F8X A;  4WYK B;  1AR0 A;  5DRV A;  5IG4 A;  4RZM A;  3MHE A;  3K0Z A;  5TGN A;  3H51 A;  3ROB A;  3G8Z A;  2HMJ B;  5DRE A;  5CF1 A;  3CU3 A;  4LMI A;  1GY6 A;  4XM4 A;  5IG0 A;  1JN5 A;  3SOA A;  1IDP A;  5JPU A;  3B7C A;  1GY5 A;  1OGZ A;  4X2H A;  5FW5 A;  4MJD A;  1JN5 B;  3D9R A;  1Q42 A;  3EF8 A;  1ASK A;  3HX8 A;  3LYG A;  3NUV A;  4OUQ A;  1OHO A;  2JQ5 A;  3WMD A;  1K41 A;  1O7P B;  1NWW A;  2BMR B;  3GRD A;  5G2G A;  1O7N B;  3OXA A;  4WP5 A;  3NV0 A;  5IG3 A;  4I4K A;  4R9K A;  3DMC A;  3T8N A;  1S5A A;  1VZZ A;  1TP6 A;  1OHS A;  2I9W A;  2YFL B;  2Z77 A;  3EQQ B;  3GZR A;  3IPT A;  1O7M B;  3KKG A;  2QIY A;  2XR8 B;  4HZB B;  4L7K A;  4N3V A;  4XB5 A;  2INX A;  5IEO A;  3STD A;  3T8U A;  1ISK A;  3F7S A;  3DXO A;  1ZX2 A;  3I0Y A;  3MKI A;  3FGY A;  4HM3 B;  5BXQ A;  1E3V A;  2GXF A;  3B4O A;  4HJL B;  5IEP A;  1JB4 A;  1E97 A;  3JUO A;  3F9S A;  2BNG A;  3JUQ A;  2OWP A;  3OX9 A;  3NXJ A;  1JKG B;  2STD A;  3BLZ A;  3OWU A;  1JB2 A;  3OWS A;  3F40 A;  3B8L A;  3FF0 A;  1GS3 A;  4XBY A;  5D81 A;  7STD A;  5IG5 A;  4IIA A;  3VSY A;  2HMM B;  2Z76 A;  3FSD A;  1WQL B;  1DMM A;  2RFR A;  2UX0 A;  5CXO A;  2CHC A;  3GZX B;  2B24 B;  3G0K A;  5AIG A;  5KP1 A;  4HVN A;  3E99 A;  3DUK A;  3CPO A;  2F98 A;  3BB9 A;  4XBX A;  3UJM A;  3EHC A;  3GZB A;  4K1U A;  5AI1 A;  2W2C A;  1CQS A;  1NDO B;  3FKA A;  3LZA A;  1OH0 A;  4X2O A;  1ULJ B;  3SOY A;  2GBX B;  5AEU B;  2XSO B;  1BUQ A;  2IMJ A;  5D83 A;  2BMQ B;  1A2K A;  5EVH A;  5IEN A;  5KP3 A;  4KVH A;  4LEH A;  1Q40 B;  4STD A;  1ZO2 A;  2GBW B;  1W6Y A;  3F8H A;  4OVM A;  3FH1 A;  3S5C A;  3JUP A;  3RGR A;  2YFI B;  4HZ9 B;  3RGA A;  2A15 A;  2F99 A;  3H3H A;  1W02 A;  3B4P A;  3DM8 A;  2HMO B;  3EBT A;  5CK6 A;  4WWU C;  6STD A;  1NU3 A;  3NV0 B;  3FF2 A;  2RGQ A;  3NHX A;  2Z7A A;  2XSH B;  3JUM A;  3K7C A;  4R9L A;  1QMA A;  4ORL A;  4WYK A;  3F14 A;  1JKG A;  3JUN A;  5AII A;  3MYT A;  4L8P A;  3SED A;  4HM7 B;  3GZY B;  1EA2 A;  1Q40 A;  3HZP A;  5AIH A;  8CHO A;  3EN8 A;  1O7H B;  5JPP A;  3EX9 A;  3ER7 A;  4HM0 B;  3ECF A;  2HMN B;  3DZL A;  3EC9 A;  4FCM A;  4XDW A;  4CDL A;  5IF6 A;  1O7G B;  1OPY A;  3OWY A;  1EG9 B;  1OHP A;  4XBT A;  4GB5 A;  1STD A;  3NBR A;  4J8T A;  5IER A;  4L8O A;  2HML B;  1JB5 A;  5KP4 A;  1W01 A;  4HM6 B;  1O7W B;  3FZW A;  1ULI B; 
#chains in the Genus database with same CATH topology
 1FUT A;  1SIH A;  2K3D A;  4HM2 B;  1KSI A;  1RGH A;  2SBL A;  1GMP A;  1GY7 A;  3KE7 A;  4AKZ A;  4RNY A;  3Q3F A;  2F86 B;  2D1W A;  2OQE A;  1LRA A;  4BTW A;  1BRN L;  2FNQ A;  4U13 A;  1OCV A;  3NQY A;  4N6M A;  3FLJ A;  3LML A;  3PXM A;  4R1K A;  1JBS A;  1SPU A;  4EC6 A;  2W04 A;  2ML5 A;  5CF2 A;  1LOV A;  1STF I;  5EEO A;  3BNC A;  2K54 A;  4BIR A;  1VQ9 3;  4KFF A;  1RGG A;  1BGS A;  5D82 A;  2XEP A;  2CX1 A;  1YNV X;  1N5P A;  3PCR A;  1HKX A;  2YFJ B;  2HOH A;  3OV4 A;  4OK0 A;  1GOU A;  3QK9 A;  1UCJ A;  1AR0 A;  2IUK A;  1M9G A;  3K0Z A;  7GSP A;  3CCM 3;  4K61 A;  3G8Z A;  3CC2 3;  3CU3 A;  4TX4 A;  6GSP A;  1YJ9 3;  5IG0 A;  1T3B A;  4BTX A;  3EF8 A;  3LT8 A;  3HX8 A;  4GHO A;  1NB3 I;  4N6V 0;  1HYF A;  1N9J A;  1Q7Y 4;  3WOF B;  2RBI A;  1PYL A;  2RNT A;  1MNL A;  1NWW A;  3GRD A;  1O7N B;  3OXA A;  1QAL A;  1LOY A;  1L5G B;  4FMC A;  9RNT A;  3IMA B;  3N54 B;  3CD6 3;  2GU3 A;  2W9Q A;  3HII A;  3DMC A;  8RNT A;  1OHS A;  5IF6 A;  2P0X A;  3GZR A;  3WA2 X;  5CXO A;  1VQ6 3;  3KKG A;  1M1X B;  1YGW A;  4O3V A;  1G02 A;  3GAX A;  1TU5 A;  5RNT A;  3LT9 A;  1JBT A;  1IQY A;  5BXQ A;  5IEP A;  1D6U A;  2H0G A;  2XGN A;  1CH0 A;  2GXF A;  3NBB A;  4HJL B;  3F9S A;  1UCK A;  3S29 A;  1VQ7 3;  1YGE A;  2JDI H;  3IJE B;  3F40 A;  1GS3 A;  1BU4 A;  1YVS A;  2CWU A;  3LTA A;  1VQO 3;  1I3I A;  3VSY A;  2HMM B;  2Z76 A;  1BAO A;  5AYR B;  2O3O A;  1G96 A;  1DMM A;  1JBR A;  1K9M 4;  2B24 B;  1D6Z A;  1I2E A;  3KFQ C;  1BNR A;  4ILF A;  3GZB A;  5BU4 A;  1GOV A;  1N5H A;  3SOY A;  5AEU B;  2XSO B;  1BUQ A;  1IT7 A;  1EQK A;  1BRH A;  1A2K A;  1IQX A;  2D42 A;  5A0O B;  1F8N A;  1Y4K A;  1W6Y A;  3X41 A;  1BSE A;  2M7O A;  5LC7 A;  1DE3 A;  1IVV A;  3RGR A;  1PFP A;  2YFI B;  4HZ9 B;  5I97 A;  3I55 3;  1W02 A;  3K63 A;  1VQL 3;  2E2V A;  3NV0 B;  1QAF A;  2Z7A A;  4R4K A;  4R9L A;  1RRH A;  3K7C A;  1WMN A;  4K90 B;  4WYK A;  2W56 A;  1BRS A;  3HI7 A;  5M18 A;  1JKG A;  3JUN A;  1RN7 A;  5AII A;  3NQZ A;  3MYT A;  5AIH A;  1EA2 A;  1VQQ A;  2ZA4 A;  1DYU A;  1FGO A;  3N9H A;  4MEI A;  3DGN A;  5JPP A;  4HM0 B;  1A2V A;  3DZL A;  1R4C A;  3KN4 A;  1BNI A;  1IU7 A;  1Q81 4;  1DVC A;  4GB5 A;  1WNH A;  2CX0 A;  3NBR A;  2HML B;  1JB5 A;  1W01 A;  3Q2P A;  4HM6 B;  5ELU A;  4MMY B;  4O2H A;  3DGL A;  3KSE D;  4NRE A;  1OF5 A;  1JV2 B;  1UGI A;  1W6G A;  1B2Z A;  2K0M A;  3FG1 A;  3NX0 A;  3I56 3;  1SJW A;  1B2U A;  2BO9 B;  2AAE A;  1Z1S A;  5CLK A;  2KF6 A;  3G71 3;  2O9U X;  1AVK A;  1BSB A;  1RGF A;  3X40 A;  4HBR A;  1GYB A;  3WHO A;  1BVI A;  1GD3 A;  1N9E A;  1IYY A;  2BHM A;  3KCH A;  2RCD A;  3Q90 A;  1W00 A;  5IW9 A;  4HM8 B;  1YIJ 3;  2P38 A;  4N6U A;  2Y73 A;  3NM7 A;  2XRX B;  2WOF A;  1FGT A;  1ROA A;  2GEX A;  1UUW B;  3UL6 A;  1NB5 I;  3F7X A;  1T2I A;  3HK4 A;  3M8C A;  2GEY A;  2GSP A;  2PNC A;  3DH2 A;  3AMO A;  3O8Y A;  3CPW 2;  3F8X A;  2CWT A;  1SQW A;  1V58 A;  1LQG C;  2ZL8 A;  3AGO A;  3QRD A;  2KCD A;  2HMJ B;  1LOX A;  1MWU A;  1RSN A;  3PYJ A;  1T5Y A;  5CF1 A;  4LMI A;  1BRJ A;  1GY6 A;  3AHW A;  1IDP A;  3D4A A;  2MC8 A;  1GY5 A;  1I2G A;  1NNV A;  1LNH A;  5JPU A;  1JN5 B;  3D9R A;  3DGM A;  2OOV A;  4DKI A;  1B2M A;  1W6C A;  3FZW A;  2JQ5 A;  1US1 A;  3D5I A;  5G2G A;  1K28 A;  3X3Y A;  1QAK A;  4WFO A;  5IG3 A;  1K73 4;  3LTD A;  4I4K A;  3L0R A;  1S5A A;  5IEN A;  4HZB B;  4L7K A;  4XB5 A;  5IEO A;  1B2X A;  2QIY A;  2XR8 B;  1BUJ A;  4JRF A;  4IPB A;  1LNI A;  1AV4 A;  2YX9 A;  2BU4 A;  3F7S A;  3LH4 A;  3DXO A;  3D79 A;  4AEQ A;  3FGY A;  1TRP A;  3EB8 A;  2OWP A;  1KWI A;  3BLZ A;  3MWZ A;  1JB2 A;  1FW7 A;  1SII A;  2P09 A;  3B8L A;  3FF0 A;  1I3F A;  1S72 3;  2OOV C;  1UCL A;  2CFL A;  5IG5 A;  3FSD A;  2F4Y A;  3LXU X;  1RKY A;  4LYL B;  2WO0 A;  5KP1 A;  3GZX B;  1GMR A;  2L1S A;  3E99 A;  4G1M B;  3K5T A;  3CPO A;  4N6T A;  1VQN 3;  4XBX A;  1A67 A;  1NDO B;  2CFD A;  3FKA A;  1C54 A;  3AHS A;  4X2O A;  1BNS A;  3PCS A;  1YVB I;  2IMJ A;  5D83 A;  1VQ8 3;  2CFG A;  2C4B A;  3CCL 3;  5FGO A;  1KD1 4;  2BT3 A;  4EXR A;  2W03 A;  3F8H A;  4OVM A;  3JUP A;  2BIR A;  3GSP A;  3HOH A;  4MMX B;  3BU4 A;  1IVW A;  4O02 B;  3B4P A;  2WGO A;  2ML6 A;  2HMO B;  3DM8 A;  5CK6 A;  1FA3 A;  1B2S A;  2RSX A;  3J7Y d;  1W5Z A;  1QVG 2;  1ZS7 A;  1BRI A;  1RCL A;  4L8P A;  1B20 A;  3D3L A;  3GZY B;  3HZP A;  4FCZ A;  3EN8 A;  4EW5 A;  3SYU A;  4CDL A;  2WOH A;  4XDW A;  2CW9 A;  1Q82 4;  1EG9 B;  1OHP A;  4AKY A;  3LTB A;  5JBS A;  1STD A;  3N8B A;  1K8A 4;  1RMS A;  1IV7 A;  2CFW A;  3FG3 A;  5KP4 A;  1FGR A;  3CCQ 3;  1O7W B;  3JUO A;  1RN1 A;  1ULI B;  2R4I A;  4K1V A;  5AIF A;  3MSO A;  1GSP A;  2E2T A;  4HM1 B;  1VQP 3;  2W56 B;  1MWS A;  3CC4 3;  1MWR A;  1OF5 B;  1TFO A;  3G16 A;  3VGN A;  4FMA A;  4FMD A;  1OUN A;  3EJV A;  4HM5 B;  1V74 A;  3JVC A;  1RJO A;  1A90 A;  3EN1 B;  4CJN A;  3Q1C A;  1J2B A;  1DMN A;  1M90 4;  5BVB A;  4J9A A;  2W0Q A;  1FGQ A;  1Q7H A;  1YIT 3;  3CCE 3;  1VQ4 3;  2QGU A;  1TUH A;  3A76 A;  1YJW 3;  1OGX A;  2OTJ 3;  2HMK B;  4HKV B;  1G0T A;  4Q53 A;  3S28 A;  4QWT A;  3MG1 A;  1IT8 A;  4PEJ A;  1FUS A;  4LGQ A;  2PZV A;  4RBN A;  3ZG5 A;  1UI8 A;  1Q9E A;  2B1X B;  2CC3 A;  1U5O A;  5HOH A;  5IG4 A;  4BTY A;  2Z6B A;  4RZM A;  1RTU A;  5M1A A;  2XGL A;  3EE1 A;  5TGN A;  3FG4 A;  5DRE A;  2CG1 A;  1IV9 A;  1I8V A;  4BL2 A;  3B7C A;  4X2H A;  5FW5 A;  4R80 A;  2KF3 A;  1HZ1 A;  1RNT A;  1Q42 A;  3LYG A;  1ASK A;  1OAC A;  1A2P A;  1OHO A;  4MMZ B;  2C11 A;  3WMD A;  1DET A;  1BSC A;  1LVN A;  3NV0 A;  4WP5 A;  3U97 A;  1FUW A;  1GOY A;  4R9K A;  1NJI 4;  3V99 A;  1LXE A;  3T8N A;  1BOX A;  2XFT A;  1VZZ A;  2Z77 A;  2P0M A;  1B27 A;  3EQQ B;  2GU1 A;  2W6J H;  3IPT A;  3MPH A;  2IUJ A;  3S5C A;  3STD A;  1R4Y A;  4HOH A;  3T8U A;  1T2H A;  1ISK A;  4J5G A;  1TTO A;  4KT3 B;  2WGQ A;  1ZX2 A;  3MKI A;  1CYV A;  4LSO A;  3B4O A;  3G6E 3;  3LOY A;  1JB4 A;  1E97 A;  2R41 A;  3JUQ A;  3UB1 A;  3OX9 A;  3X42 A;  3CMA 3;  1BNG A;  1JKG B;  1TJD A;  3OWU A;  3URP A;  1B21 A;  3OWS A;  2H0I A;  1UUG B;  4XBY A;  7STD A;  2CG0 A;  1JRQ A;  1W4N A;  3WR2 A;  1FGM A;  2UX0 A;  4FR9 A;  3G0K A;  1RN4 A;  4N6N B;  1N8Q A;  3BB9 A;  4K1U A;  3VF1 A;  1TIJ A;  2W2C A;  3BND A;  3RDE A;  1SAR A;  1RRL A;  1RGA A;  4GL6 A;  1LOW A;  4LEH A;  4J5K A;  1MWT A;  5KP3 A;  3WDG B;  4EBG A;  1BRK A;  1TRQ A;  1ZO2 A;  1KC8 4;  3CCS 3;  1VQK 3;  1IVU A;  1BRG A;  1NO3 A;  2IYJ A;  1PY3 A;  3BIR A;  3FH1 A;  3G4S 3;  1YJN 3;  3CME 3;  2V1L A;  3RGA A;  3D5G A;  2A15 A;  3PGB A;  3EBT A;  4BU4 A;  6STD A;  1CYU A;  1NU3 A;  3FF2 A;  3HIG A;  3NHX A;  1BNF A;  1X1U A;  2IY2 A;  4NHF A;  3JUM A;  1RDS A;  2CH9 A;  4RNZ A;  2H0H A;  4ORL A;  2IA7 A;  3X3X A;  1UI7 A;  2Y74 A;  3F14 A;  3CC7 3;  2KF5 A;  4WHA A;  3U1W A;  4HM7 B;  8CHO A;  3EX9 A;  3ER7 A;  4FCM A;  2HMN B;  3BNB A;  1ROV A;  4GSP A;  1YI2 3;  5AYS C;  1O7G B;  1RGL A;  2XH9 A;  3OWY A;  2CFK A;  2KRT A;  2L4V A;  3S67 A;  4XBT A;  2OTL 3;  4EV5 A;  4J8T A;  2ZDJ A;  1YHQ 3;  4I5Q A;  4EV2 A;  3KII A;  1QMA A;  3NM2 A;  1I70 A;  2SAR A;  3GWR A;  1AY7 A;  2CKF B;  1W2Z A;  2FXT A;  1ZGX A;  1VQ5 3;  1EUI C;  4FCJ A;  4HM4 B;  1E3R A;  1QJG A;  2P05 A;  1I0X A;  3MG3 A;  3EBY A;  3S27 A;  1AQZ A;  2F56 A;  5HGR A;  4XDV A;  4N6L A;  1IK3 A;  3CNM A;  1C7H A;  1UUV B;  3CNX A;  2BMO B;  3MG2 A;  1RNB A;  2KAA A;  3UNL A;  5G1K A;  3CXC 2;  1I0V A;  1WMO A;  4H3U A;  3SX1 A;  2MF7 A;  2FGT A;  1EEJ A;  2LQV A;  1BSD A;  1UW1 A;  3SOA A;  1DMQ A;  2J8X B;  3A5E A;  3AMO B;  3FCS B;  3KSP A;  3LTC A;  1RLS A;  5AEW B;  1BIR A;  3KZT A;  4WYK B;  3BNE A;  1V57 A;  5DRV A;  3SVA A;  3MHE A;  1UGH I;  1VQM 3;  1IQ8 A;  3H51 A;  3PZW A;  3ROB A;  1B3S A;  1BAN A;  3ZG0 A;  1W2B 2;  2UUG C;  4XM4 A;  3WOD G;  1JN5 A;  2AAD A;  1D6Y A;  1OGZ A;  5BIR A;  4HYZ A;  4MJD A;  4OUQ A;  3UL5 A;  1UDI I;  3NUV A;  3SXX A;  3DY5 A;  1K41 A;  2XF3 A;  3DGO A;  6RNT A;  1O7P B;  2BMR B;  4O8S A;  1BNJ A;  1N8R 4;  1TFK A;  4CCV A;  3T0U A;  1RGC A;  3TDG A;  3V98 A;  1MOL A;  5STD A;  1TP6 A;  2I9W A;  5AI1 A;  1RHL A;  2YFL B;  1O7M B;  4N3V A;  1CEW I;  1I2F A;  4KFD A;  4RNT A;  5EQL A;  2INX A;  1JZO A;  1MGR A;  4ZM8 A;  1KQS 2;  3ZFZ A;  3I0Y A;  4HM3 B;  3OW2 2;  1E3V A;  1JZD A;  2OCT A;  3X3Z A;  2BNG A;  2ZHX B;  1JJ2 2;  3NXJ A;  1X1X A;  2STD A;  4N6O B;  5D81 A;  2XFS A;  5LC6 A;  4IT7 A;  1DVD A;  2F5M A;  1LQM B;  4H61 A;  4IIA A;  3CCJ 3;  3ALA A;  4KZ1 A;  1FYS A;  4CPK A;  1WQL B;  2RFR A;  1IVX A;  2CHC A;  5AIG A;  1UCI A;  3CCV 3;  2QA4 3;  4HVN A;  3DUK A;  2F98 A;  1AVL A;  2OQE C;  3UJM A;  7RNT A;  3EHC A;  2CWV A;  4KFE A;  1CQS A;  1WTH A;  5GSP A;  1PU4 A;  3SLU A;  1GD4 A;  3LZA A;  1OH0 A;  1ULJ B;  2W9P A;  2F5W A;  2GBX B;  1RCK A;  2BMQ B;  5EVH A;  4EYC A;  4KVH A;  1Q40 B;  4STD A;  2GBW B;  3PS8 A;  1GMQ A;  4BL3 A;  1U8C B;  1RGE A;  4JF8 A;  3RNT A;  3NBJ A;  3WOE B;  4NPB A;  5G1L A;  2QEX 3;  1FZU A;  3CCU 3;  2F99 A;  3H3H A;  2CK3 H;  2E2U A;  2UGI A;  2KF4 A;  4WWU C;  1EKM A;  1W7C A;  4FMB A;  1M1K 4;  2RGQ A;  5M19 A;  4HAA A;  2XSH B;  1X1W A;  3AGN A;  3CCR 3;  2Q07 A;  2C10 A;  3K9M C;  2LYX A;  3WA3 A;  1JNQ A;  3SED A;  1Q40 A;  1X1Y A;  1BSA A;  5ELJ A;  4LZI A;  1O7H B;  1WMP A;  1BNE A;  3ECF A;  3EC9 A;  1Q86 4;  1HU9 A;  1RGK A;  1OPY A;  3V92 A;  1QVF 2;  2KXG A;  5IER A;  4L8O A;  1MGW A;  3DGY A;  2CIU A; 
#chains in the Genus database with same CATH homology
 1SIH A;  4HM2 B;  1KSI A;  2SBL A;  1GY7 A;  3KE7 A;  4AKZ A;  4RNY A;  2F86 B;  2D1W A;  2OQE A;  4BTW A;  2FNQ A;  4U13 A;  1OCV A;  3NQY A;  4N6M A;  3FLJ A;  3LML A;  3PXM A;  4R1K A;  1SPU A;  4EC6 A;  2W04 A;  2ML5 A;  5CF2 A;  1STF I;  5EEO A;  3BNC A;  2K54 A;  1VQ9 3;  4KFF A;  5D82 A;  2XEP A;  1N5P A;  3PCR A;  1HKX A;  2YFJ B;  3OV4 A;  4OK0 A;  3QK9 A;  1AR0 A;  2IUK A;  1M9G A;  3K0Z A;  3CCM 3;  4K61 A;  3G8Z A;  3CU3 A;  4TX4 A;  1YJ9 3;  5IG0 A;  4BTX A;  3EF8 A;  3LT8 A;  3HX8 A;  1Q7Y 4;  1NB3 I;  4N6V 0;  1N9J A;  3WOF B;  1MNL A;  1NWW A;  3GRD A;  1O7N B;  3OXA A;  1QAL A;  1L5G B;  4FMC A;  3IMA B;  3N54 B;  3CD6 3;  2GU3 A;  2W9Q A;  3HII A;  3DMC A;  1OHS A;  5IF6 A;  2P0X A;  3GZR A;  3WA2 X;  5CXO A;  1VQ6 3;  3KKG A;  1M1X B;  4O3V A;  3GAX A;  1TU5 A;  3LT9 A;  1IQY A;  5BXQ A;  5IEP A;  1D6U A;  2XGN A;  4HJL B;  2GXF A;  3NBB A;  3F9S A;  3S29 A;  1VQ7 3;  1YGE A;  2JDI H;  3IJE B;  3F40 A;  1GS3 A;  2CWU A;  3LTA A;  1VQO 3;  3VSY A;  2HMM B;  2Z76 A;  5AYR B;  2O3O A;  1G96 A;  1DMM A;  1K9M 4;  2B24 B;  1D6Z A;  3KFQ C;  3GZB A;  1N5H A;  3SOY A;  5AEU B;  2XSO B;  1BUQ A;  1IT7 A;  1EQK A;  1A2K A;  1IQX A;  2D42 A;  5A0O B;  1F8N A;  1Y4K A;  1W6Y A;  3X41 A;  5LC7 A;  2M7O A;  1IVV A;  3RGR A;  1PFP A;  2YFI B;  4HZ9 B;  5I97 A;  3I55 3;  1W02 A;  3K63 A;  1VQL 3;  2E2V A;  3NV0 B;  1QAF A;  2Z7A A;  4R4K A;  4R9L A;  1RRH A;  3K7C A;  1WMN A;  4K90 B;  4WYK A;  2W56 A;  3HI7 A;  1JKG A;  3JUN A;  1RN7 A;  5AII A;  3NQZ A;  3MYT A;  5AIH A;  1EA2 A;  1DYU A;  1FGO A;  3N9H A;  4MEI A;  3DGN A;  5JPP A;  4HM0 B;  1A2V A;  3DZL A;  1R4C A;  3KN4 A;  1IU7 A;  1Q81 4;  1DVC A;  4GB5 A;  1WNH A;  3NBR A;  2HML B;  1JB5 A;  1W01 A;  3Q2P A;  4HM6 B;  5ELU A;  4MMY B;  4O2H A;  3DGL A;  3KSE D;  4NRE A;  1OF5 A;  1JV2 B;  1W6G A;  3FG1 A;  2K0M A;  3NX0 A;  3I56 3;  1SJW A;  2BO9 B;  1Z1S A;  5CLK A;  3G71 3;  2O9U X;  1AVK A;  3X40 A;  4HBR A;  1GYB A;  1N9E A;  1GD3 A;  2BHM A;  2RCD A;  3Q90 A;  1W00 A;  5IW9 A;  4HM8 B;  1YIJ 3;  2P38 A;  4N6U A;  2Y73 A;  3NM7 A;  2XRX B;  2WOF A;  1FGT A;  1ROA A;  2GEX A;  1UUW B;  3UL6 A;  1NB5 I;  3F7X A;  3HK4 A;  3M8C A;  2GEY A;  2PNC A;  3AMO A;  3O8Y A;  3CPW 2;  3F8X A;  2CWT A;  1SQW A;  2ZL8 A;  3QRD A;  2KCD A;  2HMJ B;  1LOX A;  3PYJ A;  5CF1 A;  1T5Y A;  4LMI A;  1GY6 A;  1IDP A;  2MC8 A;  5JPU A;  1GY5 A;  1LNH A;  1JN5 B;  3D9R A;  3DGM A;  2OOV A;  1W6C A;  3FZW A;  2JQ5 A;  1US1 A;  5G2G A;  1K28 A;  3X3Y A;  1QAK A;  4WFO A;  5IG3 A;  1K73 4;  3LTD A;  4I4K A;  3L0R A;  1S5A A;  5IEN A;  4HZB B;  4L7K A;  4XB5 A;  5IEO A;  2QIY A;  2XR8 B;  4JRF A;  4IPB A;  1AV4 A;  2YX9 A;  3F7S A;  3LH4 A;  3DXO A;  4AEQ A;  3FGY A;  3EB8 A;  2OWP A;  1KWI A;  3BLZ A;  3MWZ A;  1JB2 A;  1SII A;  2P09 A;  3B8L A;  3FF0 A;  1S72 3;  2OOV C;  2CFL A;  5IG5 A;  3FSD A;  1RKY A;  3LXU X;  2WO0 A;  5KP1 A;  3GZX B;  3E99 A;  4G1M B;  3K5T A;  3CPO A;  4N6T A;  1VQN 3;  4XBX A;  1A67 A;  1NDO B;  2CFD A;  3FKA A;  4X2O A;  3PCS A;  1YVB I;  2IMJ A;  5D83 A;  1VQ8 3;  2CFG A;  3CCL 3;  5FGO A;  1KD1 4;  2BT3 A;  4EXR A;  2W03 A;  3F8H A;  4OVM A;  3JUP A;  4MMX B;  1IVW A;  4O02 B;  3B4P A;  2WGO A;  2ML6 A;  2HMO B;  3DM8 A;  5CK6 A;  1FA3 A;  2RSX A;  3J7Y d;  1W5Z A;  1QVG 2;  4L8P A;  3D3L A;  3GZY B;  4FCZ A;  3HZP A;  3EN8 A;  4CDL A;  2WOH A;  4XDW A;  2CW9 A;  1Q82 4;  1EG9 B;  1OHP A;  4AKY A;  3LTB A;  5JBS A;  1STD A;  3N8B A;  1K8A 4;  1IV7 A;  2CFW A;  3FG3 A;  5KP4 A;  1FGR A;  3CCQ 3;  1O7W B;  3JUO A;  1ULI B;  2R4I A;  4K1V A;  5AIF A;  3MSO A;  2E2T A;  4HM1 B;  1VQP 3;  2W56 B;  3CC4 3;  1OF5 B;  1TFO A;  3G16 A;  3VGN A;  4FMA A;  4FMD A;  1OUN A;  3EJV A;  4HM5 B;  1V74 A;  3JVC A;  1RJO A;  1A90 A;  3EN1 B;  3Q1C A;  1J2B A;  1DMN A;  1M90 4;  5BVB A;  4J9A A;  2W0Q A;  1FGQ A;  1YIT 3;  1VQ4 3;  3CCE 3;  2QGU A;  1TUH A;  3A76 A;  1YJW 3;  1OGX A;  2OTJ 3;  2HMK B;  4HKV B;  3S28 A;  4QWT A;  3MG1 A;  1IT8 A;  4PEJ A;  4LGQ A;  2PZV A;  4RBN A;  1UI8 A;  2B1X B;  2CC3 A;  1U5O A;  5IG4 A;  4BTY A;  2Z6B A;  4RZM A;  2XGL A;  3EE1 A;  5TGN A;  3FG4 A;  5DRE A;  2CG1 A;  1IV9 A;  3B7C A;  4X2H A;  5FW5 A;  4R80 A;  3LYG A;  1Q42 A;  1ASK A;  1OAC A;  1OHO A;  4MMZ B;  2C11 A;  3WMD A;  1LVN A;  4WP5 A;  3NV0 A;  3U97 A;  1FUW A;  4R9K A;  1NJI 4;  3V99 A;  1LXE A;  3T8N A;  2XFT A;  2Z77 A;  1VZZ A;  2P0M A;  3IPT A;  3EQQ B;  2GU1 A;  2W6J H;  3MPH A;  2IUJ A;  3S5C A;  3STD A;  3T8U A;  1ISK A;  2WGQ A;  1ZX2 A;  3MKI A;  1CYV A;  4LSO A;  3B4O A;  3G6E 3;  3LOY A;  1JB4 A;  1E97 A;  3JUQ A;  3UB1 A;  3CC2 3;  3OX9 A;  3X42 A;  3CMA 3;  1JKG B;  3OWU A;  3OWS A;  4XBY A;  7STD A;  2CG0 A;  1JRQ A;  1W4N A;  1FGM A;  2UX0 A;  4FR9 A;  3G0K A;  4N6N B;  1N8Q A;  3BB9 A;  4K1U A;  3VF1 A;  1TIJ A;  2W2C A;  3BND A;  3RDE A;  1RRL A;  4GL6 A;  5KP3 A;  4LEH A;  4EBG A;  3WDG B;  1KC8 4;  1ZO2 A;  3CCS 3;  1VQK 3;  1IVU A;  3G4S 3;  1NO3 A;  3FH1 A;  1YJN 3;  3CME 3;  2V1L A;  3RGA A;  2A15 A;  3PGB A;  3EBT A;  6STD A;  1CYU A;  1NU3 A;  3FF2 A;  3HIG A;  3NHX A;  4NHF A;  3JUM A;  2CH9 A;  4RNZ A;  4ORL A;  2IA7 A;  3X3X A;  1UI7 A;  2Y74 A;  3F14 A;  3CC7 3;  4WHA A;  3U1W A;  4HM7 B;  8CHO A;  3EX9 A;  3ER7 A;  4FCM A;  2HMN B;  3BNB A;  1ROV A;  1YI2 3;  5AYS C;  1O7G B;  2XH9 A;  3OWY A;  2CFK A;  2KRT A;  2L4V A;  3S67 A;  4XBT A;  2OTL 3;  4EV5 A;  4J8T A;  2ZDJ A;  1YHQ 3;  4EV2 A;  3KII A;  1QMA A;  3NM2 A;  3GWR A;  2CKF B;  1W2Z A;  2FXT A;  1VQ5 3;  4HM4 B;  4FCJ A;  1E3R A;  1QJG A;  2P05 A;  3MG3 A;  3EBY A;  3S27 A;  5HGR A;  1IK3 A;  4XDV A;  4N6L A;  3CNM A;  1C7H A;  1UUV B;  3CNX A;  2BMO B;  3MG2 A;  3UNL A;  3CXC 2;  1WMO A;  4H3U A;  3SX1 A;  2MF7 A;  2FGT A;  2LQV A;  1UW1 A;  3SOA A;  1DMQ A;  3AMO B;  3FCS B;  3KSP A;  3LTC A;  5AEW B;  3KZT A;  4WYK B;  3BNE A;  5DRV A;  3SVA A;  3MHE A;  1VQM 3;  1IQ8 A;  3H51 A;  3PZW A;  3ROB A;  1W2B 2;  4XM4 A;  3WOD G;  1JN5 A;  1D6Y A;  1OGZ A;  4HYZ A;  4MJD A;  4OUQ A;  3UL5 A;  3NUV A;  3SXX A;  3DY5 A;  1K41 A;  2XF3 A;  3DGO A;  1O7P B;  2BMR B;  4O8S A;  1N8R 4;  1TFK A;  4CCV A;  3T0U A;  3V98 A;  3TDG A;  1MOL A;  5STD A;  1TP6 A;  2I9W A;  5AI1 A;  2YFL B;  1O7M B;  4N3V A;  1CEW I;  4KFD A;  5EQL A;  2INX A;  4ZM8 A;  1KQS 2;  3I0Y A;  4HM3 B;  3OW2 2;  1E3V A;  2OCT A;  3X3Z A;  2BNG A;  1JJ2 2;  3NXJ A;  2STD A;  4N6O B;  5D81 A;  2XFS A;  5LC6 A;  4IT7 A;  1DVD A;  4IIA A;  4H61 A;  3CCJ 3;  3ALA A;  4KZ1 A;  1WQL B;  2RFR A;  1IVX A;  2CHC A;  5AIG A;  3CCV 3;  2QA4 3;  4HVN A;  3DUK A;  2F98 A;  1AVL A;  2OQE C;  3UJM A;  3EHC A;  2CWV A;  4KFE A;  1CQS A;  1WTH A;  1PU4 A;  3SLU A;  1GD4 A;  3LZA A;  1OH0 A;  1ULJ B;  2W9P A;  2GBX B;  5EVH A;  2BMQ B;  4EYC A;  4KVH A;  1Q40 B;  4STD A;  2GBW B;  3PS8 A;  1U8C B;  3WOE B;  4JF8 A;  3NBJ A;  2QEX 3;  3CCU 3;  2F99 A;  3H3H A;  2CK3 H;  2E2U A;  4WWU C;  1EKM A;  1W7C A;  4FMB A;  1M1K 4;  2RGQ A;  2XSH B;  3CCR 3;  2Q07 A;  2C10 A;  3K9M C;  2LYX A;  3WA3 A;  1JNQ A;  3SED A;  1Q40 A;  5ELJ A;  4LZI A;  1O7H B;  1WMP A;  3ECF A;  3EC9 A;  1Q86 4;  1HU9 A;  1OPY A;  3V92 A;  1QVF 2;  2KXG A;  5IER A;  4L8O A;  4Q53 A;  2CIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...