4J9AA

Engineered digoxigenin binder dig10.3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
122
Chain Sequence
b'NAKEIVVHALRLLENGDARGWSDLFHPEGVLEYPYPPPGYKTRFEGRETIWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAYDYIAVWRTRDGQILLYRLFFNPLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered Digoxigenin binder protein DIG10.3
publication title Computational design of ligand-binding proteins with high affinity and selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Digoxigenin binding protein
total genus 32
structure length 122
sequence length 122
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4j9aA00
5EVHA 3B8LA 4XBTA 2XSHB 4LMIA 1W6YA 4WP5A 1QJGA 3NXJA 1OHSA 3NV0A 4IIAA 4U13A 3FF0A 3T8UA 1DMQA 4HKVB 3UNLA 5STDA 3UJMA 5KP4A 4J9AA 3OV4A 3I0YA 1GYBA 2GEXA 1STDA 5D81A 4HM2B 4XDVA 3G8ZA 3KE7A 4WWUC 4XBXA 5AIIA 2B24B 1C7HA 4HM6B 1ISKA 3SOYA 3H3HA 5D82A 5IG3A 3NV0B 1ASKA 3NBRA 1GY6A 1JN5A 1JB4A 5HGRA 4XB5A 1O7HB 4FCJA 1O7PB 1OCVA 2Z7AA 4STDA 1U5OA 3F8XA 3ECFA 5BVBA 5JPPA 2RGQA 5BXQA 5JPUA 4WYKB 1GS3A 1S5AA 4HJLB 3D9RA 4HM4B 4HM1B 1Z1SA 2Z77A 4HM7B 1TP6A 4XDWA 3EN8A 1OHOA 3ROBA 1VZZA 1Q40B 1O7GB 2BMRB 3KZTA 2B1XB 5G2GA 2HMOB 1SJWA 1OF5B 2XR8B 3GWRA 2RFRA 4RZMA 2XRXB 3F8HA 2F86B 3JUMA 3LYGA 2W2CA 3KSPA 2INXA 3EQQB 3LZAA 1W00A 8CHOA 4K1VA 3RGAA 4R9LA 4HZ9B 4PEJA 4HZBB 4MJDA 7STDA 4OUQA 1NU3A 4LGQA 3CU3A 3F9SA 5AIGA 3MSOA 4R1KA 3B4PA 3VGNA 1O7NB 4H3UA 3NUVA 1JB2A 4GB5A 5CXOA 3EF8A 2BNGA 3F40A 2F98A 5IG5A 3EJVA 4FCMA 2RCDA 3GZXB 3M8CA 3F14A 3B7CA 3G16A 5IG4A 5CK6A 2STDA 3BB9A 3CPOA 1OGXA 1Q42A 1JKGA 3EHCA 2R4IA 3HX8A 5CF1A 1GY5A 3STDA 5AIFA 1ZX2A 2IMJA 1E3VA 1DMNA 1NDOB 1O7WB 2PZVA 3MYTA 3CNXA 3G0KA 3K7CA 3RGRA 3EBTA 3SOAA 1CQSA 4HM5B 2XSOB 3A76A 1JN5B 5KP3A 2YFIB 3MG1A 4X2HA 3KKGA 1OUNA 3GZBA 3F7XA 1OHPA 2K54A 3ER7A 5FW5A 3GZYB 3NHXA 1HKXA 3EN1B 3DM8A 1ULJB 4HVNA 5AI1A 3GZRA 1AR0A 3EBYA 4J8TA 3JUOA 1UUWB 4ORLA 5DREA 5CF2A 3EX9A 3FZWA 2JQ5A 1IDPA 3Q90A 5IERA 5IEPA 2YFJB 3BLZA 3FKAA 3OWYA 4N3VA 3EC9A 5AIHA 3B4OA 1OH0A 3JUNA 3MHEA 3H51A 3MG3A 5D83A 1A2KA 1NWWA 2HMMB 4HM8B 4HM3B 3IPTA 3DUKA 1O7MB 4Q53A 1W01A 4L8OA 2GBXB 3CNMA 1ZO2A 4OVMA 2F99A 4L8PA 5IG0A 1EA2A 3FF2A 1QMAA 3FH1A 2YFLB 2HMNB 3JUPA 1DMMA 3K0ZA 4KVHA 4XM4A 3DMCA 3FGYA 2I9WA 3HK4A 3OWSA 4WYKA 3OWUA 3NM2A 5IEOA 1OPYA 1WQLB 3OXAA 1GY7A 2GXFA 3MG2A 5IENA 1K41A 4CDLA 3WMDA 2GEYA 1UUVB 1BUQA 5AEWB 5CLKA 1OGZA 3S5CA 3OX9A 1Q40A 2BMOB 4R9KA 5DRVA 5AEUB 4X2OA 4K1UA 4I4KA 4XBYA 2GBWB 2QIYA 2UX0A 1TUHA 1OF5A 4HM0B 1JKGB 2HMLB 2CKFB 3FSDA 3E99A 1EG9B 3DXOA 3GRDA 3JUQA 1E3RA 2CHCA 2HMJB 3F7SA 3FLJA 2A15A 3SEDA 3MKIA 2BMQB 2Z76A 2QGUA 5KP1A 5IF6A 2OWPA 3T8NA 6STDA 5TGNA 1E97A 3HZPA 4L7KA 3VSYA 2HMKB 3DZLA 1JB5A 1W02A 1ULIB 4LEHA
chains in the Genus database with same CATH superfamily
1A2PA 2FGTA 3N9HA 1SPUA 3Q2PA 2ZDJA 1LXEA 3PCRA 4LZIA 5EVHA 3GSPA 1QAFA 2ML6A 1TTOA 1NB5I 1SIIA 3B8LA 4XBTA 1AVLA 2XSHB 5JBSA 2V1LA 3NX0A 2IA7A 4LMIA 1W6YA 4WP5A 1QJGA 1M9GA 3D79A 3NXJA 1FUSA 1OHSA 3D4AA 1RGAA 3NV0A 4NPBA 4IIAA 2CW9A 5LC6A 4U13A 4FMBA 3FF0A 3T8UA 1DMQA 3HOHA 4HKVB 3X40A 2FXTA 1T5YA 3FCSB 3IMAB 3KSED 1UDII 3UNLA 2GU3A 3Q3FA 5STDA 1IQYA 3WOFB 3UJMA 2KCDA 1HU9A 5KP4A 4J9AA 3OV4A 3I0YA 1GYBA 3UB1A 1Q824 2P09A 1Q814 4KT3B 1BVIA 1IV7A 4GHOA 2GEXA 4J5KA 1STDA 5D81A 1WMNA 4HM2B 3G4S3 4XDVA 1N8QA 3X42A 3G8ZA 3CPW2 3DY5A 3K63A 1UI8A 3KE7A 1B27A 1N5HA 1T2IA 4WWUC 1TRPA 4XBXA 1I2EA 2W56A 4KFEA 3HI7A 1PY3A 3CC23 3DH2A 5AIIA 2B24B 1C7HA 4EXRA 1BNJA 4HM6B 1ISKA 3SOYA 3H3HA 2OQEC 5D82A 5IG3A 4R4KA 3NV0B 1A2VA 2CFWA 1ASKA 3NBRA 3NQZA 1GY6A 1JN5A 1JB4A 5HGRA 1M1K4 1B21A 4XB5A 1D6YA 1O7HB 1DYUA 4FCJA 4OK0A 3CCJ3 1O7PB 1UW1A 2W04A 2Z6BA 3UL6A 1OCVA 2WOHA 2Z7AA 5EQLA 1ROAA 4STDA 2WGOA 1U5OA 1RRLA 3F8XA 1W4NA 5BIRA 3DGNA 3LXUX 3U1WA 2W9PA 2CFGA 4DKIA 1BOXA 3LTDA 1QALA 3ECFA 5BVBA 2OOVA 5JPPA 1BSEA 1VQL3 2RGQA 1LOWA 5BXQA 5JPUA 3TDGA 1IV9A 4EYCA 2BT3A 4WYKB 1IU7A 1GS3A 8RNTA 1GD3A 1S5AA 1RGGA 2CC3A 1W2ZA 4HJLB 1IQ8A 3PXMA 2H0IA 1V57A 2F56A 1BSCA 4J5GA 1KWIA 1X1XA 3D3LA 3D9RA 3KFQC 4HM4B 1D6UA 4LSOA 5ELUA 3K9MC 4HM1B 2Q07A 4GSPA 5M1AA 1BSAA 4LYLB 1NO3A 1Z1SA 2Z77A 1RN7A 1TP6A 4HM7B 3HIGA 4N6OB 1RRHA 1YI23 3QRDA 3JVCA 4XDWA 3EN8A 1JBTA 2UUGC 1OHOA 2R41A 3BU4A 3ROBA 3WDGB 1BNSA 2ZL8A 1VZZA 1Q40B 1VQQA 2LYXA 1O7GB 2KF6A 2XGLA 5RNTA 3IJEB 4R80A 4BIRA 1IQXA 2BMRB 2F5MA 1LQMB 3X41A 1UGHI 1QAKA 2CFKA 1BNGA 3KZTA 2B1XB 2SARA 2HMOB 5G2GA 3L0RA 1R4YA 1VQK3 1RNTA 2Y74A 4N6TA 3AGNA 1RJOA 1SJWA 1OF5B 2LQVA 1VQ83 4N6NB 3WHOA 2XR8B 2ZA4A 2RBIA 1W6GA 3GWRA 2RFRA 4RZMA 1CYUA 2XRXB 3F8HA 1IVXA 2F86B 3JUMA 3LYGA 2IYJA 2W2CA 3DGOA 1IVWA 1TRQA 3WR2A 3KSPA 1AQZA 1Y4KA 1G0TA 1W7CA 2INXA 4BU4A 5A0OB 1RKYA 3EQQB 3FG3A 3LZAA 1WMPA 1W00A 1FGMA 1BNRA 1BGSA 8CHOA 2P0MA 1UI7A 4K1VA 3RGAA 4AKYA 1W6CA 1MWUA 4HBRA 4R9LA 2RNTA 2SBLA 3CD63 1DE3A 1BU4A 1LNHA 1U8CB 4HZ9B 4PEJA 1EEJA 2F4YA 1YHQ3 4HZBB 1GMPA 1IYYA 4O2HA 3D5GA 3ZG0A 1JNQA 4RNZA 1JBSA 4MJDA 7RNTA 3DGLA 7STDA 1FYSA 4OUQA 2RSXA 1NU3A 4LGQA 1V74A 3CU3A 3F9SA 1RTUA 2C10A 4AKZA 3NM7A 5AIGA 3CCE3 1NJI4 3MSOA 4R1KA 1BRNL 2E2VA 3B4PA 4NREA 2XEPA 1BANA 3VGNA 3V99A 1O7NB 1Q9EA 2W0QA 3BIRA 6GSPA 1RN4A 4H3UA 1EQKA 1YIT3 1GOUA 1UGIA 3Q1CA 1B2MA 5G1KA 3AGOA 1AY7A 3NUVA 2PNCA 1JB2A 1YJ93 4FR9A 3EE1A 1BRJA 2MC8A 3AHSA 4GB5A 3I553 1JZDA 2CFLA 1M904 4K90B 3WA3A 5CXOA 4BL2A 1L5GB 1MWSA 1WNHA 4FMCA 1SARA 1FGOA 3EF8A 3CC43 3N54B 2BHMA 2BNGA 3F40A 2F98A 1X1YA 5IG5A 1VQM3 4WFOA 1I0VA 1PFPA 1STFI 3S29A 5M18A 4EV2A 3EJVA 1RGHA 2O9UX 1VQN3 1RSNA 3NQYA 3CCV3 3X3YA 1GOVA 4FCMA 1RCLA 2RCDA 2ZHXB 3GZXB 3O8YA 3M8CA 1Q7HA 3F14A 3D5IA 3B7CA 1I2FA 2D42A 4QWTA 3G16A 4WHAA 3EB8A 4JF8A 4RBNA 2STDA 5CK6A 5IG4A 3BB9A 1YIJ3 1UUGB 2C4BA 2KXGA 3CPOA 3V92A 1GD4A 1OGXA 1JJ22 1BNEA 1Q42A 1JKGA 5HOHA 1GMRA 1JRQA 4RNTA 1KD14 1CH0A 3RDEA 1RGFA 3EHCA 2R4IA 3HX8A 2P38A 5CF1A 1GY5A 1J2BA 1NNVA 3STDA 2XH9A 3KN4A 1M1XB 3LMLA 4RNYA 1HZ1A 3CMA3 5AIFA 2WOFA 4TX4A 1LRAA 1ZX2A 4I5QA 2IMJA 1RMSA 1E3VA 1VQP3 3S27A 1DMNA 1NDOB 2XGNA 1N5PA 1S723 1O7WB 3MWZA 2PZVA 4AEQA 1X1WA 1RGKA 2F5WA 4KFFA 3MYTA 1FA3A 2CX1A 3CNXA 5AYRB 2W56B 2KF3A 3G0KA 3K7CA 3WA2X 2YX9A 1US1A 1LOVA 1W5ZA 4H61A 1MWRA 1YVSA 5FGOA 2L1SA 3RGRA 3EBTA 4N6UA 3SOAA 1ZGXA 1RGLA 1CQSA 1BIRA 1B2ZA 2KF5A 4HM5B 1VQ63 2XSOB 3CCL3 1VQ73 3CCQ3 3A76A 1JN5B 5G1LA 4BL3A 1C54A 1NB3I 1SIHA 2IUJA 3V98A 3DGMA 3MPHA 2YFIB 3MG1A 5KP3A 3VF1A 4X2HA 1RCKA 1VQ53 3KKGA 1FGRA 1OUNA 2CWUA 1YGEA 1BSBA 3GZBA 3F7XA 1VQO3 1KQS2 1OHPA 4IPBA 1JV2B 2K54A 2XF3A 3K5TA 3ER7A 2O3OA 5IW9A 2ML5A 3U97A 3UL5A 5FW5A 3CC73 1VQ43 3S67A 3GZYB 3NHXA 1HKXA 3EN1B 5EEOA 3AMOA 3DM8A 3LT8A 1ULJB 4KZ1A 4HVNA 2J8XB 1BRKA 1WMOA 3CCM3 5AI1A 3GZRA 1AR0A 3EBYA 4J8TA 2AAEA 1I70A 1IK3A 3JUOA 1DVDA 3NBBA 1UUWB 4ORLA 6RNTA 5DREA 1BNFA 1BRSA 5CF2A 3EX9A 2P05A 3FZWA 2OOVC 4NHFA 2H0HA 2JQ5A 2E2UA 1IVVA 1IDPA 2CFDA 2CH9A 3Q90A 3PZWA 4ILFA 5IERA 1QVF2 5IEPA 1JBRA 1B20A 2YFJB 3BLZA 2CK3H 2HOHA 3FKAA 1FUTA 3OWYA 5LC7A 4BTYA 4N3VA 4CCVA 1W2B2 4O8SA 1KC84 1V58A 3SXXA 3EC9A 5AIHA 1HYFA 4O3VA 3B4OA 2W03A 2XFSA 4G1MB 1F8NA 1R4CA 1OH0A 3JUNA 2CWTA 2OCTA 3MHEA 4K61A 3H51A 1B3SA 3MG3A 4HYZA 5ELJA 5D83A 1RN1A 3LT9A 3RNTA 3LTCA 2BIRA 2CIUA 1A2KA 3LTBA 2W9QA 3SLUA 1DETA 2OQEA 1BAOA 4N6V0 3PYJA 1NWWA 2HMMB 4HM8B 1BRHA 4HM3B 4JRFA 3URPA 1SQWA 3KCHA 3PS8A 1G02A 3IPTA 3ALAA 3DUKA 1EKMA 3X3XA 2KF4A 9RNTA 1MWTA 1O7MB 3BNEA 1KSIA 4Q53A 2OTL3 1B2SA 3BNBA 2KAAA 1W01A 4L8OA 1QVG2 4MMXB 2GBXB 3PGBA 1IT7A 5AYSC 1B2XA 3CNMA 1I3FA 1ZO2A 1BRIA 4OVMA 2F99A 1I2GA 1G96A 4L8PA 4MMYB 1FUWA 2GSPA 3CCR3 5IG0A 1MNLA 3HIIA 1RNBA 2Y73A 3ZFZA 2MF7A 3S28A 2CG0A 1LQGC 3PCSA 1PU4A 3QK9A 1EA2A 1TIJA 4BTWA 7GSPA 4EC6A 3FF2A 2WO0A 4BTXA 1BSDA 1QMAA 3FH1A 4ZM8A 2YFLB 2HMNB 1EUIC 1DMMA 1GSPA 2JDIH 3JUPA 3K0ZA 4KVHA 4XM4A 2FNQA 3A5EA 3DMCA 3FGYA 2GU1A 2I9WA 1RLSA 1FZUA 3HK4A 3CCS3 4MMZB 1YVBI 1JZOA 2BO9B 3BNCA 3OWSA 4WYKA 3CME3 3LH4A 3OWUA 1I0XA 3NM2A 1MGRA 3LOYA 3GAXA 5IEOA 2CWVA 1FGQA 4EW5A 1OPYA 2KRTA 5I97A 3J7Yd 1WQLB 3OXAA 4IT7A 1RDSA 1AVKA 4EBGA 1GY7A 2QEX3 2BU4A 3BNDA 2GXFA 3MG2A 5IENA 1I8VA 1ROVA 1FGTA 3DGYA 2C11A 3LTAA 1K41A 2H0GA 3WMDA 4CDLA 1I3IA 1UUVB 2GEYA 1BUQA 1UCLA 5AEWB 5CLKA 1GOYA 4HAAA 4MEIA 1D6ZA 1OGZA 3S5CA 4FCZA 3OX9A 1Q40A 2BMOB 4R9KA 5DRVA 5AEUB 1YJW3 1B2UA 1K9M4 1WTHA 4X2OA 1Q864 1UCJA 2WGQA 4K1UA 3N8BA 4I4KA 4XBYA 1GMQA 1TJDA 2K0MA 2GBWB 2QIYA 1UCIA 2UX0A 5BU4A 2OTJ3 3G713 1LOYA 1RHLA 1TUHA 3X3ZA 1TFOA 4CJNA 1OF5A 3AHWA 3CXC2 1T2HA 1A90A 4HM0B 1JKGB 2P0XA 1OACA 1T3BA 4HOHA 1CYVA 2HMLB 3ZG5A 2CKFB 3FSDA 1BRGA 2CG1A 3E99A 1EG9B 4FMDA 3SYUA 1A67A 1BUJA 2QA43 1N8R4 3DXOA 3GRDA 2E2TA 1MOLA 3JUQA 4N6LA 1E3RA 1FW7A 2CHCA 3WOEB 2HMJB 1UCKA 3F7SA 3WODG 4EV5A 3FLJA 1N9JA 1DVCA 2W6JH 5GSPA 2A15A 3SEDA 2IUKA 1VQ93 3MKIA 1LOXA 1TFKA 4GL6A 2BMQB 2Z76A 1YJN3 3KIIA 1Q7Y4 2D1WA 3OW22 1AV4A 2K3DA 1BNIA 3CCU3 1TU5A 2QGUA 3FG4A 1YGWA 5KP1A 2L4VA 3SVAA 5IF6A 4CPKA 2OWPA 3T8NA 1IVUA 1YNVX 4FMAA 2M7OA 3NBJA 4KFDA 5TGNA 6STDA 1X1UA 2CX0A 3T0UA 2UGIA 3SX1A 5M19A 3FG1A 2AADA 1E97A 3HZPA 4L7KA 1RGCA 3VSYA 1LNIA 1N9EA 1K8A4 2HMKB 3DZLA 4O02B 2IY2A 1IT8A 1ZS7A 2XFTA 4N6MA 1MGWA 1K734 1JB5A 1W02A 1PYLA 3AMOB 1ULIB 3G6E3 1LVNA 3I563 1K28A 1RGEA 1CEWI 4LEHA
chains in the Genus database with same CATH topology
2FGTA 3N9HA 1SPUA 3Q2PA 2ZDJA 1LXEA 3PCRA 4LZIA 5EVHA 1QAFA 2ML6A 1NB5I 1SIIA 3B8LA 4XBTA 1AVLA 2XSHB 5JBSA 2V1LA 3NX0A 2IA7A 4LMIA 1W6YA 4WP5A 1QJGA 1M9GA 3NXJA 1OHSA 3NV0A 4IIAA 2CW9A 5LC6A 4U13A 4FMBA 3FF0A 3T8UA 1DMQA 4HKVB 3X40A 2FXTA 1T5YA 3FCSB 3IMAB 3KSED 3UNLA 2GU3A 5STDA 1IQYA 3WOFB 3UJMA 2KCDA 1HU9A 5KP4A 4J9AA 3OV4A 3I0YA 1GYBA 3UB1A 1Q824 2P09A 1Q814 1IV7A 2GEXA 1STDA 5D81A 1WMNA 4HM2B 3G4S3 4XDVA 1N8QA 3X42A 3G8ZA 3CPW2 3DY5A 3K63A 1UI8A 3KE7A 1N5HA 4WWUC 4XBXA 4KFEA 2W56A 3HI7A 3CC23 5AIIA 2B24B 1C7HA 4EXRA 4HM6B 1ISKA 3SOYA 3H3HA 2OQEC 5D82A 5IG3A 4R4KA 3NV0B 1A2VA 2CFWA 1ASKA 3NBRA 3NQZA 1GY6A 1JN5A 1JB4A 5HGRA 1M1K4 4XB5A 1D6YA 1O7HB 1DYUA 4FCJA 4OK0A 3CCJ3 1O7PB 1UW1A 2W04A 2Z6BA 3UL6A 1OCVA 2WOHA 2Z7AA 5EQLA 1ROAA 4STDA 2WGOA 1U5OA 1RRLA 3F8XA 1W4NA 3DGNA 3LXUX 3U1WA 2W9PA 2CFGA 3LTDA 1QALA 3ECFA 5BVBA 2OOVA 5JPPA 1VQL3 2RGQA 5BXQA 5JPUA 3TDGA 1IV9A 4EYCA 2BT3A 4WYKB 1IU7A 1GS3A 1GD3A 1S5AA 2CC3A 1W2ZA 4HJLB 1IQ8A 3PXMA 1KWIA 3D3LA 3D9RA 3KFQC 4HM4B 4LSOA 1D6UA 5ELUA 3K9MC 4HM1B 2Q07A 1NO3A 1Z1SA 2Z77A 1RN7A 1TP6A 4HM7B 3HIGA 4N6OB 1RRHA 1YI23 3QRDA 3JVCA 4XDWA 3EN8A 1OHOA 3ROBA 3WDGB 2ZL8A 1VZZA 1Q40B 2LYXA 1O7GB 2XGLA 3IJEB 4R80A 1IQXA 2BMRB 3X41A 1QAKA 2CFKA 3KZTA 2B1XB 5G2GA 2HMOB 3L0RA 1VQK3 2Y74A 4N6TA 1RJOA 1SJWA 1OF5B 2LQVA 1VQ83 4N6NB 2XR8B 1W6GA 3GWRA 2RFRA 4RZMA 1CYUA 2XRXB 3F8HA 1IVXA 2F86B 3JUMA 3LYGA 2W2CA 3DGOA 1IVWA 3KSPA 1W7CA 1Y4KA 2INXA 5A0OB 1RKYA 3EQQB 3FG3A 3LZAA 1WMPA 1W00A 1FGMA 8CHOA 2P0MA 1UI7A 4K1VA 3RGAA 4AKYA 1W6CA 4HBRA 4R9LA 3CD63 2SBLA 1LNHA 1U8CB 4HZ9B 4PEJA 1YHQ3 4HZBB 4O2HA 1JNQA 4RNZA 4MJDA 3DGLA 7STDA 4OUQA 2RSXA 1NU3A 4LGQA 1V74A 3CU3A 3F9SA 2C10A 4AKZA 3NM7A 5AIGA 3CCE3 1NJI4 3MSOA 4R1KA 2E2VA 3B4PA 4NREA 2XEPA 3VGNA 3V99A 1O7NB 2W0QA 4H3UA 1EQKA 1YIT3 3Q1CA 3NUVA 2PNCA 1JB2A 1YJ93 4FR9A 3EE1A 2MC8A 4GB5A 3I553 2CFLA 1M904 4K90B 3WA3A 5CXOA 1L5GB 1WNHA 4FMCA 1FGOA 3EF8A 3CC43 3N54B 2BHMA 2BNGA 3F40A 2F98A 5IG5A 1VQM3 4WFOA 1PFPA 1STFI 3S29A 4EV2A 3EJVA 2O9UX 1VQN3 3NQYA 3CCV3 3X3YA 4FCMA 2RCDA 3GZXB 3O8YA 3M8CA 3F14A 3B7CA 2D42A 4QWTA 3G16A 4WHAA 3EB8A 4JF8A 4RBNA 2STDA 5CK6A 5IG4A 3BB9A 1YIJ3 2KXGA 3CPOA 3V92A 1GD4A 1OGXA 1JJ22 1Q42A 1JKGA 1JRQA 1KD14 3RDEA 3EHCA 2R4IA 3HX8A 2P38A 5CF1A 1GY5A 1J2BA 3STDA 2XH9A 3KN4A 1M1XB 3LMLA 4RNYA 3CMA3 5AIFA 2WOFA 4TX4A 1ZX2A 2IMJA 1E3VA 1VQP3 3S27A 1DMNA 1NDOB 2XGNA 1N5PA 1S723 1O7WB 3MWZA 2PZVA 4AEQA 4KFFA 3MYTA 1FA3A 3CNXA 5AYRB 2W56B 3G0KA 3K7CA 3WA2X 2YX9A 1US1A 1W5ZA 4H61A 5FGOA 3RGRA 3EBTA 4N6UA 3SOAA 1CQSA 4HM5B 1VQ63 2XSOB 3CCL3 1VQ73 3CCQ3 3A76A 1JN5B 1NB3I 1SIHA 2IUJA 3V98A 3DGMA 3MPHA 2YFIB 3MG1A 5KP3A 3VF1A 4X2HA 1VQ53 3KKGA 1FGRA 1OUNA 2CWUA 1YGEA 3GZBA 3F7XA 1VQO3 1KQS2 1OHPA 4IPBA 1JV2B 2K54A 2XF3A 3K5TA 3ER7A 2O3OA 5IW9A 2ML5A 3U97A 3UL5A 5FW5A 3CC73 1VQ43 3S67A 3GZYB 3NHXA 1HKXA 3EN1B 5EEOA 3AMOA 3DM8A 3LT8A 1ULJB 4KZ1A 4HVNA 1WMOA 3CCM3 5AI1A 3GZRA 1AR0A 3EBYA 4J8TA 3JUOA 1DVDA 3NBBA 1UUWB 4ORLA 5DREA 5CF2A 3EX9A 2P05A 3FZWA 2OOVC 4NHFA 2JQ5A 2E2UA 1IVVA 1IDPA 2CFDA 2CH9A 3Q90A 3PZWA 5IERA 1QVF2 5IEPA 2YFJB 5LC7A 3BLZA 2CK3H 3FKAA 3OWYA 4BTYA 4CCVA 1W2B2 4N3VA 4O8SA 1KC84 3SXXA 3EC9A 5AIHA 4O3VA 3B4OA 2W03A 2XFSA 4G1MB 1F8NA 1R4CA 1OH0A 3JUNA 2CWTA 2OCTA 3MHEA 4K61A 3H51A 3MG3A 4HYZA 5ELJA 5D83A 3LT9A 3LTCA 2CIUA 3LTBA 1A2KA 2W9QA 3SLUA 2OQEA 4N6V0 3PYJA 1NWWA 2HMMB 4HM8B 4HM3B 4JRFA 1SQWA 3PS8A 3IPTA 3ALAA 3DUKA 1EKMA 3X3XA 1O7MB 3BNEA 1KSIA 4Q53A 2OTL3 3BNBA 1W01A 4L8OA 1QVG2 4MMXB 2GBXB 3PGBA 1IT7A 5AYSC 3CNMA 1ZO2A 4OVMA 2F99A 1G96A 4L8PA 4MMYB 1FUWA 3CCR3 5IG0A 1MNLA 3HIIA 2Y73A 2MF7A 3S28A 2CG0A 3PCSA 1PU4A 3QK9A 1EA2A 1TIJA 4BTWA 4EC6A 3FF2A 2WO0A 4BTXA 4ZM8A 1QMAA 3FH1A 1IK3A 2YFLB 2HMNB 3JUPA 1DMMA 2JDIH 3K0ZA 4KVHA 4XM4A 2QEX3 2FNQA 3DMCA 3FGYA 2GU1A 2I9WA 3HK4A 3CCS3 4MMZB 1YVBI 2BO9B 3BNCA 3OWSA 4WYKA 3CME3 3LH4A 3OWUA 3NM2A 3LOYA 3GAXA 5IEOA 2CWVA 1FGQA 1OPYA 2KRTA 5I97A 3J7Yd 1WQLB 3OXAA 4IT7A 4EBGA 1AVKA 1GY7A 3BNDA 2GXFA 3MG2A 5IENA 1ROVA 1FGTA 2C11A 3LTAA 1K41A 4CDLA 3WMDA 2GEYA 1UUVB 1BUQA 5AEWB 5CLKA 4MEIA 1D6ZA 1OGZA 3S5CA 4FCZA 3OX9A 1Q40A 2BMOB 4R9KA 5DRVA 5AEUB 1YJW3 1K9M4 1WTHA 4X2OA 1Q864 2WGQA 4K1UA 3N8BA 4I4KA 4XBYA 2K0MA 2GBWB 2QIYA 2UX0A 2OTJ3 3G713 1TUHA 3X3ZA 1TFOA 1OF5A 3CXC2 1A90A 4HM0B 1JKGB 2P0XA 1OACA 1CYVA 2HMLB 2CKFB 3FSDA 2CG1A 3E99A 1EG9B 4FMDA 1A67A 2QA43 1N8R4 3DXOA 3GRDA 2E2TA 1MOLA 3JUQA 4N6LA 1E3RA 2CHCA 3WOEB 2HMJB 3F7SA 3WODG 4EV5A 3FLJA 1N9JA 1DVCA 2W6JH 2A15A 3SEDA 2IUKA 1VQ93 3MKIA 1LOXA 1TFKA 4GL6A 2BMQB 2Z76A 1YJN3 3KIIA 1Q7Y4 2D1WA 3OW22 1AV4A 3CCU3 1TU5A 2QGUA 3FG4A 5KP1A 2L4VA 3SVAA 5IF6A 2OWPA 3T8NA 1IVUA 4FMAA 2M7OA 3NBJA 4KFDA 5TGNA 6STDA 3T0UA 3SX1A 3FG1A 1E97A 3HZPA 4L7KA 3VSYA 1N9EA 1K8A4 2HMKB 3DZLA 4O02B 1IT8A 2XFTA 4N6MA 1K734 1JB5A 1W02A 3AMOB 1ULIB 3G6E3 1LVNA 3I563 1K28A 1CEWI 4LEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVH A;  3B8L A;  4XBT A;  2XSH B;  4LMI A;  1W6Y A;  4WP5 A;  1QJG A;  3NXJ A;  1OHS A;  3NV0 A;  4IIA A;  4U13 A;  3FF0 A;  3T8U A;  1DMQ A;  4HKV B;  3UNL A;  5STD A;  3UJM A;  5KP4 A;  4J9A A;  3OV4 A;  3I0Y A;  1GYB A;  2GEX A;  1STD A;  5D81 A;  4HM2 B;  4XDV A;  3G8Z A;  3KE7 A;  4WWU C;  4XBX A;  5AII A;  2B24 B;  1C7H A;  4HM6 B;  1ISK A;  3SOY A;  3H3H A;  5D82 A;  5IG3 A;  3NV0 B;  1ASK A;  3NBR A;  1GY6 A;  1JN5 A;  1JB4 A;  5HGR A;  4XB5 A;  1O7H B;  4FCJ A;  1O7P B;  1OCV A;  2Z7A A;  4STD A;  1U5O A;  3F8X A;  3ECF A;  5BVB A;  5JPP A;  2RGQ A;  5BXQ A;  5JPU A;  4WYK B;  1GS3 A;  1S5A A;  4HJL B;  3D9R A;  4HM4 B;  4HM1 B;  1Z1S A;  2Z77 A;  4HM7 B;  1TP6 A;  4XDW A;  3EN8 A;  1OHO A;  3ROB A;  1VZZ A;  1Q40 B;  1O7G B;  2BMR B;  3KZT A;  2B1X B;  5G2G A;  2HMO B;  1SJW A;  1OF5 B;  2XR8 B;  3GWR A;  2RFR A;  4RZM A;  2XRX B;  3F8H A;  2F86 B;  3JUM A;  3LYG A;  2W2C A;  3KSP A;  2INX A;  3EQQ B;  3LZA A;  1W00 A;  8CHO A;  4K1V A;  3RGA A;  4R9L A;  4HZ9 B;  4PEJ A;  4HZB B;  4MJD A;  7STD A;  4OUQ A;  1NU3 A;  4LGQ A;  3CU3 A;  3F9S A;  5AIG A;  3MSO A;  4R1K A;  3B4P A;  3VGN A;  1O7N B;  4H3U A;  3NUV A;  1JB2 A;  4GB5 A;  5CXO A;  3EF8 A;  2BNG A;  3F40 A;  2F98 A;  5IG5 A;  3EJV A;  4FCM A;  2RCD A;  3GZX B;  3M8C A;  3F14 A;  3B7C A;  3G16 A;  5IG4 A;  5CK6 A;  2STD A;  3BB9 A;  3CPO A;  1OGX A;  1Q42 A;  1JKG A;  3EHC A;  2R4I A;  3HX8 A;  5CF1 A;  1GY5 A;  3STD A;  5AIF A;  1ZX2 A;  2IMJ A;  1E3V A;  1DMN A;  1NDO B;  1O7W B;  2PZV A;  3MYT A;  3CNX A;  3G0K A;  3K7C A;  3RGR A;  3EBT A;  3SOA A;  1CQS A;  4HM5 B;  2XSO B;  3A76 A;  1JN5 B;  5KP3 A;  2YFI B;  3MG1 A;  4X2H A;  3KKG A;  1OUN A;  3GZB A;  3F7X A;  1OHP A;  2K54 A;  3ER7 A;  5FW5 A;  3GZY B;  3NHX A;  1HKX A;  3EN1 B;  3DM8 A;  1ULJ B;  4HVN A;  5AI1 A;  3GZR A;  1AR0 A;  3EBY A;  4J8T A;  3JUO A;  1UUW B;  4ORL A;  5DRE A;  5CF2 A;  3EX9 A;  3FZW A;  2JQ5 A;  1IDP A;  3Q90 A;  5IER A;  5IEP A;  2YFJ B;  3BLZ A;  3FKA A;  3OWY A;  4N3V A;  3EC9 A;  5AIH A;  3B4O A;  1OH0 A;  3JUN A;  3MHE A;  3H51 A;  3MG3 A;  5D83 A;  1A2K A;  1NWW A;  2HMM B;  4HM8 B;  4HM3 B;  3IPT A;  3DUK A;  1O7M B;  4Q53 A;  1W01 A;  4L8O A;  2GBX B;  3CNM A;  1ZO2 A;  4OVM A;  2F99 A;  4L8P A;  5IG0 A;  1EA2 A;  3FF2 A;  1QMA A;  3FH1 A;  2YFL B;  2HMN B;  3JUP A;  1DMM A;  3K0Z A;  4KVH A;  4XM4 A;  3DMC A;  3FGY A;  2I9W A;  3HK4 A;  3OWS A;  4WYK A;  3OWU A;  3NM2 A;  5IEO A;  1OPY A;  1WQL B;  3OXA A;  1GY7 A;  2GXF A;  3MG2 A;  5IEN A;  1K41 A;  4CDL A;  3WMD A;  2GEY A;  1UUV B;  1BUQ A;  5AEW B;  5CLK A;  1OGZ A;  3S5C A;  3OX9 A;  1Q40 A;  2BMO B;  4R9K A;  5DRV A;  5AEU B;  4X2O A;  4K1U A;  4I4K A;  4XBY A;  2GBW B;  2QIY A;  2UX0 A;  1TUH A;  1OF5 A;  4HM0 B;  1JKG B;  2HML B;  2CKF B;  3FSD A;  3E99 A;  1EG9 B;  3DXO A;  3GRD A;  3JUQ A;  1E3R A;  2CHC A;  2HMJ B;  3F7S A;  3FLJ A;  2A15 A;  3SED A;  3MKI A;  2BMQ B;  2Z76 A;  2QGU A;  5KP1 A;  5IF6 A;  2OWP A;  3T8N A;  6STD A;  5TGN A;  1E97 A;  3HZP A;  4L7K A;  3VSY A;  2HMK B;  3DZL A;  1JB5 A;  1W02 A;  1ULI B;  4LEH A; 
#chains in the Genus database with same CATH topology
 1A2P A;  2FGT A;  3N9H A;  1SPU A;  3Q2P A;  2ZDJ A;  1LXE A;  3PCR A;  4LZI A;  5EVH A;  3GSP A;  1QAF A;  2ML6 A;  1TTO A;  1NB5 I;  1SII A;  3B8L A;  4XBT A;  1AVL A;  2XSH B;  5JBS A;  2V1L A;  3NX0 A;  2IA7 A;  4LMI A;  1W6Y A;  4WP5 A;  1QJG A;  1M9G A;  3D79 A;  3NXJ A;  1FUS A;  1OHS A;  3D4A A;  1RGA A;  3NV0 A;  4NPB A;  4IIA A;  2CW9 A;  5LC6 A;  4U13 A;  4FMB A;  3FF0 A;  3T8U A;  1DMQ A;  3HOH A;  4HKV B;  3X40 A;  2FXT A;  1T5Y A;  3FCS B;  3IMA B;  3KSE D;  1UDI I;  3UNL A;  2GU3 A;  3Q3F A;  5STD A;  1IQY A;  3WOF B;  3UJM A;  2KCD A;  1HU9 A;  5KP4 A;  4J9A A;  3OV4 A;  3I0Y A;  1GYB A;  3UB1 A;  1Q82 4;  2P09 A;  1Q81 4;  4KT3 B;  1BVI A;  1IV7 A;  4GHO A;  2GEX A;  4J5K A;  1STD A;  5D81 A;  1WMN A;  4HM2 B;  3G4S 3;  4XDV A;  1N8Q A;  3X42 A;  3G8Z A;  3CPW 2;  3DY5 A;  3K63 A;  1UI8 A;  3KE7 A;  1B27 A;  1N5H A;  1T2I A;  4WWU C;  1TRP A;  4XBX A;  1I2E A;  2W56 A;  4KFE A;  3HI7 A;  1PY3 A;  3CC2 3;  3DH2 A;  5AII A;  2B24 B;  1C7H A;  4EXR A;  1BNJ A;  4HM6 B;  1ISK A;  3SOY A;  3H3H A;  2OQE C;  5D82 A;  5IG3 A;  4R4K A;  3NV0 B;  1A2V A;  2CFW A;  1ASK A;  3NBR A;  3NQZ A;  1GY6 A;  1JN5 A;  1JB4 A;  5HGR A;  1M1K 4;  1B21 A;  4XB5 A;  1D6Y A;  1O7H B;  1DYU A;  4FCJ A;  4OK0 A;  3CCJ 3;  1O7P B;  1UW1 A;  2W04 A;  2Z6B A;  3UL6 A;  1OCV A;  2WOH A;  2Z7A A;  5EQL A;  1ROA A;  4STD A;  2WGO A;  1U5O A;  1RRL A;  3F8X A;  1W4N A;  5BIR A;  3DGN A;  3LXU X;  3U1W A;  2W9P A;  2CFG A;  4DKI A;  1BOX A;  3LTD A;  1QAL A;  3ECF A;  5BVB A;  2OOV A;  5JPP A;  1BSE A;  1VQL 3;  2RGQ A;  1LOW A;  5BXQ A;  5JPU A;  3TDG A;  1IV9 A;  4EYC A;  2BT3 A;  4WYK B;  1IU7 A;  1GS3 A;  8RNT A;  1GD3 A;  1S5A A;  1RGG A;  2CC3 A;  1W2Z A;  4HJL B;  1IQ8 A;  3PXM A;  2H0I A;  1V57 A;  2F56 A;  1BSC A;  4J5G A;  1KWI A;  1X1X A;  3D3L A;  3D9R A;  3KFQ C;  4HM4 B;  1D6U A;  4LSO A;  5ELU A;  3K9M C;  4HM1 B;  2Q07 A;  4GSP A;  5M1A A;  1BSA A;  4LYL B;  1NO3 A;  1Z1S A;  2Z77 A;  1RN7 A;  1TP6 A;  4HM7 B;  3HIG A;  4N6O B;  1RRH A;  1YI2 3;  3QRD A;  3JVC A;  4XDW A;  3EN8 A;  1JBT A;  2UUG C;  1OHO A;  2R41 A;  3BU4 A;  3ROB A;  3WDG B;  1BNS A;  2ZL8 A;  1VZZ A;  1Q40 B;  1VQQ A;  2LYX A;  1O7G B;  2KF6 A;  2XGL A;  5RNT A;  3IJE B;  4R80 A;  4BIR A;  1IQX A;  2BMR B;  2F5M A;  1LQM B;  3X41 A;  1UGH I;  1QAK A;  2CFK A;  1BNG A;  3KZT A;  2B1X B;  2SAR A;  2HMO B;  5G2G A;  3L0R A;  1R4Y A;  1VQK 3;  1RNT A;  2Y74 A;  4N6T A;  3AGN A;  1RJO A;  1SJW A;  1OF5 B;  2LQV A;  1VQ8 3;  4N6N B;  3WHO A;  2XR8 B;  2ZA4 A;  2RBI A;  1W6G A;  3GWR A;  2RFR A;  4RZM A;  1CYU A;  2XRX B;  3F8H A;  1IVX A;  2F86 B;  3JUM A;  3LYG A;  2IYJ A;  2W2C A;  3DGO A;  1IVW A;  1TRQ A;  3WR2 A;  3KSP A;  1AQZ A;  1Y4K A;  1G0T A;  1W7C A;  2INX A;  4BU4 A;  5A0O B;  1RKY A;  3EQQ B;  3FG3 A;  3LZA A;  1WMP A;  1W00 A;  1FGM A;  1BNR A;  1BGS A;  8CHO A;  2P0M A;  1UI7 A;  4K1V A;  3RGA A;  4AKY A;  1W6C A;  1MWU A;  4HBR A;  4R9L A;  2RNT A;  2SBL A;  3CD6 3;  1DE3 A;  1BU4 A;  1LNH A;  1U8C B;  4HZ9 B;  4PEJ A;  1EEJ A;  2F4Y A;  1YHQ 3;  4HZB B;  1GMP A;  1IYY A;  4O2H A;  3D5G A;  3ZG0 A;  1JNQ A;  4RNZ A;  1JBS A;  4MJD A;  7RNT A;  3DGL A;  7STD A;  1FYS A;  4OUQ A;  2RSX A;  1NU3 A;  4LGQ A;  1V74 A;  3CU3 A;  3F9S A;  1RTU A;  2C10 A;  4AKZ A;  3NM7 A;  5AIG A;  3CCE 3;  1NJI 4;  3MSO A;  4R1K A;  1BRN L;  2E2V A;  3B4P A;  4NRE A;  2XEP A;  1BAN A;  3VGN A;  3V99 A;  1O7N B;  1Q9E A;  2W0Q A;  3BIR A;  6GSP A;  1RN4 A;  4H3U A;  1EQK A;  1YIT 3;  1GOU A;  1UGI A;  3Q1C A;  1B2M A;  5G1K A;  3AGO A;  1AY7 A;  3NUV A;  2PNC A;  1JB2 A;  1YJ9 3;  4FR9 A;  3EE1 A;  1BRJ A;  2MC8 A;  3AHS A;  4GB5 A;  3I55 3;  1JZD A;  2CFL A;  1M90 4;  4K90 B;  3WA3 A;  5CXO A;  4BL2 A;  1L5G B;  1MWS A;  1WNH A;  4FMC A;  1SAR A;  1FGO A;  3EF8 A;  3CC4 3;  3N54 B;  2BHM A;  2BNG A;  3F40 A;  2F98 A;  1X1Y A;  5IG5 A;  1VQM 3;  4WFO A;  1I0V A;  1PFP A;  1STF I;  3S29 A;  5M18 A;  4EV2 A;  3EJV A;  1RGH A;  2O9U X;  1VQN 3;  1RSN A;  3NQY A;  3CCV 3;  3X3Y A;  1GOV A;  4FCM A;  1RCL A;  2RCD A;  2ZHX B;  3GZX B;  3O8Y A;  3M8C A;  1Q7H A;  3F14 A;  3D5I A;  3B7C A;  1I2F A;  2D42 A;  4QWT A;  3G16 A;  4WHA A;  3EB8 A;  4JF8 A;  4RBN A;  2STD A;  5CK6 A;  5IG4 A;  3BB9 A;  1YIJ 3;  1UUG B;  2C4B A;  2KXG A;  3CPO A;  3V92 A;  1GD4 A;  1OGX A;  1JJ2 2;  1BNE A;  1Q42 A;  1JKG A;  5HOH A;  1GMR A;  1JRQ A;  4RNT A;  1KD1 4;  1CH0 A;  3RDE A;  1RGF A;  3EHC A;  2R4I A;  3HX8 A;  2P38 A;  5CF1 A;  1GY5 A;  1J2B A;  1NNV A;  3STD A;  2XH9 A;  3KN4 A;  1M1X B;  3LML A;  4RNY A;  1HZ1 A;  3CMA 3;  5AIF A;  2WOF A;  4TX4 A;  1LRA A;  1ZX2 A;  4I5Q A;  2IMJ A;  1RMS A;  1E3V A;  1VQP 3;  3S27 A;  1DMN A;  1NDO B;  2XGN A;  1N5P A;  1S72 3;  1O7W B;  3MWZ A;  2PZV A;  4AEQ A;  1X1W A;  1RGK A;  2F5W A;  4KFF A;  3MYT A;  1FA3 A;  2CX1 A;  3CNX A;  5AYR B;  2W56 B;  2KF3 A;  3G0K A;  3K7C A;  3WA2 X;  2YX9 A;  1US1 A;  1LOV A;  1W5Z A;  4H61 A;  1MWR A;  1YVS A;  5FGO A;  2L1S A;  3RGR A;  3EBT A;  4N6U A;  3SOA A;  1ZGX A;  1RGL A;  1CQS A;  1BIR A;  1B2Z A;  2KF5 A;  4HM5 B;  1VQ6 3;  2XSO B;  3CCL 3;  1VQ7 3;  3CCQ 3;  3A76 A;  1JN5 B;  5G1L A;  4BL3 A;  1C54 A;  1NB3 I;  1SIH A;  2IUJ A;  3V98 A;  3DGM A;  3MPH A;  2YFI B;  3MG1 A;  5KP3 A;  3VF1 A;  4X2H A;  1RCK A;  1VQ5 3;  3KKG A;  1FGR A;  1OUN A;  2CWU A;  1YGE A;  1BSB A;  3GZB A;  3F7X A;  1VQO 3;  1KQS 2;  1OHP A;  4IPB A;  1JV2 B;  2K54 A;  2XF3 A;  3K5T A;  3ER7 A;  2O3O A;  5IW9 A;  2ML5 A;  3U97 A;  3UL5 A;  5FW5 A;  3CC7 3;  1VQ4 3;  3S67 A;  3GZY B;  3NHX A;  1HKX A;  3EN1 B;  5EEO A;  3AMO A;  3DM8 A;  3LT8 A;  1ULJ B;  4KZ1 A;  4HVN A;  2J8X B;  1BRK A;  1WMO A;  3CCM 3;  5AI1 A;  3GZR A;  1AR0 A;  3EBY A;  4J8T A;  2AAE A;  1I70 A;  1IK3 A;  3JUO A;  1DVD A;  3NBB A;  1UUW B;  4ORL A;  6RNT A;  5DRE A;  1BNF A;  1BRS A;  5CF2 A;  3EX9 A;  2P05 A;  3FZW A;  2OOV C;  4NHF A;  2H0H A;  2JQ5 A;  2E2U A;  1IVV A;  1IDP A;  2CFD A;  2CH9 A;  3Q90 A;  3PZW A;  4ILF A;  5IER A;  1QVF 2;  5IEP A;  1JBR A;  1B20 A;  2YFJ B;  3BLZ A;  2CK3 H;  2HOH A;  3FKA A;  1FUT A;  3OWY A;  5LC7 A;  4BTY A;  4N3V A;  4CCV A;  1W2B 2;  4O8S A;  1KC8 4;  1V58 A;  3SXX A;  3EC9 A;  5AIH A;  1HYF A;  4O3V A;  3B4O A;  2W03 A;  2XFS A;  4G1M B;  1F8N A;  1R4C A;  1OH0 A;  3JUN A;  2CWT A;  2OCT A;  3MHE A;  4K61 A;  3H51 A;  1B3S A;  3MG3 A;  4HYZ A;  5ELJ A;  5D83 A;  1RN1 A;  3LT9 A;  3RNT A;  3LTC A;  2BIR A;  2CIU A;  1A2K A;  3LTB A;  2W9Q A;  3SLU A;  1DET A;  2OQE A;  1BAO A;  4N6V 0;  3PYJ A;  1NWW A;  2HMM B;  4HM8 B;  1BRH A;  4HM3 B;  4JRF A;  3URP A;  1SQW A;  3KCH A;  3PS8 A;  1G02 A;  3IPT A;  3ALA A;  3DUK A;  1EKM A;  3X3X A;  2KF4 A;  9RNT A;  1MWT A;  1O7M B;  3BNE A;  1KSI A;  4Q53 A;  2OTL 3;  1B2S A;  3BNB A;  2KAA A;  1W01 A;  4L8O A;  1QVG 2;  4MMX B;  2GBX B;  3PGB A;  1IT7 A;  5AYS C;  1B2X A;  3CNM A;  1I3F A;  1ZO2 A;  1BRI A;  4OVM A;  2F99 A;  1I2G A;  1G96 A;  4L8P A;  4MMY B;  1FUW A;  2GSP A;  3CCR 3;  5IG0 A;  1MNL A;  3HII A;  1RNB A;  2Y73 A;  3ZFZ A;  2MF7 A;  3S28 A;  2CG0 A;  1LQG C;  3PCS A;  1PU4 A;  3QK9 A;  1EA2 A;  1TIJ A;  4BTW A;  7GSP A;  4EC6 A;  3FF2 A;  2WO0 A;  4BTX A;  1BSD A;  1QMA A;  3FH1 A;  4ZM8 A;  2YFL B;  2HMN B;  1EUI C;  1DMM A;  1GSP A;  2JDI H;  3JUP A;  3K0Z A;  4KVH A;  4XM4 A;  2FNQ A;  3A5E A;  3DMC A;  3FGY A;  2GU1 A;  2I9W A;  1RLS A;  1FZU A;  3HK4 A;  3CCS 3;  4MMZ B;  1YVB I;  1JZO A;  2BO9 B;  3BNC A;  3OWS A;  4WYK A;  3CME 3;  3LH4 A;  3OWU A;  1I0X A;  3NM2 A;  1MGR A;  3LOY A;  3GAX A;  5IEO A;  2CWV A;  1FGQ A;  4EW5 A;  1OPY A;  2KRT A;  5I97 A;  3J7Y d;  1WQL B;  3OXA A;  4IT7 A;  1RDS A;  1AVK A;  4EBG A;  1GY7 A;  2QEX 3;  2BU4 A;  3BND A;  2GXF A;  3MG2 A;  5IEN A;  1I8V A;  1ROV A;  1FGT A;  3DGY A;  2C11 A;  3LTA A;  1K41 A;  2H0G A;  3WMD A;  4CDL A;  1I3I A;  1UUV B;  2GEY A;  1BUQ A;  1UCL A;  5AEW B;  5CLK A;  1GOY A;  4HAA A;  4MEI A;  1D6Z A;  1OGZ A;  3S5C A;  4FCZ A;  3OX9 A;  1Q40 A;  2BMO B;  4R9K A;  5DRV A;  5AEU B;  1YJW 3;  1B2U A;  1K9M 4;  1WTH A;  4X2O A;  1Q86 4;  1UCJ A;  2WGQ A;  4K1U A;  3N8B A;  4I4K A;  4XBY A;  1GMQ A;  1TJD A;  2K0M A;  2GBW B;  2QIY A;  1UCI A;  2UX0 A;  5BU4 A;  2OTJ 3;  3G71 3;  1LOY A;  1RHL A;  1TUH A;  3X3Z A;  1TFO A;  4CJN A;  1OF5 A;  3AHW A;  3CXC 2;  1T2H A;  1A90 A;  4HM0 B;  1JKG B;  2P0X A;  1OAC A;  1T3B A;  4HOH A;  1CYV A;  2HML B;  3ZG5 A;  2CKF B;  3FSD A;  1BRG A;  2CG1 A;  3E99 A;  1EG9 B;  4FMD A;  3SYU A;  1A67 A;  1BUJ A;  2QA4 3;  1N8R 4;  3DXO A;  3GRD A;  2E2T A;  1MOL A;  3JUQ A;  4N6L A;  1E3R A;  1FW7 A;  2CHC A;  3WOE B;  2HMJ B;  1UCK A;  3F7S A;  3WOD G;  4EV5 A;  3FLJ A;  1N9J A;  1DVC A;  2W6J H;  5GSP A;  2A15 A;  3SED A;  2IUK A;  1VQ9 3;  3MKI A;  1LOX A;  1TFK A;  4GL6 A;  2BMQ B;  2Z76 A;  1YJN 3;  3KII A;  1Q7Y 4;  2D1W A;  3OW2 2;  1AV4 A;  2K3D A;  1BNI A;  3CCU 3;  1TU5 A;  2QGU A;  3FG4 A;  1YGW A;  5KP1 A;  2L4V A;  3SVA A;  5IF6 A;  4CPK A;  2OWP A;  3T8N A;  1IVU A;  1YNV X;  4FMA A;  2M7O A;  3NBJ A;  4KFD A;  5TGN A;  6STD A;  1X1U A;  2CX0 A;  3T0U A;  2UGI A;  3SX1 A;  5M19 A;  3FG1 A;  2AAD A;  1E97 A;  3HZP A;  4L7K A;  1RGC A;  3VSY A;  1LNI A;  1N9E A;  1K8A 4;  2HMK B;  3DZL A;  4O02 B;  2IY2 A;  1IT8 A;  1ZS7 A;  2XFT A;  4N6M A;  1MGW A;  1K73 4;  1JB5 A;  1W02 A;  1PYL A;  3AMO B;  1ULI B;  3G6E 3;  1LVN A;  3I56 3;  1K28 A;  1RGE A;  1CEW I;  4LEH A; 
#chains in the Genus database with same CATH homology
 2FGT A;  3N9H A;  1SPU A;  3Q2P A;  2ZDJ A;  1LXE A;  3PCR A;  4LZI A;  5EVH A;  1QAF A;  2ML6 A;  1NB5 I;  1SII A;  3B8L A;  4XBT A;  1AVL A;  2XSH B;  5JBS A;  2V1L A;  3NX0 A;  2IA7 A;  4LMI A;  1W6Y A;  4WP5 A;  1QJG A;  1M9G A;  3NXJ A;  1OHS A;  3NV0 A;  4IIA A;  2CW9 A;  5LC6 A;  4U13 A;  4FMB A;  3FF0 A;  3T8U A;  1DMQ A;  4HKV B;  3X40 A;  2FXT A;  1T5Y A;  3FCS B;  3IMA B;  3KSE D;  3UNL A;  2GU3 A;  5STD A;  1IQY A;  3WOF B;  3UJM A;  2KCD A;  1HU9 A;  5KP4 A;  4J9A A;  3OV4 A;  3I0Y A;  1GYB A;  3UB1 A;  1Q82 4;  2P09 A;  1Q81 4;  1IV7 A;  2GEX A;  1STD A;  5D81 A;  1WMN A;  4HM2 B;  3G4S 3;  4XDV A;  1N8Q A;  3X42 A;  3G8Z A;  3CPW 2;  3DY5 A;  3K63 A;  1UI8 A;  3KE7 A;  1N5H A;  4WWU C;  4XBX A;  4KFE A;  2W56 A;  3HI7 A;  3CC2 3;  5AII A;  2B24 B;  1C7H A;  4EXR A;  4HM6 B;  1ISK A;  3SOY A;  3H3H A;  2OQE C;  5D82 A;  5IG3 A;  4R4K A;  3NV0 B;  1A2V A;  2CFW A;  1ASK A;  3NBR A;  3NQZ A;  1GY6 A;  1JN5 A;  1JB4 A;  5HGR A;  1M1K 4;  4XB5 A;  1D6Y A;  1O7H B;  1DYU A;  4FCJ A;  4OK0 A;  3CCJ 3;  1O7P B;  1UW1 A;  2W04 A;  2Z6B A;  3UL6 A;  1OCV A;  2WOH A;  2Z7A A;  5EQL A;  1ROA A;  4STD A;  2WGO A;  1U5O A;  1RRL A;  3F8X A;  1W4N A;  3DGN A;  3LXU X;  3U1W A;  2W9P A;  2CFG A;  3LTD A;  1QAL A;  3ECF A;  5BVB A;  2OOV A;  5JPP A;  1VQL 3;  2RGQ A;  5BXQ A;  5JPU A;  3TDG A;  1IV9 A;  4EYC A;  2BT3 A;  4WYK B;  1IU7 A;  1GS3 A;  1GD3 A;  1S5A A;  2CC3 A;  1W2Z A;  4HJL B;  1IQ8 A;  3PXM A;  1KWI A;  3D3L A;  3D9R A;  3KFQ C;  4HM4 B;  4LSO A;  1D6U A;  5ELU A;  3K9M C;  4HM1 B;  2Q07 A;  1NO3 A;  1Z1S A;  2Z77 A;  1RN7 A;  1TP6 A;  4HM7 B;  3HIG A;  4N6O B;  1RRH A;  1YI2 3;  3QRD A;  3JVC A;  4XDW A;  3EN8 A;  1OHO A;  3ROB A;  3WDG B;  2ZL8 A;  1VZZ A;  1Q40 B;  2LYX A;  1O7G B;  2XGL A;  3IJE B;  4R80 A;  1IQX A;  2BMR B;  3X41 A;  1QAK A;  2CFK A;  3KZT A;  2B1X B;  5G2G A;  2HMO B;  3L0R A;  1VQK 3;  2Y74 A;  4N6T A;  1RJO A;  1SJW A;  1OF5 B;  2LQV A;  1VQ8 3;  4N6N B;  2XR8 B;  1W6G A;  3GWR A;  2RFR A;  4RZM A;  1CYU A;  2XRX B;  3F8H A;  1IVX A;  2F86 B;  3JUM A;  3LYG A;  2W2C A;  3DGO A;  1IVW A;  3KSP A;  1W7C A;  1Y4K A;  2INX A;  5A0O B;  1RKY A;  3EQQ B;  3FG3 A;  3LZA A;  1WMP A;  1W00 A;  1FGM A;  8CHO A;  2P0M A;  1UI7 A;  4K1V A;  3RGA A;  4AKY A;  1W6C A;  4HBR A;  4R9L A;  3CD6 3;  2SBL A;  1LNH A;  1U8C B;  4HZ9 B;  4PEJ A;  1YHQ 3;  4HZB B;  4O2H A;  1JNQ A;  4RNZ A;  4MJD A;  3DGL A;  7STD A;  4OUQ A;  2RSX A;  1NU3 A;  4LGQ A;  1V74 A;  3CU3 A;  3F9S A;  2C10 A;  4AKZ A;  3NM7 A;  5AIG A;  3CCE 3;  1NJI 4;  3MSO A;  4R1K A;  2E2V A;  3B4P A;  4NRE A;  2XEP A;  3VGN A;  3V99 A;  1O7N B;  2W0Q A;  4H3U A;  1EQK A;  1YIT 3;  3Q1C A;  3NUV A;  2PNC A;  1JB2 A;  1YJ9 3;  4FR9 A;  3EE1 A;  2MC8 A;  4GB5 A;  3I55 3;  2CFL A;  1M90 4;  4K90 B;  3WA3 A;  5CXO A;  1L5G B;  1WNH A;  4FMC A;  1FGO A;  3EF8 A;  3CC4 3;  3N54 B;  2BHM A;  2BNG A;  3F40 A;  2F98 A;  5IG5 A;  1VQM 3;  4WFO A;  1PFP A;  1STF I;  3S29 A;  4EV2 A;  3EJV A;  2O9U X;  1VQN 3;  3NQY A;  3CCV 3;  3X3Y A;  4FCM A;  2RCD A;  3GZX B;  3O8Y A;  3M8C A;  3F14 A;  3B7C A;  2D42 A;  4QWT A;  3G16 A;  4WHA A;  3EB8 A;  4JF8 A;  4RBN A;  2STD A;  5CK6 A;  5IG4 A;  3BB9 A;  1YIJ 3;  2KXG A;  3CPO A;  3V92 A;  1GD4 A;  1OGX A;  1JJ2 2;  1Q42 A;  1JKG A;  1JRQ A;  1KD1 4;  3RDE A;  3EHC A;  2R4I A;  3HX8 A;  2P38 A;  5CF1 A;  1GY5 A;  1J2B A;  3STD A;  2XH9 A;  3KN4 A;  1M1X B;  3LML A;  4RNY A;  3CMA 3;  5AIF A;  2WOF A;  4TX4 A;  1ZX2 A;  2IMJ A;  1E3V A;  1VQP 3;  3S27 A;  1DMN A;  1NDO B;  2XGN A;  1N5P A;  1S72 3;  1O7W B;  3MWZ A;  2PZV A;  4AEQ A;  4KFF A;  3MYT A;  1FA3 A;  3CNX A;  5AYR B;  2W56 B;  3G0K A;  3K7C A;  3WA2 X;  2YX9 A;  1US1 A;  1W5Z A;  4H61 A;  5FGO A;  3RGR A;  3EBT A;  4N6U A;  3SOA A;  1CQS A;  4HM5 B;  1VQ6 3;  2XSO B;  3CCL 3;  1VQ7 3;  3CCQ 3;  3A76 A;  1JN5 B;  1NB3 I;  1SIH A;  2IUJ A;  3V98 A;  3DGM A;  3MPH A;  2YFI B;  3MG1 A;  5KP3 A;  3VF1 A;  4X2H A;  1VQ5 3;  3KKG A;  1FGR A;  1OUN A;  2CWU A;  1YGE A;  3GZB A;  3F7X A;  1VQO 3;  1KQS 2;  1OHP A;  4IPB A;  1JV2 B;  2K54 A;  2XF3 A;  3K5T A;  3ER7 A;  2O3O A;  5IW9 A;  2ML5 A;  3U97 A;  3UL5 A;  5FW5 A;  3CC7 3;  1VQ4 3;  3S67 A;  3GZY B;  3NHX A;  1HKX A;  3EN1 B;  5EEO A;  3AMO A;  3DM8 A;  3LT8 A;  1ULJ B;  4KZ1 A;  4HVN A;  1WMO A;  3CCM 3;  5AI1 A;  3GZR A;  1AR0 A;  3EBY A;  4J8T A;  3JUO A;  1DVD A;  3NBB A;  1UUW B;  4ORL A;  5DRE A;  5CF2 A;  3EX9 A;  2P05 A;  3FZW A;  2OOV C;  4NHF A;  2JQ5 A;  2E2U A;  1IVV A;  1IDP A;  2CFD A;  2CH9 A;  3Q90 A;  3PZW A;  5IER A;  1QVF 2;  5IEP A;  2YFJ B;  5LC7 A;  3BLZ A;  2CK3 H;  3FKA A;  3OWY A;  4BTY A;  4CCV A;  1W2B 2;  4N3V A;  4O8S A;  1KC8 4;  3SXX A;  3EC9 A;  5AIH A;  4O3V A;  3B4O A;  2W03 A;  2XFS A;  4G1M B;  1F8N A;  1R4C A;  1OH0 A;  3JUN A;  2CWT A;  2OCT A;  3MHE A;  4K61 A;  3H51 A;  3MG3 A;  4HYZ A;  5ELJ A;  5D83 A;  3LT9 A;  3LTC A;  2CIU A;  3LTB A;  1A2K A;  2W9Q A;  3SLU A;  2OQE A;  4N6V 0;  3PYJ A;  1NWW A;  2HMM B;  4HM8 B;  4HM3 B;  4JRF A;  1SQW A;  3PS8 A;  3IPT A;  3ALA A;  3DUK A;  1EKM A;  3X3X A;  1O7M B;  3BNE A;  1KSI A;  4Q53 A;  2OTL 3;  3BNB A;  1W01 A;  4L8O A;  1QVG 2;  4MMX B;  2GBX B;  3PGB A;  1IT7 A;  5AYS C;  3CNM A;  1ZO2 A;  4OVM A;  2F99 A;  1G96 A;  4L8P A;  4MMY B;  1FUW A;  3CCR 3;  5IG0 A;  1MNL A;  3HII A;  2Y73 A;  2MF7 A;  3S28 A;  2CG0 A;  3PCS A;  1PU4 A;  3QK9 A;  1EA2 A;  1TIJ A;  4BTW A;  4EC6 A;  3FF2 A;  2WO0 A;  4BTX A;  4ZM8 A;  1QMA A;  3FH1 A;  1IK3 A;  2YFL B;  2HMN B;  3JUP A;  1DMM A;  2JDI H;  3K0Z A;  4KVH A;  4XM4 A;  2QEX 3;  2FNQ A;  3DMC A;  3FGY A;  2GU1 A;  2I9W A;  3HK4 A;  3CCS 3;  4MMZ B;  1YVB I;  2BO9 B;  3BNC A;  3OWS A;  4WYK A;  3CME 3;  3LH4 A;  3OWU A;  3NM2 A;  3LOY A;  3GAX A;  5IEO A;  2CWV A;  1FGQ A;  1OPY A;  2KRT A;  5I97 A;  3J7Y d;  1WQL B;  3OXA A;  4IT7 A;  4EBG A;  1AVK A;  1GY7 A;  3BND A;  2GXF A;  3MG2 A;  5IEN A;  1ROV A;  1FGT A;  2C11 A;  3LTA A;  1K41 A;  4CDL A;  3WMD A;  2GEY A;  1UUV B;  1BUQ A;  5AEW B;  5CLK A;  4MEI A;  1D6Z A;  1OGZ A;  3S5C A;  4FCZ A;  3OX9 A;  1Q40 A;  2BMO B;  4R9K A;  5DRV A;  5AEU B;  1YJW 3;  1K9M 4;  1WTH A;  4X2O A;  1Q86 4;  2WGQ A;  4K1U A;  3N8B A;  4I4K A;  4XBY A;  2K0M A;  2GBW B;  2QIY A;  2UX0 A;  2OTJ 3;  3G71 3;  1TUH A;  3X3Z A;  1TFO A;  1OF5 A;  3CXC 2;  1A90 A;  4HM0 B;  1JKG B;  2P0X A;  1OAC A;  1CYV A;  2HML B;  2CKF B;  3FSD A;  2CG1 A;  3E99 A;  1EG9 B;  4FMD A;  1A67 A;  2QA4 3;  1N8R 4;  3DXO A;  3GRD A;  2E2T A;  1MOL A;  3JUQ A;  4N6L A;  1E3R A;  2CHC A;  3WOE B;  2HMJ B;  3F7S A;  3WOD G;  4EV5 A;  3FLJ A;  1N9J A;  1DVC A;  2W6J H;  2A15 A;  3SED A;  2IUK A;  1VQ9 3;  3MKI A;  1LOX A;  1TFK A;  4GL6 A;  2BMQ B;  2Z76 A;  1YJN 3;  3KII A;  1Q7Y 4;  2D1W A;  3OW2 2;  1AV4 A;  3CCU 3;  1TU5 A;  2QGU A;  3FG4 A;  5KP1 A;  2L4V A;  3SVA A;  5IF6 A;  2OWP A;  3T8N A;  1IVU A;  4FMA A;  2M7O A;  3NBJ A;  4KFD A;  5TGN A;  6STD A;  3T0U A;  3SX1 A;  3FG1 A;  1E97 A;  3HZP A;  4L7K A;  3VSY A;  1N9E A;  1K8A 4;  2HMK B;  3DZL A;  4O02 B;  1IT8 A;  2XFT A;  4N6M A;  1K73 4;  1JB5 A;  1W02 A;  3AMO B;  1ULI B;  3G6E 3;  1LVN A;  3I56 3;  1K28 A;  1CEW I;  4LEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...