4J9AA

Engineered digoxigenin binder dig10.3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
122
Chain Sequence
NAKEIVVHALRLLENGDARGWSDLFHPEGVLEYPYPPPGYKTRFEGRETIWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAYDYIAVWRTRDGQILLYRLFFNPLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Digoxigenin binding protein
molecule keywords Engineered Digoxigenin binder protein DIG10.3
publication title Computational design of ligand-binding proteins with high affinity and selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 32
structure length 122
sequence length 122
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4j9aA00
3DMCA 5IG4A 5KP3A 3FZWA 1OHOA 2HMLB 5IF6A 2I9WA 3HZPA 4HM0B 2Z7AA 5BVBA 3MG3A 4MJDA 4HJLB 6STDA 4HZBB 3NUVA 1W00A 1E3VA 2OWPA 3HK4A 2F86B 4J8TA 4WWUC 4Q53A 3FGYA 2F99A 1ULIB 1E3RA 1EG9B 2W2CA 4WYKB 4HM4B 3F40A 1ZX2A 4XB5A 4PEJA 1VZZA 3KZTA 1OH0A 1A2KA 3SOAA 3FSDA 3IPTA 2HMKB 5CF2A 2BMQB 3VGNA 1O7PB 1UUVB 3ROBA 2GBXB 4U13A 4J9AA 4WYKA 1ULJB 2A15A 2Z77A 3DZLA 1OUNA 1STDA 2GXFA 5CF1A 3OWSA 4N3VA 3K0ZA 5DREA 2HMJB 3B4OA 2RGQA 3EC9A 3NBRA 1AR0A 1SJWA 1CQSA 3FKAA 2PZVA 1ZO2A 2GBWB 2QIYA 1GY5A 4HM2B 3WMDA 1OGXA 3CU3A 1ASKA 3RGRA 3JUNA 3MSOA 2HMNB 3NXJA 1TUHA 2QGUA 2INXA 3EN1B 1U5OA 5TGNA 4FCMA 5D81A 3KKGA 3CNXA 3EBYA 3E99A 1ISKA 5HGRA 5D82A 3EBTA 3OWUA 3Q90A 1IDPA 3MHEA 3F9SA 1JKGA 5IEPA 5KP1A 3FF2A 3B8LA 5IEOA 2RCDA 4OUQA 4HZ9B 1DMQA 1Q40A 3OXAA 4RZMA 2XR8B 3OV4A 3FLJA 3KE7A 5IENA 1NU3A 2XSHB 1GY6A 4FCJA 2XSOB 3EF8A 3HX8A 2BMRB 3GZYB 4R9KA 3ER7A 1OPYA 3STDA 3GZBA 1OGZA 1Q42A 3SOYA 1DMMA 4HM3B 1DMNA 5D83A 1HKXA 1K41A 4R1KA 5JPPA 4K1UA 5AI1A 3LZAA 5CLKA 3F8HA 1O7GB 3F7XA 5IG3A 4HM5B 3DUKA 3K7CA 3JUQA 4OVMA 5AIFA 2GEYA 2Z76A 4R9LA 1E97A 2STDA 2YFIB 3OX9A 3EHCA 4H3UA 3GWRA 2B1XB 1OCVA 2BNGA 3F8XA 3A76A 1W6YA 2F98A 4LMIA 1BUQA 1OHPA 4ORLA 5AEUB 4WP5A 5AIIA 1NWWA 3VSYA 3NHXA 3G8ZA 2BMOB 3GRDA 1NDOB 4XBYA 1OHSA 3FH1A 1O7WB 1JN5A 1C7HA 1JKGB 3CPOA 4I4KA 2HMMB 5CK6A 1UUWB 3EQQB 4XM4A 1Q40B 2HMOB 5AIGA 3H3HA 2IMJA 3G0KA 3F14A 1QJGA 3F7SA 1S5AA 3KSPA 3LYGA 2GEXA 3ECFA 3MKIA 4HM7B 4KVHA 4GB5A 3EJVA 4L8PA 4STDA 3JUOA 3MG2A 3G16A 2YFJB 5KP4A 5G2GA 3JUMA 3GZRA 1Z1SA 2K54A 5JPUA 3EX9A 3JUPA 1GS3A 3D9RA 3I0YA 4XBTA 5BXQA 3NV0A 1WQLB 1O7MB 4XDVA 4L7KA 3UNLA 2RFRA 5CXOA 3NM2A 1O7HB 5FW5A 2B24B 1GY7A 1JB2A 3CNMA 4IIAA 5AEWB 2CHCA 8CHOA 4LEHA 4XDWA 5AIHA 4XBXA 3B7CA 1EA2A 1OF5B 3FF0A 4HM8B 2R4IA 1JN5B 2JQ5A 3EN8A 3MYTA 1W01A 3GZXB 3B4PA 1QMAA 3H51A 5IERA 1GYBA 1JB4A 3RGAA 4HKVB 5STDA 3DM8A 4HVNA 2YFLB 4CDLA 5IG5A 3UJMA 1OF5A 3MG1A 2CKFB 3OWYA 3BLZA 3S5CA 5IG0A 5EVHA 1JB5A 1O7NB 1W02A 4HM6B 4X2HA 3T8UA 7STDA 3M8CA 3NV0B 4L8OA 4K1VA 4X2OA 3SEDA 2XRXB 2UX0A 3DXOA 5DRVA 1TP6A 4LGQA 4HM1B 3BB9A 3T8NA
chains in the Genus database with same CATH superfamily
1BSCA 3AGOA 3DGOA 3LOYA 3DMCA 5AYRB 4N6V0 5IG4A 1I0XA 7GSPA 3NM7A 3URPA 3NBJA 4HBRA 5KP3A 1S723 3LT9A 3FZWA 1BNIA 1IQ8A 1OHOA 2R41A 1ROVA 3D5IA 2HMLB 3EE1A 5IF6A 1RGFA 2CK3H 1JJ22 2I9WA 2Y73A 3SYUA 3BNEA 1IYYA 3HZPA 3U97A 5M19A 3FCSB 1VQN3 4HM0B 2Z7AA 5BVBA 1JBRA 3MG3A 4MJDA 2UGIA 1ZGXA 4HJLB 4EV5A 1V74A 5EQLA 2E2TA 2CFGA 3NUVA 1LNHA 1YGWA 1W00A 2IYJA 4HZBB 6STDA 7RNTA 1VQO3 1YIT3 2P0MA 6GSPA 1E3VA 1WMOA 4TX4A 2OWPA 4H61A 1RN1A 2CFLA 3HK4A 4BL3A 3FG4A 1YIJ3 3NX0A 1LQMB 2F86B 3AHSA 4J8TA 4Q53A 4WWUC 1IV9A 2O3OA 2F99A 3FGYA 1FYSA 1ULIB 4LZIA 1SIIA 2AADA 1E3RA 4GSPA 1PY3A 4JF8A 5M18A 3PS8A 1LQGC 1EG9B 3HOHA 1A90A 2W2CA 4WYKB 1RGCA 4HM4B 2KF4A 1CH0A 1GOYA 3DGNA 3F40A 1YHQ3 4CPKA 2W56A 1B2UA 1ZX2A 1N9JA 2CFWA 1RMSA 4XB5A 4PEJA 1VZZA 2XFSA 3CMA3 3KZTA 1UI8A 1OH0A 1R4CA 1A2KA 2CFKA 3CC73 3SOAA 1W4NA 1PFPA 1W7CA 4GHOA 5LC6A 3FSDA 5G1LA 3IPTA 2ZA4A 3WR2A 2YX9A 2FNQA 3X42A 3CME3 1OACA 1YVSA 2HMKB 4MMYB 1Q814 3CCS3 4O3VA 1IVVA 2BHMA 1B2ZA 3SLUA 1AQZA 1F8NA 3LT8A 5CF2A 2BMQB 3VGNA 1IQYA 1QAKA 2M7OA 1RCLA 4ZM8A 2CWUA 1O7PB 1I3FA 1BUJA 1STFI 1UUVB 3T0UA 3ROBA 2GBXB 4U13A 3AGNA 1AY7A 2UUGC 4J9AA 2WOHA 4N6UA 4WYKA 1BRKA 1ULJB 3LTBA 2IUJA 2OTL3 2A15A 2Z77A 1MNLA 3DZLA 1OUNA 1STDA 1SIHA 3S28A 2GXFA 1B2MA 4NHFA 3SVAA 3KIIA 5CF1A 4RNTA 3OWSA 2KXGA 4N3VA 3K0ZA 3K5TA 1IU7A 5DREA 2HMJB 3NBBA 2KRTA 3WODG 3PYJA 1L5GB 3NQYA 1KD14 3B4OA 4MMXB 1KWIA 2RGQA 1EQKA 3EC9A 3NBRA 4R80A 1MWTA 2W03A 1AR0A 1SJWA 1GMRA 3D3LA 1CQSA 1GSPA 3FKAA 2PZVA 1ROAA 1ZO2A 5A0OB 3CC43 4I5QA 4RBNA 1K28A 1BGSA 2GBWB 5ELUA 4N6OB 2QIYA 3CCV3 3WHOA 4HOHA 1GY5A 4HM2B 2OQEA 3WMDA 1YJN3 1B3SA 1BRGA 1N5HA 1OGXA 1VQ53 1FUSA 1YNVX 2OQEC 1GMQA 5I97A 3CU3A 1UCIA 1ASKA 3HIIA 4K90B 3OW22 1FZUA 1DYUA 4QWTA 3RGRA 3JUNA 4BIRA 4BTYA 3S27A 3HI7A 4J5KA 2CC3A 3MSOA 1WNHA 1TIJA 2OOVA 8RNTA 1C54A 2HMNB 1NB3I 2ML5A 3MWZA 1SQWA 3G6E3 3NXJA 1TUHA 2QGUA 2INXA 2H0IA 3EN1B 1U5OA 3KCHA 4MEIA 3Q2PA 5TGNA 1IVXA 1JBSA 1A67A 1FGOA 4FCMA 1V57A 5D81A 3KKGA 1VQ93 2W6JH 1I8VA 3CNXA 3EBYA 3E99A 1ISKA 5HGRA 4EV2A 1CEWI 5D82A 3EBTA 3N54B 1GD3A 3L0RA 2L4VA 3OWUA 1UDII 3N9HA 3Q90A 2BIRA 1IDPA 3X40A 3MHEA 4EBGA 3KN4A 4K61A 2W56B 1NNVA 3AMOA 4IPBA 3CCJ3 1B20A 2C4BA 1UI7A 2KCDA 5EEOA 3CCR3 2F56A 3F9SA 1UCLA 1QVG2 3CCU3 1BNRA 1BRIA 1RGAA 1JKGA 1T2HA 3UL6A 2CX0A 1N8R4 1Y4KA 3HIGA 3ZG0A 1YGEA 2AAEA 3PCSA 5IEPA 5KP1A 1R4YA 3FF2A 3B8LA 1D6YA 5IEOA 1MOLA 1VQL3 2RCDA 4OUQA 4FMBA 5FGOA 1MWUA 4HZ9B 1DMQA 1Q40A 1W2ZA 1BNJA 3OXAA 3QK9A 2XEPA 5AYSC 4RZMA 1Q7Y4 2D42A 2XR8B 3CCM3 3OV4A 2Y74A 1RCKA 3EB8A 2C11A 4BTWA 1VQ43 3FLJA 3KE7A 5IENA 1NU3A 2L1SA 1EEJA 1LOVA 2XSHB 4O8SA 1GY6A 2IUKA 3FG3A 4FCJA 1VQ73 2XSOB 3EF8A 1BSBA 4KFFA 4LSOA 3BNDA 3HX8A 2BMRB 3GZYB 4KZ1A 1I2FA 1G02A 4R9KA 2F5MA 1BIRA 1TRQA 3ER7A 1BVIA 1YVBI 1FGTA 3AHWA 1M1K4 1OPYA 3SXXA 1BRJA 3STDA 3LTCA 3ALAA 3GZBA 4N6MA 1OGZA 3PGBA 3ZFZA 1VQQA 2WGQA 1Q42A 1RGLA 1YJW3 1GOVA 2P0XA 3SOYA 2CG0A 1DMMA 4HM3B 1FW7A 1X1XA 1BRHA 1DMNA 2P09A 1HKXA 1HU9A 5D83A 1K41A 3GSPA 4R1KA 5JPPA 4K1UA 1K8A4 5AI1A 1FUWA 1B2XA 2CX1A 3LZAA 3RNTA 4JRFA 5CLKA 1Q824 3F8HA 1O7GB 2XF3A 1W6CA 3BIRA 4ILFA 1Q9EA 3UB1A 3DGMA 3F7XA 5IG3A 3BU4A 2W9QA 4HM5B 3DUKA 3G4S3 1CYVA 1TFKA 3JUQA 1M9GA 1RLSA 3IMAB 3K7CA 2BU4A 4OVMA 1IT8A 5AIFA 1BANA 1X1WA 2GEYA 2Z76A 1A2VA 1BNSA 1FGMA 4R9LA 1E97A 2STDA 2YFIB 1BOXA 2ZDJA 3OX9A 3DGYA 4NPBA 3EHCA 3X3YA 4BL2A 4H3UA 2J8XB 4O02B 3GWRA 2Q07A 2B1XB 2BO9B 1UCJA 1RNTA 2K0MA 1OCVA 2BNGA 3F8XA 2RSXA 3A76A 2W9PA 3BNCA 5BU4A 1MGRA 2GU3A 1W6YA 3PXMA 3CC23 3G713 4FMCA 2RBIA 1AVLA 1NJI4 1JZDA 2F98A 3CXC2 4LMIA 1BUQA 1JNQA 1OHPA 4ORLA 2ZHXB 5AEUB 3O8YA 1RRLA 1AVKA 1BNGA 1LOXA 4WP5A 5ELJA 1G96A 5AIIA 1FA3A 1RHLA 1NWWA 2CWTA 1RGHA 3VSYA 3SX1A 3NHXA 3X41A 4R4KA 4J5GA 3G8ZA 3BNBA 3LXUX 2BMOB 4FMAA 1TFOA 1FGRA 1NDOB 3AMOB 3GRDA 1OHSA 4OK0A 4XBYA 1MWSA 2F4YA 1D6UA 2K3DA 4LYLB 1VQ83 2KAAA 3JVCA 3FH1A 2ZL8A 4N6NB 4EC6A 3DGLA 1O7WB 3WA3A 1JN5A 1C7HA 1JKGB 2E2UA 3LTAA 3NQZA 1VQK3 2QEX3 3CPOA 1RKYA 4I4KA 1Q864 4RNZA 2D1WA 2HMMB 3X3ZA 4CCVA 2WGOA 1EKMA 5CK6A 1UUWB 5M1AA 3EQQB 4XM4A 1YI23 2XGNA 1Q40B 2HMOB 1QAFA 2XFTA 5AIGA 1I3IA 3H3HA 2IMJA 2XGLA 3G0KA 3V92A 3F14A 1QJGA 3S29A 1UGIA 1NO3A 1NB5I 4EW5A 2CFDA 3F7SA 2JDIH 2MF7A 1S5AA 1X1YA 2FXTA 3KSPA 2LQVA 1LVNA 3LYGA 1KC84 2GEXA 1T2IA 2CWVA 3ECFA 4HAAA 5G1KA 3FG1A 3A5EA 3MKIA 4HM7B 4KVHA 4AKZA 4GB5A 3EJVA 3D79A 4L8PA 4FR9A 1J2BA 1GOUA 3WDGB 4BTXA 4STDA 3JUOA 3IJEB 3DH2A 3MG2A 3RDEA 2HOHA 4WFOA 3G16A 2YFJB 1BSDA 1IT7A 3QRDA 5KP4A 1I0VA 5G2GA 4BU4A 1WMNA 2P05A 2W04A 3MPHA 3U1WA 3JUMA 3GZRA 1JZOA 1Z1SA 2K54A 5JPUA 3EX9A 3JUPA 3Q3FA 1RGEA 1KQS2 1JV2B 1GS3A 3D9RA 3I0YA 3ZG5A 2PNCA 1JBTA 2V1LA 4XBTA 5BXQA 3NV0A 3LH4A 3Q1CA 4AKYA 3WOEB 1WQLB 5RNTA 1O7MB 3I553 2KF6A 1UW1A 4NREA 4XDVA 3J7Yd 1CYUA 3WA2X 4GL6A 4EXRA 4L7KA 3UNLA 1B2SA 2H0GA 1DVDA 1AV4A 2RFRA 3DY5A 5CXOA 3NM2A 1WTHA 4RNYA 1RJOA 1O7HB 2IY2A 5FW5A 3I563 4FCZA 1IK3A 1RRHA 1X1UA 3CCQ3 1N9EA 1BU4A 2BT3A 1BNFA 2B24B 2CW9A 1MGWA 3LTDA 1GY7A 1W2B2 1BRNL 1PU4A 4IT7A 5BIRA 1JB2A 3CNMA 3V99A 3K9MC 3PCRA 1US1A 1VQP3 4IIAA 1UCKA 1BSEA 4DKIA 5AEWB 2W0QA 4MMZB 3WOFB 4N6TA 1EUIC 2Z6BA 1GD4A 2CHCA 2H0HA 8CHOA 2C10A 4LEHA 4XDWA 4CJNA 1TU5A 1FGQA 5AIHA 3X3XA 1LOYA 1M1XB 3TDGA 1LXEA 1LNIA 1FUTA 3CPW2 2GSPA 1DE3A 2GU1A 1QALA 1KSIA 4XBXA 2CIUA 1M904 2F5WA 3B7CA 1MWRA 1EA2A 1Q7HA 2CG1A 4G1MB 4O2HA 1OF5B 3FF0A 4HM8B 4WHAA 2MC8A 1RTUA 1ZS7A 2R4IA 1DVCA 1SPUA 1JN5B 1GMPA 1IVWA 5GSPA 9RNTA 1B21A 2SBLA 3VF1A 1VQM3 2JQ5A 1VQ63 3EN8A 3MYTA 4KFDA 2KF5A 1W6GA 1K734 1HZ1A 2LYXA 2E2VA 1W01A 1TJDA 3CCL3 1PYLA 2WOFA 1UUGB 1RGGA 3GZXB 2QA43 3B4PA 4N6LA 1QMAA 2FGTA 3H51A 5IERA 1GYBA 1JB4A 1UGHI 3RGAA 1BRSA 3K63A 1V58A 1IVUA 4AEQA 1JRQA 4HKVB 5STDA 2WO0A 1G0TA 3DM8A 3N8BA 4HVNA 1I70A 1RNBA 2YFLB 4CDLA 5IG5A 3UJMA 1WMPA 1T3BA 1I2GA 1OF5A 2CH9A 1RDSA 3MG1A 1SARA 2CKFB 3KFQC 3OWYA 4EYCA 1LRAA 3BLZA 6RNTA 1T5YA 1K9M4 1BNEA 2O9UX 2XH9A 1IV7A 3LMLA 3UL5A 3S5CA 1N5PA 2P38A 5IG0A 1TRPA 1JB5A 1HYFA 3D4AA 5EVHA 1O7NB 1W02A 3V98A 1D6ZA 1RSNA 4HM6B 1W5ZA 5JBSA 3CCE3 2IA7A 1TTOA 4X2HA 3T8UA 4KFEA 2KF3A 3S67A 1QVF2 1A2PA 7STDA 1RGKA 1RN7A 2ML6A 3M8CA 3NV0B 1N8QA 4L8OA 3PZWA 2RNTA 4K1VA 4HYZA 2SARA 1IQXA 2OTJ3 1LOWA 2OCTA 4FMDA 4X2OA 1BAOA 1U8CB 3GAXA 4KT3B 3SEDA 5LC7A 1I2EA 3CD63 2XRXB 1BSAA 1RN4A 2OOVC 2UX0A 3DXOA 5DRVA 1B27A 1TP6A 5IW9A 3KSED 3D5GA 4LGQA 4HM1B 3BB9A 3T8NA 1DETA 1YJ93 5HOHA
chains in the Genus database with same CATH topology
3DGOA 3LOYA 3DMCA 5AYRB 4N6V0 5IG4A 3NM7A 3NBJA 4HBRA 5KP3A 1S723 3LT9A 3FZWA 1IQ8A 1OHOA 1ROVA 2HMLB 3EE1A 5IF6A 2CK3H 1JJ22 2I9WA 2Y73A 3BNEA 3HZPA 3U97A 1VQN3 3FCSB 4HM0B 2Z7AA 5BVBA 3MG3A 4MJDA 4HJLB 4EV5A 1V74A 5EQLA 2E2TA 2CFGA 3NUVA 1LNHA 4HZBB 1W00A 6STDA 1VQO3 1YIT3 2P0MA 1E3VA 1WMOA 4TX4A 2OWPA 4H61A 2CFLA 3HK4A 3FG4A 1YIJ3 3NX0A 2F86B 4J8TA 4WWUC 4Q53A 1IV9A 2O3OA 2F99A 3FGYA 1ULIB 4LZIA 1SIIA 1E3RA 4JF8A 3PS8A 1EG9B 1A90A 2W2CA 4WYKB 4HM4B 3DGNA 3F40A 1YHQ3 2W56A 1ZX2A 1N9JA 2CFWA 4XB5A 4PEJA 1VZZA 2XFSA 3CMA3 3KZTA 1UI8A 1OH0A 1R4CA 1A2KA 2CFKA 3CC73 3SOAA 1W4NA 1PFPA 1W7CA 5LC6A 3FSDA 3IPTA 2YX9A 2FNQA 3X42A 3CME3 1OACA 2HMKB 4MMYB 1Q814 3CCS3 4O3VA 1IVVA 2BHMA 3SLUA 1F8NA 3LT8A 5CF2A 2BMQB 3VGNA 1IQYA 1QAKA 2M7OA 4ZM8A 2CWUA 1O7PB 1STFI 1UUVB 3T0UA 3ROBA 2GBXB 4U13A 4N6UA 4J9AA 2WOHA 4WYKA 2OTL3 1ULJB 3LTBA 2IUJA 2A15A 2Z77A 1MNLA 3DZLA 1OUNA 1STDA 1SIHA 3S28A 2GXFA 4NHFA 3SVAA 3KIIA 5CF1A 3OWSA 2KXGA 4N3VA 3K0ZA 3K5TA 1IU7A 5DREA 2HMJB 3NBBA 2KRTA 3WODG 3PYJA 1L5GB 3NQYA 1KD14 3B4OA 4MMXB 1KWIA 2RGQA 1EQKA 3EC9A 3NBRA 4R80A 2W03A 1AR0A 1SJWA 3D3LA 1CQSA 3FKAA 2PZVA 1ROAA 1ZO2A 5A0OB 3CC43 4RBNA 1K28A 2GBWB 5ELUA 4N6OB 2QIYA 3CCV3 1GY5A 4HM2B 2OQEA 3WMDA 1YJN3 1N5HA 1OGXA 1VQ53 2OQEC 5I97A 3CU3A 1ASKA 3HIIA 4K90B 3OW22 1DYUA 4QWTA 3RGRA 3JUNA 4BTYA 3S27A 3HI7A 2CC3A 3MSOA 1WNHA 1TIJA 2OOVA 2HMNB 1NB3I 2ML5A 3MWZA 1SQWA 3G6E3 3NXJA 1TUHA 2QGUA 2INXA 3EN1B 4MEIA 1U5OA 3Q2PA 5TGNA 1IVXA 1A67A 1FGOA 4FCMA 5D81A 3KKGA 1VQ93 2W6JH 3CNXA 3EBYA 3E99A 1ISKA 5HGRA 4EV2A 1CEWI 5D82A 3EBTA 3N54B 1GD3A 3L0RA 2L4VA 3OWUA 3N9HA 3Q90A 1IDPA 3X40A 3MHEA 4EBGA 3KN4A 4K61A 2W56B 3AMOA 3CCJ3 4IPBA 1UI7A 2KCDA 5EEOA 3CCR3 3F9SA 1QVG2 3CCU3 1JKGA 3UL6A 1N8R4 1Y4KA 3HIGA 1YGEA 5IEPA 3PCSA 5KP1A 3FF2A 3B8LA 1D6YA 5IEOA 1MOLA 1VQL3 2RCDA 4OUQA 4FMBA 5FGOA 4HZ9B 1DMQA 1Q40A 1W2ZA 3OXAA 3QK9A 2XEPA 5AYSC 4RZMA 1Q7Y4 2D42A 2XR8B 3CCM3 3OV4A 2Y74A 3EB8A 2C11A 4BTWA 1VQ43 3FLJA 3KE7A 5IENA 1NU3A 2XSHB 4O8SA 1GY6A 2IUKA 3FG3A 4FCJA 1VQ73 2XSOB 3EF8A 4KFFA 4LSOA 3BNDA 3HX8A 2BMRB 3GZYB 4KZ1A 4R9KA 3ER7A 1YVBI 1FGTA 1M1K4 1OPYA 3SXXA 3STDA 3LTCA 3ALAA 3GZBA 4N6MA 1OGZA 3PGBA 2WGQA 1Q42A 1YJW3 2P0XA 3SOYA 2CG0A 1DMMA 4HM3B 1DMNA 2P09A 1HKXA 1HU9A 5D83A 1K41A 4R1KA 5JPPA 4K1UA 1K8A4 5AI1A 1FUWA 3LZAA 4JRFA 5CLKA 1Q824 3F8HA 1O7GB 2XF3A 1W6CA 3UB1A 3DGMA 3F7XA 5IG3A 2W9QA 4HM5B 3DUKA 3G4S3 1CYVA 1TFKA 3JUQA 1M9GA 3IMAB 3K7CA 4OVMA 1IT8A 5AIFA 2GEYA 2Z76A 1A2VA 1FGMA 4R9LA 1E97A 2STDA 2YFIB 2ZDJA 3OX9A 3EHCA 3X3YA 4H3UA 4O02B 3GWRA 2Q07A 2B1XB 2BO9B 2K0MA 1OCVA 2BNGA 3F8XA 2RSXA 3A76A 2W9PA 3BNCA 2GU3A 1W6YA 3PXMA 3CC23 3G713 4FMCA 1AVLA 1NJI4 2F98A 3CXC2 4LMIA 1BUQA 1JNQA 1OHPA 4ORLA 5AEUB 3O8YA 1RRLA 1AVKA 1LOXA 4WP5A 5ELJA 1G96A 5AIIA 1FA3A 1NWWA 2CWTA 3VSYA 3SX1A 3NHXA 3X41A 4R4KA 3G8ZA 3BNBA 3LXUX 2BMOB 4FMAA 1TFOA 1FGRA 1NDOB 3AMOB 3GRDA 1OHSA 4OK0A 4XBYA 1D6UA 1VQ83 3JVCA 3FH1A 2ZL8A 4N6NB 4EC6A 3DGLA 1O7WB 3WA3A 1JN5A 1C7HA 1JKGB 2E2UA 3LTAA 3NQZA 1VQK3 2QEX3 3CPOA 1RKYA 4I4KA 1Q864 4RNZA 2D1WA 2HMMB 3X3ZA 4CCVA 2WGOA 1EKMA 5CK6A 1UUWB 1YI23 3EQQB 4XM4A 2XGNA 1Q40B 2XFTA 1QAFA 2HMOB 5AIGA 3H3HA 2IMJA 2XGLA 3G0KA 3V92A 3F14A 1QJGA 3S29A 1NB5I 1NO3A 2CFDA 3F7SA 2JDIH 2MF7A 1S5AA 2FXTA 3KSPA 2LQVA 1LVNA 3LYGA 1KC84 2GEXA 2CWVA 3ECFA 3FG1A 3MKIA 4HM7B 4KVHA 4AKZA 4GB5A 3EJVA 4L8PA 4FR9A 1J2BA 3WDGB 4BTXA 4STDA 3JUOA 3IJEB 3MG2A 3RDEA 4WFOA 3G16A 2YFJB 3QRDA 1IT7A 5KP4A 5G2GA 1WMNA 2P05A 2W04A 3MPHA 3U1WA 3JUMA 3GZRA 1Z1SA 2K54A 5JPUA 3EX9A 3JUPA 1KQS2 1JV2B 1GS3A 3D9RA 3I0YA 2PNCA 2V1LA 4XBTA 5BXQA 3NV0A 3LH4A 3Q1CA 4AKYA 3WOEB 1WQLB 1O7MB 3I553 4XDVA 1UW1A 4NREA 1CYUA 3J7Yd 3WA2X 4GL6A 4EXRA 4L7KA 3UNLA 1DVDA 1AV4A 2RFRA 3DY5A 5CXOA 3NM2A 1WTHA 4RNYA 1RJOA 1O7HB 5FW5A 3I563 4FCZA 1IK3A 1RRHA 3CCQ3 1N9EA 2BT3A 2B24B 2CW9A 3LTDA 1GY7A 1W2B2 1PU4A 4IT7A 1JB2A 3CNMA 3V99A 3K9MC 3PCRA 1US1A 1VQP3 4IIAA 5AEWB 2W0QA 4MMZB 3WOFB 4N6TA 2Z6BA 1GD4A 2CHCA 8CHOA 2C10A 4LEHA 4XDWA 1TU5A 1FGQA 5AIHA 3X3XA 1M1XB 3TDGA 1LXEA 3CPW2 2GU1A 1QALA 1KSIA 4XBXA 2CIUA 1M904 3B7CA 1EA2A 2CG1A 4G1MB 4O2HA 1OF5B 3FF0A 4HM8B 4WHAA 2MC8A 2R4IA 1DVCA 1SPUA 1JN5B 1IVWA 2SBLA 3VF1A 1VQM3 2JQ5A 1VQ63 3EN8A 3MYTA 4KFDA 1W6GA 1K734 2LYXA 2E2VA 1W01A 3CCL3 2WOFA 3GZXB 2QA43 3B4PA 4N6LA 1QMAA 2FGTA 3H51A 5IERA 1GYBA 1JB4A 3RGAA 3K63A 1IVUA 4AEQA 1JRQA 4HKVB 5STDA 2WO0A 3DM8A 3N8BA 4HVNA 2YFLB 4CDLA 5IG5A 3UJMA 1WMPA 1OF5A 2CH9A 3MG1A 2CKFB 3KFQC 3OWYA 4EYCA 3BLZA 1T5YA 1K9M4 2O9UX 2XH9A 1IV7A 3LMLA 3UL5A 3S5CA 1N5PA 2P38A 5IG0A 5EVHA 1JB5A 3V98A 1O7NB 1W02A 1D6ZA 4HM6B 5JBSA 1W5ZA 3CCE3 2IA7A 4X2HA 3T8UA 4KFEA 1QVF2 3S67A 7STDA 1RN7A 2ML6A 3M8CA 3NV0B 1N8QA 4L8OA 3PZWA 4K1VA 4HYZA 1IQXA 2OTJ3 2OCTA 4FMDA 4X2OA 1U8CB 3GAXA 3SEDA 5LC7A 3CD63 2XRXB 2OOVC 2UX0A 3DXOA 5DRVA 1TP6A 5IW9A 3KSED 4LGQA 4HM1B 3BB9A 3T8NA 1YJ93
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMC A;  5IG4 A;  5KP3 A;  3FZW A;  1OHO A;  2HML B;  5IF6 A;  2I9W A;  3HZP A;  4HM0 B;  2Z7A A;  5BVB A;  3MG3 A;  4MJD A;  4HJL B;  6STD A;  4HZB B;  3NUV A;  1W00 A;  1E3V A;  2OWP A;  3HK4 A;  2F86 B;  4J8T A;  4WWU C;  4Q53 A;  3FGY A;  2F99 A;  1ULI B;  1E3R A;  1EG9 B;  2W2C A;  4WYK B;  4HM4 B;  3F40 A;  1ZX2 A;  4XB5 A;  4PEJ A;  1VZZ A;  3KZT A;  1OH0 A;  1A2K A;  3SOA A;  3FSD A;  3IPT A;  2HMK B;  5CF2 A;  2BMQ B;  3VGN A;  1O7P B;  1UUV B;  3ROB A;  2GBX B;  4U13 A;  4J9A A;  4WYK A;  1ULJ B;  2A15 A;  2Z77 A;  3DZL A;  1OUN A;  1STD A;  2GXF A;  5CF1 A;  3OWS A;  4N3V A;  3K0Z A;  5DRE A;  2HMJ B;  3B4O A;  2RGQ A;  3EC9 A;  3NBR A;  1AR0 A;  1SJW A;  1CQS A;  3FKA A;  2PZV A;  1ZO2 A;  2GBW B;  2QIY A;  1GY5 A;  4HM2 B;  3WMD A;  1OGX A;  3CU3 A;  1ASK A;  3RGR A;  3JUN A;  3MSO A;  2HMN B;  3NXJ A;  1TUH A;  2QGU A;  2INX A;  3EN1 B;  1U5O A;  5TGN A;  4FCM A;  5D81 A;  3KKG A;  3CNX A;  3EBY A;  3E99 A;  1ISK A;  5HGR A;  5D82 A;  3EBT A;  3OWU A;  3Q90 A;  1IDP A;  3MHE A;  3F9S A;  1JKG A;  5IEP A;  5KP1 A;  3FF2 A;  3B8L A;  5IEO A;  2RCD A;  4OUQ A;  4HZ9 B;  1DMQ A;  1Q40 A;  3OXA A;  4RZM A;  2XR8 B;  3OV4 A;  3FLJ A;  3KE7 A;  5IEN A;  1NU3 A;  2XSH B;  1GY6 A;  4FCJ A;  2XSO B;  3EF8 A;  3HX8 A;  2BMR B;  3GZY B;  4R9K A;  3ER7 A;  1OPY A;  3STD A;  3GZB A;  1OGZ A;  1Q42 A;  3SOY A;  1DMM A;  4HM3 B;  1DMN A;  5D83 A;  1HKX A;  1K41 A;  4R1K A;  5JPP A;  4K1U A;  5AI1 A;  3LZA A;  5CLK A;  3F8H A;  1O7G B;  3F7X A;  5IG3 A;  4HM5 B;  3DUK A;  3K7C A;  3JUQ A;  4OVM A;  5AIF A;  2GEY A;  2Z76 A;  4R9L A;  1E97 A;  2STD A;  2YFI B;  3OX9 A;  3EHC A;  4H3U A;  3GWR A;  2B1X B;  1OCV A;  2BNG A;  3F8X A;  3A76 A;  1W6Y A;  2F98 A;  4LMI A;  1BUQ A;  1OHP A;  4ORL A;  5AEU B;  4WP5 A;  5AII A;  1NWW A;  3VSY A;  3NHX A;  3G8Z A;  2BMO B;  3GRD A;  1NDO B;  4XBY A;  1OHS A;  3FH1 A;  1O7W B;  1JN5 A;  1C7H A;  1JKG B;  3CPO A;  4I4K A;  2HMM B;  5CK6 A;  1UUW B;  3EQQ B;  4XM4 A;  1Q40 B;  2HMO B;  5AIG A;  3H3H A;  2IMJ A;  3G0K A;  3F14 A;  1QJG A;  3F7S A;  1S5A A;  3KSP A;  3LYG A;  2GEX A;  3ECF A;  3MKI A;  4HM7 B;  4KVH A;  4GB5 A;  3EJV A;  4L8P A;  4STD A;  3JUO A;  3MG2 A;  3G16 A;  2YFJ B;  5KP4 A;  5G2G A;  3JUM A;  3GZR A;  1Z1S A;  2K54 A;  5JPU A;  3EX9 A;  3JUP A;  1GS3 A;  3D9R A;  3I0Y A;  4XBT A;  5BXQ A;  3NV0 A;  1WQL B;  1O7M B;  4XDV A;  4L7K A;  3UNL A;  2RFR A;  5CXO A;  3NM2 A;  1O7H B;  5FW5 A;  2B24 B;  1GY7 A;  1JB2 A;  3CNM A;  4IIA A;  5AEW B;  2CHC A;  8CHO A;  4LEH A;  4XDW A;  5AIH A;  4XBX A;  3B7C A;  1EA2 A;  1OF5 B;  3FF0 A;  4HM8 B;  2R4I A;  1JN5 B;  2JQ5 A;  3EN8 A;  3MYT A;  1W01 A;  3GZX B;  3B4P A;  1QMA A;  3H51 A;  5IER A;  1GYB A;  1JB4 A;  3RGA A;  4HKV B;  5STD A;  3DM8 A;  4HVN A;  2YFL B;  4CDL A;  5IG5 A;  3UJM A;  1OF5 A;  3MG1 A;  2CKF B;  3OWY A;  3BLZ A;  3S5C A;  5IG0 A;  5EVH A;  1JB5 A;  1O7N B;  1W02 A;  4HM6 B;  4X2H A;  3T8U A;  7STD A;  3M8C A;  3NV0 B;  4L8O A;  4K1V A;  4X2O A;  3SED A;  2XRX B;  2UX0 A;  3DXO A;  5DRV A;  1TP6 A;  4LGQ A;  4HM1 B;  3BB9 A;  3T8N A; 
#chains in the Genus database with same CATH topology
 1BSC A;  3AGO A;  3DGO A;  3LOY A;  3DMC A;  5AYR B;  4N6V 0;  5IG4 A;  1I0X A;  7GSP A;  3NM7 A;  3URP A;  3NBJ A;  4HBR A;  5KP3 A;  1S72 3;  3LT9 A;  3FZW A;  1BNI A;  1IQ8 A;  1OHO A;  2R41 A;  1ROV A;  3D5I A;  2HML B;  3EE1 A;  5IF6 A;  1RGF A;  2CK3 H;  1JJ2 2;  2I9W A;  2Y73 A;  3SYU A;  3BNE A;  1IYY A;  3HZP A;  3U97 A;  5M19 A;  3FCS B;  1VQN 3;  4HM0 B;  2Z7A A;  5BVB A;  1JBR A;  3MG3 A;  4MJD A;  2UGI A;  1ZGX A;  4HJL B;  4EV5 A;  1V74 A;  5EQL A;  2E2T A;  2CFG A;  3NUV A;  1LNH A;  1YGW A;  1W00 A;  2IYJ A;  4HZB B;  6STD A;  7RNT A;  1VQO 3;  1YIT 3;  2P0M A;  6GSP A;  1E3V A;  1WMO A;  4TX4 A;  2OWP A;  4H61 A;  1RN1 A;  2CFL A;  3HK4 A;  4BL3 A;  3FG4 A;  1YIJ 3;  3NX0 A;  1LQM B;  2F86 B;  3AHS A;  4J8T A;  4Q53 A;  4WWU C;  1IV9 A;  2O3O A;  2F99 A;  3FGY A;  1FYS A;  1ULI B;  4LZI A;  1SII A;  2AAD A;  1E3R A;  4GSP A;  1PY3 A;  4JF8 A;  5M18 A;  3PS8 A;  1LQG C;  1EG9 B;  3HOH A;  1A90 A;  2W2C A;  4WYK B;  1RGC A;  4HM4 B;  2KF4 A;  1CH0 A;  1GOY A;  3DGN A;  3F40 A;  1YHQ 3;  4CPK A;  2W56 A;  1B2U A;  1ZX2 A;  1N9J A;  2CFW A;  1RMS A;  4XB5 A;  4PEJ A;  1VZZ A;  2XFS A;  3CMA 3;  3KZT A;  1UI8 A;  1OH0 A;  1R4C A;  1A2K A;  2CFK A;  3CC7 3;  3SOA A;  1W4N A;  1PFP A;  1W7C A;  4GHO A;  5LC6 A;  3FSD A;  5G1L A;  3IPT A;  2ZA4 A;  3WR2 A;  2YX9 A;  2FNQ A;  3X42 A;  3CME 3;  1OAC A;  1YVS A;  2HMK B;  4MMY B;  1Q81 4;  3CCS 3;  4O3V A;  1IVV A;  2BHM A;  1B2Z A;  3SLU A;  1AQZ A;  1F8N A;  3LT8 A;  5CF2 A;  2BMQ B;  3VGN A;  1IQY A;  1QAK A;  2M7O A;  1RCL A;  4ZM8 A;  2CWU A;  1O7P B;  1I3F A;  1BUJ A;  1STF I;  1UUV B;  3T0U A;  3ROB A;  2GBX B;  4U13 A;  3AGN A;  1AY7 A;  2UUG C;  4J9A A;  2WOH A;  4N6U A;  4WYK A;  1BRK A;  1ULJ B;  3LTB A;  2IUJ A;  2OTL 3;  2A15 A;  2Z77 A;  1MNL A;  3DZL A;  1OUN A;  1STD A;  1SIH A;  3S28 A;  2GXF A;  1B2M A;  4NHF A;  3SVA A;  3KII A;  5CF1 A;  4RNT A;  3OWS A;  2KXG A;  4N3V A;  3K0Z A;  3K5T A;  1IU7 A;  5DRE A;  2HMJ B;  3NBB A;  2KRT A;  3WOD G;  3PYJ A;  1L5G B;  3NQY A;  1KD1 4;  3B4O A;  4MMX B;  1KWI A;  2RGQ A;  1EQK A;  3EC9 A;  3NBR A;  4R80 A;  1MWT A;  2W03 A;  1AR0 A;  1SJW A;  1GMR A;  3D3L A;  1CQS A;  1GSP A;  3FKA A;  2PZV A;  1ROA A;  1ZO2 A;  5A0O B;  3CC4 3;  4I5Q A;  4RBN A;  1K28 A;  1BGS A;  2GBW B;  5ELU A;  4N6O B;  2QIY A;  3CCV 3;  3WHO A;  4HOH A;  1GY5 A;  4HM2 B;  2OQE A;  3WMD A;  1YJN 3;  1B3S A;  1BRG A;  1N5H A;  1OGX A;  1VQ5 3;  1FUS A;  1YNV X;  2OQE C;  1GMQ A;  5I97 A;  3CU3 A;  1UCI A;  1ASK A;  3HII A;  4K90 B;  3OW2 2;  1FZU A;  1DYU A;  4QWT A;  3RGR A;  3JUN A;  4BIR A;  4BTY A;  3S27 A;  3HI7 A;  4J5K A;  2CC3 A;  3MSO A;  1WNH A;  1TIJ A;  2OOV A;  8RNT A;  1C54 A;  2HMN B;  1NB3 I;  2ML5 A;  3MWZ A;  1SQW A;  3G6E 3;  3NXJ A;  1TUH A;  2QGU A;  2INX A;  2H0I A;  3EN1 B;  1U5O A;  3KCH A;  4MEI A;  3Q2P A;  5TGN A;  1IVX A;  1JBS A;  1A67 A;  1FGO A;  4FCM A;  1V57 A;  5D81 A;  3KKG A;  1VQ9 3;  2W6J H;  1I8V A;  3CNX A;  3EBY A;  3E99 A;  1ISK A;  5HGR A;  4EV2 A;  1CEW I;  5D82 A;  3EBT A;  3N54 B;  1GD3 A;  3L0R A;  2L4V A;  3OWU A;  1UDI I;  3N9H A;  3Q90 A;  2BIR A;  1IDP A;  3X40 A;  3MHE A;  4EBG A;  3KN4 A;  4K61 A;  2W56 B;  1NNV A;  3AMO A;  4IPB A;  3CCJ 3;  1B20 A;  2C4B A;  1UI7 A;  2KCD A;  5EEO A;  3CCR 3;  2F56 A;  3F9S A;  1UCL A;  1QVG 2;  3CCU 3;  1BNR A;  1BRI A;  1RGA A;  1JKG A;  1T2H A;  3UL6 A;  2CX0 A;  1N8R 4;  1Y4K A;  3HIG A;  3ZG0 A;  1YGE A;  2AAE A;  3PCS A;  5IEP A;  5KP1 A;  1R4Y A;  3FF2 A;  3B8L A;  1D6Y A;  5IEO A;  1MOL A;  1VQL 3;  2RCD A;  4OUQ A;  4FMB A;  5FGO A;  1MWU A;  4HZ9 B;  1DMQ A;  1Q40 A;  1W2Z A;  1BNJ A;  3OXA A;  3QK9 A;  2XEP A;  5AYS C;  4RZM A;  1Q7Y 4;  2D42 A;  2XR8 B;  3CCM 3;  3OV4 A;  2Y74 A;  1RCK A;  3EB8 A;  2C11 A;  4BTW A;  1VQ4 3;  3FLJ A;  3KE7 A;  5IEN A;  1NU3 A;  2L1S A;  1EEJ A;  1LOV A;  2XSH B;  4O8S A;  1GY6 A;  2IUK A;  3FG3 A;  4FCJ A;  1VQ7 3;  2XSO B;  3EF8 A;  1BSB A;  4KFF A;  4LSO A;  3BND A;  3HX8 A;  2BMR B;  3GZY B;  4KZ1 A;  1I2F A;  1G02 A;  4R9K A;  2F5M A;  1BIR A;  1TRQ A;  3ER7 A;  1BVI A;  1YVB I;  1FGT A;  3AHW A;  1M1K 4;  1OPY A;  3SXX A;  1BRJ A;  3STD A;  3LTC A;  3ALA A;  3GZB A;  4N6M A;  1OGZ A;  3PGB A;  3ZFZ A;  1VQQ A;  2WGQ A;  1Q42 A;  1RGL A;  1YJW 3;  1GOV A;  2P0X A;  3SOY A;  2CG0 A;  1DMM A;  4HM3 B;  1FW7 A;  1X1X A;  1BRH A;  1DMN A;  2P09 A;  1HKX A;  1HU9 A;  5D83 A;  1K41 A;  3GSP A;  4R1K A;  5JPP A;  4K1U A;  1K8A 4;  5AI1 A;  1FUW A;  1B2X A;  2CX1 A;  3LZA A;  3RNT A;  4JRF A;  5CLK A;  1Q82 4;  3F8H A;  1O7G B;  2XF3 A;  1W6C A;  3BIR A;  4ILF A;  1Q9E A;  3UB1 A;  3DGM A;  3F7X A;  5IG3 A;  3BU4 A;  2W9Q A;  4HM5 B;  3DUK A;  3G4S 3;  1CYV A;  1TFK A;  3JUQ A;  1M9G A;  1RLS A;  3IMA B;  3K7C A;  2BU4 A;  4OVM A;  1IT8 A;  5AIF A;  1BAN A;  1X1W A;  2GEY A;  2Z76 A;  1A2V A;  1BNS A;  1FGM A;  4R9L A;  1E97 A;  2STD A;  2YFI B;  1BOX A;  2ZDJ A;  3OX9 A;  3DGY A;  4NPB A;  3EHC A;  3X3Y A;  4BL2 A;  4H3U A;  2J8X B;  4O02 B;  3GWR A;  2Q07 A;  2B1X B;  2BO9 B;  1UCJ A;  1RNT A;  2K0M A;  1OCV A;  2BNG A;  3F8X A;  2RSX A;  3A76 A;  2W9P A;  3BNC A;  5BU4 A;  1MGR A;  2GU3 A;  1W6Y A;  3PXM A;  3CC2 3;  3G71 3;  4FMC A;  2RBI A;  1AVL A;  1NJI 4;  1JZD A;  2F98 A;  3CXC 2;  4LMI A;  1BUQ A;  1JNQ A;  1OHP A;  4ORL A;  2ZHX B;  5AEU B;  3O8Y A;  1RRL A;  1AVK A;  1BNG A;  1LOX A;  4WP5 A;  5ELJ A;  1G96 A;  5AII A;  1FA3 A;  1RHL A;  1NWW A;  2CWT A;  1RGH A;  3VSY A;  3SX1 A;  3NHX A;  3X41 A;  4R4K A;  4J5G A;  3G8Z A;  3BNB A;  3LXU X;  2BMO B;  4FMA A;  1TFO A;  1FGR A;  1NDO B;  3AMO B;  3GRD A;  1OHS A;  4OK0 A;  4XBY A;  1MWS A;  2F4Y A;  1D6U A;  2K3D A;  4LYL B;  1VQ8 3;  2KAA A;  3JVC A;  3FH1 A;  2ZL8 A;  4N6N B;  4EC6 A;  3DGL A;  1O7W B;  3WA3 A;  1JN5 A;  1C7H A;  1JKG B;  2E2U A;  3LTA A;  3NQZ A;  1VQK 3;  2QEX 3;  3CPO A;  1RKY A;  4I4K A;  1Q86 4;  4RNZ A;  2D1W A;  2HMM B;  3X3Z A;  4CCV A;  2WGO A;  1EKM A;  5CK6 A;  1UUW B;  5M1A A;  3EQQ B;  4XM4 A;  1YI2 3;  2XGN A;  1Q40 B;  2HMO B;  1QAF A;  2XFT A;  5AIG A;  1I3I A;  3H3H A;  2IMJ A;  2XGL A;  3G0K A;  3V92 A;  3F14 A;  1QJG A;  3S29 A;  1UGI A;  1NO3 A;  1NB5 I;  4EW5 A;  2CFD A;  3F7S A;  2JDI H;  2MF7 A;  1S5A A;  1X1Y A;  2FXT A;  3KSP A;  2LQV A;  1LVN A;  3LYG A;  1KC8 4;  2GEX A;  1T2I A;  2CWV A;  3ECF A;  4HAA A;  5G1K A;  3FG1 A;  3A5E A;  3MKI A;  4HM7 B;  4KVH A;  4AKZ A;  4GB5 A;  3EJV A;  3D79 A;  4L8P A;  4FR9 A;  1J2B A;  1GOU A;  3WDG B;  4BTX A;  4STD A;  3JUO A;  3IJE B;  3DH2 A;  3MG2 A;  3RDE A;  2HOH A;  4WFO A;  3G16 A;  2YFJ B;  1BSD A;  1IT7 A;  3QRD A;  5KP4 A;  1I0V A;  5G2G A;  4BU4 A;  1WMN A;  2P05 A;  2W04 A;  3MPH A;  3U1W A;  3JUM A;  3GZR A;  1JZO A;  1Z1S A;  2K54 A;  5JPU A;  3EX9 A;  3JUP A;  3Q3F A;  1RGE A;  1KQS 2;  1JV2 B;  1GS3 A;  3D9R A;  3I0Y A;  3ZG5 A;  2PNC A;  1JBT A;  2V1L A;  4XBT A;  5BXQ A;  3NV0 A;  3LH4 A;  3Q1C A;  4AKY A;  3WOE B;  1WQL B;  5RNT A;  1O7M B;  3I55 3;  2KF6 A;  1UW1 A;  4NRE A;  4XDV A;  3J7Y d;  1CYU A;  3WA2 X;  4GL6 A;  4EXR A;  4L7K A;  3UNL A;  1B2S A;  2H0G A;  1DVD A;  1AV4 A;  2RFR A;  3DY5 A;  5CXO A;  3NM2 A;  1WTH A;  4RNY A;  1RJO A;  1O7H B;  2IY2 A;  5FW5 A;  3I56 3;  4FCZ A;  1IK3 A;  1RRH A;  1X1U A;  3CCQ 3;  1N9E A;  1BU4 A;  2BT3 A;  1BNF A;  2B24 B;  2CW9 A;  1MGW A;  3LTD A;  1GY7 A;  1W2B 2;  1BRN L;  1PU4 A;  4IT7 A;  5BIR A;  1JB2 A;  3CNM A;  3V99 A;  3K9M C;  3PCR A;  1US1 A;  1VQP 3;  4IIA A;  1UCK A;  1BSE A;  4DKI A;  5AEW B;  2W0Q A;  4MMZ B;  3WOF B;  4N6T A;  1EUI C;  2Z6B A;  1GD4 A;  2CHC A;  2H0H A;  8CHO A;  2C10 A;  4LEH A;  4XDW A;  4CJN A;  1TU5 A;  1FGQ A;  5AIH A;  3X3X A;  1LOY A;  1M1X B;  3TDG A;  1LXE A;  1LNI A;  1FUT A;  3CPW 2;  2GSP A;  1DE3 A;  2GU1 A;  1QAL A;  1KSI A;  4XBX A;  2CIU A;  1M90 4;  2F5W A;  3B7C A;  1MWR A;  1EA2 A;  1Q7H A;  2CG1 A;  4G1M B;  4O2H A;  1OF5 B;  3FF0 A;  4HM8 B;  4WHA A;  2MC8 A;  1RTU A;  1ZS7 A;  2R4I A;  1DVC A;  1SPU A;  1JN5 B;  1GMP A;  1IVW A;  5GSP A;  9RNT A;  1B21 A;  2SBL A;  3VF1 A;  1VQM 3;  2JQ5 A;  1VQ6 3;  3EN8 A;  3MYT A;  4KFD A;  2KF5 A;  1W6G A;  1K73 4;  1HZ1 A;  2LYX A;  2E2V A;  1W01 A;  1TJD A;  3CCL 3;  1PYL A;  2WOF A;  1UUG B;  1RGG A;  3GZX B;  2QA4 3;  3B4P A;  4N6L A;  1QMA A;  2FGT A;  3H51 A;  5IER A;  1GYB A;  1JB4 A;  1UGH I;  3RGA A;  1BRS A;  3K63 A;  1V58 A;  1IVU A;  4AEQ A;  1JRQ A;  4HKV B;  5STD A;  2WO0 A;  1G0T A;  3DM8 A;  3N8B A;  4HVN A;  1I70 A;  1RNB A;  2YFL B;  4CDL A;  5IG5 A;  3UJM A;  1WMP A;  1T3B A;  1I2G A;  1OF5 A;  2CH9 A;  1RDS A;  3MG1 A;  1SAR A;  2CKF B;  3KFQ C;  3OWY A;  4EYC A;  1LRA A;  3BLZ A;  6RNT A;  1T5Y A;  1K9M 4;  1BNE A;  2O9U X;  2XH9 A;  1IV7 A;  3LML A;  3UL5 A;  3S5C A;  1N5P A;  2P38 A;  5IG0 A;  1TRP A;  1JB5 A;  1HYF A;  3D4A A;  5EVH A;  1O7N B;  1W02 A;  3V98 A;  1D6Z A;  1RSN A;  4HM6 B;  1W5Z A;  5JBS A;  3CCE 3;  2IA7 A;  1TTO A;  4X2H A;  3T8U A;  4KFE A;  2KF3 A;  3S67 A;  1QVF 2;  1A2P A;  7STD A;  1RGK A;  1RN7 A;  2ML6 A;  3M8C A;  3NV0 B;  1N8Q A;  4L8O A;  3PZW A;  2RNT A;  4K1V A;  4HYZ A;  2SAR A;  1IQX A;  2OTJ 3;  1LOW A;  2OCT A;  4FMD A;  4X2O A;  1BAO A;  1U8C B;  3GAX A;  4KT3 B;  3SED A;  5LC7 A;  1I2E A;  3CD6 3;  2XRX B;  1BSA A;  1RN4 A;  2OOV C;  2UX0 A;  3DXO A;  5DRV A;  1B27 A;  1TP6 A;  5IW9 A;  3KSE D;  3D5G A;  4LGQ A;  4HM1 B;  3BB9 A;  3T8N A;  1DET A;  1YJ9 3;  5HOH A; 
#chains in the Genus database with same CATH homology
 3DGO A;  3LOY A;  3DMC A;  5AYR B;  4N6V 0;  5IG4 A;  3NM7 A;  3NBJ A;  4HBR A;  5KP3 A;  1S72 3;  3LT9 A;  3FZW A;  1IQ8 A;  1OHO A;  1ROV A;  2HML B;  3EE1 A;  5IF6 A;  2CK3 H;  1JJ2 2;  2I9W A;  2Y73 A;  3BNE A;  3HZP A;  3U97 A;  1VQN 3;  3FCS B;  4HM0 B;  2Z7A A;  5BVB A;  3MG3 A;  4MJD A;  4HJL B;  4EV5 A;  1V74 A;  5EQL A;  2E2T A;  2CFG A;  3NUV A;  1LNH A;  4HZB B;  1W00 A;  6STD A;  1VQO 3;  1YIT 3;  2P0M A;  1E3V A;  1WMO A;  4TX4 A;  2OWP A;  4H61 A;  2CFL A;  3HK4 A;  3FG4 A;  1YIJ 3;  3NX0 A;  2F86 B;  4J8T A;  4WWU C;  4Q53 A;  1IV9 A;  2O3O A;  2F99 A;  3FGY A;  1ULI B;  4LZI A;  1SII A;  1E3R A;  4JF8 A;  3PS8 A;  1EG9 B;  1A90 A;  2W2C A;  4WYK B;  4HM4 B;  3DGN A;  3F40 A;  1YHQ 3;  2W56 A;  1ZX2 A;  1N9J A;  2CFW A;  4XB5 A;  4PEJ A;  1VZZ A;  2XFS A;  3CMA 3;  3KZT A;  1UI8 A;  1OH0 A;  1R4C A;  1A2K A;  2CFK A;  3CC7 3;  3SOA A;  1W4N A;  1PFP A;  1W7C A;  5LC6 A;  3FSD A;  3IPT A;  2YX9 A;  2FNQ A;  3X42 A;  3CME 3;  1OAC A;  2HMK B;  4MMY B;  1Q81 4;  3CCS 3;  4O3V A;  1IVV A;  2BHM A;  3SLU A;  1F8N A;  3LT8 A;  5CF2 A;  2BMQ B;  3VGN A;  1IQY A;  1QAK A;  2M7O A;  4ZM8 A;  2CWU A;  1O7P B;  1STF I;  1UUV B;  3T0U A;  3ROB A;  2GBX B;  4U13 A;  4N6U A;  4J9A A;  2WOH A;  4WYK A;  2OTL 3;  1ULJ B;  3LTB A;  2IUJ A;  2A15 A;  2Z77 A;  1MNL A;  3DZL A;  1OUN A;  1STD A;  1SIH A;  3S28 A;  2GXF A;  4NHF A;  3SVA A;  3KII A;  5CF1 A;  3OWS A;  2KXG A;  4N3V A;  3K0Z A;  3K5T A;  1IU7 A;  5DRE A;  2HMJ B;  3NBB A;  2KRT A;  3WOD G;  3PYJ A;  1L5G B;  3NQY A;  1KD1 4;  3B4O A;  4MMX B;  1KWI A;  2RGQ A;  1EQK A;  3EC9 A;  3NBR A;  4R80 A;  2W03 A;  1AR0 A;  1SJW A;  3D3L A;  1CQS A;  3FKA A;  2PZV A;  1ROA A;  1ZO2 A;  5A0O B;  3CC4 3;  4RBN A;  1K28 A;  2GBW B;  5ELU A;  4N6O B;  2QIY A;  3CCV 3;  1GY5 A;  4HM2 B;  2OQE A;  3WMD A;  1YJN 3;  1N5H A;  1OGX A;  1VQ5 3;  2OQE C;  5I97 A;  3CU3 A;  1ASK A;  3HII A;  4K90 B;  3OW2 2;  1DYU A;  4QWT A;  3RGR A;  3JUN A;  4BTY A;  3S27 A;  3HI7 A;  2CC3 A;  3MSO A;  1WNH A;  1TIJ A;  2OOV A;  2HMN B;  1NB3 I;  2ML5 A;  3MWZ A;  1SQW A;  3G6E 3;  3NXJ A;  1TUH A;  2QGU A;  2INX A;  3EN1 B;  4MEI A;  1U5O A;  3Q2P A;  5TGN A;  1IVX A;  1A67 A;  1FGO A;  4FCM A;  5D81 A;  3KKG A;  1VQ9 3;  2W6J H;  3CNX A;  3EBY A;  3E99 A;  1ISK A;  5HGR A;  4EV2 A;  1CEW I;  5D82 A;  3EBT A;  3N54 B;  1GD3 A;  3L0R A;  2L4V A;  3OWU A;  3N9H A;  3Q90 A;  1IDP A;  3X40 A;  3MHE A;  4EBG A;  3KN4 A;  4K61 A;  2W56 B;  3AMO A;  3CCJ 3;  4IPB A;  1UI7 A;  2KCD A;  5EEO A;  3CCR 3;  3F9S A;  1QVG 2;  3CCU 3;  1JKG A;  3UL6 A;  1N8R 4;  1Y4K A;  3HIG A;  1YGE A;  5IEP A;  3PCS A;  5KP1 A;  3FF2 A;  3B8L A;  1D6Y A;  5IEO A;  1MOL A;  1VQL 3;  2RCD A;  4OUQ A;  4FMB A;  5FGO A;  4HZ9 B;  1DMQ A;  1Q40 A;  1W2Z A;  3OXA A;  3QK9 A;  2XEP A;  5AYS C;  4RZM A;  1Q7Y 4;  2D42 A;  2XR8 B;  3CCM 3;  3OV4 A;  2Y74 A;  3EB8 A;  2C11 A;  4BTW A;  1VQ4 3;  3FLJ A;  3KE7 A;  5IEN A;  1NU3 A;  2XSH B;  4O8S A;  1GY6 A;  2IUK A;  3FG3 A;  4FCJ A;  1VQ7 3;  2XSO B;  3EF8 A;  4KFF A;  4LSO A;  3BND A;  3HX8 A;  2BMR B;  3GZY B;  4KZ1 A;  4R9K A;  3ER7 A;  1YVB I;  1FGT A;  1M1K 4;  1OPY A;  3SXX A;  3STD A;  3LTC A;  3ALA A;  3GZB A;  4N6M A;  1OGZ A;  3PGB A;  2WGQ A;  1Q42 A;  1YJW 3;  2P0X A;  3SOY A;  2CG0 A;  1DMM A;  4HM3 B;  1DMN A;  2P09 A;  1HKX A;  1HU9 A;  5D83 A;  1K41 A;  4R1K A;  5JPP A;  4K1U A;  1K8A 4;  5AI1 A;  1FUW A;  3LZA A;  4JRF A;  5CLK A;  1Q82 4;  3F8H A;  1O7G B;  2XF3 A;  1W6C A;  3UB1 A;  3DGM A;  3F7X A;  5IG3 A;  2W9Q A;  4HM5 B;  3DUK A;  3G4S 3;  1CYV A;  1TFK A;  3JUQ A;  1M9G A;  3IMA B;  3K7C A;  4OVM A;  1IT8 A;  5AIF A;  2GEY A;  2Z76 A;  1A2V A;  1FGM A;  4R9L A;  1E97 A;  2STD A;  2YFI B;  2ZDJ A;  3OX9 A;  3EHC A;  3X3Y A;  4H3U A;  4O02 B;  3GWR A;  2Q07 A;  2B1X B;  2BO9 B;  2K0M A;  1OCV A;  2BNG A;  3F8X A;  2RSX A;  3A76 A;  2W9P A;  3BNC A;  2GU3 A;  1W6Y A;  3PXM A;  3CC2 3;  3G71 3;  4FMC A;  1AVL A;  1NJI 4;  2F98 A;  3CXC 2;  4LMI A;  1BUQ A;  1JNQ A;  1OHP A;  4ORL A;  5AEU B;  3O8Y A;  1RRL A;  1AVK A;  1LOX A;  4WP5 A;  5ELJ A;  1G96 A;  5AII A;  1FA3 A;  1NWW A;  2CWT A;  3VSY A;  3SX1 A;  3NHX A;  3X41 A;  4R4K A;  3G8Z A;  3BNB A;  3LXU X;  2BMO B;  4FMA A;  1TFO A;  1FGR A;  1NDO B;  3AMO B;  3GRD A;  1OHS A;  4OK0 A;  4XBY A;  1D6U A;  1VQ8 3;  3JVC A;  3FH1 A;  2ZL8 A;  4N6N B;  4EC6 A;  3DGL A;  1O7W B;  3WA3 A;  1JN5 A;  1C7H A;  1JKG B;  2E2U A;  3LTA A;  3NQZ A;  1VQK 3;  2QEX 3;  3CPO A;  1RKY A;  4I4K A;  1Q86 4;  4RNZ A;  2D1W A;  2HMM B;  3X3Z A;  4CCV A;  2WGO A;  1EKM A;  5CK6 A;  1UUW B;  1YI2 3;  3EQQ B;  4XM4 A;  2XGN A;  1Q40 B;  2XFT A;  1QAF A;  2HMO B;  5AIG A;  3H3H A;  2IMJ A;  2XGL A;  3G0K A;  3V92 A;  3F14 A;  1QJG A;  3S29 A;  1NB5 I;  1NO3 A;  2CFD A;  3F7S A;  2JDI H;  2MF7 A;  1S5A A;  2FXT A;  3KSP A;  2LQV A;  1LVN A;  3LYG A;  1KC8 4;  2GEX A;  2CWV A;  3ECF A;  3FG1 A;  3MKI A;  4HM7 B;  4KVH A;  4AKZ A;  4GB5 A;  3EJV A;  4L8P A;  4FR9 A;  1J2B A;  3WDG B;  4BTX A;  4STD A;  3JUO A;  3IJE B;  3MG2 A;  3RDE A;  4WFO A;  3G16 A;  2YFJ B;  3QRD A;  1IT7 A;  5KP4 A;  5G2G A;  1WMN A;  2P05 A;  2W04 A;  3MPH A;  3U1W A;  3JUM A;  3GZR A;  1Z1S A;  2K54 A;  5JPU A;  3EX9 A;  3JUP A;  1KQS 2;  1JV2 B;  1GS3 A;  3D9R A;  3I0Y A;  2PNC A;  2V1L A;  4XBT A;  5BXQ A;  3NV0 A;  3LH4 A;  3Q1C A;  4AKY A;  3WOE B;  1WQL B;  1O7M B;  3I55 3;  4XDV A;  1UW1 A;  4NRE A;  1CYU A;  3J7Y d;  3WA2 X;  4GL6 A;  4EXR A;  4L7K A;  3UNL A;  1DVD A;  1AV4 A;  2RFR A;  3DY5 A;  5CXO A;  3NM2 A;  1WTH A;  4RNY A;  1RJO A;  1O7H B;  5FW5 A;  3I56 3;  4FCZ A;  1IK3 A;  1RRH A;  3CCQ 3;  1N9E A;  2BT3 A;  2B24 B;  2CW9 A;  3LTD A;  1GY7 A;  1W2B 2;  1PU4 A;  4IT7 A;  1JB2 A;  3CNM A;  3V99 A;  3K9M C;  3PCR A;  1US1 A;  1VQP 3;  4IIA A;  5AEW B;  2W0Q A;  4MMZ B;  3WOF B;  4N6T A;  2Z6B A;  1GD4 A;  2CHC A;  8CHO A;  2C10 A;  4LEH A;  4XDW A;  1TU5 A;  1FGQ A;  5AIH A;  3X3X A;  1M1X B;  3TDG A;  1LXE A;  3CPW 2;  2GU1 A;  1QAL A;  1KSI A;  4XBX A;  2CIU A;  1M90 4;  3B7C A;  1EA2 A;  2CG1 A;  4G1M B;  4O2H A;  1OF5 B;  3FF0 A;  4HM8 B;  4WHA A;  2MC8 A;  2R4I A;  1DVC A;  1SPU A;  1JN5 B;  1IVW A;  2SBL A;  3VF1 A;  1VQM 3;  2JQ5 A;  1VQ6 3;  3EN8 A;  3MYT A;  4KFD A;  1W6G A;  1K73 4;  2LYX A;  2E2V A;  1W01 A;  3CCL 3;  2WOF A;  3GZX B;  2QA4 3;  3B4P A;  4N6L A;  1QMA A;  2FGT A;  3H51 A;  5IER A;  1GYB A;  1JB4 A;  3RGA A;  3K63 A;  1IVU A;  4AEQ A;  1JRQ A;  4HKV B;  5STD A;  2WO0 A;  3DM8 A;  3N8B A;  4HVN A;  2YFL B;  4CDL A;  5IG5 A;  3UJM A;  1WMP A;  1OF5 A;  2CH9 A;  3MG1 A;  2CKF B;  3KFQ C;  3OWY A;  4EYC A;  3BLZ A;  1T5Y A;  1K9M 4;  2O9U X;  2XH9 A;  1IV7 A;  3LML A;  3UL5 A;  3S5C A;  1N5P A;  2P38 A;  5IG0 A;  5EVH A;  1JB5 A;  3V98 A;  1O7N B;  1W02 A;  1D6Z A;  4HM6 B;  5JBS A;  1W5Z A;  3CCE 3;  2IA7 A;  4X2H A;  3T8U A;  4KFE A;  1QVF 2;  3S67 A;  7STD A;  1RN7 A;  2ML6 A;  3M8C A;  3NV0 B;  1N8Q A;  4L8O A;  3PZW A;  4K1V A;  4HYZ A;  1IQX A;  2OTJ 3;  2OCT A;  4FMD A;  4X2O A;  1U8C B;  3GAX A;  3SED A;  5LC7 A;  3CD6 3;  2XRX B;  2OOV C;  2UX0 A;  3DXO A;  5DRV A;  1TP6 A;  5IW9 A;  3KSE D;  4LGQ A;  4HM1 B;  3BB9 A;  3T8N A;  1YJ9 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...