4J9AA

Engineered digoxigenin binder dig10.3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
122
Chain Sequence
NAKEIVVHALRLLENGDARGWSDLFHPEGVLEYPYPPPGYKTRFEGRETIWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAYDYIAVWRTRDGQILLYRLFFNPLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of ligand-binding proteins with high affinity and selectivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Digoxigenin binding protein
molecule keywords Engineered Digoxigenin binder protein DIG10.3
total genus 32
structure length 122
sequence length 122
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4j9aA00
4HM5B 5D83A 5FW5A 3T8NA 3MG3A 1JN5B 3KE7A 5EVHA 2BMQB 3ECFA 3EN1B 3JUPA 3LZAA 1OCVA 3LYGA 3T8UA 2UX0A 3E99A 1O7WB 2Z7AA 4K1UA 2F99A 1JKGA 1DMMA 4H3UA 1E3RA 3A76A 2PZVA 3FSDA 3RGAA 3M8CA 4HJLB 3KZTA 5AIHA 3NV0A 3OV4A 1W02A 2BNGA 2HMOB 4HM3B 3FGYA 4RZMA 3NBRA 1O7PB 3F9SA 4WYKB 4HM8B 3NXJA 1ASKA 3OX9A 1K41A 4J8TA 5AIGA 5IERA 5KP1A 2GBXB 4KVHA 5IG5A 4FCJA 3SOYA 1OHOA 5BXQA 5CF1A 1OH0A 5STDA 2XR8B 1GYBA 3NHXA 5IG0A 3FF2A 2IMJA 3CNMA 1JB5A 7STDA 2STDA 2QGUA 2CHCA 4X2HA 3OWYA 1OF5A 1EG9B 3FZWA 3B8LA 1DMNA 2YFIB 5D81A 2B24B 1W00A 5IENA 5G2GA 1CQSA 1GY6A 4HM2B 2A15A 1GY5A 1JN5A 1NU3A 2Z76A 3B4PA 3CU3A 2HMKB 3D9RA 3EQQB 1E97A 1W01A 3HK4A 2XRXB 3OXAA 4L8OA 3EJVA 4WP5A 1Q40B 2HMJB 1OPYA 1VZZA 1JKGB 3CNXA 3EF8A 3ROBA 5CF2A 1TP6A 3DM8A 3I0YA 2GBWB 3F7XA 4R9KA 4Q53A 1OHSA 5DRVA 3DXOA 4WYKA 1HKXA 1U5OA 4XBTA 3HZPA 1NDOB 1ISKA 2GEYA 3GZYB 3GWRA 1C7HA 3JUMA 4FCMA 4XM4A 1BUQA 5IF6A 8CHOA 2GXFA 2YFJB 3EC9A 4HM6B 1A2KA 4L7KA 5CLKA 5IEPA 4HM7B 5AIIA 2GEXA 3H3HA 4OVMA 4HKVB 1NWWA 1UUWB 2BMRB 3GZBA 5IEOA 3MG1A 5AEUB 5TGNA 1GY7A 4HZBB 3VGNA 2I9WA 2XSHB 3B4OA 3RGRA 4HM0B 3G0KA 3VSYA 5JPPA 1SJWA 3CPOA 3Q90A 4WWUC 5CK6A 5BVBA 3FKAA 3MKIA 3F40A 4XBYA 4HVNA 2HMMB 1W6YA 1Q40A 2QIYA 4LEHA 5AI1A 1OGZA 5HGRA 3DZLA 2RFRA 4XDVA 3NV0B 3GRDA 3HX8A 4HM4B 1JB2A 4XB5A 2RCDA 3KKGA 1JB4A 1QMAA 4J9AA 5D82A 3OWUA 3GZXB 4K1VA 2JQ5A 3EBTA 1UUVB 3MSOA 2HMLB 4IIAA 2OWPA 4HM1B 1O7HB 3NM2A 4LGQA 3DUKA 2B1XB 5AIFA 1AR0A 4I4KA 3MYTA 3NUVA 3MG2A 1ZO2A 4ORLA 1ULJB 3FLJA 4N3VA 4R1KA 5KP4A 4L8PA 3MHEA 3S5CA 3UNLA 4X2OA 3GZRA 2RGQA 3EN8A 4CDLA 1ULIB 1GS3A 5KP3A 2YFLB 4STDA 3EX9A 3F8HA 3STDA 1EA2A 1O7NB 1QJGA 2F98A 3B7CA 1S5AA 1Z1SA 3EBYA 3F14A 3K0ZA 3JUOA 4HZ9B 3BLZA 5IG4A 4XBXA 4XDWA 2HMNB 4U13A 1DMQA 1E3VA 2INXA 2Z77A 3KSPA 2BMOB 2F86B 3WMDA 4R9LA 3IPTA 4LMIA 3SOAA 1O7GB 3EHCA 4MJDA 6STDA 3DMCA 3FF0A 4GB5A 1OUNA 1Q42A 3FH1A 4OUQA 3BB9A 3JUQA 4PEJA 5DREA 1TUHA 3UJMA 1ZX2A 1O7MB 3ER7A 3F8XA 1OF5B 5JPUA 2W2CA 3H51A 3F7SA 2R4IA 1OGXA 3JUNA 3K7CA 2XSOB 5CXOA 3G8ZA 1STDA 2CKFB 1WQLB 1IDPA 5AEWB 3SEDA 3G16A 1OHPA 5IG3A 3OWSA 2K54A
chains in the Genus database with same CATH superfamily
1ROVA 4HM5B 5FW5A 5GSPA 1LVNA 3T8NA 3KE7A 1JV2B 3ECFA 3JUPA 1OCVA 3K63A 1V74A 3PS8A 2KAAA 5I97A 3E99A 1CYUA 3NQZA 3SX1A 2H0GA 4H3UA 1DMMA 3FSDA 1MWRA 3KZTA 3NV0A 1UGIA 2XF3A 4HM3B 1VQM3 1O7PB 3DH2A 1BSEA 1EUIC 5KP1A 2CIUA 1TFOA 4FCJA 2KF3A 1OHOA 4HOHA 5BXQA 4O2HA 3G713 1VQ73 2XR8B 3U97A 3NHXA 1PY3A 1IV9A 1FGTA 2K0MA 1EG9B 1DVDA 1X1XA 1DMNA 2B24B 1RRLA 4K90B 5IENA 2AADA 3I563 2WO0A 1M904 4X2OA 1UI8A 1BOXA 1JN5A 1NU3A 2Z76A 3ALAA 3B4PA 4L8OA 3WA2X 3UB1A 3OXAA 1BANA 3G6E3 2HMJB 1VZZA 2F5WA 1JKGB 2OCTA 3ROBA 5M1AA 5CF2A 1TP6A 3DM8A 2C10A 2GBWB 2XGNA 4R9KA 1FGMA 3UL5A 1HKXA 1BRSA 3HIIA 3HZPA 1NDOB 1G0TA 1I2EA 4FMBA 1IVWA 1C7HA 1FZUA 3V92A 8CHOA 2YFJB 5CLKA 1U8CB 1I0XA 2SARA 1X1YA 3H3HA 4OVMA 2BMRB 3GZBA 3ZG5A 1Q7Y4 2F56A 1NNVA 2BU4A 5TGNA 2P0MA 2ZDJA 2OQEA 4HZBB 1UI7A 2P38A 2XSHB 3B4OA 4HM0B 3VSYA 4N6OB 2W03A 4N6MA 3CCJ3 1VQ93 3PGBA 5BVBA 4QWTA 4XBYA 3L0RA 3URPA 1W6YA 2RFRA 3BNEA 3HX8A 3WHOA 5G1KA 3SVAA 4LYLB 1IVVA 1FGOA 2ML5A 1ZS7A 4J9AA 3J7Yd 1GMPA 1BRNL 1UCKA 1MWUA 2Z6BA 1GD4A 9RNTA 5RNTA 5AIFA 3MG2A 1VQP3 4ORLA 2W9PA 4EW5A 4EV5A 1BAOA 1BNEA 3UNLA 2QEX3 1CYVA 3AGNA 1IYYA 1LXEA 3S67A 1K734 1ULIB 4J5GA 3D79A 2CFKA 4WFOA 3X40A 1BNFA 1EQKA 2YFLB 1JZDA 1PYLA 1O7NB 2F98A 3K0ZA 3EBYA 1HU9A 1W6CA 3JUOA 3BLZA 2D42A 1RTUA 4MMZB 4XDWA 2HMNB 2H0IA 2E2VA 2Z77A 4J5KA 4IPBA 1TRPA 3X42A 1SPUA 1LQGC 1UCJA 3D4AA 3SXXA 1I3IA 1GMRA 1FGRA 4N6UA 1LRAA 1RN7A 6STDA 1I0VA 1A67A 3Q3FA 1TUHA 3IJEB 1NB3I 3UJMA 3CCR3 5JPUA 1MWTA 1OF5B 1IQXA 4HAAA 3F7SA 2R4IA 1OGXA 2GSPA 3KCHA 1N9EA 1N8R4 3LH4A 1Q864 5AEWB 1KC84 1IDPA 3SEDA 2K54A 3CME3 5D83A 3MG3A 5EVHA 1A90A 2BMQB 3PXMA 4GSPA 3CMA3 3DGOA 4CJNA 1O7WB 1UCIA 1BRIA 3DGMA 2F99A 3FG3A 6GSPA 1E3RA 3A76A 2PZVA 3LTAA 3LTCA 2J8XB 4WYKB 1BNSA 1N8QA 3FGYA 3NBRA 2C4BA 2CG1A 3CC43 1ASKA 3QRDA 2LQVA 2W0QA 4J8TA 4BL2A 2GBXB 2RSXA 3VF1A 4O3VA 4BU4A 2OOVA 2D1WA 5CF1A 5STDA 3PYJA 1GYBA 1LOWA 1RHLA 3FF2A 2IMJA 2QA43 2STDA 2QGUA 2XGLA 4X2HA 2ZA4A 1FGQA 3FZWA 4GHOA 1KWIA 3B8LA 2FXTA 2P05A 3KIIA 3LT9A 1W00A 4NREA 2L1SA 1B2XA 4R80A 1GY6A 4HM2B 2A15A 3Q1CA 5G2GA 4EBGA 1W01A 1BUJA 1RLSA 2XRXB 3N9HA 4CPKA 1SIHA 4KFFA 5LC6A 3F7XA 1UDII 4O02B 5DRVA 3CXC2 2GU1A 1US1A 2XH9A 1RGFA 1U5OA 1KSIA 2IA7A 2RBIA 1LOYA 2CH9A 1VQ43 3GZYB 3GWRA 3N8BA 4FCMA 1BUQA 4AKZA 2GXFA 4L7KA 5AYSC 4H61A 4DKIA 1YHQ3 2KRTA 2W56A 4NPBA 2WOHA 5HOHA 4HKVB 1NWWA 1UUWB 3D5GA 3HI7A 5IEOA 2CX0A 3CPW2 1RN4A 2KXGA 3DGNA 1W7CA 1YIJ3 2IUKA 1IK3A 1SJWA 1FUTA 1EEJA 3CPOA 1RMSA 3Q90A 3O8YA 7RNTA 4FMCA 2XFSA 3FKAA 2CFGA 1BSCA 1Q40A 2HMMB 5AYRB 1OGZA 3CCV3 1VQO3 1RSNA 3NV0B 3SYUA 4BL3A 1VQ53 3TDGA 4BIRA 3IMAB 1A2PA 3K9MC 1T2HA 2BHMA 2F5MA 4EXRA 3OWUA 1DE3A 3MPHA 3DUKA 1V58A 2B1XB 4CCVA 3MYTA 3FG4A 1DVCA 3NUVA 1B2UA 2ZL8A 4N3VA 5KP4A 3OW22 1BSDA 1YJW3 1TFKA 3GZRA 3NX0A 2O9UX 2CWUA 1IQ8A 3STDA 5KP3A 4STDA 3EX9A 2WOFA 1EA2A 1B2ZA 1Q9EA 1B2SA 4TX4A 1Z1SA 3F14A 5ELJA 3PCSA 4N6V0 1VQ63 4U13A 2BMOB 1ROAA 4R9LA 1BRHA 1NB5I 4MEIA 1W2B2 4WHAA 3SOAA 1PFPA 3EHCA 4EC6A 3DMCA 4BTYA 1UW1A 3FF0A 1I70A 2F4YA 1Q42A 1RJOA 5DREA 1QAFA 1BNGA 1TIJA 2P09A 1IU7A 2XEPA 4G1MB 1N5HA 2Y73A 4HYZA 1IT7A 1SIIA 3HOHA 4BTXA 1VQN3 8RNTA 3H51A 3KSED 1Y4KA 2XSOB 1YVSA 3QK9A 3G8ZA 5LC7A 3CC23 3OWSA 1RGLA 1VQK3 1RNBA 2SBLA 3EN1B 3LZAA 1T5YA 3LYGA 1BRKA 4KFEA 2KF6A 2Z7AA 1JKGA 3WDGB 1MWSA 2E2TA 1K9M4 1K8A4 3MWZA 3LXUX 3WODG 3OV4A 1W02A 2BNGA 4RZMA 7STDA 3CCU3 3A5EA 4HM8B 4I5QA 4K61A 1MNLA 1T3BA 2ML6A 5IERA 2KF5A 3LTBA 3SOYA 4MMXB 1RGKA 1T2IA 5IG0A 2W6JH 3BU4A 2R41A 3WA3A 3CD63 1FYSA 1JRQA 3AHSA 1QAKA 4N6LA 1RKYA 2W9QA 3WOEB 3CCM3 2CC3A 1IV7A 1CQSA 4HM1B 1GY5A 3CU3A 3D9RA 3PCRA 4K1UA 3NBJA 2HMKB 4RNZA 1D6UA 1AVLA 3FCSB 1IT8A 1X1UA 4FR9A 4WP5A 1RRHA 2HOHA 3EJVA 1RGEA 3CNXA 1WMNA 3EF8A 1QVG2 3NQYA 4KZ1A 3CCE3 4AKYA 1RNTA 4RBNA 4N6NB 1CH0A 3DXOA 4XBTA 4FMDA 1I2GA 1W6GA 2GEYA 1W5ZA 3S27A 3CCS3 5IF6A 4HM6B 1BSAA 1IVUA 1A2KA 4EYCA 4RNTA 3EE1A 5AIIA 1I8VA 3V98A 2CFWA 2GEXA 1FUWA 4AEQA 3AHWA 2K3DA 4LSOA 1GY7A 1JBRA 1QVF2 1I3FA 2I9WA 3Q2PA 1WMOA 2BIRA 5CK6A 1B27A 3WOFB 1RDSA 1M1XB 3F40A 4HVNA 1B2MA 1K28A 4LEHA 1V57A 5HGRA 3KFQC 5AI1A 1HYFA 3DZLA 7GSPA 1YI23 1YIT3 4XDVA 1GD3A 2CG0A 1LNHA 2KCDA 1JB2A 1G96A 4XB5A 2RCDA 3KKGA 1MGRA 2IUJA 1M1K4 1AY7A 1QMAA 1VQ83 5D82A 3GZXB 3G4S3 1UUVB 3MSOA 2HMLB 4IIAA 3NM2A 2Y74A 1GOUA 1DETA 1FA3A 1ZO2A 1ULJB 3FLJA 3ZFZA 6RNTA 1BRGA 4L8PA 3MHEA 3EB8A 3FG1A 3X3XA 5M19A 1W2ZA 1BU4A 5BIRA 3S29A 2BT3A 4JF8A 3GSPA 3F8HA 4HBRA 2GU3A 1QJGA 3CC73 1KQS2 1BIRA 1RGHA 1A2VA 1FUSA 2UGIA 4MMYB 1DMQA 1E3VA 1RCLA 2F86B 1AVKA 1TRQA 2LYXA 1B3SA 3GAXA 1BVIA 1D6YA 3IPTA 2FGTA 3N54B 1GMQA 1BSBA 2V1LA 1R4YA 1YVBI 2P0XA 1B21A 2L4VA 4LMIA 4MJDA 1PU4A 1J2BA 2RNTA 1LQMB 4O8SA 4FCZA 3WR2A 1WMPA 4NHFA 1O7MB 1R4CA 3F8XA 2W2CA 2W56B 1L5GB 1ZGXA 2H0HA 3K7CA 5CXOA 1STDA 3PZWA 3G16A 1OHPA 2OOVC 3HIGA 3JUNA 1FW7A 5JBSA 1UGHI 1JN5B 2MF7A 3T8UA 1MGWA 2UX0A 1Q814 5EQLA 3AMOB 1DYUA 1RCKA 3D5IA 3RGRA 3RGAA 3S28A 3M8CA 2W04A 1HZ1A 4HJLB 4JRFA 1SARA 3BNDA 5AIHA 3V99A 1NJI4 2Q07A 5G1LA 2HMOB 1D6ZA 4LZIA 1YJ93 3BIRA 3F9SA 3NXJA 3OX9A 3CCQ3 1K41A 5AIGA 3DGLA 4ILFA 1G02A 3BNCA 4KVHA 5IG5A 1RGCA 1JBSA 1OH0A 1YGWA 1NO3A 3CNMA 1JB5A 1SQWA 2CHCA 3OWYA 1OF5A 2YFIB 5D81A 2IY2A 1WTHA 2MC8A 2KF4A 1Q7HA 2IYJA 3EQQB 3T0UA 3HK4A 1N9JA 5FGOA 1E97A 1YJN3 1AV4A 1Q40B 2FNQA 1OPYA 1BRJA 3I0YA 1I2FA 2CWVA 2CW9A 1F8NA 3AMOA 3I553 4Q53A 1OHSA 2OTL3 1LOVA 3ZG0A 4WYKA 1N5PA 1JZOA 4KFDA 1UCLA 1ISKA 4OK0A 2JDIH 3LOYA 4IT7A 3JUMA 4XM4A 5A0OB 2OQEC 2CWTA 1BNJA 3EC9A 2CK3H 5IEPA 4HM7B 3NM7A 1Q824 3X3YA 1AQZA 3RNTA 1RGAA 1BGSA 3MG1A 4KT3B 5AEUB 4GL6A 2WGQA 3JVCA 3U1WA 3VGNA 1JNQA 5JPPA 3G0KA 1IVXA 4WWUC 1OACA 4R4KA 1JBTA 1BNIA 3MKIA 3LTDA 3AGOA 2OTJ3 1WNHA 2C11A 2QIYA 2CX1A 1GSPA 1EKMA 1QALA 3DGYA 3GRDA 4HM4B 3UL6A 1YGEA 3DY5A 1JB4A 2XFTA 1VQQA 2BO9B 3LMLA 4K1VA 1LOXA 2JQ5A 1X1WA 3EBTA 3NBBA 1BNRA 2E2UA 2OWPA 4LGQA 1O7HB 1UUGB 1JJ22 1MOLA 1W4NA 1AR0A 4I4KA 1IQYA 3X3ZA 4R1KA 5M18A 3X41A 3S5CA 5IW9A 3CCL3 2CFDA 3K5TA 3RDEA 2RGQA 3EN8A 4CDLA 3BNBA 1C54A 1GS3A 1YNVX 2PNCA 1TJDA 2UUGC 3B7CA 1S5AA 4HZ9B 1KD14 2O3OA 5IG4A 1STFI 4XBXA 1S723 2INXA 1TU5A 3KSPA 3WMDA 5EEOA 2CFLA 5ELUA 1TTOA 3LT8A 4EV2A 1O7GB 1GOVA 4N6TA 1B20A 4FMAA 4GB5A 1OUNA 3FH1A 4OUQA 4PEJA 1GOYA 3BB9A 3JUQA 3D3LA 2YX9A 1ZX2A 1LNIA 2WGOA 2M7OA 3ER7A 5BU4A 1VQL3 4RNYA 4ZM8A 3KN4A 2AAEA 1CEWI 1M9GA 2CKFB 1RN1A 1WQLB 4BTWA 1RGGA 2ZHXB 5IG3A 3SLUA
chains in the Genus database with same CATH topology
1ROVA 4HM5B 5FW5A 3T8NA 1LVNA 3KE7A 1JV2B 3ECFA 3JUPA 1OCVA 3K63A 1V74A 3PS8A 5I97A 3E99A 1CYUA 3NQZA 3SX1A 4H3UA 1DMMA 3FSDA 3KZTA 3NV0A 2XF3A 4HM3B 1VQM3 1O7PB 5KP1A 2CIUA 1TFOA 4FCJA 1OHOA 5BXQA 4O2HA 3G713 1VQ73 2XR8B 3U97A 3NHXA 1IV9A 1FGTA 2K0MA 1EG9B 1DVDA 1DMNA 2B24B 1RRLA 4K90B 5IENA 3I563 2WO0A 1M904 4X2OA 1UI8A 3B4PA 1JN5A 1NU3A 2Z76A 3ALAA 3WA2X 4L8OA 3UB1A 3OXAA 3G6E3 2HMJB 1VZZA 1JKGB 2OCTA 3ROBA 5CF2A 1TP6A 3DM8A 2C10A 2GBWB 2XGNA 4R9KA 1FGMA 3UL5A 1HKXA 3HIIA 3HZPA 1NDOB 4FMBA 1IVWA 1C7HA 3V92A 8CHOA 2YFJB 5CLKA 1U8CB 3H3HA 4OVMA 2BMRB 3GZBA 1Q7Y4 5TGNA 2P0MA 2ZDJA 2OQEA 4HZBB 1UI7A 2P38A 2XSHB 3B4OA 4HM0B 3VSYA 4N6OB 2W03A 4N6MA 3CCJ3 1VQ93 3PGBA 5BVBA 4QWTA 4XBYA 3L0RA 1W6YA 2RFRA 3BNEA 3HX8A 3SVAA 1IVVA 1FGOA 2ML5A 4J9AA 2Z6BA 1GD4A 5AIFA 3MG2A 1VQP3 4ORLA 2W9PA 4EV5A 3UNLA 2QEX3 1CYVA 1LXEA 3S67A 1K734 1ULIB 2CFKA 4WFOA 3X40A 1EQKA 2YFLB 2F98A 1O7NB 3K0ZA 3EBYA 1HU9A 1W6CA 3JUOA 3BLZA 2D42A 4MMZB 4XDWA 2HMNB 2E2VA 2Z77A 4IPBA 3X42A 1SPUA 3SXXA 1FGRA 4N6UA 6STDA 1RN7A 1A67A 1TUHA 3IJEB 1NB3I 3UJMA 3CCR3 5JPUA 1OF5B 1IQXA 1N8R4 3F7SA 2R4IA 1OGXA 1N9EA 3LH4A 1Q864 5AEWB 1KC84 1IDPA 3SEDA 2K54A 3CME3 5D83A 3MG3A 5EVHA 1A90A 2BMQB 3PXMA 3CMA3 3DGOA 1O7WB 3DGMA 3FG3A 2F99A 1E3RA 3A76A 2PZVA 3LTAA 3LTCA 4WYKB 1N8QA 3FGYA 3NBRA 2CG1A 3CC43 1ASKA 3QRDA 2LQVA 2W0QA 4J8TA 2GBXB 2RSXA 3VF1A 4O3VA 2OOVA 2D1WA 5CF1A 5STDA 3PYJA 1GYBA 3FF2A 2IMJA 2QA43 2STDA 2QGUA 2XGLA 4X2HA 3FZWA 1FGQA 1KWIA 3B8LA 2FXTA 2P05A 3KIIA 3LT9A 1W00A 4NREA 4R80A 1GY6A 4HM2B 2A15A 3Q1CA 5G2GA 4EBGA 1W01A 2XRXB 3N9HA 1SIHA 4KFFA 5LC6A 3F7XA 4O02B 5DRVA 3CXC2 2GU1A 1US1A 2XH9A 1U5OA 1KSIA 2IA7A 2CH9A 1VQ43 3GZYB 3GWRA 3N8BA 4FCMA 1BUQA 4AKZA 2GXFA 4L7KA 5AYSC 4H61A 1YHQ3 2KRTA 2W56A 2WOHA 4HKVB 1NWWA 1UUWB 5IEOA 3HI7A 3CPW2 2KXGA 3DGNA 1W7CA 1YIJ3 2IUKA 1IK3A 1SJWA 3CPOA 3Q90A 3O8YA 4FMCA 2XFSA 3FKAA 2CFGA 2HMMB 1Q40A 5AYRB 1OGZA 3CCV3 1VQO3 3NV0B 1VQ53 3TDGA 3IMAB 3K9MC 2BHMA 4EXRA 3OWUA 3MPHA 3DUKA 2B1XB 4CCVA 3MYTA 3FG4A 1DVCA 3NUVA 5KP4A 2ZL8A 4N3VA 3OW22 1YJW3 1TFKA 3GZRA 3NX0A 2O9UX 2CWUA 1IQ8A 3STDA 5KP3A 4STDA 3EX9A 2WOFA 1EA2A 4TX4A 1Z1SA 3F14A 5ELJA 3PCSA 4N6V0 1VQ63 4U13A 2BMOB 1ROAA 4R9LA 1NB5I 4MEIA 1W2B2 4WHAA 3SOAA 1PFPA 3EHCA 4EC6A 3DMCA 4BTYA 1UW1A 3FF0A 1RJOA 1Q42A 5DREA 3J7Yd 1QAFA 1TIJA 2P09A 2XEPA 1IU7A 4G1MB 4HYZA 1N5HA 2Y73A 4BTXA 1IT7A 1SIIA 1VQN3 3H51A 3KSED 1Y4KA 2XSOB 3QK9A 3G8ZA 5LC7A 3CC23 3OWSA 1VQK3 2SBLA 3EN1B 3LZAA 1T5YA 3LYGA 4KFEA 2Z7AA 1JKGA 3WDGB 2E2TA 1K9M4 1K8A4 3MWZA 3LXUX 3WODG 3OV4A 1W02A 2BNGA 4RZMA 7STDA 3CCU3 4HM8B 4K61A 1MNLA 2ML6A 5IERA 3LTBA 3SOYA 4MMXB 5IG0A 2W6JH 3WA3A 3CD63 1JRQA 1QAKA 4N6LA 1RKYA 2W9QA 3WOEB 3CCM3 2CC3A 1IV7A 1CQSA 4HM1B 1GY5A 3CU3A 3D9RA 3PCRA 4K1UA 3NBJA 2HMKB 4RNZA 1D6UA 1AVLA 3FCSB 1IT8A 4FR9A 4WP5A 1RRHA 3EJVA 3CNXA 1WMNA 3EF8A 1QVG2 3NQYA 4KZ1A 3CCE3 4AKYA 4RBNA 4N6NB 3DXOA 4XBTA 4FMDA 1W6GA 2GEYA 1W5ZA 3S27A 3CCS3 5IF6A 4HM6B 1IVUA 1A2KA 4EYCA 3EE1A 5AIIA 3V98A 2CFWA 2GEXA 1FUWA 4AEQA 4LSOA 1GY7A 1QVF2 2I9WA 3Q2PA 1WMOA 5CK6A 3WOFB 1M1XB 3F40A 4HVNA 1K28A 4LEHA 5HGRA 3KFQC 5AI1A 1YI23 3DZLA 1YIT3 4XDVA 1GD3A 2CG0A 1LNHA 2KCDA 1JB2A 1G96A 4XB5A 2RCDA 3KKGA 2IUJA 1M1K4 1VQ83 1QMAA 5D82A 3GZXB 3G4S3 1UUVB 3MSOA 2HMLB 4IIAA 3NM2A 2Y74A 1FA3A 1ZO2A 1ULJB 3FLJA 4L8PA 3MHEA 3EB8A 3FG1A 3X3XA 1W2ZA 3S29A 2BT3A 4JF8A 3F8HA 4HBRA 2GU3A 1QJGA 3CC73 1KQS2 1A2VA 4MMYB 1DMQA 1E3VA 2F86B 1AVKA 2LYXA 3IPTA 3GAXA 1D6YA 3N54B 2FGTA 2V1LA 1YVBI 2P0XA 4LMIA 2L4VA 1PU4A 4MJDA 1J2BA 4O8SA 4FCZA 1WMPA 4NHFA 1O7MB 1R4CA 3F8XA 2W2CA 2W56B 1L5GB 3K7CA 5CXOA 1STDA 3PZWA 3G16A 1OHPA 2OOVC 3HIGA 3JUNA 5JBSA 1JN5B 2MF7A 3T8UA 2UX0A 1Q814 5EQLA 3AMOB 1DYUA 3RGRA 3S28A 3RGAA 3M8CA 2W04A 4HJLB 4JRFA 5AIHA 3BNDA 3V99A 1NJI4 2Q07A 2HMOB 1D6ZA 4LZIA 1YJ93 3F9SA 3NXJA 3OX9A 3CCQ3 1K41A 5AIGA 3DGLA 3BNCA 4KVHA 5IG5A 1OH0A 1NO3A 3CNMA 1JB5A 1SQWA 2CHCA 3OWYA 1OF5A 2YFIB 5D81A 1WTHA 2MC8A 3EQQB 3T0UA 3HK4A 1N9JA 5FGOA 1E97A 1YJN3 1AV4A 1Q40B 2FNQA 1OPYA 3I0YA 2CWVA 2CW9A 1F8NA 3AMOA 3I553 4Q53A 1OHSA 2OTL3 4WYKA 1N5PA 4KFDA 1ISKA 4OK0A 2JDIH 3LOYA 4IT7A 3JUMA 4XM4A 5A0OB 2OQEC 2CWTA 3EC9A 2CK3H 5IEPA 4HM7B 3NM7A 1Q824 3X3YA 3MG1A 5AEUB 4GL6A 2WGQA 3JVCA 3U1WA 3VGNA 1JNQA 5JPPA 3G0KA 1IVXA 4WWUC 1OACA 4R4KA 3MKIA 3LTDA 2OTJ3 1WNHA 2C11A 2QIYA 1EKMA 1QALA 3GRDA 4HM4B 3UL6A 1YGEA 3DY5A 1JB4A 2XFTA 3LMLA 2BO9B 4K1VA 1LOXA 2JQ5A 3EBTA 3NBBA 2E2UA 2OWPA 4LGQA 1O7HB 1JJ22 1MOLA 1W4NA 1AR0A 4I4KA 1IQYA 3X3ZA 4R1KA 3X41A 3S5CA 5IW9A 3CCL3 2CFDA 3K5TA 3RDEA 2RGQA 3EN8A 4CDLA 3BNBA 1GS3A 2PNCA 3B7CA 1S5AA 4HZ9B 1KD14 2O3OA 5IG4A 1STFI 4XBXA 1S723 2INXA 1TU5A 3KSPA 3WMDA 5EEOA 2CFLA 5ELUA 3LT8A 4EV2A 1O7GB 4N6TA 4FMAA 4GB5A 1OUNA 3FH1A 4OUQA 4PEJA 3BB9A 3JUQA 3D3LA 2YX9A 2WGOA 1ZX2A 3ER7A 2M7OA 1VQL3 4RNYA 4ZM8A 3KN4A 1CEWI 1M9GA 2CKFB 1WQLB 4BTWA 5IG3A 3SLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM5 B;  5D83 A;  5FW5 A;  3T8N A;  3MG3 A;  1JN5 B;  3KE7 A;  5EVH A;  2BMQ B;  3ECF A;  3EN1 B;  3JUP A;  3LZA A;  1OCV A;  3LYG A;  3T8U A;  2UX0 A;  3E99 A;  1O7W B;  2Z7A A;  4K1U A;  2F99 A;  1JKG A;  1DMM A;  4H3U A;  1E3R A;  3A76 A;  2PZV A;  3FSD A;  3RGA A;  3M8C A;  4HJL B;  3KZT A;  5AIH A;  3NV0 A;  3OV4 A;  1W02 A;  2BNG A;  2HMO B;  4HM3 B;  3FGY A;  4RZM A;  3NBR A;  1O7P B;  3F9S A;  4WYK B;  4HM8 B;  3NXJ A;  1ASK A;  3OX9 A;  1K41 A;  4J8T A;  5AIG A;  5IER A;  5KP1 A;  2GBX B;  4KVH A;  5IG5 A;  4FCJ A;  3SOY A;  1OHO A;  5BXQ A;  5CF1 A;  1OH0 A;  5STD A;  2XR8 B;  1GYB A;  3NHX A;  5IG0 A;  3FF2 A;  2IMJ A;  3CNM A;  1JB5 A;  7STD A;  2STD A;  2QGU A;  2CHC A;  4X2H A;  3OWY A;  1OF5 A;  1EG9 B;  3FZW A;  3B8L A;  1DMN A;  2YFI B;  5D81 A;  2B24 B;  1W00 A;  5IEN A;  5G2G A;  1CQS A;  1GY6 A;  4HM2 B;  2A15 A;  1GY5 A;  1JN5 A;  1NU3 A;  2Z76 A;  3B4P A;  3CU3 A;  2HMK B;  3D9R A;  3EQQ B;  1E97 A;  1W01 A;  3HK4 A;  2XRX B;  3OXA A;  4L8O A;  3EJV A;  4WP5 A;  1Q40 B;  2HMJ B;  1OPY A;  1VZZ A;  1JKG B;  3CNX A;  3EF8 A;  3ROB A;  5CF2 A;  1TP6 A;  3DM8 A;  3I0Y A;  2GBW B;  3F7X A;  4R9K A;  4Q53 A;  1OHS A;  5DRV A;  3DXO A;  4WYK A;  1HKX A;  1U5O A;  4XBT A;  3HZP A;  1NDO B;  1ISK A;  2GEY A;  3GZY B;  3GWR A;  1C7H A;  3JUM A;  4FCM A;  4XM4 A;  1BUQ A;  5IF6 A;  8CHO A;  2GXF A;  2YFJ B;  3EC9 A;  4HM6 B;  1A2K A;  4L7K A;  5CLK A;  5IEP A;  4HM7 B;  5AII A;  2GEX A;  3H3H A;  4OVM A;  4HKV B;  1NWW A;  1UUW B;  2BMR B;  3GZB A;  5IEO A;  3MG1 A;  5AEU B;  5TGN A;  1GY7 A;  4HZB B;  3VGN A;  2I9W A;  2XSH B;  3B4O A;  3RGR A;  4HM0 B;  3G0K A;  3VSY A;  5JPP A;  1SJW A;  3CPO A;  3Q90 A;  4WWU C;  5CK6 A;  5BVB A;  3FKA A;  3MKI A;  3F40 A;  4XBY A;  4HVN A;  2HMM B;  1W6Y A;  1Q40 A;  2QIY A;  4LEH A;  5AI1 A;  1OGZ A;  5HGR A;  3DZL A;  2RFR A;  4XDV A;  3NV0 B;  3GRD A;  3HX8 A;  4HM4 B;  1JB2 A;  4XB5 A;  2RCD A;  3KKG A;  1JB4 A;  1QMA A;  4J9A A;  5D82 A;  3OWU A;  3GZX B;  4K1V A;  2JQ5 A;  3EBT A;  1UUV B;  3MSO A;  2HML B;  4IIA A;  2OWP A;  4HM1 B;  1O7H B;  3NM2 A;  4LGQ A;  3DUK A;  2B1X B;  5AIF A;  1AR0 A;  4I4K A;  3MYT A;  3NUV A;  3MG2 A;  1ZO2 A;  4ORL A;  1ULJ B;  3FLJ A;  4N3V A;  4R1K A;  5KP4 A;  4L8P A;  3MHE A;  3S5C A;  3UNL A;  4X2O A;  3GZR A;  2RGQ A;  3EN8 A;  4CDL A;  1ULI B;  1GS3 A;  5KP3 A;  2YFL B;  4STD A;  3EX9 A;  3F8H A;  3STD A;  1EA2 A;  1O7N B;  1QJG A;  2F98 A;  3B7C A;  1S5A A;  1Z1S A;  3EBY A;  3F14 A;  3K0Z A;  3JUO A;  4HZ9 B;  3BLZ A;  5IG4 A;  4XBX A;  4XDW A;  2HMN B;  4U13 A;  1DMQ A;  1E3V A;  2INX A;  2Z77 A;  3KSP A;  2BMO B;  2F86 B;  3WMD A;  4R9L A;  3IPT A;  4LMI A;  3SOA A;  1O7G B;  3EHC A;  4MJD A;  6STD A;  3DMC A;  3FF0 A;  4GB5 A;  1OUN A;  1Q42 A;  3FH1 A;  4OUQ A;  3BB9 A;  3JUQ A;  4PEJ A;  5DRE A;  1TUH A;  3UJM A;  1ZX2 A;  1O7M B;  3ER7 A;  3F8X A;  1OF5 B;  5JPU A;  2W2C A;  3H51 A;  3F7S A;  2R4I A;  1OGX A;  3JUN A;  3K7C A;  2XSO B;  5CXO A;  3G8Z A;  1STD A;  2CKF B;  1WQL B;  1IDP A;  5AEW B;  3SED A;  3G16 A;  1OHP A;  5IG3 A;  3OWS A;  2K54 A; 
#chains in the Genus database with same CATH topology
 1ROV A;  4HM5 B;  5FW5 A;  5GSP A;  1LVN A;  3T8N A;  3KE7 A;  1JV2 B;  3ECF A;  3JUP A;  1OCV A;  3K63 A;  1V74 A;  3PS8 A;  2KAA A;  5I97 A;  3E99 A;  1CYU A;  3NQZ A;  3SX1 A;  2H0G A;  4H3U A;  1DMM A;  3FSD A;  1MWR A;  3KZT A;  3NV0 A;  1UGI A;  2XF3 A;  4HM3 B;  1VQM 3;  1O7P B;  3DH2 A;  1BSE A;  1EUI C;  5KP1 A;  2CIU A;  1TFO A;  4FCJ A;  2KF3 A;  1OHO A;  4HOH A;  5BXQ A;  4O2H A;  3G71 3;  1VQ7 3;  2XR8 B;  3U97 A;  3NHX A;  1PY3 A;  1IV9 A;  1FGT A;  2K0M A;  1EG9 B;  1DVD A;  1X1X A;  1DMN A;  2B24 B;  1RRL A;  4K90 B;  5IEN A;  2AAD A;  3I56 3;  2WO0 A;  1M90 4;  4X2O A;  1UI8 A;  1BOX A;  1JN5 A;  1NU3 A;  2Z76 A;  3ALA A;  3B4P A;  4L8O A;  3WA2 X;  3UB1 A;  3OXA A;  1BAN A;  3G6E 3;  2HMJ B;  1VZZ A;  2F5W A;  1JKG B;  2OCT A;  3ROB A;  5M1A A;  5CF2 A;  1TP6 A;  3DM8 A;  2C10 A;  2GBW B;  2XGN A;  4R9K A;  1FGM A;  3UL5 A;  1HKX A;  1BRS A;  3HII A;  3HZP A;  1NDO B;  1G0T A;  1I2E A;  4FMB A;  1IVW A;  1C7H A;  1FZU A;  3V92 A;  8CHO A;  2YFJ B;  5CLK A;  1U8C B;  1I0X A;  2SAR A;  1X1Y A;  3H3H A;  4OVM A;  2BMR B;  3GZB A;  3ZG5 A;  1Q7Y 4;  2F56 A;  1NNV A;  2BU4 A;  5TGN A;  2P0M A;  2ZDJ A;  2OQE A;  4HZB B;  1UI7 A;  2P38 A;  2XSH B;  3B4O A;  4HM0 B;  3VSY A;  4N6O B;  2W03 A;  4N6M A;  3CCJ 3;  1VQ9 3;  3PGB A;  5BVB A;  4QWT A;  4XBY A;  3L0R A;  3URP A;  1W6Y A;  2RFR A;  3BNE A;  3HX8 A;  3WHO A;  5G1K A;  3SVA A;  4LYL B;  1IVV A;  1FGO A;  2ML5 A;  1ZS7 A;  4J9A A;  3J7Y d;  1GMP A;  1BRN L;  1UCK A;  1MWU A;  2Z6B A;  1GD4 A;  9RNT A;  5RNT A;  5AIF A;  3MG2 A;  1VQP 3;  4ORL A;  2W9P A;  4EW5 A;  4EV5 A;  1BAO A;  1BNE A;  3UNL A;  2QEX 3;  1CYV A;  3AGN A;  1IYY A;  1LXE A;  3S67 A;  1K73 4;  1ULI B;  4J5G A;  3D79 A;  2CFK A;  4WFO A;  3X40 A;  1BNF A;  1EQK A;  2YFL B;  1JZD A;  1PYL A;  1O7N B;  2F98 A;  3K0Z A;  3EBY A;  1HU9 A;  1W6C A;  3JUO A;  3BLZ A;  2D42 A;  1RTU A;  4MMZ B;  4XDW A;  2HMN B;  2H0I A;  2E2V A;  2Z77 A;  4J5K A;  4IPB A;  1TRP A;  3X42 A;  1SPU A;  1LQG C;  1UCJ A;  3D4A A;  3SXX A;  1I3I A;  1GMR A;  1FGR A;  4N6U A;  1LRA A;  1RN7 A;  6STD A;  1I0V A;  1A67 A;  3Q3F A;  1TUH A;  3IJE B;  1NB3 I;  3UJM A;  3CCR 3;  5JPU A;  1MWT A;  1OF5 B;  1IQX A;  4HAA A;  3F7S A;  2R4I A;  1OGX A;  2GSP A;  3KCH A;  1N9E A;  1N8R 4;  3LH4 A;  1Q86 4;  5AEW B;  1KC8 4;  1IDP A;  3SED A;  2K54 A;  3CME 3;  5D83 A;  3MG3 A;  5EVH A;  1A90 A;  2BMQ B;  3PXM A;  4GSP A;  3CMA 3;  3DGO A;  4CJN A;  1O7W B;  1UCI A;  1BRI A;  3DGM A;  2F99 A;  3FG3 A;  6GSP A;  1E3R A;  3A76 A;  2PZV A;  3LTA A;  3LTC A;  2J8X B;  4WYK B;  1BNS A;  1N8Q A;  3FGY A;  3NBR A;  2C4B A;  2CG1 A;  3CC4 3;  1ASK A;  3QRD A;  2LQV A;  2W0Q A;  4J8T A;  4BL2 A;  2GBX B;  2RSX A;  3VF1 A;  4O3V A;  4BU4 A;  2OOV A;  2D1W A;  5CF1 A;  5STD A;  3PYJ A;  1GYB A;  1LOW A;  1RHL A;  3FF2 A;  2IMJ A;  2QA4 3;  2STD A;  2QGU A;  2XGL A;  4X2H A;  2ZA4 A;  1FGQ A;  3FZW A;  4GHO A;  1KWI A;  3B8L A;  2FXT A;  2P05 A;  3KII A;  3LT9 A;  1W00 A;  4NRE A;  2L1S A;  1B2X A;  4R80 A;  1GY6 A;  4HM2 B;  2A15 A;  3Q1C A;  5G2G A;  4EBG A;  1W01 A;  1BUJ A;  1RLS A;  2XRX B;  3N9H A;  4CPK A;  1SIH A;  4KFF A;  5LC6 A;  3F7X A;  1UDI I;  4O02 B;  5DRV A;  3CXC 2;  2GU1 A;  1US1 A;  2XH9 A;  1RGF A;  1U5O A;  1KSI A;  2IA7 A;  2RBI A;  1LOY A;  2CH9 A;  1VQ4 3;  3GZY B;  3GWR A;  3N8B A;  4FCM A;  1BUQ A;  4AKZ A;  2GXF A;  4L7K A;  5AYS C;  4H61 A;  4DKI A;  1YHQ 3;  2KRT A;  2W56 A;  4NPB A;  2WOH A;  5HOH A;  4HKV B;  1NWW A;  1UUW B;  3D5G A;  3HI7 A;  5IEO A;  2CX0 A;  3CPW 2;  1RN4 A;  2KXG A;  3DGN A;  1W7C A;  1YIJ 3;  2IUK A;  1IK3 A;  1SJW A;  1FUT A;  1EEJ A;  3CPO A;  1RMS A;  3Q90 A;  3O8Y A;  7RNT A;  4FMC A;  2XFS A;  3FKA A;  2CFG A;  1BSC A;  1Q40 A;  2HMM B;  5AYR B;  1OGZ A;  3CCV 3;  1VQO 3;  1RSN A;  3NV0 B;  3SYU A;  4BL3 A;  1VQ5 3;  3TDG A;  4BIR A;  3IMA B;  1A2P A;  3K9M C;  1T2H A;  2BHM A;  2F5M A;  4EXR A;  3OWU A;  1DE3 A;  3MPH A;  3DUK A;  1V58 A;  2B1X B;  4CCV A;  3MYT A;  3FG4 A;  1DVC A;  3NUV A;  1B2U A;  2ZL8 A;  4N3V A;  5KP4 A;  3OW2 2;  1BSD A;  1YJW 3;  1TFK A;  3GZR A;  3NX0 A;  2O9U X;  2CWU A;  1IQ8 A;  3STD A;  5KP3 A;  4STD A;  3EX9 A;  2WOF A;  1EA2 A;  1B2Z A;  1Q9E A;  1B2S A;  4TX4 A;  1Z1S A;  3F14 A;  5ELJ A;  3PCS A;  4N6V 0;  1VQ6 3;  4U13 A;  2BMO B;  1ROA A;  4R9L A;  1BRH A;  1NB5 I;  4MEI A;  1W2B 2;  4WHA A;  3SOA A;  1PFP A;  3EHC A;  4EC6 A;  3DMC A;  4BTY A;  1UW1 A;  3FF0 A;  1I70 A;  2F4Y A;  1Q42 A;  1RJO A;  5DRE A;  1QAF A;  1BNG A;  1TIJ A;  2P09 A;  1IU7 A;  2XEP A;  4G1M B;  1N5H A;  2Y73 A;  4HYZ A;  1IT7 A;  1SII A;  3HOH A;  4BTX A;  1VQN 3;  8RNT A;  3H51 A;  3KSE D;  1Y4K A;  2XSO B;  1YVS A;  3QK9 A;  3G8Z A;  5LC7 A;  3CC2 3;  3OWS A;  1RGL A;  1VQK 3;  1RNB A;  2SBL A;  3EN1 B;  3LZA A;  1T5Y A;  3LYG A;  1BRK A;  4KFE A;  2KF6 A;  2Z7A A;  1JKG A;  3WDG B;  1MWS A;  2E2T A;  1K9M 4;  1K8A 4;  3MWZ A;  3LXU X;  3WOD G;  3OV4 A;  1W02 A;  2BNG A;  4RZM A;  7STD A;  3CCU 3;  3A5E A;  4HM8 B;  4I5Q A;  4K61 A;  1MNL A;  1T3B A;  2ML6 A;  5IER A;  2KF5 A;  3LTB A;  3SOY A;  4MMX B;  1RGK A;  1T2I A;  5IG0 A;  2W6J H;  3BU4 A;  2R41 A;  3WA3 A;  3CD6 3;  1FYS A;  1JRQ A;  3AHS A;  1QAK A;  4N6L A;  1RKY A;  2W9Q A;  3WOE B;  3CCM 3;  2CC3 A;  1IV7 A;  1CQS A;  4HM1 B;  1GY5 A;  3CU3 A;  3D9R A;  3PCR A;  4K1U A;  3NBJ A;  2HMK B;  4RNZ A;  1D6U A;  1AVL A;  3FCS B;  1IT8 A;  1X1U A;  4FR9 A;  4WP5 A;  1RRH A;  2HOH A;  3EJV A;  1RGE A;  3CNX A;  1WMN A;  3EF8 A;  1QVG 2;  3NQY A;  4KZ1 A;  3CCE 3;  4AKY A;  1RNT A;  4RBN A;  4N6N B;  1CH0 A;  3DXO A;  4XBT A;  4FMD A;  1I2G A;  1W6G A;  2GEY A;  1W5Z A;  3S27 A;  3CCS 3;  5IF6 A;  4HM6 B;  1BSA A;  1IVU A;  1A2K A;  4EYC A;  4RNT A;  3EE1 A;  5AII A;  1I8V A;  3V98 A;  2CFW A;  2GEX A;  1FUW A;  4AEQ A;  3AHW A;  2K3D A;  4LSO A;  1GY7 A;  1JBR A;  1QVF 2;  1I3F A;  2I9W A;  3Q2P A;  1WMO A;  2BIR A;  5CK6 A;  1B27 A;  3WOF B;  1RDS A;  1M1X B;  3F40 A;  4HVN A;  1B2M A;  1K28 A;  4LEH A;  1V57 A;  5HGR A;  3KFQ C;  5AI1 A;  1HYF A;  3DZL A;  7GSP A;  1YI2 3;  1YIT 3;  4XDV A;  1GD3 A;  2CG0 A;  1LNH A;  2KCD A;  1JB2 A;  1G96 A;  4XB5 A;  2RCD A;  3KKG A;  1MGR A;  2IUJ A;  1M1K 4;  1AY7 A;  1QMA A;  1VQ8 3;  5D82 A;  3GZX B;  3G4S 3;  1UUV B;  3MSO A;  2HML B;  4IIA A;  3NM2 A;  2Y74 A;  1GOU A;  1DET A;  1FA3 A;  1ZO2 A;  1ULJ B;  3FLJ A;  3ZFZ A;  6RNT A;  1BRG A;  4L8P A;  3MHE A;  3EB8 A;  3FG1 A;  3X3X A;  5M19 A;  1W2Z A;  1BU4 A;  5BIR A;  3S29 A;  2BT3 A;  4JF8 A;  3GSP A;  3F8H A;  4HBR A;  2GU3 A;  1QJG A;  3CC7 3;  1KQS 2;  1BIR A;  1RGH A;  1A2V A;  1FUS A;  2UGI A;  4MMY B;  1DMQ A;  1E3V A;  1RCL A;  2F86 B;  1AVK A;  1TRQ A;  2LYX A;  1B3S A;  3GAX A;  1BVI A;  1D6Y A;  3IPT A;  2FGT A;  3N54 B;  1GMQ A;  1BSB A;  2V1L A;  1R4Y A;  1YVB I;  2P0X A;  1B21 A;  2L4V A;  4LMI A;  4MJD A;  1PU4 A;  1J2B A;  2RNT A;  1LQM B;  4O8S A;  4FCZ A;  3WR2 A;  1WMP A;  4NHF A;  1O7M B;  1R4C A;  3F8X A;  2W2C A;  2W56 B;  1L5G B;  1ZGX A;  2H0H A;  3K7C A;  5CXO A;  1STD A;  3PZW A;  3G16 A;  1OHP A;  2OOV C;  3HIG A;  3JUN A;  1FW7 A;  5JBS A;  1UGH I;  1JN5 B;  2MF7 A;  3T8U A;  1MGW A;  2UX0 A;  1Q81 4;  5EQL A;  3AMO B;  1DYU A;  1RCK A;  3D5I A;  3RGR A;  3RGA A;  3S28 A;  3M8C A;  2W04 A;  1HZ1 A;  4HJL B;  4JRF A;  1SAR A;  3BND A;  5AIH A;  3V99 A;  1NJI 4;  2Q07 A;  5G1L A;  2HMO B;  1D6Z A;  4LZI A;  1YJ9 3;  3BIR A;  3F9S A;  3NXJ A;  3OX9 A;  3CCQ 3;  1K41 A;  5AIG A;  3DGL A;  4ILF A;  1G02 A;  3BNC A;  4KVH A;  5IG5 A;  1RGC A;  1JBS A;  1OH0 A;  1YGW A;  1NO3 A;  3CNM A;  1JB5 A;  1SQW A;  2CHC A;  3OWY A;  1OF5 A;  2YFI B;  5D81 A;  2IY2 A;  1WTH A;  2MC8 A;  2KF4 A;  1Q7H A;  2IYJ A;  3EQQ B;  3T0U A;  3HK4 A;  1N9J A;  5FGO A;  1E97 A;  1YJN 3;  1AV4 A;  1Q40 B;  2FNQ A;  1OPY A;  1BRJ A;  3I0Y A;  1I2F A;  2CWV A;  2CW9 A;  1F8N A;  3AMO A;  3I55 3;  4Q53 A;  1OHS A;  2OTL 3;  1LOV A;  3ZG0 A;  4WYK A;  1N5P A;  1JZO A;  4KFD A;  1UCL A;  1ISK A;  4OK0 A;  2JDI H;  3LOY A;  4IT7 A;  3JUM A;  4XM4 A;  5A0O B;  2OQE C;  2CWT A;  1BNJ A;  3EC9 A;  2CK3 H;  5IEP A;  4HM7 B;  3NM7 A;  1Q82 4;  3X3Y A;  1AQZ A;  3RNT A;  1RGA A;  1BGS A;  3MG1 A;  4KT3 B;  5AEU B;  4GL6 A;  2WGQ A;  3JVC A;  3U1W A;  3VGN A;  1JNQ A;  5JPP A;  3G0K A;  1IVX A;  4WWU C;  1OAC A;  4R4K A;  1JBT A;  1BNI A;  3MKI A;  3LTD A;  3AGO A;  2OTJ 3;  1WNH A;  2C11 A;  2QIY A;  2CX1 A;  1GSP A;  1EKM A;  1QAL A;  3DGY A;  3GRD A;  4HM4 B;  3UL6 A;  1YGE A;  3DY5 A;  1JB4 A;  2XFT A;  1VQQ A;  2BO9 B;  3LML A;  4K1V A;  1LOX A;  2JQ5 A;  1X1W A;  3EBT A;  3NBB A;  1BNR A;  2E2U A;  2OWP A;  4LGQ A;  1O7H B;  1UUG B;  1JJ2 2;  1MOL A;  1W4N A;  1AR0 A;  4I4K A;  1IQY A;  3X3Z A;  4R1K A;  5M18 A;  3X41 A;  3S5C A;  5IW9 A;  3CCL 3;  2CFD A;  3K5T A;  3RDE A;  2RGQ A;  3EN8 A;  4CDL A;  3BNB A;  1C54 A;  1GS3 A;  1YNV X;  2PNC A;  1TJD A;  2UUG C;  3B7C A;  1S5A A;  4HZ9 B;  1KD1 4;  2O3O A;  5IG4 A;  1STF I;  4XBX A;  1S72 3;  2INX A;  1TU5 A;  3KSP A;  3WMD A;  5EEO A;  2CFL A;  5ELU A;  1TTO A;  3LT8 A;  4EV2 A;  1O7G B;  1GOV A;  4N6T A;  1B20 A;  4FMA A;  4GB5 A;  1OUN A;  3FH1 A;  4OUQ A;  4PEJ A;  1GOY A;  3BB9 A;  3JUQ A;  3D3L A;  2YX9 A;  1ZX2 A;  1LNI A;  2WGO A;  2M7O A;  3ER7 A;  5BU4 A;  1VQL 3;  4RNY A;  4ZM8 A;  3KN4 A;  2AAE A;  1CEW I;  1M9G A;  2CKF B;  1RN1 A;  1WQL B;  4BTW A;  1RGG A;  2ZHX B;  5IG3 A;  3SLU A; 
#chains in the Genus database with same CATH homology
 1ROV A;  4HM5 B;  5FW5 A;  3T8N A;  1LVN A;  3KE7 A;  1JV2 B;  3ECF A;  3JUP A;  1OCV A;  3K63 A;  1V74 A;  3PS8 A;  5I97 A;  3E99 A;  1CYU A;  3NQZ A;  3SX1 A;  4H3U A;  1DMM A;  3FSD A;  3KZT A;  3NV0 A;  2XF3 A;  4HM3 B;  1VQM 3;  1O7P B;  5KP1 A;  2CIU A;  1TFO A;  4FCJ A;  1OHO A;  5BXQ A;  4O2H A;  3G71 3;  1VQ7 3;  2XR8 B;  3U97 A;  3NHX A;  1IV9 A;  1FGT A;  2K0M A;  1EG9 B;  1DVD A;  1DMN A;  2B24 B;  1RRL A;  4K90 B;  5IEN A;  3I56 3;  2WO0 A;  1M90 4;  4X2O A;  1UI8 A;  3B4P A;  1JN5 A;  1NU3 A;  2Z76 A;  3ALA A;  3WA2 X;  4L8O A;  3UB1 A;  3OXA A;  3G6E 3;  2HMJ B;  1VZZ A;  1JKG B;  2OCT A;  3ROB A;  5CF2 A;  1TP6 A;  3DM8 A;  2C10 A;  2GBW B;  2XGN A;  4R9K A;  1FGM A;  3UL5 A;  1HKX A;  3HII A;  3HZP A;  1NDO B;  4FMB A;  1IVW A;  1C7H A;  3V92 A;  8CHO A;  2YFJ B;  5CLK A;  1U8C B;  3H3H A;  4OVM A;  2BMR B;  3GZB A;  1Q7Y 4;  5TGN A;  2P0M A;  2ZDJ A;  2OQE A;  4HZB B;  1UI7 A;  2P38 A;  2XSH B;  3B4O A;  4HM0 B;  3VSY A;  4N6O B;  2W03 A;  4N6M A;  3CCJ 3;  1VQ9 3;  3PGB A;  5BVB A;  4QWT A;  4XBY A;  3L0R A;  1W6Y A;  2RFR A;  3BNE A;  3HX8 A;  3SVA A;  1IVV A;  1FGO A;  2ML5 A;  4J9A A;  2Z6B A;  1GD4 A;  5AIF A;  3MG2 A;  1VQP 3;  4ORL A;  2W9P A;  4EV5 A;  3UNL A;  2QEX 3;  1CYV A;  1LXE A;  3S67 A;  1K73 4;  1ULI B;  2CFK A;  4WFO A;  3X40 A;  1EQK A;  2YFL B;  2F98 A;  1O7N B;  3K0Z A;  3EBY A;  1HU9 A;  1W6C A;  3JUO A;  3BLZ A;  2D42 A;  4MMZ B;  4XDW A;  2HMN B;  2E2V A;  2Z77 A;  4IPB A;  3X42 A;  1SPU A;  3SXX A;  1FGR A;  4N6U A;  6STD A;  1RN7 A;  1A67 A;  1TUH A;  3IJE B;  1NB3 I;  3UJM A;  3CCR 3;  5JPU A;  1OF5 B;  1IQX A;  1N8R 4;  3F7S A;  2R4I A;  1OGX A;  1N9E A;  3LH4 A;  1Q86 4;  5AEW B;  1KC8 4;  1IDP A;  3SED A;  2K54 A;  3CME 3;  5D83 A;  3MG3 A;  5EVH A;  1A90 A;  2BMQ B;  3PXM A;  3CMA 3;  3DGO A;  1O7W B;  3DGM A;  3FG3 A;  2F99 A;  1E3R A;  3A76 A;  2PZV A;  3LTA A;  3LTC A;  4WYK B;  1N8Q A;  3FGY A;  3NBR A;  2CG1 A;  3CC4 3;  1ASK A;  3QRD A;  2LQV A;  2W0Q A;  4J8T A;  2GBX B;  2RSX A;  3VF1 A;  4O3V A;  2OOV A;  2D1W A;  5CF1 A;  5STD A;  3PYJ A;  1GYB A;  3FF2 A;  2IMJ A;  2QA4 3;  2STD A;  2QGU A;  2XGL A;  4X2H A;  3FZW A;  1FGQ A;  1KWI A;  3B8L A;  2FXT A;  2P05 A;  3KII A;  3LT9 A;  1W00 A;  4NRE A;  4R80 A;  1GY6 A;  4HM2 B;  2A15 A;  3Q1C A;  5G2G A;  4EBG A;  1W01 A;  2XRX B;  3N9H A;  1SIH A;  4KFF A;  5LC6 A;  3F7X A;  4O02 B;  5DRV A;  3CXC 2;  2GU1 A;  1US1 A;  2XH9 A;  1U5O A;  1KSI A;  2IA7 A;  2CH9 A;  1VQ4 3;  3GZY B;  3GWR A;  3N8B A;  4FCM A;  1BUQ A;  4AKZ A;  2GXF A;  4L7K A;  5AYS C;  4H61 A;  1YHQ 3;  2KRT A;  2W56 A;  2WOH A;  4HKV B;  1NWW A;  1UUW B;  5IEO A;  3HI7 A;  3CPW 2;  2KXG A;  3DGN A;  1W7C A;  1YIJ 3;  2IUK A;  1IK3 A;  1SJW A;  3CPO A;  3Q90 A;  3O8Y A;  4FMC A;  2XFS A;  3FKA A;  2CFG A;  2HMM B;  1Q40 A;  5AYR B;  1OGZ A;  3CCV 3;  1VQO 3;  3NV0 B;  1VQ5 3;  3TDG A;  3IMA B;  3K9M C;  2BHM A;  4EXR A;  3OWU A;  3MPH A;  3DUK A;  2B1X B;  4CCV A;  3MYT A;  3FG4 A;  1DVC A;  3NUV A;  5KP4 A;  2ZL8 A;  4N3V A;  3OW2 2;  1YJW 3;  1TFK A;  3GZR A;  3NX0 A;  2O9U X;  2CWU A;  1IQ8 A;  3STD A;  5KP3 A;  4STD A;  3EX9 A;  2WOF A;  1EA2 A;  4TX4 A;  1Z1S A;  3F14 A;  5ELJ A;  3PCS A;  4N6V 0;  1VQ6 3;  4U13 A;  2BMO B;  1ROA A;  4R9L A;  1NB5 I;  4MEI A;  1W2B 2;  4WHA A;  3SOA A;  1PFP A;  3EHC A;  4EC6 A;  3DMC A;  4BTY A;  1UW1 A;  3FF0 A;  1RJO A;  1Q42 A;  5DRE A;  3J7Y d;  1QAF A;  1TIJ A;  2P09 A;  2XEP A;  1IU7 A;  4G1M B;  4HYZ A;  1N5H A;  2Y73 A;  4BTX A;  1IT7 A;  1SII A;  1VQN 3;  3H51 A;  3KSE D;  1Y4K A;  2XSO B;  3QK9 A;  3G8Z A;  5LC7 A;  3CC2 3;  3OWS A;  1VQK 3;  2SBL A;  3EN1 B;  3LZA A;  1T5Y A;  3LYG A;  4KFE A;  2Z7A A;  1JKG A;  3WDG B;  2E2T A;  1K9M 4;  1K8A 4;  3MWZ A;  3LXU X;  3WOD G;  3OV4 A;  1W02 A;  2BNG A;  4RZM A;  7STD A;  3CCU 3;  4HM8 B;  4K61 A;  1MNL A;  2ML6 A;  5IER A;  3LTB A;  3SOY A;  4MMX B;  5IG0 A;  2W6J H;  3WA3 A;  3CD6 3;  1JRQ A;  1QAK A;  4N6L A;  1RKY A;  2W9Q A;  3WOE B;  3CCM 3;  2CC3 A;  1IV7 A;  1CQS A;  4HM1 B;  1GY5 A;  3CU3 A;  3D9R A;  3PCR A;  4K1U A;  3NBJ A;  2HMK B;  4RNZ A;  1D6U A;  1AVL A;  3FCS B;  1IT8 A;  4FR9 A;  4WP5 A;  1RRH A;  3EJV A;  3CNX A;  1WMN A;  3EF8 A;  1QVG 2;  3NQY A;  4KZ1 A;  3CCE 3;  4AKY A;  4RBN A;  4N6N B;  3DXO A;  4XBT A;  4FMD A;  1W6G A;  2GEY A;  1W5Z A;  3S27 A;  3CCS 3;  5IF6 A;  4HM6 B;  1IVU A;  1A2K A;  4EYC A;  3EE1 A;  5AII A;  3V98 A;  2CFW A;  2GEX A;  1FUW A;  4AEQ A;  4LSO A;  1GY7 A;  1QVF 2;  2I9W A;  3Q2P A;  1WMO A;  5CK6 A;  3WOF B;  1M1X B;  3F40 A;  4HVN A;  1K28 A;  4LEH A;  5HGR A;  3KFQ C;  5AI1 A;  1YI2 3;  3DZL A;  1YIT 3;  4XDV A;  1GD3 A;  2CG0 A;  1LNH A;  2KCD A;  1JB2 A;  1G96 A;  4XB5 A;  2RCD A;  3KKG A;  2IUJ A;  1M1K 4;  1VQ8 3;  1QMA A;  5D82 A;  3GZX B;  3G4S 3;  1UUV B;  3MSO A;  2HML B;  4IIA A;  3NM2 A;  2Y74 A;  1FA3 A;  1ZO2 A;  1ULJ B;  3FLJ A;  4L8P A;  3MHE A;  3EB8 A;  3FG1 A;  3X3X A;  1W2Z A;  3S29 A;  2BT3 A;  4JF8 A;  3F8H A;  4HBR A;  2GU3 A;  1QJG A;  3CC7 3;  1KQS 2;  1A2V A;  4MMY B;  1DMQ A;  1E3V A;  2F86 B;  1AVK A;  2LYX A;  3IPT A;  3GAX A;  1D6Y A;  3N54 B;  2FGT A;  2V1L A;  1YVB I;  2P0X A;  4LMI A;  2L4V A;  1PU4 A;  4MJD A;  1J2B A;  4O8S A;  4FCZ A;  1WMP A;  4NHF A;  1O7M B;  1R4C A;  3F8X A;  2W2C A;  2W56 B;  1L5G B;  3K7C A;  5CXO A;  1STD A;  3PZW A;  3G16 A;  1OHP A;  2OOV C;  3HIG A;  3JUN A;  5JBS A;  1JN5 B;  2MF7 A;  3T8U A;  2UX0 A;  1Q81 4;  5EQL A;  3AMO B;  1DYU A;  3RGR A;  3S28 A;  3RGA A;  3M8C A;  2W04 A;  4HJL B;  4JRF A;  5AIH A;  3BND A;  3V99 A;  1NJI 4;  2Q07 A;  2HMO B;  1D6Z A;  4LZI A;  1YJ9 3;  3F9S A;  3NXJ A;  3OX9 A;  3CCQ 3;  1K41 A;  5AIG A;  3DGL A;  3BNC A;  4KVH A;  5IG5 A;  1OH0 A;  1NO3 A;  3CNM A;  1JB5 A;  1SQW A;  2CHC A;  3OWY A;  1OF5 A;  2YFI B;  5D81 A;  1WTH A;  2MC8 A;  3EQQ B;  3T0U A;  3HK4 A;  1N9J A;  5FGO A;  1E97 A;  1YJN 3;  1AV4 A;  1Q40 B;  2FNQ A;  1OPY A;  3I0Y A;  2CWV A;  2CW9 A;  1F8N A;  3AMO A;  3I55 3;  4Q53 A;  1OHS A;  2OTL 3;  4WYK A;  1N5P A;  4KFD A;  1ISK A;  4OK0 A;  2JDI H;  3LOY A;  4IT7 A;  3JUM A;  4XM4 A;  5A0O B;  2OQE C;  2CWT A;  3EC9 A;  2CK3 H;  5IEP A;  4HM7 B;  3NM7 A;  1Q82 4;  3X3Y A;  3MG1 A;  5AEU B;  4GL6 A;  2WGQ A;  3JVC A;  3U1W A;  3VGN A;  1JNQ A;  5JPP A;  3G0K A;  1IVX A;  4WWU C;  1OAC A;  4R4K A;  3MKI A;  3LTD A;  2OTJ 3;  1WNH A;  2C11 A;  2QIY A;  1EKM A;  1QAL A;  3GRD A;  4HM4 B;  3UL6 A;  1YGE A;  3DY5 A;  1JB4 A;  2XFT A;  3LML A;  2BO9 B;  4K1V A;  1LOX A;  2JQ5 A;  3EBT A;  3NBB A;  2E2U A;  2OWP A;  4LGQ A;  1O7H B;  1JJ2 2;  1MOL A;  1W4N A;  1AR0 A;  4I4K A;  1IQY A;  3X3Z A;  4R1K A;  3X41 A;  3S5C A;  5IW9 A;  3CCL 3;  2CFD A;  3K5T A;  3RDE A;  2RGQ A;  3EN8 A;  4CDL A;  3BNB A;  1GS3 A;  2PNC A;  3B7C A;  1S5A A;  4HZ9 B;  1KD1 4;  2O3O A;  5IG4 A;  1STF I;  4XBX A;  1S72 3;  2INX A;  1TU5 A;  3KSP A;  3WMD A;  5EEO A;  2CFL A;  5ELU A;  3LT8 A;  4EV2 A;  1O7G B;  4N6T A;  4FMA A;  4GB5 A;  1OUN A;  3FH1 A;  4OUQ A;  4PEJ A;  3BB9 A;  3JUQ A;  3D3L A;  2YX9 A;  2WGO A;  1ZX2 A;  3ER7 A;  2M7O A;  1VQL 3;  4RNY A;  4ZM8 A;  3KN4 A;  1CEW I;  1M9G A;  2CKF B;  1WQL B;  4BTW A;  5IG3 A;  3SLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...