1T2IA

T76w mutant of rnase sa from streptomyces aureofaciens
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEAWQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of single tryptophan residues to the fluorescence and stability of ribonuclease sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 25
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1t2iA00
1B2ZA 1BNEA 1I2GA 1T2HA 1BIRA 1RNTA 6RNTA 1TTOA 1TRPA 1DE3A 1CH0A 1B27A 1RCLA 1B2MA 1RHLA 1BSEA 1FZUA 1X1WA 1SARA 2KF6A 4HAAA 1JBRA 1TRQA 3Q3FA 2BU4A 1RSNA 2F4YA 1UCKA 1B20A 1BNIA 4BU4A 1A2PA 1GMQA 1ZGXA 2AADA 1UCLA 1BUJA 1RGCA 4RNTA 5BIRA 1BSDA 1I0VA 1PY3A 1Q9EA 1PYLA 3URPA 3HOHA 3DGYA 1RGFA 1HZ1A 3AHWA 1BNJA 1FUSA 3BIRA 1FYSA 3WHOA 2F5MA 1I2EA 1G02A 1LOVA 1RGHA 1FUTA 1RMSA 1LOYA 2AAEA 1BRGA 1BNRA 1B2SA 4J5KA 1BANA 3DH2A 2HOHA 1GMPA 1RGGA 3AHSA 4GSPA 2BIRA 1GSPA 1BGSA 2SARA 1LOWA 1RGLA 9RNTA 2RBIA 1B3SA 1GOVA 1B21A 2KF3A 1GOUA 1BOXA 1UCJA 1YVSA 3GSPA 1C54A 1MGWA 3AGNA 7RNTA 1JBSA 3D4AA 4J5GA 1I8VA 1I3FA 1RCKA 1HYFA 3WR2A 1BSAA 1BSBA 1GMRA 1BNSA 1YNVX 1I70A 1I0XA 2F5WA 1BNFA 7GSPA 1BRIA 1B2UA 3SYUA 1BRNL 1X1YA 1FW7A 2RNTA 1AQZA 2F56A 1RGAA 1RTUA 5BU4A 1BNGA 5HOHA 1BRHA 1RLSA 1BRKA 2KAAA 3AGOA 1AY7A 1B2XA 1RGKA 1X1XA 1X1UA 2KF5A 3A5EA 2GSPA 4HOHA 1GOYA 5GSPA 2KF4A 1RNBA 3KCHA 2C4BA 1DETA 1T2IA 1BRSA 1UCIA 3BU4A 1LNIA 1JBTA 1BVIA 1RN4A 1RN1A 3RNTA 1BU4A 3D5IA 1BAOA 1I2FA 1I3IA 4BIRA 1YGWA 1BSCA 1BRJA 1LRAA 3D5GA 6GSPA 5RNTA 1IYYA 1RGEA 2ZA4A 8RNTA 1RDSA 1MGRA 1R4YA 4GHOA
chains in the Genus database with same CATH superfamily
1B2ZA 1IU7A 5EQLA 5IG5A 3SXXA 5G1LA 4EYCA 4HVNA 1Q824 1QVG2 1VQQA 1RNTA 3WOFB 6RNTA 3X40A 2XR8B 3AMOA 4N6MA 1UUGB 2BMQB 2RGQA 1KQS2 2CFGA 3ZG5A 1FGTA 2WOHA 3B4PA 1N9JA 1LQMB 3FH1A 3M8CA 2XFTA 5AI1A 1IV7A 1GD4A 1FZUA 1IVWA 3Q3FA 3OWUA 3CCM3 3GZRA 2CX1A 4GL6A 4BL3A 3CCJ3 1VQ63 3EN8A 3CPW2 1RSNA 3HX8A 2W9PA 2OTL3 4L8PA 3F8HA 4QWTA 4BU4A 5LC6A 2HMMB 1A2VA 1GMQA 1QJGA 2K54A 3LMLA 5D82A 3NQYA 3BNCA 4AKYA 1BUJA 1RGCA 1WMNA 5BIRA 1T5YA 3K5TA 1I0VA 3PYJA 5EVHA 3HOHA 3N54B 4BTXA 3B7CA 1O7NB 3DGYA 4MMZB 5IG3A 2W0QA 4R80A 1RGFA 3CME3 2CX0A 4MMXB 1BNJA 1JNQA 1IK3A 3CC23 3F9SA 1AR0A 2Q07A 2F5MA 2JQ5A 2XEPA 1RRLA 3MKIA 1SJWA 1I2EA 3NV0A 3OV4A 4LEHA 5CF2A 3DGLA 2YFLB 2QEX3 2W9QA 1RMSA 3WDGB 1VQM3 4U13A 3L0RA 3CCR3 2OQEC 3FGYA 4XB5A 4GSPA 1SIIA 1C7HA 1GSPA 2ML6A 3HK4A 3RGAA 1EKMA 3HIIA 1JB4A 2SARA 3FSDA 1IVVA 2OCTA 3WMDA 2L4VA 3JUMA 9RNTA 2Z7AA 2P09A 3NUVA 1AV4A 2BT3A 2W6JH 4LGQA 1IQYA 4WYKA 4LSOA 2XSHB 1NB3I 3F7SA 3ROBA 1GOUA 1YHQ3 3DXOA 1YVSA 3EX9A 3MYTA 2HMJB 1MGWA 1C54A 3AGNA 1JBSA 3FLJA 3D4AA 1UW1A 3VF1A 1U5OA 1ULJB 1UI7A 2B1XB 3FCSB 1HYFA 1TJDA 2Z76A 1N8QA 4HJLB 2XH9A 4STDA 1VQP3 1BSBA 4IPBA 2FNQA 3PCSA 2KXGA 4HZBB 3S5CA 1BNFA 3NX0A 4J9AA 3E99A 4R4KA 1MNLA 3SYUA 2GU3A 3VGNA 1Q42A 1OUNA 1FW7A 2RNTA 3SVAA 3LOYA 2H0GA 1MWUA 1R4CA 5BU4A 3PCRA 5FGOA 3X3ZA 1BRHA 3JUNA 1IVXA 3EBYA 5FW5A 2CHCA 3PGBA 3WOEB 2IUKA 4ZM8A 4HM8B 4CPKA 3D79A 3H51A 1BUQA 4LYLB 1YJ93 2RFRA 5JPPA 3NQZA 4O02B 2WGQA 1YIT3 1YIJ3 3BU4A 1LNIA 2QGUA 3V99A 1HKXA 4KT3B 1JB2A 4N6V0 3ECFA 2P0MA 1YGWA 1FA3A 4FR9A 2UX0A 4HM7B 2GEXA 3X3XA 5IG4A 3OW22 3FF0A 6GSPA 2GU1A 2YFIB 3N9HA 1VQO3 3MWZA 5LC7A 1RJOA 2OOVC 2CFLA 4K61A 1R4YA 3NBRA 3BNBA 3ZG0A 2INXA 1K734 1I2GA 1T2HA 1BIRA 4N6OB 2CWUA 3MSOA 1W7CA 4FCMA 5AIHA 1NU3A 1UI8A 4X2HA 4IIAA 1DE3A 7STDA 1G96A 3MG1A 1B2MA 2KF6A 1X1WA 2PZVA 4HAAA 2JDIH 3KN4A 1JBRA 3UJMA 1S5AA 2BU4A 1DMNA 4HBRA 1TFOA 2W56A 1UCKA 4TX4A 1W6GA 1VZZA 5IEOA 1TIJA 1ZS7A 1N9EA 2P38A 1K8A4 1F8NA 3DY5A 1A2PA 3ALAA 1N5HA 1OHPA 2H0HA 1VQN3 1ZGXA 2AADA 5AYRB 1VQL3 4WHAA 4RNTA 4HM2B 1QAFA 1GYBA 2BO9B 1PY3A 1Q9EA 1O7HB 1W6YA 1PYLA 3FF2A 2Z77A 3K63A 4EXRA 5IF6A 3CC73 1YI23 3ER7A 1V57A 3HI7A 2CWVA 1KC84 4EC6A 5KP4A 2IUJA 1ZO2A 3S27A 3V98A 1K28A 3BIRA 3I553 1OCVA 2R41A 1MWTA 2ZDJA 1WMPA 1TFKA 5AYSC 1Q864 1OH0A 2A15A 1FUTA 2WO0A 4GB5A 1Q7Y4 4N6NB 4LMIA 3RGRA 1Q814 3WODG 3B4OA 1QVF2 2QIYA 1BNRA 1BANA 3KKGA 1FGOA 1SQWA 2R4IA 1RGGA 1AVLA 3AHSA 4O3VA 1JV2B 2BIRA 2GBWB 2V1LA 3AMOB 4O8SA 4EBGA 1BGSA 1US1A 2E2TA 3BNEA 1LOWA 3EJVA 3H3HA 4LZIA 1O7WB 3JUPA 2RBIA 5STDA 1B3SA 3ZFZA 3G8ZA 2KF3A 1D6YA 3EE1A 1EG9B 1BOXA 3GRDA 3OWSA 1O7PB 1LNHA 3Q90A 3GWRA 3KZTA 4KFDA 3BB9A 2E2UA 1STFI 3NM2A 4CJNA 1UGIA 2QA43 3WR2A 4R9LA 2FXTA 1OHOA 4ILFA 5ELUA 5CK6A 3I563 1GMRA 1OGXA 3GZBA 1DVCA 1I0XA 2F5WA 2H0IA 3SEDA 2LQVA 1BRIA 3O8YA 1B2UA 4XBXA 1WMOA 2SBLA 4XDVA 1AQZA 1VQ93 1BNGA 1TP6A 3LTAA 3JUOA 5G2GA 3K0ZA 1X1XA 1X1UA 3WA2X 5IEPA 2YX9A 1CYVA 1UGHI 3A5EA 4HOHA 4MMYB 1GOYA 5GSPA 3WA3A 2RCDA 3NV0B 4FCJA 1RNBA 5D83A 1JRQA 2YFJB 3EN1B 4OK0A 2B24B 3HIGA 2WGOA 1BRSA 1N8R4 1JBTA 4OVMA 1BVIA 1OACA 2CK3H 2J8XB 4XBYA 1V58A 4WFOA 1RN1A 1BU4A 3D5IA 1BAOA 4FMAA 1I2FA 1I3IA 4I4KA 1ROAA 4BIRA 1LVNA 1BSCA 1WNHA 4XDWA 3CPOA 4KFFA 3UL5A 3D5GA 1ASKA 2W04A 1JN5B 3MG2A 4WYKB 1DYUA 3JVCA 1IYYA 1TU5A 1Q40A 2C11A 2ZA4A 1JZDA 4EW5A 2CKFB 5AIGA 2CFKA 4MEIA 4AEQA 3CCE3 5AEWB 3GZYB 5AEUB 3EBTA 1LQGC 1TTOA 3K7CA 1JB5A 3S67A 1ISKA 3QRDA 3EC9A 1B27A 3T8UA 3LZAA 4BTWA 1NJI4 4EV2A 1RHLA 1BSEA 2XFSA 1JKGA 1SARA 5ELJA 1EA2A 4HM6B 2UUGC 1HU9A 3U97A 2OTJ3 2F4YA 1EUIC 5AIIA 1FGRA 1B20A 2GEYA 1BNIA 1W4NA 4NPBA 5M1AA 5CF1A 1RKYA 2F98A 1IT8A 2ML5A 3BNDA 4BL2A 4JF8A 5BVBA 2E2VA 1GY7A 5I97A 5JBSA 1A67A 3CNMA 3EB8A 4RNYA 3G6E3 1CYUA 3KIIA 3LTCA 1KD14 3TDGA 4X2OA 4NHFA 2HMNB 1IVUA 1YGEA 4HZ9B 5CXOA 3FG1A 3URPA 1YVBI 1PFPA 3FKAA 3DUKA 1W00A 8CHOA 1JJ22 1OF5A 2XRXB 1FUSA 3DMCA 3WHOA 4HM5B 3SX1A 6STDA 1LOVA 1RGHA 3IPTA 1LOYA 5AIFA 2AAEA 1IDPA 3IJEB 1B2SA 3DH2A 4I5QA 2HOHA 4RNZA 4O2HA 3LYGA 4NREA 2CFWA 1N5PA 1W02A 2M7OA 5BXQA 3D9RA 4H3UA 1J2BA 3S28A 4BTYA 1GD3A 1RGLA 3DM8A 1Q7HA 2STDA 2ZL8A 3FG4A 5IG0A 2XF3A 2MC8A 1GOVA 4DKIA 4KFEA 1NNVA 3GSPA 3QK9A 4PEJA 3CCU3 7RNTA 3GAXA 3B8LA 4J5GA 2W56B 1NB5I 1I3FA 3DZLA 2CC3A 3STDA 3CCV3 4H61A 2D1WA 1BSAA 5CLKA 2W2CA 1BNSA 1YNVX 5KP1A 4IT7A 1E3RA 2RSXA 1W6CA 3MPHA 3OWYA 1X1YA 3F14A 1IQ8A 3CU3A 1GS3A 2Y74A 4RZMA 1RTUA 3EF8A 1W5ZA 4J8TA 3F40A 1RLSA 5G1KA 1S723 2KAAA 2MF7A 1AY7A 1RGKA 3IMAB 2L1SA 4XBTA 1QALA 1TUHA 2KF5A 2GSPA 1U8CB 2IY2A 1WTHA 3JUQA 3OXAA 3SOAA 5M18A 4EV5A 3HZPA 1KSIA 2CH9A 1RN7A 2ZHXB 3A76A 3EQQB 3FZWA 1DETA 1T2IA 3LT8A 3X3YA 3G713 3RDEA 1RN4A 3RNTA 2GXFA 3G16A 4HM4B 1D6ZA 1PU4A 3CCQ3 2BMOB 3F7XA 1MWSA 1UUWB 3Q2PA 3G4S3 2XGNA 1EQKA 2CIUA 1LRAA 2Z6BA 5IENA 3LTDA 1VQ53 5RNTA 1RGEA 4FMBA 2F99A 3CNXA 1RRHA 4JRFA 1MGRA 1TRPA 1IT7A 4GHOA 1YJN3 4L8OA 4XM4A 1BNEA 1YJW3 1E3VA 2O3OA 4RBNA 3KSED 1K9M4 4CDLA 1CH0A 4HM3B 1RCLA 5D81A 4HYZA 3UB1A 2P0XA 5KP3A 1OPYA 2CW9A 1KWIA 4N3VA 1TRQA 5EEOA 3VSYA 1GY5A 3D3LA 1M1XB 3CCS3 3DGOA 2CFDA 1FGMA 3I0YA 4ORLA 4N6TA 1EEJA 1MOLA 2BMRB 3K9MC 4L7KA 3GZXB 4OUQA 1OHSA 3DGNA 4N6UA 3DGMA 1UCLA 1JN5A 2K0MA 3NXJA 1O7MB 1Z1SA 1BSDA 1LOXA 3Q1CA 3X42A 2PNCA 2K3DA 4WWUC 3LH4A 4KVHA 3T8NA 2F86B 1FUWA 3LTBA 3BLZA 3LXUX 1HZ1A 3AHWA 1O7GB 1W2ZA 2HMLB 1VQK3 2IYJA 4HM1B 1FYSA 1W01A 5A0OB 1G02A 5JPUA 2FGTA 3S29A 1Q40B 2OWPA 4FMCA 2IMJA 3V92A 3NM7A 3PZWA 3T0UA 4CCVA 1NWWA 1BRGA 2OQEA 1K41A 1IQXA 4J5KA 2CG0A 4MJDA 1GMPA 3CXC2 3CMA3 5DRVA 4WP5A 1E97A 1DVDA 3PXMA 2HMKB 3CD63 1FGQA 2XSOB 1B21A 2O9UX 2W03A 4HM0B 1M904 1SPUA 3N8BA 1JKGB 1UCJA 1OGZA 1NO3A 2LYXA 4Q53A 5TGNA 2I9WA 3SLUA 5IW9A 3SOYA 4KZ1A 1I8VA 1RCKA 1A2KA 1CEWI 1VQ43 1JZOA 2WOFA 4K90B 1V74A 4R1KA 5DREA 1I70A 1ZX2A 1IV9A 3EHCA 3U1WA 7GSPA 3CC43 1AVKA 3PS8A 1T3BA 1D6UA 1VQ83 3UL6A 3CCL3 1G0TA 1LXEA 1BRNL 1STDA 3MHEA 4N6LA 3KE7A 2F56A 3NBBA 2CG1A 2C10A 3OX9A 2Y73A 1RGAA 3FG3A 5HOHA 1QMAA 1DMMA 4FCZA 2KRTA 1BRKA 3AGOA 5HGRA 1W2B2 1B2XA 2P05A 3X41A 1OF5B 2D42A 3MG3A 2IA7A 2KF4A 1UUVB 3LT9A 4FMDA 3KCHA 2C4BA 3KFQC 1L5GB 4K1UA 1MWRA 2GBXB 1UCIA 5M19A 3G0KA 2HMOB 4AKZA 2BNGA 1A90A 1M9GA 1GY6A 1QAKA 4G1MB 2XGLA 1SIHA 3NBJA 1BRJA 1NDOB 1WQLB 3NHXA 1CQSA 2BHMA 4K1VA 1M1K4 2KCDA 2UGIA 1ULIB 2OOVA 3UNLA 1VQ73 1UDII 1Y4KA 8RNTA 3KSPA 5IERA 1RDSA 4R9KA 1DMQA 3J7Yd 4HKVB 1ROVA 3F8XA 2CWTA
chains in the Genus database with same CATH topology
1B2ZA 1BNEA 1I2GA 1T2HA 1BIRA 1RNTA 6RNTA 1TTOA 1TRPA 1DE3A 1CH0A 1B27A 1RCLA 1B2MA 1RHLA 1BSEA 1FZUA 1X1WA 1SARA 2KF6A 4HAAA 1JBRA 1TRQA 3Q3FA 2BU4A 1RSNA 2F4YA 1UCKA 1B20A 1BNIA 4BU4A 1A2PA 1GMQA 1ZGXA 2AADA 1UCLA 1BUJA 1RGCA 4RNTA 5BIRA 1BSDA 1I0VA 1PY3A 1Q9EA 1PYLA 3URPA 3HOHA 3DGYA 1RGFA 1HZ1A 3AHWA 1BNJA 1FUSA 3BIRA 1FYSA 3WHOA 2F5MA 1I2EA 1G02A 1LOVA 1RGHA 1FUTA 1RMSA 1LOYA 2AAEA 1BRGA 1BNRA 1B2SA 4J5KA 1BANA 3DH2A 2HOHA 1GMPA 1RGGA 3AHSA 4GSPA 2BIRA 1GSPA 1BGSA 2SARA 1LOWA 1RGLA 9RNTA 2RBIA 1B3SA 1GOVA 1B21A 2KF3A 1GOUA 1BOXA 1UCJA 1YVSA 3GSPA 1C54A 1MGWA 3AGNA 7RNTA 1JBSA 3D4AA 4J5GA 1I8VA 1I3FA 1RCKA 1HYFA 3WR2A 1BSAA 1BSBA 1GMRA 1BNSA 1YNVX 1I70A 1I0XA 2F5WA 1BNFA 7GSPA 1BRIA 1B2UA 3SYUA 1BRNL 1X1YA 1FW7A 2RNTA 1AQZA 2F56A 1RGAA 1RTUA 5BU4A 1BNGA 5HOHA 1BRHA 1RLSA 1BRKA 2KAAA 3AGOA 1AY7A 1B2XA 1RGKA 1X1XA 1X1UA 2KF5A 3A5EA 2GSPA 4HOHA 1GOYA 5GSPA 2KF4A 1RNBA 3KCHA 2C4BA 1DETA 1T2IA 1BRSA 1UCIA 3BU4A 1LNIA 1JBTA 1BVIA 1RN4A 1RN1A 3RNTA 1BU4A 3D5IA 1BAOA 1I2FA 1I3IA 4BIRA 1YGWA 1BSCA 1BRJA 1LRAA 3D5GA 6GSPA 5RNTA 1IYYA 1RGEA 2ZA4A 8RNTA 1RDSA 1MGRA 1R4YA 4GHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2Z A;  1BNE A;  1I2G A;  1T2H A;  1BIR A;  1RNT A;  6RNT A;  1TTO A;  1TRP A;  1DE3 A;  1CH0 A;  1B27 A;  1RCL A;  1B2M A;  1RHL A;  1BSE A;  1FZU A;  1X1W A;  1SAR A;  2KF6 A;  4HAA A;  1JBR A;  1TRQ A;  3Q3F A;  2BU4 A;  1RSN A;  2F4Y A;  1UCK A;  1B20 A;  1BNI A;  4BU4 A;  1A2P A;  1GMQ A;  1ZGX A;  2AAD A;  1UCL A;  1BUJ A;  1RGC A;  4RNT A;  5BIR A;  1BSD A;  1I0V A;  1PY3 A;  1Q9E A;  1PYL A;  3URP A;  3HOH A;  3DGY A;  1RGF A;  1HZ1 A;  3AHW A;  1BNJ A;  1FUS A;  3BIR A;  1FYS A;  3WHO A;  2F5M A;  1I2E A;  1G02 A;  1LOV A;  1RGH A;  1FUT A;  1RMS A;  1LOY A;  2AAE A;  1BRG A;  1BNR A;  1B2S A;  4J5K A;  1BAN A;  3DH2 A;  2HOH A;  1GMP A;  1RGG A;  3AHS A;  4GSP A;  2BIR A;  1GSP A;  1BGS A;  2SAR A;  1LOW A;  1RGL A;  9RNT A;  2RBI A;  1B3S A;  1GOV A;  1B21 A;  2KF3 A;  1GOU A;  1BOX A;  1UCJ A;  1YVS A;  3GSP A;  1C54 A;  1MGW A;  3AGN A;  7RNT A;  1JBS A;  3D4A A;  4J5G A;  1I8V A;  1I3F A;  1RCK A;  1HYF A;  3WR2 A;  1BSA A;  1BSB A;  1GMR A;  1BNS A;  1YNV X;  1I70 A;  1I0X A;  2F5W A;  1BNF A;  7GSP A;  1BRI A;  1B2U A;  3SYU A;  1BRN L;  1X1Y A;  1FW7 A;  2RNT A;  1AQZ A;  2F56 A;  1RGA A;  1RTU A;  5BU4 A;  1BNG A;  5HOH A;  1BRH A;  1RLS A;  1BRK A;  2KAA A;  3AGO A;  1AY7 A;  1B2X A;  1RGK A;  1X1X A;  1X1U A;  2KF5 A;  3A5E A;  2GSP A;  4HOH A;  1GOY A;  5GSP A;  2KF4 A;  1RNB A;  3KCH A;  2C4B A;  1DET A;  1T2I A;  1BRS A;  1UCI A;  3BU4 A;  1LNI A;  1JBT A;  1BVI A;  1RN4 A;  1RN1 A;  3RNT A;  1BU4 A;  3D5I A;  1BAO A;  1I2F A;  1I3I A;  4BIR A;  1YGW A;  1BSC A;  1BRJ A;  1LRA A;  3D5G A;  6GSP A;  5RNT A;  1IYY A;  1RGE A;  2ZA4 A;  8RNT A;  1RDS A;  1MGR A;  1R4Y A;  4GHO A; 
#chains in the Genus database with same CATH topology
 1B2Z A;  1IU7 A;  5EQL A;  5IG5 A;  3SXX A;  5G1L A;  4EYC A;  4HVN A;  1Q82 4;  1QVG 2;  1VQQ A;  1RNT A;  3WOF B;  6RNT A;  3X40 A;  2XR8 B;  3AMO A;  4N6M A;  1UUG B;  2BMQ B;  2RGQ A;  1KQS 2;  2CFG A;  3ZG5 A;  1FGT A;  2WOH A;  3B4P A;  1N9J A;  1LQM B;  3FH1 A;  3M8C A;  2XFT A;  5AI1 A;  1IV7 A;  1GD4 A;  1FZU A;  1IVW A;  3Q3F A;  3OWU A;  3CCM 3;  3GZR A;  2CX1 A;  4GL6 A;  4BL3 A;  3CCJ 3;  1VQ6 3;  3EN8 A;  3CPW 2;  1RSN A;  3HX8 A;  2W9P A;  2OTL 3;  4L8P A;  3F8H A;  4QWT A;  4BU4 A;  5LC6 A;  2HMM B;  1A2V A;  1GMQ A;  1QJG A;  2K54 A;  3LML A;  5D82 A;  3NQY A;  3BNC A;  4AKY A;  1BUJ A;  1RGC A;  1WMN A;  5BIR A;  1T5Y A;  3K5T A;  1I0V A;  3PYJ A;  5EVH A;  3HOH A;  3N54 B;  4BTX A;  3B7C A;  1O7N B;  3DGY A;  4MMZ B;  5IG3 A;  2W0Q A;  4R80 A;  1RGF A;  3CME 3;  2CX0 A;  4MMX B;  1BNJ A;  1JNQ A;  1IK3 A;  3CC2 3;  3F9S A;  1AR0 A;  2Q07 A;  2F5M A;  2JQ5 A;  2XEP A;  1RRL A;  3MKI A;  1SJW A;  1I2E A;  3NV0 A;  3OV4 A;  4LEH A;  5CF2 A;  3DGL A;  2YFL B;  2QEX 3;  2W9Q A;  1RMS A;  3WDG B;  1VQM 3;  4U13 A;  3L0R A;  3CCR 3;  2OQE C;  3FGY A;  4XB5 A;  4GSP A;  1SII A;  1C7H A;  1GSP A;  2ML6 A;  3HK4 A;  3RGA A;  1EKM A;  3HII A;  1JB4 A;  2SAR A;  3FSD A;  1IVV A;  2OCT A;  3WMD A;  2L4V A;  3JUM A;  9RNT A;  2Z7A A;  2P09 A;  3NUV A;  1AV4 A;  2BT3 A;  2W6J H;  4LGQ A;  1IQY A;  4WYK A;  4LSO A;  2XSH B;  1NB3 I;  3F7S A;  3ROB A;  1GOU A;  1YHQ 3;  3DXO A;  1YVS A;  3EX9 A;  3MYT A;  2HMJ B;  1MGW A;  1C54 A;  3AGN A;  1JBS A;  3FLJ A;  3D4A A;  1UW1 A;  3VF1 A;  1U5O A;  1ULJ B;  1UI7 A;  2B1X B;  3FCS B;  1HYF A;  1TJD A;  2Z76 A;  1N8Q A;  4HJL B;  2XH9 A;  4STD A;  1VQP 3;  1BSB A;  4IPB A;  2FNQ A;  3PCS A;  2KXG A;  4HZB B;  3S5C A;  1BNF A;  3NX0 A;  4J9A A;  3E99 A;  4R4K A;  1MNL A;  3SYU A;  2GU3 A;  3VGN A;  1Q42 A;  1OUN A;  1FW7 A;  2RNT A;  3SVA A;  3LOY A;  2H0G A;  1MWU A;  1R4C A;  5BU4 A;  3PCR A;  5FGO A;  3X3Z A;  1BRH A;  3JUN A;  1IVX A;  3EBY A;  5FW5 A;  2CHC A;  3PGB A;  3WOE B;  2IUK A;  4ZM8 A;  4HM8 B;  4CPK A;  3D79 A;  3H51 A;  1BUQ A;  4LYL B;  1YJ9 3;  2RFR A;  5JPP A;  3NQZ A;  4O02 B;  2WGQ A;  1YIT 3;  1YIJ 3;  3BU4 A;  1LNI A;  2QGU A;  3V99 A;  1HKX A;  4KT3 B;  1JB2 A;  4N6V 0;  3ECF A;  2P0M A;  1YGW A;  1FA3 A;  4FR9 A;  2UX0 A;  4HM7 B;  2GEX A;  3X3X A;  5IG4 A;  3OW2 2;  3FF0 A;  6GSP A;  2GU1 A;  2YFI B;  3N9H A;  1VQO 3;  3MWZ A;  5LC7 A;  1RJO A;  2OOV C;  2CFL A;  4K61 A;  1R4Y A;  3NBR A;  3BNB A;  3ZG0 A;  2INX A;  1K73 4;  1I2G A;  1T2H A;  1BIR A;  4N6O B;  2CWU A;  3MSO A;  1W7C A;  4FCM A;  5AIH A;  1NU3 A;  1UI8 A;  4X2H A;  4IIA A;  1DE3 A;  7STD A;  1G96 A;  3MG1 A;  1B2M A;  2KF6 A;  1X1W A;  2PZV A;  4HAA A;  2JDI H;  3KN4 A;  1JBR A;  3UJM A;  1S5A A;  2BU4 A;  1DMN A;  4HBR A;  1TFO A;  2W56 A;  1UCK A;  4TX4 A;  1W6G A;  1VZZ A;  5IEO A;  1TIJ A;  1ZS7 A;  1N9E A;  2P38 A;  1K8A 4;  1F8N A;  3DY5 A;  1A2P A;  3ALA A;  1N5H A;  1OHP A;  2H0H A;  1VQN 3;  1ZGX A;  2AAD A;  5AYR B;  1VQL 3;  4WHA A;  4RNT A;  4HM2 B;  1QAF A;  1GYB A;  2BO9 B;  1PY3 A;  1Q9E A;  1O7H B;  1W6Y A;  1PYL A;  3FF2 A;  2Z77 A;  3K63 A;  4EXR A;  5IF6 A;  3CC7 3;  1YI2 3;  3ER7 A;  1V57 A;  3HI7 A;  2CWV A;  1KC8 4;  4EC6 A;  5KP4 A;  2IUJ A;  1ZO2 A;  3S27 A;  3V98 A;  1K28 A;  3BIR A;  3I55 3;  1OCV A;  2R41 A;  1MWT A;  2ZDJ A;  1WMP A;  1TFK A;  5AYS C;  1Q86 4;  1OH0 A;  2A15 A;  1FUT A;  2WO0 A;  4GB5 A;  1Q7Y 4;  4N6N B;  4LMI A;  3RGR A;  1Q81 4;  3WOD G;  3B4O A;  1QVF 2;  2QIY A;  1BNR A;  1BAN A;  3KKG A;  1FGO A;  1SQW A;  2R4I A;  1RGG A;  1AVL A;  3AHS A;  4O3V A;  1JV2 B;  2BIR A;  2GBW B;  2V1L A;  3AMO B;  4O8S A;  4EBG A;  1BGS A;  1US1 A;  2E2T A;  3BNE A;  1LOW A;  3EJV A;  3H3H A;  4LZI A;  1O7W B;  3JUP A;  2RBI A;  5STD A;  1B3S A;  3ZFZ A;  3G8Z A;  2KF3 A;  1D6Y A;  3EE1 A;  1EG9 B;  1BOX A;  3GRD A;  3OWS A;  1O7P B;  1LNH A;  3Q90 A;  3GWR A;  3KZT A;  4KFD A;  3BB9 A;  2E2U A;  1STF I;  3NM2 A;  4CJN A;  1UGI A;  2QA4 3;  3WR2 A;  4R9L A;  2FXT A;  1OHO A;  4ILF A;  5ELU A;  5CK6 A;  3I56 3;  1GMR A;  1OGX A;  3GZB A;  1DVC A;  1I0X A;  2F5W A;  2H0I A;  3SED A;  2LQV A;  1BRI A;  3O8Y A;  1B2U A;  4XBX A;  1WMO A;  2SBL A;  4XDV A;  1AQZ A;  1VQ9 3;  1BNG A;  1TP6 A;  3LTA A;  3JUO A;  5G2G A;  3K0Z A;  1X1X A;  1X1U A;  3WA2 X;  5IEP A;  2YX9 A;  1CYV A;  1UGH I;  3A5E A;  4HOH A;  4MMY B;  1GOY A;  5GSP A;  3WA3 A;  2RCD A;  3NV0 B;  4FCJ A;  1RNB A;  5D83 A;  1JRQ A;  2YFJ B;  3EN1 B;  4OK0 A;  2B24 B;  3HIG A;  2WGO A;  1BRS A;  1N8R 4;  1JBT A;  4OVM A;  1BVI A;  1OAC A;  2CK3 H;  2J8X B;  4XBY A;  1V58 A;  4WFO A;  1RN1 A;  1BU4 A;  3D5I A;  1BAO A;  4FMA A;  1I2F A;  1I3I A;  4I4K A;  1ROA A;  4BIR A;  1LVN A;  1BSC A;  1WNH A;  4XDW A;  3CPO A;  4KFF A;  3UL5 A;  3D5G A;  1ASK A;  2W04 A;  1JN5 B;  3MG2 A;  4WYK B;  1DYU A;  3JVC A;  1IYY A;  1TU5 A;  1Q40 A;  2C11 A;  2ZA4 A;  1JZD A;  4EW5 A;  2CKF B;  5AIG A;  2CFK A;  4MEI A;  4AEQ A;  3CCE 3;  5AEW B;  3GZY B;  5AEU B;  3EBT A;  1LQG C;  1TTO A;  3K7C A;  1JB5 A;  3S67 A;  1ISK A;  3QRD A;  3EC9 A;  1B27 A;  3T8U A;  3LZA A;  4BTW A;  1NJI 4;  4EV2 A;  1RHL A;  1BSE A;  2XFS A;  1JKG A;  1SAR A;  5ELJ A;  1EA2 A;  4HM6 B;  2UUG C;  1HU9 A;  3U97 A;  2OTJ 3;  2F4Y A;  1EUI C;  5AII A;  1FGR A;  1B20 A;  2GEY A;  1BNI A;  1W4N A;  4NPB A;  5M1A A;  5CF1 A;  1RKY A;  2F98 A;  1IT8 A;  2ML5 A;  3BND A;  4BL2 A;  4JF8 A;  5BVB A;  2E2V A;  1GY7 A;  5I97 A;  5JBS A;  1A67 A;  3CNM A;  3EB8 A;  4RNY A;  3G6E 3;  1CYU A;  3KII A;  3LTC A;  1KD1 4;  3TDG A;  4X2O A;  4NHF A;  2HMN B;  1IVU A;  1YGE A;  4HZ9 B;  5CXO A;  3FG1 A;  3URP A;  1YVB I;  1PFP A;  3FKA A;  3DUK A;  1W00 A;  8CHO A;  1JJ2 2;  1OF5 A;  2XRX B;  1FUS A;  3DMC A;  3WHO A;  4HM5 B;  3SX1 A;  6STD A;  1LOV A;  1RGH A;  3IPT A;  1LOY A;  5AIF A;  2AAE A;  1IDP A;  3IJE B;  1B2S A;  3DH2 A;  4I5Q A;  2HOH A;  4RNZ A;  4O2H A;  3LYG A;  4NRE A;  2CFW A;  1N5P A;  1W02 A;  2M7O A;  5BXQ A;  3D9R A;  4H3U A;  1J2B A;  3S28 A;  4BTY A;  1GD3 A;  1RGL A;  3DM8 A;  1Q7H A;  2STD A;  2ZL8 A;  3FG4 A;  5IG0 A;  2XF3 A;  2MC8 A;  1GOV A;  4DKI A;  4KFE A;  1NNV A;  3GSP A;  3QK9 A;  4PEJ A;  3CCU 3;  7RNT A;  3GAX A;  3B8L A;  4J5G A;  2W56 B;  1NB5 I;  1I3F A;  3DZL A;  2CC3 A;  3STD A;  3CCV 3;  4H61 A;  2D1W A;  1BSA A;  5CLK A;  2W2C A;  1BNS A;  1YNV X;  5KP1 A;  4IT7 A;  1E3R A;  2RSX A;  1W6C A;  3MPH A;  3OWY A;  1X1Y A;  3F14 A;  1IQ8 A;  3CU3 A;  1GS3 A;  2Y74 A;  4RZM A;  1RTU A;  3EF8 A;  1W5Z A;  4J8T A;  3F40 A;  1RLS A;  5G1K A;  1S72 3;  2KAA A;  2MF7 A;  1AY7 A;  1RGK A;  3IMA B;  2L1S A;  4XBT A;  1QAL A;  1TUH A;  2KF5 A;  2GSP A;  1U8C B;  2IY2 A;  1WTH A;  3JUQ A;  3OXA A;  3SOA A;  5M18 A;  4EV5 A;  3HZP A;  1KSI A;  2CH9 A;  1RN7 A;  2ZHX B;  3A76 A;  3EQQ B;  3FZW A;  1DET A;  1T2I A;  3LT8 A;  3X3Y A;  3G71 3;  3RDE A;  1RN4 A;  3RNT A;  2GXF A;  3G16 A;  4HM4 B;  1D6Z A;  1PU4 A;  3CCQ 3;  2BMO B;  3F7X A;  1MWS A;  1UUW B;  3Q2P A;  3G4S 3;  2XGN A;  1EQK A;  2CIU A;  1LRA A;  2Z6B A;  5IEN A;  3LTD A;  1VQ5 3;  5RNT A;  1RGE A;  4FMB A;  2F99 A;  3CNX A;  1RRH A;  4JRF A;  1MGR A;  1TRP A;  1IT7 A;  4GHO A;  1YJN 3;  4L8O A;  4XM4 A;  1BNE A;  1YJW 3;  1E3V A;  2O3O A;  4RBN A;  3KSE D;  1K9M 4;  4CDL A;  1CH0 A;  4HM3 B;  1RCL A;  5D81 A;  4HYZ A;  3UB1 A;  2P0X A;  5KP3 A;  1OPY A;  2CW9 A;  1KWI A;  4N3V A;  1TRQ A;  5EEO A;  3VSY A;  1GY5 A;  3D3L A;  1M1X B;  3CCS 3;  3DGO A;  2CFD A;  1FGM A;  3I0Y A;  4ORL A;  4N6T A;  1EEJ A;  1MOL A;  2BMR B;  3K9M C;  4L7K A;  3GZX B;  4OUQ A;  1OHS A;  3DGN A;  4N6U A;  3DGM A;  1UCL A;  1JN5 A;  2K0M A;  3NXJ A;  1O7M B;  1Z1S A;  1BSD A;  1LOX A;  3Q1C A;  3X42 A;  2PNC A;  2K3D A;  4WWU C;  3LH4 A;  4KVH A;  3T8N A;  2F86 B;  1FUW A;  3LTB A;  3BLZ A;  3LXU X;  1HZ1 A;  3AHW A;  1O7G B;  1W2Z A;  2HML B;  1VQK 3;  2IYJ A;  4HM1 B;  1FYS A;  1W01 A;  5A0O B;  1G02 A;  5JPU A;  2FGT A;  3S29 A;  1Q40 B;  2OWP A;  4FMC A;  2IMJ A;  3V92 A;  3NM7 A;  3PZW A;  3T0U A;  4CCV A;  1NWW A;  1BRG A;  2OQE A;  1K41 A;  1IQX A;  4J5K A;  2CG0 A;  4MJD A;  1GMP A;  3CXC 2;  3CMA 3;  5DRV A;  4WP5 A;  1E97 A;  1DVD A;  3PXM A;  2HMK B;  3CD6 3;  1FGQ A;  2XSO B;  1B21 A;  2O9U X;  2W03 A;  4HM0 B;  1M90 4;  1SPU A;  3N8B A;  1JKG B;  1UCJ A;  1OGZ A;  1NO3 A;  2LYX A;  4Q53 A;  5TGN A;  2I9W A;  3SLU A;  5IW9 A;  3SOY A;  4KZ1 A;  1I8V A;  1RCK A;  1A2K A;  1CEW I;  1VQ4 3;  1JZO A;  2WOF A;  4K90 B;  1V74 A;  4R1K A;  5DRE A;  1I70 A;  1ZX2 A;  1IV9 A;  3EHC A;  3U1W A;  7GSP A;  3CC4 3;  1AVK A;  3PS8 A;  1T3B A;  1D6U A;  1VQ8 3;  3UL6 A;  3CCL 3;  1G0T A;  1LXE A;  1BRN L;  1STD A;  3MHE A;  4N6L A;  3KE7 A;  2F56 A;  3NBB A;  2CG1 A;  2C10 A;  3OX9 A;  2Y73 A;  1RGA A;  3FG3 A;  5HOH A;  1QMA A;  1DMM A;  4FCZ A;  2KRT A;  1BRK A;  3AGO A;  5HGR A;  1W2B 2;  1B2X A;  2P05 A;  3X41 A;  1OF5 B;  2D42 A;  3MG3 A;  2IA7 A;  2KF4 A;  1UUV B;  3LT9 A;  4FMD A;  3KCH A;  2C4B A;  3KFQ C;  1L5G B;  4K1U A;  1MWR A;  2GBX B;  1UCI A;  5M19 A;  3G0K A;  2HMO B;  4AKZ A;  2BNG A;  1A90 A;  1M9G A;  1GY6 A;  1QAK A;  4G1M B;  2XGL A;  1SIH A;  3NBJ A;  1BRJ A;  1NDO B;  1WQL B;  3NHX A;  1CQS A;  2BHM A;  4K1V A;  1M1K 4;  2KCD A;  2UGI A;  1ULI B;  2OOV A;  3UNL A;  1VQ7 3;  1UDI I;  1Y4K A;  8RNT A;  3KSP A;  5IER A;  1RDS A;  4R9K A;  1DMQ A;  3J7Y d;  4HKV B;  1ROV A;  3F8X A;  2CWT A; 
#chains in the Genus database with same CATH homology
 1B2Z A;  1BNE A;  1I2G A;  1T2H A;  1BIR A;  1RNT A;  6RNT A;  1TTO A;  1TRP A;  1DE3 A;  1CH0 A;  1B27 A;  1RCL A;  1B2M A;  1RHL A;  1BSE A;  1FZU A;  1X1W A;  1SAR A;  2KF6 A;  4HAA A;  1JBR A;  1TRQ A;  3Q3F A;  2BU4 A;  1RSN A;  2F4Y A;  1UCK A;  1B20 A;  1BNI A;  4BU4 A;  1A2P A;  1GMQ A;  1ZGX A;  2AAD A;  1UCL A;  1BUJ A;  1RGC A;  4RNT A;  5BIR A;  1BSD A;  1I0V A;  1PY3 A;  1Q9E A;  1PYL A;  3URP A;  3HOH A;  3DGY A;  1RGF A;  1HZ1 A;  3AHW A;  1BNJ A;  1FUS A;  3BIR A;  1FYS A;  3WHO A;  2F5M A;  1I2E A;  1G02 A;  1LOV A;  1RGH A;  1FUT A;  1RMS A;  1LOY A;  2AAE A;  1BRG A;  1BNR A;  1B2S A;  4J5K A;  1BAN A;  3DH2 A;  2HOH A;  1GMP A;  1RGG A;  3AHS A;  4GSP A;  2BIR A;  1GSP A;  1BGS A;  2SAR A;  1LOW A;  1RGL A;  9RNT A;  2RBI A;  1B3S A;  1GOV A;  1B21 A;  2KF3 A;  1GOU A;  1BOX A;  1UCJ A;  1YVS A;  3GSP A;  1C54 A;  1MGW A;  3AGN A;  7RNT A;  1JBS A;  3D4A A;  4J5G A;  1I8V A;  1I3F A;  1RCK A;  1HYF A;  3WR2 A;  1BSA A;  1BSB A;  1GMR A;  1BNS A;  1YNV X;  1I70 A;  1I0X A;  2F5W A;  1BNF A;  7GSP A;  1BRI A;  1B2U A;  3SYU A;  1BRN L;  1X1Y A;  1FW7 A;  2RNT A;  1AQZ A;  2F56 A;  1RGA A;  1RTU A;  5BU4 A;  1BNG A;  5HOH A;  1BRH A;  1RLS A;  1BRK A;  2KAA A;  3AGO A;  1AY7 A;  1B2X A;  1RGK A;  1X1X A;  1X1U A;  2KF5 A;  3A5E A;  2GSP A;  4HOH A;  1GOY A;  5GSP A;  2KF4 A;  1RNB A;  3KCH A;  2C4B A;  1DET A;  1T2I A;  1BRS A;  1UCI A;  3BU4 A;  1LNI A;  1JBT A;  1BVI A;  1RN4 A;  1RN1 A;  3RNT A;  1BU4 A;  3D5I A;  1BAO A;  1I2F A;  1I3I A;  4BIR A;  1YGW A;  1BSC A;  1BRJ A;  1LRA A;  3D5G A;  6GSP A;  5RNT A;  1IYY A;  1RGE A;  2ZA4 A;  8RNT A;  1RDS A;  1MGR A;  1R4Y A;  4GHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...