1T2IA

T76w mutant of rnase sa from streptomyces aureofaciens
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEAWQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of single tryptophan residues to the fluorescence and stability of ribonuclease sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
total genus 25
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1t2iA00
1PYLA 1BVIA 1I3FA 2KF4A 8RNTA 1I0VA 1B21A 1TRQA 1B2SA 1YGWA 1AY7A 1RMSA 1B2UA 1GSPA 1X1XA 5BIRA 1TRPA 3D5IA 3AGOA 1BRJA 7GSPA 2KF5A 1FW7A 3Q3FA 2C4BA 1X1UA 6GSPA 1I70A 2F56A 1I2FA 1T2IA 1RLSA 1BSDA 1LOYA 1UCIA 1I8VA 4J5GA 3HOHA 1BOXA 3URPA 1HZ1A 1BNJA 3D5GA 5BU4A 2RBIA 1BRGA 1GOYA 1BAOA 1BNIA 1BRHA 1BIRA 3SYUA 1BNEA 5RNTA 1RGKA 1RCLA 3RNTA 1I3IA 3DGYA 1FUTA 1B2XA 1BSBA 1BUJA 1RGLA 3D4AA 1BRNL 1BU4A 2F5WA 1GMQA 1C54A 3GSPA 4GSPA 1RGHA 1RGFA 1PY3A 1YNVX 1GMRA 1RSNA 1I0XA 4GHOA 1I2GA 3BIRA 1RGEA 3AHWA 2GSPA 2F4YA 1MGWA 2BU4A 3BU4A 1RHLA 1LOVA 1RGGA 1LRAA 2KF3A 1FYSA 1LOWA 1RN4A 1BRIA 2HOHA 4BIRA 1UCLA 1GOVA 4BU4A 2KAAA 1RNTA 3AGNA 1B27A 1RNBA 1BANA 1I2EA 4HOHA 1CH0A 1T2HA 1FZUA 1LNIA 3AHSA 2AADA 2SARA 1BNFA 1BGSA 1IYYA 1GMPA 1JBSA 1UCJA 1BRKA 1X1YA 2BIRA 9RNTA 1BNRA 2AAEA 1RGAA 1BNSA 1B2ZA 2ZA4A 1UCKA 1A2PA 1DETA 1HYFA 2RNTA 1B2MA 1Q9EA 7RNTA 3WHOA 1BSCA 1X1WA 1RGCA 1ZGXA 1G02A 5GSPA 1RN1A 3A5EA 1DE3A 4HAAA 6RNTA 1SARA 1BNGA 2F5MA 1AQZA 1BSAA 3KCHA 1RTUA 3DH2A 4RNTA 1FUSA 2KF6A 1MGRA 1RDSA 1R4YA 1TTOA 1GOUA 1YVSA 1BRSA 1JBTA 1BSEA 1RCKA 3WR2A 1B3SA 1B20A 4J5KA 5HOHA 1JBRA
chains in the Genus database with same CATH superfamily
3LH4A 2Z7AA 4BTXA 2QIYA 2CK3H 3G0KA 1GS3A 1B21A 1Q40B 3FH1A 1TRQA 4HZ9B 4XBTA 1K41A 1X1XA 5CK6A 2IA7A 2MC8A 3VF1A 5CXOA 4FCMA 3MG3A 1JB2A 1FW7A 4RNZA 1UUGB 5IG4A 2CIUA 2ML5A 2P09A 1QJGA 3N9HA 2GU1A 4O2HA 3STDA 1K8A4 1LXEA 1I2FA 4N6OB 4HM6B 2XF3A 3OWUA 2K54A 4XDVA 1N9JA 5AEUB 4WWUC 3AMOA 1LQGC 1BOXA 1IVXA 3RGRA 1W00A 3NXJA 2RBIA 3F7XA 5AEWB 2CW9A 2YFLB 3S29A 1BRHA 3V98A 1M1XB 3FZWA 2GXFA 1BIRA 4FMDA 3N8BA 1A2VA 4BTYA 1Q7Y4 3RNTA 1J2BA 2JDIH 3B4PA 4ILFA 2RGQA 1BSBA 2KCDA 1IQYA 1PFPA 1QAKA 2XFSA 3NBRA 5I97A 1AR0A 1GMQA 2CG1A 3I0YA 3PYJA 1W4NA 3CCQ3 1C54A 4NHFA 3KSED 3K7CA 1CQSA 5AIFA 4DKIA 1RRHA 2INXA 1CYVA 3LT8A 3PZWA 2WGQA 2Y74A 2CFWA 4AKYA 3H51A 3BIRA 3PXMA 1OACA 3AHWA 4HZBB 5STDA 5KP1A 4EBGA 2BU4A 2XH9A 3MYTA 4XM4A 1ISKA 3KZTA 3LTDA 1TFOA 2V1LA 1OGZA 2CG0A 1SPUA 2IMJA 2KF3A 3BNDA 5AIHA 1EG9B 1FYSA 3CPOA 4NREA 1JJ22 4HKVB 4LSOA 1BRIA 2HOHA 2OTJ3 1UCLA 1GOVA 1O7MB 4XB5A 2QEX3 1RNBA 3VGNA 1HKXA 1I2EA 1TFKA 1O7NB 2CFGA 3HIIA 3LT9A 1AVKA 2RSXA 3B7CA 2K3DA 3F14A 4KFDA 1IYYA 1BGSA 3GAXA 3BLZA 5EVHA 4EV5A 5EQLA 1UCJA 4K1VA 1UUVB 1BRKA 4U13A 1FGRA 4BL3A 3DGNA 3BNCA 3ROBA 3MWZA 1DMMA 2UUGC 3MPHA 1RGAA 1ROVA 3HK4A 4JF8A 4KVHA 1B2ZA 1DMQA 1UCKA 2CWVA 2OQEC 3K63A 3SOYA 1M9GA 1HYFA 1IV7A 2K0MA 2RNTA 5D82A 5KP3A 3RGAA 1ROAA 2WGOA 2Z77A 3KN4A 3LOYA 3CXC2 1WMPA 1Q40A 4R9LA 3WHOA 1VQ43 1OF5A 1RGCA 1ZGXA 4RNYA 1RN1A 2BMQB 3HIGA 1UUWB 2F5MA 1BSAA 2C10A 3CNMA 3FG4A 1RTUA 1F8NA 5EEOA 5IEPA 3MG2A 2KF6A 3ALAA 3CCM3 1YVSA 3CNXA 3GZBA 2W9PA 1UW1A 5FW5A 2QA43 2Z6BA 4J5KA 1JV2B 5HOHA 1W2ZA 1OPYA 1Q864 1SIIA 1VQQA 1PYLA 3FG3A 1EUIC 3NV0B 1I3FA 1KQS2 3LYGA 4XDWA 1DYUA 5JBSA 2STDA 1YGWA 1YIJ3 3LXUX 3OW22 1GSPA 4PEJA 4LMIA 1TRPA 3AGOA 3KIIA 5M1AA 1BRJA 2GBXB 4CCVA 1L5GB 2YFIB 3BNBA 2HMJB 2BHMA 4EXRA 1CEWI 3DY5A 1X1UA 3CCR3 4FMAA 1N8R4 4L7KA 3WMDA 3NM7A 3CMA3 1LOYA 1OHPA 3ZFZA 1UCIA 5IF6A 3F8HA 1IVVA 1SQWA 1A67A 2W56A 2H0HA 3K9MC 3QK9A 3URPA 1V58A 1JN5B 5IG3A 1YHQ3 3D5GA 4K90B 4TX4A 2F86B 3HZPA 4OUQA 1ZO2A 3NUVA 1JN5A 1GOYA 2XEPA 3VSYA 1FGOA 4CJNA 1BNIA 1UI8A 4HM1B 3Q90A 3L0RA 1TJDA 4N6TA 1IU7A 3SEDA 3X3ZA 1VQO3 3O8YA 1RCLA 4N6UA 1S5AA 2W9QA 3DGOA 1IQXA 1OHSA 4AKZA 3EQQB 3FKAA 1Y4KA 2KRTA 4OK0A 4I4KA 1QAFA 3B4OA 1YI23 2QGUA 2CFKA 2E2VA 3UNLA 1RKYA 3EE1A 3LTAA 2IUJA 2MF7A 1W2B2 1IT8A 1JB5A 1PY3A 1R4CA 4HM3B 4ORLA 1GMRA 2FXTA 3NX0A 5IERA 1RRLA 1UGIA 3FF0A 1E3VA 1N8QA 2F4YA 5BXQA 4L8PA 3CCJ3 2WOHA 4HM4B 4EC6A 3G8ZA 1VQ53 3DGMA 4BTWA 5IENA 3S28A 1RGGA 3EN8A 1LOWA 3OV4A 1T3BA 2FGTA 4FR9A 4K61A 1A2KA 1DVDA 3NQYA 3SLUA 1O7GB 2IUKA 4HM2B 1IVUA 2KAAA 3SVAA 2F99A 1RNTA 5DREA 2XFTA 1B27A 5AYRB 4HOHA 1T2HA 3F8XA 1N5HA 1FZUA 1GD4A 2Z76A 3FG1A 4WP5A 4J9AA 1O7WB 1Q824 4HM8B 1MOLA 1VQM3 3B8LA 1ZX2A 2B1XB 2H0GA 4FMBA 1JBSA 3EC9A 5BVBA 1IV9A 1ULIB 3ZG0A 4OVMA 4N6MA 3SOAA 3F9SA 4IIAA 2CWTA 2IY2A 1VQ83 1KWIA 1LOXA 1VQL3 1TUHA 1W7CA 2W6JH 3JUNA 1JRQA 7RNTA 3CCS3 1MWRA 3EX9A 1STFI 1LVNA 2OWPA 4X2OA 5D81A 3S27A 3Q2PA 1OHOA 2GEYA 2PZVA 1JKGA 3KKGA 5GSPA 3A5EA 1DMNA 2R4IA 4HAAA 4KZ1A 1JZDA 3BNEA 1JKGB 1WNHA 1AQZA 3EHCA 3EJVA 4N6V0 3DH2A 1OH0A 4IPBA 2HMNB 1MGRA 2L1SA 1R4YA 3D79A 2OOVC 4L8OA 2OOVA 1KSIA 3WDGB 1W02A 1BSEA 1RCKA 4HM7B 3WR2A 4LGQA 1NB5I 3FF2A 3WOEB 1MNLA 2D42A 1STDA 5ELJA 5FGOA 1GYBA 2CKFB 3OX9A 1WMOA 1U5OA 1BVIA 4QWTA 1YJN3 2LQVA 4FCZA 3OWSA 1Z1SA 1B2SA 3K5TA 5BIRA 3D5IA 3CU3A 3CME3 1RN7A 4FMCA 2KF5A 3Q3FA 4O3VA 1D6ZA 2C4BA 3RDEA 1I70A 2F56A 3WA2X 4BL2A 1W01A 1SJWA 1N5PA 1BSDA 2M7OA 1G96A 3K0ZA 4STDA 2HMLB 3HOHA 2CC3A 1HZ1A 2FNQA 3EB8A 2F98A 7STDA 1BNJA 3J7Yd 1DVCA 2BMRB 2W2CA 3IPTA 5BU4A 2OCTA 2OTL3 1BRGA 5G2GA 1G0TA 1FUWA 1W6GA 1ASKA 4MJDA 2ZHXB 4MEIA 3G4S3 1GY7A 1BNEA 5RNTA 1RGKA 4LYLB 4RZMA 3DGYA 3MKIA 1FUTA 2R41A 3PCSA 1BUJA 1RGLA 3FGYA 3F40A 3EF8A 1IVWA 2RFRA 1BRNL 3S67A 1Q7HA 1LNHA 2CWUA 3Q1CA 3GWRA 3GSPA 3N54B 4FCJA 4Q53A 1V57A 2CHCA 4N6NB 3CCU3 1TU5A 1T5YA 1RGHA 4XBYA 4NPBA 4J8TA 3X3XA 1YNVX 3GZYB 4N6LA 3JUPA 5A0OB 1RSNA 1I0XA 4GHOA 3OXAA 4EYCA 3GZXB 5JPPA 3DMCA 2H0IA 2SBLA 1MGWA 1VQ63 2CH9A 3T8NA 3NBJA 2Y73A 1Q42A 1UDII 3BU4A 1EEJA 1EKMA 4WYKA 2XSOB 1K28A 3OWYA 5CF1A 1RJOA 5KP4A 2BT3A 1O7PB 3A76A 4WYKB 1YGEA 5LC6A 3KSPA 4BIRA 2P05A 1UGHI 3AGNA 1AVLA 2HMOB 4WFOA 1OF5B 4RBNA 1KC84 5CF2A 1E97A 1FGQA 1C7HA 2WO0A 3HX8A 5AI1A 3MHEA 1NDOB 1BNFA 2CFLA 3WOFB 3D9RA 3NBBA 1GMPA 1Q814 3NM2A 1MWSA 1X1YA 2I9WA 9RNTA 2Q07A 1BNRA 2AAEA 2C11A 1GY6A 2YFJB 2XR8B 5TGNA 3G16A 5IEOA 1QMAA 2HMMB 2J8XB 2W03A 3F7SA 3CCE3 2CX1A 1YVBI 4H61A 3DXOA 3NV0A 4HVNA 1EA2A 2E2UA 3NHXA 2W04A 3NQZA 2HMKB 1BSCA 1NO3A 1X1WA 3ECFA 3JUOA 3U1WA 4ZM8A 1ZS7A 3U97A 2ZL8A 1NNVA 1DE3A 6RNTA 1SARA 1VQ73 5AYSC 4GL6A 1BNGA 2XSHB 2ZDJA 4R80A 1YJ93 2A15A 1FUSA 4G1MB 1RDSA 1TTOA 1U8CB 1GOUA 1IDPA 4XBXA 2PNCA 3CC73 1B3SA 1B20A 2BMOB 2XGLA 2YX9A 2W56B 3IJEB 4K1UA 4EV2A 1VQ93 1JBRA 1OGXA 3UL6A 3SXXA 3CPW2 1FGTA 2KF4A 1I0VA 3S5CA 3UJMA 8RNTA 3LMLA 1MWTA 1AY7A 1RMSA 6STDA 1B2UA 3T0UA 2O3OA 3GZRA 3QRDA 4HJLB 2BO9B 7GSPA 3X41A 1TP6A 1OUNA 3ZG5A 3LTCA 5JPUA 1WMNA 4I5QA 4MMYB 4O02B 5M19A 6GSPA 1T2IA 2BNGA 1RLSA 3EN1B 4LZIA 3FLJA 3AMOB 5AIGA 1O7HB 1I8VA 1NU3A 3JUMA 4J5GA 4AEQA 1SIHA 3X42A 2E2TA 3JVCA 3H3HA 2KXGA 1UI7A 1US1A 4CPKA 2B24B 2P0XA 1YJW3 1LQMB 1VQN3 3G6E3 3EBTA 1VQK3 1BAOA 2W0QA 5AIIA 3SX1A 2P0MA 3E99A 3SYUA 3T8UA 3GRDA 4R4KA 1D6UA 5DRVA 4KFEA 2WOFA 1I3IA 1B2XA 5M18A 3PCRA 3IMAB 4HM0B 3D4AA 1CYUA 3PGBA 1W6CA 3TDGA 1BU4A 2F5WA 4LEHA 2CX0A 1NB3I 1TIJA 1NJI4 4IT7A 4KT3B 4GSPA 1JNQA 1RGFA 1N9EA 3CC43 5IG5A 3X3YA 4KFFA 3UL5A 4HBRA 1QVG2 2JQ5A 1I2GA 3I563 1RGEA 1PU4A 2GSPA 3CCV3 1IQ8A 1WTHA 4CDLA 1M1K4 1YIT3 1V74A 3LTBA 2UGIA 5D83A 1AV4A 1FGMA 1NWWA 4HM5B 3CCL3 4WHAA 1OCVA 1RHLA 1LOVA 1IK3A 3V92A 1FA3A 3CC23 1LRAA 4R1KA 8CHOA 1D6YA 1WQLB 3HI7A 3MG1A 1IT7A 1RN4A 3JUQA 1GY5A 2ML6A 4R9KA 4GB5A 2O9UX 2RCDA 4BU4A 3FCSB 1BANA 1JB4A 2D1WA 1CH0A 3WA3A 4EW5A 4H3UA 5G1KA 1LNIA 1W6YA 1QALA 3AHSA 2AADA 2SARA 3BB9A 2L4VA 3DGLA 1QVF2 1ULJB 5HGRA 5LC7A 3EBYA 1W5ZA 2BIRA 4JRFA 2GU3A 1VQP3 2LYXA 3DUKA 5ELUA 1BNSA 4O8SA 1MWUA 2GEXA 2GBWB 2ZA4A 4MMZB 1M904 1EQKA 1E3RA 3G713 1A2PA 1DETA 1HU9A 3KFQC 1B2MA 3PS8A 2XRXB 1Q9EA 1K734 2IYJA 3WODG 5IW9A 5IG0A 2P38A 1S723 3LZAA 2XGNA 3CD63 1G02A 4X2HA 1BUQA 2OQEA 5CLKA 3X40A 3KE7A 3KCHA 2CFDA 5G1LA 3UB1A 3I553 3M8CA 4RNTA 3V99A 1K9M4 3FSDA 4N3VA 1JZOA 3DM8A 1BRSA 2UX0A 1JBTA 1GD3A 3MSOA 3D3LA 1VZZA 4MMXB 4HYZA 3ER7A 1A90A 3DZLA 1KD14
chains in the Genus database with same CATH topology
1PYLA 1BVIA 1I3FA 2KF4A 8RNTA 1I0VA 1B21A 1TRQA 1B2SA 1YGWA 1AY7A 1RMSA 1B2UA 1GSPA 1X1XA 5BIRA 1TRPA 3D5IA 3AGOA 1BRJA 7GSPA 2KF5A 1FW7A 3Q3FA 2C4BA 1X1UA 6GSPA 1I70A 2F56A 1I2FA 1T2IA 1RLSA 1BSDA 1LOYA 1UCIA 1I8VA 4J5GA 3HOHA 1BOXA 3URPA 1HZ1A 1BNJA 3D5GA 5BU4A 2RBIA 1BRGA 1GOYA 1BAOA 1BNIA 1BRHA 1BIRA 3SYUA 1BNEA 5RNTA 1RGKA 1RCLA 3RNTA 1I3IA 3DGYA 1FUTA 1B2XA 1BSBA 1BUJA 1RGLA 3D4AA 1BRNL 1BU4A 2F5WA 1GMQA 1C54A 3GSPA 4GSPA 1RGHA 1RGFA 1PY3A 1YNVX 1GMRA 1RSNA 1I0XA 4GHOA 1I2GA 3BIRA 1RGEA 3AHWA 2GSPA 2F4YA 1MGWA 2BU4A 3BU4A 1RHLA 1LOVA 1RGGA 1LRAA 2KF3A 1FYSA 1LOWA 1RN4A 1BRIA 2HOHA 4BIRA 1UCLA 1GOVA 4BU4A 2KAAA 1RNTA 3AGNA 1B27A 1RNBA 1BANA 1I2EA 4HOHA 1CH0A 1T2HA 1FZUA 1LNIA 3AHSA 2AADA 2SARA 1BNFA 1BGSA 1IYYA 1GMPA 1JBSA 1UCJA 1BRKA 1X1YA 2BIRA 9RNTA 1BNRA 2AAEA 1RGAA 1BNSA 1B2ZA 2ZA4A 1UCKA 1A2PA 1DETA 1HYFA 2RNTA 1B2MA 1Q9EA 7RNTA 3WHOA 1BSCA 1X1WA 1RGCA 1ZGXA 1G02A 5GSPA 1RN1A 3A5EA 1DE3A 4HAAA 6RNTA 1SARA 1BNGA 2F5MA 1AQZA 1BSAA 3KCHA 1RTUA 3DH2A 4RNTA 1FUSA 2KF6A 1MGRA 1RDSA 1R4YA 1TTOA 1GOUA 1YVSA 1BRSA 1JBTA 1BSEA 1RCKA 3WR2A 1B3SA 1B20A 4J5KA 5HOHA 1JBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYL A;  1BVI A;  1I3F A;  2KF4 A;  8RNT A;  1I0V A;  1B21 A;  1TRQ A;  1B2S A;  1YGW A;  1AY7 A;  1RMS A;  1B2U A;  1GSP A;  1X1X A;  5BIR A;  1TRP A;  3D5I A;  3AGO A;  1BRJ A;  7GSP A;  2KF5 A;  1FW7 A;  3Q3F A;  2C4B A;  1X1U A;  6GSP A;  1I70 A;  2F56 A;  1I2F A;  1T2I A;  1RLS A;  1BSD A;  1LOY A;  1UCI A;  1I8V A;  4J5G A;  3HOH A;  1BOX A;  3URP A;  1HZ1 A;  1BNJ A;  3D5G A;  5BU4 A;  2RBI A;  1BRG A;  1GOY A;  1BAO A;  1BNI A;  1BRH A;  1BIR A;  3SYU A;  1BNE A;  5RNT A;  1RGK A;  1RCL A;  3RNT A;  1I3I A;  3DGY A;  1FUT A;  1B2X A;  1BSB A;  1BUJ A;  1RGL A;  3D4A A;  1BRN L;  1BU4 A;  2F5W A;  1GMQ A;  1C54 A;  3GSP A;  4GSP A;  1RGH A;  1RGF A;  1PY3 A;  1YNV X;  1GMR A;  1RSN A;  1I0X A;  4GHO A;  1I2G A;  3BIR A;  1RGE A;  3AHW A;  2GSP A;  2F4Y A;  1MGW A;  2BU4 A;  3BU4 A;  1RHL A;  1LOV A;  1RGG A;  1LRA A;  2KF3 A;  1FYS A;  1LOW A;  1RN4 A;  1BRI A;  2HOH A;  4BIR A;  1UCL A;  1GOV A;  4BU4 A;  2KAA A;  1RNT A;  3AGN A;  1B27 A;  1RNB A;  1BAN A;  1I2E A;  4HOH A;  1CH0 A;  1T2H A;  1FZU A;  1LNI A;  3AHS A;  2AAD A;  2SAR A;  1BNF A;  1BGS A;  1IYY A;  1GMP A;  1JBS A;  1UCJ A;  1BRK A;  1X1Y A;  2BIR A;  9RNT A;  1BNR A;  2AAE A;  1RGA A;  1BNS A;  1B2Z A;  2ZA4 A;  1UCK A;  1A2P A;  1DET A;  1HYF A;  2RNT A;  1B2M A;  1Q9E A;  7RNT A;  3WHO A;  1BSC A;  1X1W A;  1RGC A;  1ZGX A;  1G02 A;  5GSP A;  1RN1 A;  3A5E A;  1DE3 A;  4HAA A;  6RNT A;  1SAR A;  1BNG A;  2F5M A;  1AQZ A;  1BSA A;  3KCH A;  1RTU A;  3DH2 A;  4RNT A;  1FUS A;  2KF6 A;  1MGR A;  1RDS A;  1R4Y A;  1TTO A;  1GOU A;  1YVS A;  1BRS A;  1JBT A;  1BSE A;  1RCK A;  3WR2 A;  1B3S A;  1B20 A;  4J5K A;  5HOH A;  1JBR A; 
#chains in the Genus database with same CATH topology
 3LH4 A;  2Z7A A;  4BTX A;  2QIY A;  2CK3 H;  3G0K A;  1GS3 A;  1B21 A;  1Q40 B;  3FH1 A;  1TRQ A;  4HZ9 B;  4XBT A;  1K41 A;  1X1X A;  5CK6 A;  2IA7 A;  2MC8 A;  3VF1 A;  5CXO A;  4FCM A;  3MG3 A;  1JB2 A;  1FW7 A;  4RNZ A;  1UUG B;  5IG4 A;  2CIU A;  2ML5 A;  2P09 A;  1QJG A;  3N9H A;  2GU1 A;  4O2H A;  3STD A;  1K8A 4;  1LXE A;  1I2F A;  4N6O B;  4HM6 B;  2XF3 A;  3OWU A;  2K54 A;  4XDV A;  1N9J A;  5AEU B;  4WWU C;  3AMO A;  1LQG C;  1BOX A;  1IVX A;  3RGR A;  1W00 A;  3NXJ A;  2RBI A;  3F7X A;  5AEW B;  2CW9 A;  2YFL B;  3S29 A;  1BRH A;  3V98 A;  1M1X B;  3FZW A;  2GXF A;  1BIR A;  4FMD A;  3N8B A;  1A2V A;  4BTY A;  1Q7Y 4;  3RNT A;  1J2B A;  2JDI H;  3B4P A;  4ILF A;  2RGQ A;  1BSB A;  2KCD A;  1IQY A;  1PFP A;  1QAK A;  2XFS A;  3NBR A;  5I97 A;  1AR0 A;  1GMQ A;  2CG1 A;  3I0Y A;  3PYJ A;  1W4N A;  3CCQ 3;  1C54 A;  4NHF A;  3KSE D;  3K7C A;  1CQS A;  5AIF A;  4DKI A;  1RRH A;  2INX A;  1CYV A;  3LT8 A;  3PZW A;  2WGQ A;  2Y74 A;  2CFW A;  4AKY A;  3H51 A;  3BIR A;  3PXM A;  1OAC A;  3AHW A;  4HZB B;  5STD A;  5KP1 A;  4EBG A;  2BU4 A;  2XH9 A;  3MYT A;  4XM4 A;  1ISK A;  3KZT A;  3LTD A;  1TFO A;  2V1L A;  1OGZ A;  2CG0 A;  1SPU A;  2IMJ A;  2KF3 A;  3BND A;  5AIH A;  1EG9 B;  1FYS A;  3CPO A;  4NRE A;  1JJ2 2;  4HKV B;  4LSO A;  1BRI A;  2HOH A;  2OTJ 3;  1UCL A;  1GOV A;  1O7M B;  4XB5 A;  2QEX 3;  1RNB A;  3VGN A;  1HKX A;  1I2E A;  1TFK A;  1O7N B;  2CFG A;  3HII A;  3LT9 A;  1AVK A;  2RSX A;  3B7C A;  2K3D A;  3F14 A;  4KFD A;  1IYY A;  1BGS A;  3GAX A;  3BLZ A;  5EVH A;  4EV5 A;  5EQL A;  1UCJ A;  4K1V A;  1UUV B;  1BRK A;  4U13 A;  1FGR A;  4BL3 A;  3DGN A;  3BNC A;  3ROB A;  3MWZ A;  1DMM A;  2UUG C;  3MPH A;  1RGA A;  1ROV A;  3HK4 A;  4JF8 A;  4KVH A;  1B2Z A;  1DMQ A;  1UCK A;  2CWV A;  2OQE C;  3K63 A;  3SOY A;  1M9G A;  1HYF A;  1IV7 A;  2K0M A;  2RNT A;  5D82 A;  5KP3 A;  3RGA A;  1ROA A;  2WGO A;  2Z77 A;  3KN4 A;  3LOY A;  3CXC 2;  1WMP A;  1Q40 A;  4R9L A;  3WHO A;  1VQ4 3;  1OF5 A;  1RGC A;  1ZGX A;  4RNY A;  1RN1 A;  2BMQ B;  3HIG A;  1UUW B;  2F5M A;  1BSA A;  2C10 A;  3CNM A;  3FG4 A;  1RTU A;  1F8N A;  5EEO A;  5IEP A;  3MG2 A;  2KF6 A;  3ALA A;  3CCM 3;  1YVS A;  3CNX A;  3GZB A;  2W9P A;  1UW1 A;  5FW5 A;  2QA4 3;  2Z6B A;  4J5K A;  1JV2 B;  5HOH A;  1W2Z A;  1OPY A;  1Q86 4;  1SII A;  1VQQ A;  1PYL A;  3FG3 A;  1EUI C;  3NV0 B;  1I3F A;  1KQS 2;  3LYG A;  4XDW A;  1DYU A;  5JBS A;  2STD A;  1YGW A;  1YIJ 3;  3LXU X;  3OW2 2;  1GSP A;  4PEJ A;  4LMI A;  1TRP A;  3AGO A;  3KII A;  5M1A A;  1BRJ A;  2GBX B;  4CCV A;  1L5G B;  2YFI B;  3BNB A;  2HMJ B;  2BHM A;  4EXR A;  1CEW I;  3DY5 A;  1X1U A;  3CCR 3;  4FMA A;  1N8R 4;  4L7K A;  3WMD A;  3NM7 A;  3CMA 3;  1LOY A;  1OHP A;  3ZFZ A;  1UCI A;  5IF6 A;  3F8H A;  1IVV A;  1SQW A;  1A67 A;  2W56 A;  2H0H A;  3K9M C;  3QK9 A;  3URP A;  1V58 A;  1JN5 B;  5IG3 A;  1YHQ 3;  3D5G A;  4K90 B;  4TX4 A;  2F86 B;  3HZP A;  4OUQ A;  1ZO2 A;  3NUV A;  1JN5 A;  1GOY A;  2XEP A;  3VSY A;  1FGO A;  4CJN A;  1BNI A;  1UI8 A;  4HM1 B;  3Q90 A;  3L0R A;  1TJD A;  4N6T A;  1IU7 A;  3SED A;  3X3Z A;  1VQO 3;  3O8Y A;  1RCL A;  4N6U A;  1S5A A;  2W9Q A;  3DGO A;  1IQX A;  1OHS A;  4AKZ A;  3EQQ B;  3FKA A;  1Y4K A;  2KRT A;  4OK0 A;  4I4K A;  1QAF A;  3B4O A;  1YI2 3;  2QGU A;  2CFK A;  2E2V A;  3UNL A;  1RKY A;  3EE1 A;  3LTA A;  2IUJ A;  2MF7 A;  1W2B 2;  1IT8 A;  1JB5 A;  1PY3 A;  1R4C A;  4HM3 B;  4ORL A;  1GMR A;  2FXT A;  3NX0 A;  5IER A;  1RRL A;  1UGI A;  3FF0 A;  1E3V A;  1N8Q A;  2F4Y A;  5BXQ A;  4L8P A;  3CCJ 3;  2WOH A;  4HM4 B;  4EC6 A;  3G8Z A;  1VQ5 3;  3DGM A;  4BTW A;  5IEN A;  3S28 A;  1RGG A;  3EN8 A;  1LOW A;  3OV4 A;  1T3B A;  2FGT A;  4FR9 A;  4K61 A;  1A2K A;  1DVD A;  3NQY A;  3SLU A;  1O7G B;  2IUK A;  4HM2 B;  1IVU A;  2KAA A;  3SVA A;  2F99 A;  1RNT A;  5DRE A;  2XFT A;  1B27 A;  5AYR B;  4HOH A;  1T2H A;  3F8X A;  1N5H A;  1FZU A;  1GD4 A;  2Z76 A;  3FG1 A;  4WP5 A;  4J9A A;  1O7W B;  1Q82 4;  4HM8 B;  1MOL A;  1VQM 3;  3B8L A;  1ZX2 A;  2B1X B;  2H0G A;  4FMB A;  1JBS A;  3EC9 A;  5BVB A;  1IV9 A;  1ULI B;  3ZG0 A;  4OVM A;  4N6M A;  3SOA A;  3F9S A;  4IIA A;  2CWT A;  2IY2 A;  1VQ8 3;  1KWI A;  1LOX A;  1VQL 3;  1TUH A;  1W7C A;  2W6J H;  3JUN A;  1JRQ A;  7RNT A;  3CCS 3;  1MWR A;  3EX9 A;  1STF I;  1LVN A;  2OWP A;  4X2O A;  5D81 A;  3S27 A;  3Q2P A;  1OHO A;  2GEY A;  2PZV A;  1JKG A;  3KKG A;  5GSP A;  3A5E A;  1DMN A;  2R4I A;  4HAA A;  4KZ1 A;  1JZD A;  3BNE A;  1JKG B;  1WNH A;  1AQZ A;  3EHC A;  3EJV A;  4N6V 0;  3DH2 A;  1OH0 A;  4IPB A;  2HMN B;  1MGR A;  2L1S A;  1R4Y A;  3D79 A;  2OOV C;  4L8O A;  2OOV A;  1KSI A;  3WDG B;  1W02 A;  1BSE A;  1RCK A;  4HM7 B;  3WR2 A;  4LGQ A;  1NB5 I;  3FF2 A;  3WOE B;  1MNL A;  2D42 A;  1STD A;  5ELJ A;  5FGO A;  1GYB A;  2CKF B;  3OX9 A;  1WMO A;  1U5O A;  1BVI A;  4QWT A;  1YJN 3;  2LQV A;  4FCZ A;  3OWS A;  1Z1S A;  1B2S A;  3K5T A;  5BIR A;  3D5I A;  3CU3 A;  3CME 3;  1RN7 A;  4FMC A;  2KF5 A;  3Q3F A;  4O3V A;  1D6Z A;  2C4B A;  3RDE A;  1I70 A;  2F56 A;  3WA2 X;  4BL2 A;  1W01 A;  1SJW A;  1N5P A;  1BSD A;  2M7O A;  1G96 A;  3K0Z A;  4STD A;  2HML B;  3HOH A;  2CC3 A;  1HZ1 A;  2FNQ A;  3EB8 A;  2F98 A;  7STD A;  1BNJ A;  3J7Y d;  1DVC A;  2BMR B;  2W2C A;  3IPT A;  5BU4 A;  2OCT A;  2OTL 3;  1BRG A;  5G2G A;  1G0T A;  1FUW A;  1W6G A;  1ASK A;  4MJD A;  2ZHX B;  4MEI A;  3G4S 3;  1GY7 A;  1BNE A;  5RNT A;  1RGK A;  4LYL B;  4RZM A;  3DGY A;  3MKI A;  1FUT A;  2R41 A;  3PCS A;  1BUJ A;  1RGL A;  3FGY A;  3F40 A;  3EF8 A;  1IVW A;  2RFR A;  1BRN L;  3S67 A;  1Q7H A;  1LNH A;  2CWU A;  3Q1C A;  3GWR A;  3GSP A;  3N54 B;  4FCJ A;  4Q53 A;  1V57 A;  2CHC A;  4N6N B;  3CCU 3;  1TU5 A;  1T5Y A;  1RGH A;  4XBY A;  4NPB A;  4J8T A;  3X3X A;  1YNV X;  3GZY B;  4N6L A;  3JUP A;  5A0O B;  1RSN A;  1I0X A;  4GHO A;  3OXA A;  4EYC A;  3GZX B;  5JPP A;  3DMC A;  2H0I A;  2SBL A;  1MGW A;  1VQ6 3;  2CH9 A;  3T8N A;  3NBJ A;  2Y73 A;  1Q42 A;  1UDI I;  3BU4 A;  1EEJ A;  1EKM A;  4WYK A;  2XSO B;  1K28 A;  3OWY A;  5CF1 A;  1RJO A;  5KP4 A;  2BT3 A;  1O7P B;  3A76 A;  4WYK B;  1YGE A;  5LC6 A;  3KSP A;  4BIR A;  2P05 A;  1UGH I;  3AGN A;  1AVL A;  2HMO B;  4WFO A;  1OF5 B;  4RBN A;  1KC8 4;  5CF2 A;  1E97 A;  1FGQ A;  1C7H A;  2WO0 A;  3HX8 A;  5AI1 A;  3MHE A;  1NDO B;  1BNF A;  2CFL A;  3WOF B;  3D9R A;  3NBB A;  1GMP A;  1Q81 4;  3NM2 A;  1MWS A;  1X1Y A;  2I9W A;  9RNT A;  2Q07 A;  1BNR A;  2AAE A;  2C11 A;  1GY6 A;  2YFJ B;  2XR8 B;  5TGN A;  3G16 A;  5IEO A;  1QMA A;  2HMM B;  2J8X B;  2W03 A;  3F7S A;  3CCE 3;  2CX1 A;  1YVB I;  4H61 A;  3DXO A;  3NV0 A;  4HVN A;  1EA2 A;  2E2U A;  3NHX A;  2W04 A;  3NQZ A;  2HMK B;  1BSC A;  1NO3 A;  1X1W A;  3ECF A;  3JUO A;  3U1W A;  4ZM8 A;  1ZS7 A;  3U97 A;  2ZL8 A;  1NNV A;  1DE3 A;  6RNT A;  1SAR A;  1VQ7 3;  5AYS C;  4GL6 A;  1BNG A;  2XSH B;  2ZDJ A;  4R80 A;  1YJ9 3;  2A15 A;  1FUS A;  4G1M B;  1RDS A;  1TTO A;  1U8C B;  1GOU A;  1IDP A;  4XBX A;  2PNC A;  3CC7 3;  1B3S A;  1B20 A;  2BMO B;  2XGL A;  2YX9 A;  2W56 B;  3IJE B;  4K1U A;  4EV2 A;  1VQ9 3;  1JBR A;  1OGX A;  3UL6 A;  3SXX A;  3CPW 2;  1FGT A;  2KF4 A;  1I0V A;  3S5C A;  3UJM A;  8RNT A;  3LML A;  1MWT A;  1AY7 A;  1RMS A;  6STD A;  1B2U A;  3T0U A;  2O3O A;  3GZR A;  3QRD A;  4HJL B;  2BO9 B;  7GSP A;  3X41 A;  1TP6 A;  1OUN A;  3ZG5 A;  3LTC A;  5JPU A;  1WMN A;  4I5Q A;  4MMY B;  4O02 B;  5M19 A;  6GSP A;  1T2I A;  2BNG A;  1RLS A;  3EN1 B;  4LZI A;  3FLJ A;  3AMO B;  5AIG A;  1O7H B;  1I8V A;  1NU3 A;  3JUM A;  4J5G A;  4AEQ A;  1SIH A;  3X42 A;  2E2T A;  3JVC A;  3H3H A;  2KXG A;  1UI7 A;  1US1 A;  4CPK A;  2B24 B;  2P0X A;  1YJW 3;  1LQM B;  1VQN 3;  3G6E 3;  3EBT A;  1VQK 3;  1BAO A;  2W0Q A;  5AII A;  3SX1 A;  2P0M A;  3E99 A;  3SYU A;  3T8U A;  3GRD A;  4R4K A;  1D6U A;  5DRV A;  4KFE A;  2WOF A;  1I3I A;  1B2X A;  5M18 A;  3PCR A;  3IMA B;  4HM0 B;  3D4A A;  1CYU A;  3PGB A;  1W6C A;  3TDG A;  1BU4 A;  2F5W A;  4LEH A;  2CX0 A;  1NB3 I;  1TIJ A;  1NJI 4;  4IT7 A;  4KT3 B;  4GSP A;  1JNQ A;  1RGF A;  1N9E A;  3CC4 3;  5IG5 A;  3X3Y A;  4KFF A;  3UL5 A;  4HBR A;  1QVG 2;  2JQ5 A;  1I2G A;  3I56 3;  1RGE A;  1PU4 A;  2GSP A;  3CCV 3;  1IQ8 A;  1WTH A;  4CDL A;  1M1K 4;  1YIT 3;  1V74 A;  3LTB A;  2UGI A;  5D83 A;  1AV4 A;  1FGM A;  1NWW A;  4HM5 B;  3CCL 3;  4WHA A;  1OCV A;  1RHL A;  1LOV A;  1IK3 A;  3V92 A;  1FA3 A;  3CC2 3;  1LRA A;  4R1K A;  8CHO A;  1D6Y A;  1WQL B;  3HI7 A;  3MG1 A;  1IT7 A;  1RN4 A;  3JUQ A;  1GY5 A;  2ML6 A;  4R9K A;  4GB5 A;  2O9U X;  2RCD A;  4BU4 A;  3FCS B;  1BAN A;  1JB4 A;  2D1W A;  1CH0 A;  3WA3 A;  4EW5 A;  4H3U A;  5G1K A;  1LNI A;  1W6Y A;  1QAL A;  3AHS A;  2AAD A;  2SAR A;  3BB9 A;  2L4V A;  3DGL A;  1QVF 2;  1ULJ B;  5HGR A;  5LC7 A;  3EBY A;  1W5Z A;  2BIR A;  4JRF A;  2GU3 A;  1VQP 3;  2LYX A;  3DUK A;  5ELU A;  1BNS A;  4O8S A;  1MWU A;  2GEX A;  2GBW B;  2ZA4 A;  4MMZ B;  1M90 4;  1EQK A;  1E3R A;  3G71 3;  1A2P A;  1DET A;  1HU9 A;  3KFQ C;  1B2M A;  3PS8 A;  2XRX B;  1Q9E A;  1K73 4;  2IYJ A;  3WOD G;  5IW9 A;  5IG0 A;  2P38 A;  1S72 3;  3LZA A;  2XGN A;  3CD6 3;  1G02 A;  4X2H A;  1BUQ A;  2OQE A;  5CLK A;  3X40 A;  3KE7 A;  3KCH A;  2CFD A;  5G1L A;  3UB1 A;  3I55 3;  3M8C A;  4RNT A;  3V99 A;  1K9M 4;  3FSD A;  4N3V A;  1JZO A;  3DM8 A;  1BRS A;  2UX0 A;  1JBT A;  1GD3 A;  3MSO A;  3D3L A;  1VZZ A;  4MMX B;  4HYZ A;  3ER7 A;  1A90 A;  3DZL A;  1KD1 4; 
#chains in the Genus database with same CATH homology
 1PYL A;  1BVI A;  1I3F A;  2KF4 A;  8RNT A;  1I0V A;  1B21 A;  1TRQ A;  1B2S A;  1YGW A;  1AY7 A;  1RMS A;  1B2U A;  1GSP A;  1X1X A;  5BIR A;  1TRP A;  3D5I A;  3AGO A;  1BRJ A;  7GSP A;  2KF5 A;  1FW7 A;  3Q3F A;  2C4B A;  1X1U A;  6GSP A;  1I70 A;  2F56 A;  1I2F A;  1T2I A;  1RLS A;  1BSD A;  1LOY A;  1UCI A;  1I8V A;  4J5G A;  3HOH A;  1BOX A;  3URP A;  1HZ1 A;  1BNJ A;  3D5G A;  5BU4 A;  2RBI A;  1BRG A;  1GOY A;  1BAO A;  1BNI A;  1BRH A;  1BIR A;  3SYU A;  1BNE A;  5RNT A;  1RGK A;  1RCL A;  3RNT A;  1I3I A;  3DGY A;  1FUT A;  1B2X A;  1BSB A;  1BUJ A;  1RGL A;  3D4A A;  1BRN L;  1BU4 A;  2F5W A;  1GMQ A;  1C54 A;  3GSP A;  4GSP A;  1RGH A;  1RGF A;  1PY3 A;  1YNV X;  1GMR A;  1RSN A;  1I0X A;  4GHO A;  1I2G A;  3BIR A;  1RGE A;  3AHW A;  2GSP A;  2F4Y A;  1MGW A;  2BU4 A;  3BU4 A;  1RHL A;  1LOV A;  1RGG A;  1LRA A;  2KF3 A;  1FYS A;  1LOW A;  1RN4 A;  1BRI A;  2HOH A;  4BIR A;  1UCL A;  1GOV A;  4BU4 A;  2KAA A;  1RNT A;  3AGN A;  1B27 A;  1RNB A;  1BAN A;  1I2E A;  4HOH A;  1CH0 A;  1T2H A;  1FZU A;  1LNI A;  3AHS A;  2AAD A;  2SAR A;  1BNF A;  1BGS A;  1IYY A;  1GMP A;  1JBS A;  1UCJ A;  1BRK A;  1X1Y A;  2BIR A;  9RNT A;  1BNR A;  2AAE A;  1RGA A;  1BNS A;  1B2Z A;  2ZA4 A;  1UCK A;  1A2P A;  1DET A;  1HYF A;  2RNT A;  1B2M A;  1Q9E A;  7RNT A;  3WHO A;  1BSC A;  1X1W A;  1RGC A;  1ZGX A;  1G02 A;  5GSP A;  1RN1 A;  3A5E A;  1DE3 A;  4HAA A;  6RNT A;  1SAR A;  1BNG A;  2F5M A;  1AQZ A;  1BSA A;  3KCH A;  1RTU A;  3DH2 A;  4RNT A;  1FUS A;  2KF6 A;  1MGR A;  1RDS A;  1R4Y A;  1TTO A;  1GOU A;  1YVS A;  1BRS A;  1JBT A;  1BSE A;  1RCK A;  3WR2 A;  1B3S A;  1B20 A;  4J5K A;  5HOH A;  1JBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...