1T2IA

T76w mutant of rnase sa from streptomyces aureofaciens
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEAWQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of single tryptophan residues to the fluorescence and stability of ribonuclease sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
total genus 25
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1t2iA00
1YGWA 4BIRA 1AQZA 1JBRA 1BANA 2F4YA 1BNFA 1RGAA 1GMQA 4HOHA 2BIRA 6RNTA 1TRQA 5RNTA 1YNVX 1FUSA 3AHWA 1Q9EA 2RNTA 1RGEA 1UCJA 2F5WA 1BRJA 1BSDA 1LOWA 1R4YA 1YVSA 7RNTA 1A2PA 1B20A 1BNJA 1BRGA 2AAEA 2KF4A 4HAAA 1HZ1A 2RBIA 4J5KA 4RNTA 3DGYA 1RGGA 1BGSA 1GMRA 1BNGA 1RCKA 1I3IA 1MGWA 5BIRA 1I3FA 3BU4A 1BAOA 1RCLA 1LRAA 1LOYA 2F5MA 2KF6A 1RDSA 1MGRA 1BRKA 1RGCA 1LOVA 1BNIA 1RTUA 1AY7A 3AGNA 1B2UA 1GSPA 3Q3FA 2BU4A 2KF5A 1RGLA 2F56A 1UCLA 2AADA 1RLSA 1I0VA 1BU4A 1PYLA 3D5GA 4J5GA 1JBTA 1RGKA 2GSPA 1I0XA 1T2HA 1GOVA 1B3SA 1ZGXA 1RNBA 1DETA 1I2FA 1RN4A 2ZA4A 1X1XA 1CH0A 3WR2A 1I70A 3BIRA 1RSNA 1BSAA 1B21A 3SYUA 1B27A 1I2GA 4GHOA 1BRHA 1B2MA 1DE3A 1RGFA 3WHOA 1FZUA 1RNTA 1BVIA 1FW7A 1FYSA 1TTOA 1LNIA 1BRSA 1GOYA 1BIRA 1RN1A 1BOXA 1JBSA 1SARA 2KF3A 1HYFA 1X1UA 3D4AA 1BNSA 1I8VA 3AGOA 1BRNL 2C4BA 8RNTA 1UCKA 1C54A 4BU4A 1X1WA 6GSPA 1GOUA 1UCIA 1IYYA 5BU4A 3HOHA 1BSCA 1B2XA 1X1YA 3A5EA 1B2ZA 2SARA 3KCHA 1BSEA 1I2EA 3RNTA 4GSPA 2HOHA 1T2IA 1BNEA 1RMSA 1GMPA 1RGHA 1BRIA 9RNTA 1RHLA 1BSBA 2KAAA 1FUTA 1G02A 3DH2A 3GSPA 5GSPA 3URPA 1BNRA 1B2SA 1BUJA 1TRPA 5HOHA 1PY3A 3AHSA 7GSPA 3D5IA
chains in the Genus database with same CATH superfamily
1VQ53 1JBRA 3CCJ3 2FGTA 1BANA 1BNFA 3VSYA 3MHEA 4HOHA 2BIRA 3VF1A 1JB5A 3EN1B 1JB2A 3STDA 1VQ73 1QVG2 2WGQA 1WNHA 1UGHI 1ZS7A 1FUSA 3AHWA 5IENA 1W2B2 1DVCA 1AV4A 4HM1B 3ALAA 1RGEA 4KFDA 2WO0A 3BLZA 1BRJA 1LOWA 1RN7A 2R41A 3JUQA 7RNTA 2KF4A 1BNJA 1BRGA 2WGOA 3EBYA 2H0IA 4K1UA 3S5CA 4LMIA 2CKFB 2ML6A 3BNBA 1Q7HA 4NHFA 2FNQA 2R4IA 4U13A 3LOYA 1RCKA 1YJN3 1D6ZA 3BU4A 5DREA 3ROBA 3LT8A 4J9AA 2OCTA 4O02B 2RSXA 5JPPA 3MG2A 1TIJA 1RDSA 3EBTA 4HM7B 1VQ93 1MGRA 1VQM3 1RGCA 4RBNA 3S28A 2L1SA 4L7KA 5D82A 3ZFZA 1EEJA 5AYSC 3AGNA 1FGRA 3JUMA 3UL5A 4FMDA 1GS3A 1TJDA 3GZXB 2ZHXB 1EKMA 2CX1A 3OV4A 4IIAA 3OX9A 3F40A 4ILFA 3LTBA 4STDA 4WYKB 3HZPA 1VQL3 3EB8A 4BL3A 4HM0B 1I0VA 4HM6B 1PYLA 3SVAA 3X3XA 1RJOA 3FZWA 4J5GA 1KC84 5EQLA 1B3SA 3WODG 5IG3A 2CFDA 1ZGXA 3D9RA 1TFOA 1X1XA 1IV7A 3HIGA 3OWYA 3ZG0A 2ZL8A 2CIUA 1NNVA 2BO9B 4AEQA 2GBWB 4MMYB 3SYUA 2CK3H 4CCVA 3UB1A 1DE3A 3LTDA 1GYBA 1DVDA 4JRFA 3NQYA 2Z7AA 1JZDA 5G1KA 7GSPA 2PNCA 1AVKA 4NPBA 2UX0A 1FZUA 2UGIA 1QJGA 5ELJA 1UUVB 4R4KA 5G1LA 2W9PA 1WTHA 3CCS3 3WOFB 1WMNA 1BRSA 5I97A 1BIRA 1QAFA 1BOXA 1SIIA 3K7CA 2KF3A 3WOEB 2C10A 1W6YA 1M9GA 3IMAB 1X1UA 4MEIA 1V57A 1US1A 4TX4A 3V98A 1YI23 1VZZA 1BNSA 3G0KA 2OOVC 1VQQA 8RNTA 1UCKA 2H0HA 4FCZA 1GOUA 4N6TA 3T8UA 4XB5A 3HOHA 5BVBA 1O7PB 3OXAA 5KP1A 1FGQA 1X1YA 4GB5A 1AVLA 3ECFA 3GZYB 3K5TA 2K54A 1I2EA 4N6MA 3RNTA 3CPW2 4HZ9B 2CFKA 1FGMA 1T2IA 2B24B 1K8A4 1RGHA 3CCQ3 3A76A 1T5YA 5IG0A 1JN5B 3EE1A 1G02A 1BNRA 2J8XB 3LH4A 4IPBA 3URPA 3GWRA 1B2SA 2HMNB 2KXGA 3DMCA 3X41A 3HX8A 3I0YA 1OPYA 2OOVA 2KCDA 1MWSA 3D5IA 4X2OA 4JF8A 4LGQA 2E2VA 2XFTA 1Q40A 1RGAA 3F8XA 4EBGA 3MSOA 2RGQA 1G0TA 1TRQA 1KSIA 3E99A 1JJ22 1A2VA 4J8TA 4WP5A 1GY5A 3ZG5A 2GEXA 4N6UA 1N8R4 3MG1A 3QRDA 7STDA 1OHSA 3KKGA 5ELUA 2WOFA 3GZBA 1Q42A 4N6LA 4HM3B 1UGIA 1YVSA 4R80A 1B20A 3KFQC 3F7XA 3Q90A 2RBIA 3RGAA 2IYJA 2B1XB 2HMKB 5CF2A 1GY6A 2XH9A 3PYJA 3FH1A 3HIIA 1YGEA 1YJ93 2YFLB 3K63A 3LMLA 1N5PA 3H3HA 1OACA 1I3IA 3FLJA 2Y73A 1BAOA 1RCLA 3NBRA 1LOYA 1N9EA 2KF6A 5IG4A 3CC73 1MWRA 3HI7A 1YVBI 2CC3A 2GEYA 4Q53A 2CFLA 1LOVA 1BNIA 5A0OB 1O7WB 1EA2A 5AIHA 3J7Yd 2YX9A 3HK4A 4KT3B 1KWIA 2XR8B 3S27A 1VQN3 2CG0A 1W02A 1O7MB 3U1WA 1M1K4 2STDA 4H61A 4MMXB 3RDEA 4BL2A 1RLSA 4FCMA 1BU4A 3D5GA 4O8SA 1QMAA 3EQQB 3G4S3 1TP6A 1I0XA 3PS8A 3BNCA 1C7HA 3FF0A 1TUHA 1IT8A 1YHQ3 1I2FA 1RN4A 1K9M4 3DM8A 3CCR3 3WR2A 3FCSB 1I70A 3BIRA 4KZ1A 1DYUA 1RRHA 1B21A 1OUNA 4GHOA 1FA3A 3KIIA 1VQP3 1R4CA 1B2MA 2BMOB 2H0GA 3D79A 1MWUA 5FGOA 3T0UA 3CCV3 4KVHA 3GAXA 3OW22 4BTYA 1Q7Y4 1M1XB 5CK6A 5JBSA 1RNTA 2INXA 4X2HA 1FYSA 1TTOA 1ZO2A 1LNIA 5AIIA 4BTWA 3LTAA 4R9LA 3VGNA 1FGOA 4N3VA 2HMLB 2XRXB 1HYFA 4EV2A 3NM2A 4RZMA 3GZRA 3AMOA 1JB4A 5AIFA 1E97A 3LT9A 3V99A 1IU7A 4HKVB 3B8LA 1I8VA 4L8OA 5JPUA 2C4BA 2L4VA 1O7GB 3NV0A 1C54A 3CCL3 1SJWA 1X1WA 1O7NB 5M1AA 2CWVA 3MWZA 1LNHA 4G1MB 3X3YA 5KP4A 2W0QA 1IQ8A 1AR0A 1B2XA 1IDPA 4OK0A 4WHAA 1K41A 3CMA3 3DGLA 3M8CA 1LQGC 4N6V0 2SARA 3KCHA 1UUGB 5AI1A 4NREA 2QEX3 1EG9B 2HOHA 1JNQA 3FF2A 4GSPA 1BNEA 4XDWA 2CFWA 3B7CA 1KD14 1BRIA 9RNTA 1HU9A 1RHLA 1N8QA 1WMOA 4XBXA 1Y4KA 1QALA 3BNEA 2MC8A 1LQMB 3DH2A 1W7CA 1Z1SA 3G713 3PCRA 5HGRA 1Q40B 2FXTA 4EXRA 1TRPA 1MNLA 4FMCA 5HOHA 1PY3A 3CNMA 2XSHB 3AHSA 1VQ83 5AYRB 2W56B 4FCJA 5IF6A 1RKYA 1K734 3FG1A 2OQEA 2O3OA 4BIRA 2Z77A 8CHOA 5DRVA 5M19A 1STFI 2F4YA 4I4KA 1F8NA 2HMJB 3NBBA 4R1KA 4BTXA 2V1LA 2BMRB 3LYGA 3I563 2YFIB 4AKYA 1LVNA 1IVVA 1JKGA 1VQK3 3F14A 5AIGA 1Q9EA 3SOAA 3FG3A 1YJW3 2RNTA 1IV9A 1UCJA 2F5WA 4ZM8A 1OF5A 1UI8A 3CCE3 1BSDA 1R4YA 3OWSA 4I5QA 1KQS2 2IY2A 2XGLA 1A2PA 2Z76A 3LTCA 4RNTA 1W5ZA 2ZDJA 4J5KA 3RGRA 1NDOB 3DGYA 1DMNA 1RGGA 1T3BA 1BGSA 2XGNA 3NBJA 1GMRA 3WA2X 1NB5I 2A15A 1U5OA 2C11A 3NM7A 1DMQA 2ML5A 3SLUA 2IMJA 1MGWA 1OCVA 1JRQA 2XF3A 5BIRA 1W00A 3CC43 1M904 1LRAA 4PEJA 2RCDA 2F5MA 3LXUX 3EF8A 3WMDA 4XDVA 2QIYA 4N6OB 1UI7A 5EVHA 2OTL3 2W03A 1PFPA 2W56A 3MG3A 3G6E3 1RTUA 1W6GA 3IJEB 4RNZA 1CYUA 3KN4A 1EQKA 1B2UA 4HJLB 2KF5A 2OQEC 4MMZB 2F56A 1YIJ3 4K90B 1QVF2 2AADA 1S5AA 5IEPA 1MWTA 3PCSA 4XBYA 1SQWA 1RGKA 2GSPA 1T2HA 4RNYA 3V92A 4O2HA 5IW9A 1DETA 3EN8A 3MPHA 4XBTA 5CXOA 1JZOA 1CH0A 3N8BA 4HBRA 3G8ZA 1RSNA 2QA43 3DXOA 3SXXA 1Q824 1IVXA 1OHPA 1I2GA 1LOXA 3B4PA 1VQ43 2PZVA 3SOYA 5CLKA 1A67A 5CF1A 3JVCA 4WYKA 1Q864 1Q814 1W4NA 1UUWB 3CC23 1FW7A 5AEUB 2LQVA 1A2KA 3OWUA 1TU5A 1IVUA 1GOYA 1RN1A 1JBSA 1SARA 2F98A 4FR9A 3KE7A 5AEWB 1NB3I 3EX9A 3X42A 5IG5A 2JQ5A 2GU1A 2CG1A 3D4AA 3WA3A 3AGOA 1BRNL 4BU4A 3CNXA 4N6NB 1UW1A 2GXFA 3TDGA 1IYYA 4H3UA 5EEOA 4IT7A 1BSCA 1NWWA 2F99A 1FGTA 2XFSA 3L0RA 3F8HA 4KFEA 1JN5A 2O9UX 3AMOB 3A5EA 2CX0A 1BUQA 1YIT3 2CH9A 3NHXA 5IEOA 3X40A 3MKIA 4HVNA 2W04A 2E2TA 5KP3A 4HM8B 2KAAA 2JDIH 4XM4A 3GRDA 1PU4A 3GSPA 5GSPA 3DY5A 2D1WA 1TFKA 2XSOB 5M18A 1BUJA 1OHOA 3PXMA 2BHMA 4L8PA 1JV2B 3NUVA 4HM4B 4K1VA 2M7OA 3LZAA 3DUKA 3EC9A 3FGYA 2E2UA 5LC7A 1YGWA 2W6JH 5BXQA 1AQZA 4CPKA 1IK3A 4K61A 1ULJB 3DGNA 1GMQA 1O7HB 2CWTA 6RNTA 5RNTA 1E3VA 2KRTA 1OH0A 3F7SA 4HM2B 1ULIB 2CW9A 1YNVX 2OWPA 1MOLA 3Q1CA 4KFFA 3CD63 1SIHA 1DMMA 1WMPA 3IPTA 4R9KA 5FW5A 4CDLA 2LYXA 3DGMA 6STDA 1S723 1D6UA 3CPOA 3NX0A 2AAEA 4HAAA 1HZ1A 1OGXA 3UL6A 3EJVA 2GBXB 2RFRA 1A90A 1BNGA 1N5HA 3O8YA 1W01A 4OVMA 3DZLA 3K0ZA 1FUWA 1CQSA 1CYVA 4MJDA 1K28A 4WFOA 1I3FA 3UJMA 2MF7A 4DKIA 3I553 5STDA 2F86B 2HMOB 1W6CA 4EYCA 2P05A 5D83A 3QK9A 1V74A 2BT3A 1BRKA 2CWUA 3MYTA 1AY7A 3B4OA 1VQO3 3S67A 1GSPA 1QAKA 1ROAA 1V58A 2BU4A 1W2ZA 2GU3A 2I9WA 3Q3FA 1RGLA 3H51A 1OGZA 2UUGC 1UCLA 3G16A 3UNLA 1VQ63 1LXEA 1NO3A 3WDGB 1NJI4 4QWTA 1JBTA 1GOVA 1CEWI 1HKXA 2Y74A 1RNBA 2ZA4A 4HM5B 1ROVA 4FMBA 4WWUC 2Q07A 1IT7A 2CFGA 3PGBA 1BSAA 1ISKA 1ZX2A 1B27A 1SPUA 3NXJA 1BRHA 5IERA 3CCM3 1J2BA 3K9MC 3U97A 4FMAA 1ASKA 4CJNA 3T8NA 4EV5A 1RGFA 4LYLB 3SEDA 3WHOA 3JUNA 1GD3A 5G2GA 3PZWA 5LC6A 2P0MA 2IUKA 1BVIA 1OF5B 2YFJB 1STDA 3BB9A 4HZBB 4ORLA 2WOHA 3CCU3 1GD4A 4GL6A 3KSED 1IQXA 3D3LA 3ER7A 1JKGB 4LSOA 2BNGA 2BMQB 3BNDA 3N9HA 3SX1A 1N9JA 3NQZA 1EUIC 2HMMB 2IA7A 2QGUA 3DGOA 3FSDA 5D81A 3CME3 1GY7A 6GSPA 1UCIA 4EW5A 4LZIA 5BU4A 3CXC2 2IUJA 2W2CA 1IVWA 3NV0B 2OTJ3 3F9SA 3N54B 1B2ZA 3CU3A 1WQLB 1BSEA 4EC6A 1D6YA 1L5GB 3EHCA 2K3DA 2XEPA 4AKZA 3S29A 1IQYA 1RMSA 3JUPA 1GMPA 1E3RA 3Q2PA 4O3VA 1BSBA 2D42A 3KZTA 1G96A 3X3ZA 2P09A 5TGNA 1FUTA 3FKAA 2CHCA 4LEHA 1UDII 3KSPA 1U8CB 4OUQA 1RRLA 2SBLA 2W9QA 3FG4A 1NU3A 2K0MA 2P38A 4HYZA 2P0XA 3JUOA 2Z6BA
chains in the Genus database with same CATH topology
1YGWA 4BIRA 1AQZA 1JBRA 1BANA 2F4YA 1BNFA 1RGAA 1GMQA 4HOHA 2BIRA 6RNTA 1TRQA 5RNTA 1YNVX 1FUSA 3AHWA 1Q9EA 2RNTA 1RGEA 1UCJA 2F5WA 1BRJA 1BSDA 1LOWA 1R4YA 1YVSA 7RNTA 1A2PA 1B20A 1BNJA 1BRGA 2AAEA 2KF4A 4HAAA 1HZ1A 2RBIA 4J5KA 4RNTA 3DGYA 1RGGA 1BGSA 1GMRA 1BNGA 1RCKA 1I3IA 1MGWA 5BIRA 1I3FA 3BU4A 1BAOA 1RCLA 1LRAA 1LOYA 2F5MA 2KF6A 1RDSA 1MGRA 1BRKA 1RGCA 1LOVA 1BNIA 1RTUA 1AY7A 3AGNA 1B2UA 1GSPA 3Q3FA 2BU4A 2KF5A 1RGLA 2F56A 1UCLA 2AADA 1RLSA 1I0VA 1BU4A 1PYLA 3D5GA 4J5GA 1JBTA 1RGKA 2GSPA 1I0XA 1T2HA 1GOVA 1B3SA 1ZGXA 1RNBA 1DETA 1I2FA 1RN4A 2ZA4A 1X1XA 1CH0A 3WR2A 1I70A 3BIRA 1RSNA 1BSAA 1B21A 3SYUA 1B27A 1I2GA 4GHOA 1BRHA 1B2MA 1DE3A 1RGFA 3WHOA 1FZUA 1RNTA 1BVIA 1FW7A 1FYSA 1TTOA 1LNIA 1BRSA 1GOYA 1BIRA 1RN1A 1BOXA 1JBSA 1SARA 2KF3A 1HYFA 1X1UA 3D4AA 1BNSA 1I8VA 3AGOA 1BRNL 2C4BA 8RNTA 1UCKA 1C54A 4BU4A 1X1WA 6GSPA 1GOUA 1UCIA 1IYYA 5BU4A 3HOHA 1BSCA 1B2XA 1X1YA 3A5EA 1B2ZA 2SARA 3KCHA 1BSEA 1I2EA 3RNTA 4GSPA 2HOHA 1T2IA 1BNEA 1RMSA 1GMPA 1RGHA 1BRIA 9RNTA 1RHLA 1BSBA 2KAAA 1FUTA 1G02A 3DH2A 3GSPA 5GSPA 3URPA 1BNRA 1B2SA 1BUJA 1TRPA 5HOHA 1PY3A 3AHSA 7GSPA 3D5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGW A;  4BIR A;  1AQZ A;  1JBR A;  1BAN A;  2F4Y A;  1BNF A;  1RGA A;  1GMQ A;  4HOH A;  2BIR A;  6RNT A;  1TRQ A;  5RNT A;  1YNV X;  1FUS A;  3AHW A;  1Q9E A;  2RNT A;  1RGE A;  1UCJ A;  2F5W A;  1BRJ A;  1BSD A;  1LOW A;  1R4Y A;  1YVS A;  7RNT A;  1A2P A;  1B20 A;  1BNJ A;  1BRG A;  2AAE A;  2KF4 A;  4HAA A;  1HZ1 A;  2RBI A;  4J5K A;  4RNT A;  3DGY A;  1RGG A;  1BGS A;  1GMR A;  1BNG A;  1RCK A;  1I3I A;  1MGW A;  5BIR A;  1I3F A;  3BU4 A;  1BAO A;  1RCL A;  1LRA A;  1LOY A;  2F5M A;  2KF6 A;  1RDS A;  1MGR A;  1BRK A;  1RGC A;  1LOV A;  1BNI A;  1RTU A;  1AY7 A;  3AGN A;  1B2U A;  1GSP A;  3Q3F A;  2BU4 A;  2KF5 A;  1RGL A;  2F56 A;  1UCL A;  2AAD A;  1RLS A;  1I0V A;  1BU4 A;  1PYL A;  3D5G A;  4J5G A;  1JBT A;  1RGK A;  2GSP A;  1I0X A;  1T2H A;  1GOV A;  1B3S A;  1ZGX A;  1RNB A;  1DET A;  1I2F A;  1RN4 A;  2ZA4 A;  1X1X A;  1CH0 A;  3WR2 A;  1I70 A;  3BIR A;  1RSN A;  1BSA A;  1B21 A;  3SYU A;  1B27 A;  1I2G A;  4GHO A;  1BRH A;  1B2M A;  1DE3 A;  1RGF A;  3WHO A;  1FZU A;  1RNT A;  1BVI A;  1FW7 A;  1FYS A;  1TTO A;  1LNI A;  1BRS A;  1GOY A;  1BIR A;  1RN1 A;  1BOX A;  1JBS A;  1SAR A;  2KF3 A;  1HYF A;  1X1U A;  3D4A A;  1BNS A;  1I8V A;  3AGO A;  1BRN L;  2C4B A;  8RNT A;  1UCK A;  1C54 A;  4BU4 A;  1X1W A;  6GSP A;  1GOU A;  1UCI A;  1IYY A;  5BU4 A;  3HOH A;  1BSC A;  1B2X A;  1X1Y A;  3A5E A;  1B2Z A;  2SAR A;  3KCH A;  1BSE A;  1I2E A;  3RNT A;  4GSP A;  2HOH A;  1T2I A;  1BNE A;  1RMS A;  1GMP A;  1RGH A;  1BRI A;  9RNT A;  1RHL A;  1BSB A;  2KAA A;  1FUT A;  1G02 A;  3DH2 A;  3GSP A;  5GSP A;  3URP A;  1BNR A;  1B2S A;  1BUJ A;  1TRP A;  5HOH A;  1PY3 A;  3AHS A;  7GSP A;  3D5I A; 
#chains in the Genus database with same CATH topology
 1VQ5 3;  1JBR A;  3CCJ 3;  2FGT A;  1BAN A;  1BNF A;  3VSY A;  3MHE A;  4HOH A;  2BIR A;  3VF1 A;  1JB5 A;  3EN1 B;  1JB2 A;  3STD A;  1VQ7 3;  1QVG 2;  2WGQ A;  1WNH A;  1UGH I;  1ZS7 A;  1FUS A;  3AHW A;  5IEN A;  1W2B 2;  1DVC A;  1AV4 A;  4HM1 B;  3ALA A;  1RGE A;  4KFD A;  2WO0 A;  3BLZ A;  1BRJ A;  1LOW A;  1RN7 A;  2R41 A;  3JUQ A;  7RNT A;  2KF4 A;  1BNJ A;  1BRG A;  2WGO A;  3EBY A;  2H0I A;  4K1U A;  3S5C A;  4LMI A;  2CKF B;  2ML6 A;  3BNB A;  1Q7H A;  4NHF A;  2FNQ A;  2R4I A;  4U13 A;  3LOY A;  1RCK A;  1YJN 3;  1D6Z A;  3BU4 A;  5DRE A;  3ROB A;  3LT8 A;  4J9A A;  2OCT A;  4O02 B;  2RSX A;  5JPP A;  3MG2 A;  1TIJ A;  1RDS A;  3EBT A;  4HM7 B;  1VQ9 3;  1MGR A;  1VQM 3;  1RGC A;  4RBN A;  3S28 A;  2L1S A;  4L7K A;  5D82 A;  3ZFZ A;  1EEJ A;  5AYS C;  3AGN A;  1FGR A;  3JUM A;  3UL5 A;  4FMD A;  1GS3 A;  1TJD A;  3GZX B;  2ZHX B;  1EKM A;  2CX1 A;  3OV4 A;  4IIA A;  3OX9 A;  3F40 A;  4ILF A;  3LTB A;  4STD A;  4WYK B;  3HZP A;  1VQL 3;  3EB8 A;  4BL3 A;  4HM0 B;  1I0V A;  4HM6 B;  1PYL A;  3SVA A;  3X3X A;  1RJO A;  3FZW A;  4J5G A;  1KC8 4;  5EQL A;  1B3S A;  3WOD G;  5IG3 A;  2CFD A;  1ZGX A;  3D9R A;  1TFO A;  1X1X A;  1IV7 A;  3HIG A;  3OWY A;  3ZG0 A;  2ZL8 A;  2CIU A;  1NNV A;  2BO9 B;  4AEQ A;  2GBW B;  4MMY B;  3SYU A;  2CK3 H;  4CCV A;  3UB1 A;  1DE3 A;  3LTD A;  1GYB A;  1DVD A;  4JRF A;  3NQY A;  2Z7A A;  1JZD A;  5G1K A;  7GSP A;  2PNC A;  1AVK A;  4NPB A;  2UX0 A;  1FZU A;  2UGI A;  1QJG A;  5ELJ A;  1UUV B;  4R4K A;  5G1L A;  2W9P A;  1WTH A;  3CCS 3;  3WOF B;  1WMN A;  1BRS A;  5I97 A;  1BIR A;  1QAF A;  1BOX A;  1SII A;  3K7C A;  2KF3 A;  3WOE B;  2C10 A;  1W6Y A;  1M9G A;  3IMA B;  1X1U A;  4MEI A;  1V57 A;  1US1 A;  4TX4 A;  3V98 A;  1YI2 3;  1VZZ A;  1BNS A;  3G0K A;  2OOV C;  1VQQ A;  8RNT A;  1UCK A;  2H0H A;  4FCZ A;  1GOU A;  4N6T A;  3T8U A;  4XB5 A;  3HOH A;  5BVB A;  1O7P B;  3OXA A;  5KP1 A;  1FGQ A;  1X1Y A;  4GB5 A;  1AVL A;  3ECF A;  3GZY B;  3K5T A;  2K54 A;  1I2E A;  4N6M A;  3RNT A;  3CPW 2;  4HZ9 B;  2CFK A;  1FGM A;  1T2I A;  2B24 B;  1K8A 4;  1RGH A;  3CCQ 3;  3A76 A;  1T5Y A;  5IG0 A;  1JN5 B;  3EE1 A;  1G02 A;  1BNR A;  2J8X B;  3LH4 A;  4IPB A;  3URP A;  3GWR A;  1B2S A;  2HMN B;  2KXG A;  3DMC A;  3X41 A;  3HX8 A;  3I0Y A;  1OPY A;  2OOV A;  2KCD A;  1MWS A;  3D5I A;  4X2O A;  4JF8 A;  4LGQ A;  2E2V A;  2XFT A;  1Q40 A;  1RGA A;  3F8X A;  4EBG A;  3MSO A;  2RGQ A;  1G0T A;  1TRQ A;  1KSI A;  3E99 A;  1JJ2 2;  1A2V A;  4J8T A;  4WP5 A;  1GY5 A;  3ZG5 A;  2GEX A;  4N6U A;  1N8R 4;  3MG1 A;  3QRD A;  7STD A;  1OHS A;  3KKG A;  5ELU A;  2WOF A;  3GZB A;  1Q42 A;  4N6L A;  4HM3 B;  1UGI A;  1YVS A;  4R80 A;  1B20 A;  3KFQ C;  3F7X A;  3Q90 A;  2RBI A;  3RGA A;  2IYJ A;  2B1X B;  2HMK B;  5CF2 A;  1GY6 A;  2XH9 A;  3PYJ A;  3FH1 A;  3HII A;  1YGE A;  1YJ9 3;  2YFL B;  3K63 A;  3LML A;  1N5P A;  3H3H A;  1OAC A;  1I3I A;  3FLJ A;  2Y73 A;  1BAO A;  1RCL A;  3NBR A;  1LOY A;  1N9E A;  2KF6 A;  5IG4 A;  3CC7 3;  1MWR A;  3HI7 A;  1YVB I;  2CC3 A;  2GEY A;  4Q53 A;  2CFL A;  1LOV A;  1BNI A;  5A0O B;  1O7W B;  1EA2 A;  5AIH A;  3J7Y d;  2YX9 A;  3HK4 A;  4KT3 B;  1KWI A;  2XR8 B;  3S27 A;  1VQN 3;  2CG0 A;  1W02 A;  1O7M B;  3U1W A;  1M1K 4;  2STD A;  4H61 A;  4MMX B;  3RDE A;  4BL2 A;  1RLS A;  4FCM A;  1BU4 A;  3D5G A;  4O8S A;  1QMA A;  3EQQ B;  3G4S 3;  1TP6 A;  1I0X A;  3PS8 A;  3BNC A;  1C7H A;  3FF0 A;  1TUH A;  1IT8 A;  1YHQ 3;  1I2F A;  1RN4 A;  1K9M 4;  3DM8 A;  3CCR 3;  3WR2 A;  3FCS B;  1I70 A;  3BIR A;  4KZ1 A;  1DYU A;  1RRH A;  1B21 A;  1OUN A;  4GHO A;  1FA3 A;  3KII A;  1VQP 3;  1R4C A;  1B2M A;  2BMO B;  2H0G A;  3D79 A;  1MWU A;  5FGO A;  3T0U A;  3CCV 3;  4KVH A;  3GAX A;  3OW2 2;  4BTY A;  1Q7Y 4;  1M1X B;  5CK6 A;  5JBS A;  1RNT A;  2INX A;  4X2H A;  1FYS A;  1TTO A;  1ZO2 A;  1LNI A;  5AII A;  4BTW A;  3LTA A;  4R9L A;  3VGN A;  1FGO A;  4N3V A;  2HML B;  2XRX B;  1HYF A;  4EV2 A;  3NM2 A;  4RZM A;  3GZR A;  3AMO A;  1JB4 A;  5AIF A;  1E97 A;  3LT9 A;  3V99 A;  1IU7 A;  4HKV B;  3B8L A;  1I8V A;  4L8O A;  5JPU A;  2C4B A;  2L4V A;  1O7G B;  3NV0 A;  1C54 A;  3CCL 3;  1SJW A;  1X1W A;  1O7N B;  5M1A A;  2CWV A;  3MWZ A;  1LNH A;  4G1M B;  3X3Y A;  5KP4 A;  2W0Q A;  1IQ8 A;  1AR0 A;  1B2X A;  1IDP A;  4OK0 A;  4WHA A;  1K41 A;  3CMA 3;  3DGL A;  3M8C A;  1LQG C;  4N6V 0;  2SAR A;  3KCH A;  1UUG B;  5AI1 A;  4NRE A;  2QEX 3;  1EG9 B;  2HOH A;  1JNQ A;  3FF2 A;  4GSP A;  1BNE A;  4XDW A;  2CFW A;  3B7C A;  1KD1 4;  1BRI A;  9RNT A;  1HU9 A;  1RHL A;  1N8Q A;  1WMO A;  4XBX A;  1Y4K A;  1QAL A;  3BNE A;  2MC8 A;  1LQM B;  3DH2 A;  1W7C A;  1Z1S A;  3G71 3;  3PCR A;  5HGR A;  1Q40 B;  2FXT A;  4EXR A;  1TRP A;  1MNL A;  4FMC A;  5HOH A;  1PY3 A;  3CNM A;  2XSH B;  3AHS A;  1VQ8 3;  5AYR B;  2W56 B;  4FCJ A;  5IF6 A;  1RKY A;  1K73 4;  3FG1 A;  2OQE A;  2O3O A;  4BIR A;  2Z77 A;  8CHO A;  5DRV A;  5M19 A;  1STF I;  2F4Y A;  4I4K A;  1F8N A;  2HMJ B;  3NBB A;  4R1K A;  4BTX A;  2V1L A;  2BMR B;  3LYG A;  3I56 3;  2YFI B;  4AKY A;  1LVN A;  1IVV A;  1JKG A;  1VQK 3;  3F14 A;  5AIG A;  1Q9E A;  3SOA A;  3FG3 A;  1YJW 3;  2RNT A;  1IV9 A;  1UCJ A;  2F5W A;  4ZM8 A;  1OF5 A;  1UI8 A;  3CCE 3;  1BSD A;  1R4Y A;  3OWS A;  4I5Q A;  1KQS 2;  2IY2 A;  2XGL A;  1A2P A;  2Z76 A;  3LTC A;  4RNT A;  1W5Z A;  2ZDJ A;  4J5K A;  3RGR A;  1NDO B;  3DGY A;  1DMN A;  1RGG A;  1T3B A;  1BGS A;  2XGN A;  3NBJ A;  1GMR A;  3WA2 X;  1NB5 I;  2A15 A;  1U5O A;  2C11 A;  3NM7 A;  1DMQ A;  2ML5 A;  3SLU A;  2IMJ A;  1MGW A;  1OCV A;  1JRQ A;  2XF3 A;  5BIR A;  1W00 A;  3CC4 3;  1M90 4;  1LRA A;  4PEJ A;  2RCD A;  2F5M A;  3LXU X;  3EF8 A;  3WMD A;  4XDV A;  2QIY A;  4N6O B;  1UI7 A;  5EVH A;  2OTL 3;  2W03 A;  1PFP A;  2W56 A;  3MG3 A;  3G6E 3;  1RTU A;  1W6G A;  3IJE B;  4RNZ A;  1CYU A;  3KN4 A;  1EQK A;  1B2U A;  4HJL B;  2KF5 A;  2OQE C;  4MMZ B;  2F56 A;  1YIJ 3;  4K90 B;  1QVF 2;  2AAD A;  1S5A A;  5IEP A;  1MWT A;  3PCS A;  4XBY A;  1SQW A;  1RGK A;  2GSP A;  1T2H A;  4RNY A;  3V92 A;  4O2H A;  5IW9 A;  1DET A;  3EN8 A;  3MPH A;  4XBT A;  5CXO A;  1JZO A;  1CH0 A;  3N8B A;  4HBR A;  3G8Z A;  1RSN A;  2QA4 3;  3DXO A;  3SXX A;  1Q82 4;  1IVX A;  1OHP A;  1I2G A;  1LOX A;  3B4P A;  1VQ4 3;  2PZV A;  3SOY A;  5CLK A;  1A67 A;  5CF1 A;  3JVC A;  4WYK A;  1Q86 4;  1Q81 4;  1W4N A;  1UUW B;  3CC2 3;  1FW7 A;  5AEU B;  2LQV A;  1A2K A;  3OWU A;  1TU5 A;  1IVU A;  1GOY A;  1RN1 A;  1JBS A;  1SAR A;  2F98 A;  4FR9 A;  3KE7 A;  5AEW B;  1NB3 I;  3EX9 A;  3X42 A;  5IG5 A;  2JQ5 A;  2GU1 A;  2CG1 A;  3D4A A;  3WA3 A;  3AGO A;  1BRN L;  4BU4 A;  3CNX A;  4N6N B;  1UW1 A;  2GXF A;  3TDG A;  1IYY A;  4H3U A;  5EEO A;  4IT7 A;  1BSC A;  1NWW A;  2F99 A;  1FGT A;  2XFS A;  3L0R A;  3F8H A;  4KFE A;  1JN5 A;  2O9U X;  3AMO B;  3A5E A;  2CX0 A;  1BUQ A;  1YIT 3;  2CH9 A;  3NHX A;  5IEO A;  3X40 A;  3MKI A;  4HVN A;  2W04 A;  2E2T A;  5KP3 A;  4HM8 B;  2KAA A;  2JDI H;  4XM4 A;  3GRD A;  1PU4 A;  3GSP A;  5GSP A;  3DY5 A;  2D1W A;  1TFK A;  2XSO B;  5M18 A;  1BUJ A;  1OHO A;  3PXM A;  2BHM A;  4L8P A;  1JV2 B;  3NUV A;  4HM4 B;  4K1V A;  2M7O A;  3LZA A;  3DUK A;  3EC9 A;  3FGY A;  2E2U A;  5LC7 A;  1YGW A;  2W6J H;  5BXQ A;  1AQZ A;  4CPK A;  1IK3 A;  4K61 A;  1ULJ B;  3DGN A;  1GMQ A;  1O7H B;  2CWT A;  6RNT A;  5RNT A;  1E3V A;  2KRT A;  1OH0 A;  3F7S A;  4HM2 B;  1ULI B;  2CW9 A;  1YNV X;  2OWP A;  1MOL A;  3Q1C A;  4KFF A;  3CD6 3;  1SIH A;  1DMM A;  1WMP A;  3IPT A;  4R9K A;  5FW5 A;  4CDL A;  2LYX A;  3DGM A;  6STD A;  1S72 3;  1D6U A;  3CPO A;  3NX0 A;  2AAE A;  4HAA A;  1HZ1 A;  1OGX A;  3UL6 A;  3EJV A;  2GBX B;  2RFR A;  1A90 A;  1BNG A;  1N5H A;  3O8Y A;  1W01 A;  4OVM A;  3DZL A;  3K0Z A;  1FUW A;  1CQS A;  1CYV A;  4MJD A;  1K28 A;  4WFO A;  1I3F A;  3UJM A;  2MF7 A;  4DKI A;  3I55 3;  5STD A;  2F86 B;  2HMO B;  1W6C A;  4EYC A;  2P05 A;  5D83 A;  3QK9 A;  1V74 A;  2BT3 A;  1BRK A;  2CWU A;  3MYT A;  1AY7 A;  3B4O A;  1VQO 3;  3S67 A;  1GSP A;  1QAK A;  1ROA A;  1V58 A;  2BU4 A;  1W2Z A;  2GU3 A;  2I9W A;  3Q3F A;  1RGL A;  3H51 A;  1OGZ A;  2UUG C;  1UCL A;  3G16 A;  3UNL A;  1VQ6 3;  1LXE A;  1NO3 A;  3WDG B;  1NJI 4;  4QWT A;  1JBT A;  1GOV A;  1CEW I;  1HKX A;  2Y74 A;  1RNB A;  2ZA4 A;  4HM5 B;  1ROV A;  4FMB A;  4WWU C;  2Q07 A;  1IT7 A;  2CFG A;  3PGB A;  1BSA A;  1ISK A;  1ZX2 A;  1B27 A;  1SPU A;  3NXJ A;  1BRH A;  5IER A;  3CCM 3;  1J2B A;  3K9M C;  3U97 A;  4FMA A;  1ASK A;  4CJN A;  3T8N A;  4EV5 A;  1RGF A;  4LYL B;  3SED A;  3WHO A;  3JUN A;  1GD3 A;  5G2G A;  3PZW A;  5LC6 A;  2P0M A;  2IUK A;  1BVI A;  1OF5 B;  2YFJ B;  1STD A;  3BB9 A;  4HZB B;  4ORL A;  2WOH A;  3CCU 3;  1GD4 A;  4GL6 A;  3KSE D;  1IQX A;  3D3L A;  3ER7 A;  1JKG B;  4LSO A;  2BNG A;  2BMQ B;  3BND A;  3N9H A;  3SX1 A;  1N9J A;  3NQZ A;  1EUI C;  2HMM B;  2IA7 A;  2QGU A;  3DGO A;  3FSD A;  5D81 A;  3CME 3;  1GY7 A;  6GSP A;  1UCI A;  4EW5 A;  4LZI A;  5BU4 A;  3CXC 2;  2IUJ A;  2W2C A;  1IVW A;  3NV0 B;  2OTJ 3;  3F9S A;  3N54 B;  1B2Z A;  3CU3 A;  1WQL B;  1BSE A;  4EC6 A;  1D6Y A;  1L5G B;  3EHC A;  2K3D A;  2XEP A;  4AKZ A;  3S29 A;  1IQY A;  1RMS A;  3JUP A;  1GMP A;  1E3R A;  3Q2P A;  4O3V A;  1BSB A;  2D42 A;  3KZT A;  1G96 A;  3X3Z A;  2P09 A;  5TGN A;  1FUT A;  3FKA A;  2CHC A;  4LEH A;  1UDI I;  3KSP A;  1U8C B;  4OUQ A;  1RRL A;  2SBL A;  2W9Q A;  3FG4 A;  1NU3 A;  2K0M A;  2P38 A;  4HYZ A;  2P0X A;  3JUO A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 1YGW A;  4BIR A;  1AQZ A;  1JBR A;  1BAN A;  2F4Y A;  1BNF A;  1RGA A;  1GMQ A;  4HOH A;  2BIR A;  6RNT A;  1TRQ A;  5RNT A;  1YNV X;  1FUS A;  3AHW A;  1Q9E A;  2RNT A;  1RGE A;  1UCJ A;  2F5W A;  1BRJ A;  1BSD A;  1LOW A;  1R4Y A;  1YVS A;  7RNT A;  1A2P A;  1B20 A;  1BNJ A;  1BRG A;  2AAE A;  2KF4 A;  4HAA A;  1HZ1 A;  2RBI A;  4J5K A;  4RNT A;  3DGY A;  1RGG A;  1BGS A;  1GMR A;  1BNG A;  1RCK A;  1I3I A;  1MGW A;  5BIR A;  1I3F A;  3BU4 A;  1BAO A;  1RCL A;  1LRA A;  1LOY A;  2F5M A;  2KF6 A;  1RDS A;  1MGR A;  1BRK A;  1RGC A;  1LOV A;  1BNI A;  1RTU A;  1AY7 A;  3AGN A;  1B2U A;  1GSP A;  3Q3F A;  2BU4 A;  2KF5 A;  1RGL A;  2F56 A;  1UCL A;  2AAD A;  1RLS A;  1I0V A;  1BU4 A;  1PYL A;  3D5G A;  4J5G A;  1JBT A;  1RGK A;  2GSP A;  1I0X A;  1T2H A;  1GOV A;  1B3S A;  1ZGX A;  1RNB A;  1DET A;  1I2F A;  1RN4 A;  2ZA4 A;  1X1X A;  1CH0 A;  3WR2 A;  1I70 A;  3BIR A;  1RSN A;  1BSA A;  1B21 A;  3SYU A;  1B27 A;  1I2G A;  4GHO A;  1BRH A;  1B2M A;  1DE3 A;  1RGF A;  3WHO A;  1FZU A;  1RNT A;  1BVI A;  1FW7 A;  1FYS A;  1TTO A;  1LNI A;  1BRS A;  1GOY A;  1BIR A;  1RN1 A;  1BOX A;  1JBS A;  1SAR A;  2KF3 A;  1HYF A;  1X1U A;  3D4A A;  1BNS A;  1I8V A;  3AGO A;  1BRN L;  2C4B A;  8RNT A;  1UCK A;  1C54 A;  4BU4 A;  1X1W A;  6GSP A;  1GOU A;  1UCI A;  1IYY A;  5BU4 A;  3HOH A;  1BSC A;  1B2X A;  1X1Y A;  3A5E A;  1B2Z A;  2SAR A;  3KCH A;  1BSE A;  1I2E A;  3RNT A;  4GSP A;  2HOH A;  1T2I A;  1BNE A;  1RMS A;  1GMP A;  1RGH A;  1BRI A;  9RNT A;  1RHL A;  1BSB A;  2KAA A;  1FUT A;  1G02 A;  3DH2 A;  3GSP A;  5GSP A;  3URP A;  1BNR A;  1B2S A;  1BUJ A;  1TRP A;  5HOH A;  1PY3 A;  3AHS A;  7GSP A;  3D5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...