1T2IA

T76w mutant of rnase sa from streptomyces aureofaciens
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEAWQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of single tryptophan residues to the fluorescence and stability of ribonuclease sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
total genus 25
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1t2iA00
1BSEA 1B2ZA 1JBTA 1GMQA 3D5GA 1LRAA 1TTOA 3BIRA 1RLSA 1LOYA 1UCIA 1RCLA 1BNEA 1RN4A 1B2UA 1RGHA 1DE3A 1UCKA 7GSPA 1RMSA 5HOHA 2KF5A 1BSBA 3URPA 1UCJA 1B21A 2BU4A 3AGOA 1BNFA 1BSCA 1UCLA 3SYUA 1LOVA 1RSNA 2ZA4A 4HOHA 1G02A 1LOWA 5BU4A 1BAOA 6RNTA 2AAEA 1IYYA 1FZUA 1GOVA 1BIRA 3WHOA 1PYLA 9RNTA 1T2IA 1BRNL 1HZ1A 1RGEA 1AQZA 5RNTA 4RNTA 1MGRA 4GSPA 3D4AA 1BOXA 1RGGA 1AY7A 1RNTA 1X1UA 1B3SA 1YGWA 6GSPA 1B2MA 1BRJA 1I2EA 2F5MA 1BSDA 1GOUA 1TRQA 1GMRA 3BU4A 3GSPA 1BUJA 1GSPA 1JBSA 1BRKA 2KAAA 3AHSA 1RNBA 1C54A 1RGAA 1RGCA 3DGYA 1GMPA 1I3FA 1RGFA 1RCKA 1PY3A 1RN1A 2AADA 4BU4A 3AGNA 4J5GA 4BIRA 2SARA 1RDSA 1RGKA 1BNJA 1FUTA 3WR2A 1I2GA 3RNTA 3AHWA 1BNGA 1BVIA 1R4YA 2RBIA 1BRSA 1RHLA 2F4YA 1B27A 1FW7A 1FUSA 7RNTA 1X1YA 3D5IA 1BANA 2C4BA 1BRHA 1CH0A 1GOYA 1TRPA 2KF3A 2KF6A 2GSPA 1ZGXA 1X1XA 1HYFA 2BIRA 2KF4A 1BRGA 8RNTA 1JBRA 3Q3FA 1YNVX 3KCHA 1T2HA 3DH2A 1BNIA 1SARA 1X1WA 1RTUA 2F5WA 2RNTA 1I0XA 1I2FA 4J5KA 1DETA 1YVSA 1BNRA 1RGLA 1B2SA 1I0VA 1MGWA 1I3IA 1B2XA 3HOHA 1BGSA 1BRIA 1B20A 1I8VA 5GSPA 1A2PA 2HOHA 3A5EA 1FYSA 1BSAA 1BU4A 4HAAA 2F56A 4GHOA 1I70A 1BNSA 5BIRA 1LNIA 1Q9EA
chains in the Genus database with same CATH superfamily
1MWTA 3X40A 1OPYA 1UW1A 1ASKA 2HMLB 3OX9A 3S27A 1GMQA 3CNXA 1VQM3 4ORLA 2W2CA 4CDLA 1LOYA 3Q2PA 3WOFB 1UGHI 4NHFA 1FGOA 1W01A 4FCMA 4X2HA 1B2UA 3MHEA 5KP1A 1DE3A 4N6UA 3T0UA 1UCKA 3S5CA 3F9SA 1CYUA 2O9UX 4HZBB 1UCJA 4NPBA 1B21A 2BU4A 1BNFA 1UCLA 6RNTA 1LOVA 4N6V0 1IT8A 1EA2A 1LOWA 5BU4A 3JUMA 2KCDA 1IYYA 3GAXA 4BL2A 4KZ1A 1PYLA 2IMJA 1T2IA 3LXUX 3U1WA 2P05A 1AR0A 3GRDA 4XM4A 2HMKB 1UUWB 4LMIA 5CLKA 5IEOA 2XR8B 3FZWA 5G1LA 3J7Yd 2LYXA 3L0RA 2XGNA 4GSPA 3FKAA 1RGGA 1AY7A 1CQSA 3OXAA 5EQLA 1VQP3 1YGWA 2YFLB 1SQWA 2UUGC 3NM7A 3UL6A 3F40A 1HKXA 3CPW2 3CCS3 3LZAA 2BNGA 2W9QA 4DKIA 3I0YA 1J2BA 3V92A 2IUKA 1G0TA 1GOUA 3ALAA 2QEX3 4TX4A 2OQEC 3LTAA 5DRVA 4R9LA 3LH4A 4O8SA 4LGQA 3N54B 4EV2A 1BRKA 4IIAA 3F8HA 3JUOA 5IERA 1RNBA 4K90B 3UL5A 1RGAA 4EYCA 2BHMA 4RBNA 1I3FA 4WYKA 2OTL3 1PY3A 4J8TA 2AADA 2IUJA 2STDA 3IJEB 2LQVA 4AKYA 3AGNA 3MG3A 4J5GA 4EBGA 1RDSA 4FR9A 4EXRA 1VQN3 3WR2A 1JZOA 4EV5A 2WOHA 5BVBA 1K734 4XBXA 3NXJA 3EF8A 3HZPA 1N9EA 1BVIA 2RBIA 3OWYA 1S5AA 3MYTA 1VZZA 1FW7A 3ZFZA 3G713 3NUVA 2V1LA 3SXXA 2GU3A 3FF0A 2C4BA 3HX8A 3K9MC 1YGEA 3V98A 2OOVC 4N6TA 4R4KA 1K41A 2CWUA 1CYVA 4HM2B 5HGRA 2CW9A 2QGUA 4L7KA 2QIYA 1OUNA 4WYKB 5LC6A 8RNTA 1YNVX 2OCTA 2MF7A 2GEYA 3NBRA 1Q824 4LZIA 1JNQA 3PCRA 3DH2A 1RTUA 5FW5A 2RNTA 2KRTA 2CFKA 3BLZA 1FGQA 2JQ5A 1YVSA 2OTJ3 3NHXA 1YJ93 1BNRA 1RGLA 2C11A 4XDVA 3H3HA 3QK9A 3G16A 3PZWA 3O8YA 4FMAA 3TDGA 3X41A 4J9AA 3GZBA 4L8OA 1I8VA 1N9JA 1Z1SA 1YIT3 1MWSA 3Q90A 1EEJA 1STDA 2R41A 4JRFA 1WNHA 2F56A 1GY5A 2H0GA 2P0MA 3F7SA 1I70A 2F98A 1EG9B 4FCJA 3LTCA 5BIRA 3SEDA 2YFIB 2CWTA 1IVXA 1OACA 3BNEA 1B2ZA 3GZRA 3NV0A 3UB1A 1LRAA 1FUWA 1RLSA 2Z77A 1UCIA 2A15A 1RCLA 1RN4A 3WA2X 2CG0A 4OVMA 5IW9A 3DM8A 1KWIA 1RGHA 1VQK3 1OHOA 1ROAA 1RMSA 5BXQA 3EN8A 4MMZB 1RN7A 1BSBA 1GD3A 3D9RA 4HM8B 4I5QA 1KQS2 3SYUA 3DGNA 1BSCA 3EC9A 2RSXA 1K28A 2OOVA 3LT8A 4CCVA 1NDOB 1SIIA 1FZUA 2AAEA 1LQMB 2F99A 4AKZA 1GOVA 1JB2A 4MMYB 9RNTA 3DXOA 3CCQ3 2CX0A 1TU5A 1FGTA 1BRNL 3S67A 5AIFA 1RGEA 1AQZA 1T5YA 1UI7A 2XSHB 3G8ZA 3JUNA 2GU1A 5CF1A 5RNTA 5G2GA 1MGRA 3FG3A 1VQO3 1T3BA 4CJNA 3EB8A 4XBTA 3FF2A 3K7CA 2CFGA 1OHPA 1QJGA 3MKIA 5TGNA 3AMOA 1GMRA 2BO9B 3BU4A 1VQQA 1HU9A 2WO0A 3FSDA 2BMRB 1FGMA 3LT9A 1GSPA 1AVLA 1Y4KA 3PGBA 4ILFA 5AIIA 1M9GA 1Q40A 2B1XB 3AHSA 2ML6A 1GYBA 2I9WA 3HI7A 3MG2A 4GL6A 4HM0B 3CME3 1IQYA 2IYJA 4K1VA 1N8QA 2BMOB 2JDIH 1IT7A 1DMQA 1SPUA 1A2KA 3K5TA 3ROBA 3B8LA 4BU4A 2L1SA 5AIHA 5M18A 3HK4A 3DY5A 3A76A 3AMOB 3SVAA 1E3VA 2P09A 1TJDA 4HZ9B 5AYRB 7STDA 2GBWB 4KFFA 3UNLA 4IT7A 2CG1A 3CC43 2W04A 1L5GB 2C10A 1DYUA 2CFDA 4CPKA 1R4YA 1BRSA 2F4YA 2CFWA 2K54A 1C7HA 4HM7B 2HMJB 4O3VA 1FUSA 3PCSA 7RNTA 1X1YA 2PNCA 2IY2A 2FGTA 3D5IA 2M7OA 4HM3B 4PEJA 1CH0A 1N8R4 1GOYA 2KF3A 2HMMB 3CXC2 1TFOA 2XFTA 4EC6A 1HYFA 3NM2A 5D83A 3EJVA 3VF1A 4BTYA 1A67A 3LYGA 3BNDA 4HBRA 1W6YA 4K61A 4RNYA 1CEWI 3JUPA 5IEPA 1JBRA 1SIHA 2Q07A 5A0OB 4QWTA 2W9PA 3KCHA 1TUHA 1JKGB 2Z7AA 1MOLA 2F86B 1SJWA 1BNIA 3VSYA 4FMCA 2F5WA 1I0XA 1I2FA 2FNQA 2ZDJA 1DETA 1UGIA 4NREA 1E3RA 1JB5A 1VQ93 1B2XA 2UGIA 1UDII 1Q42A 4FMBA 3PXMA 5CF2A 4MJDA 1A2PA 3G0KA 3I563 3KSPA 1G96A 3S28A 3CCL3 1VQ63 2Y74A 1IQ8A 4KFDA 5FGOA 1OHSA 3CC73 3NQYA 3WA3A 1W2ZA 1US1A 2PZVA 2H0IA 3PS8A 2INXA 1JJ22 2O3OA 4AEQA 1QAKA 1BSEA 2BT3A 1F8NA 1JBTA 3D3LA 3K0ZA 1TTOA 1U8CB 3BIRA 4KFEA 5IG4A 1ULJB 3OV4A 1K9M4 1IU7A 3B4OA 3S29A 1YVBI 4RZMA 4X2OA 3B7CA 7GSPA 2MC8A 5HOHA 2KF5A 1M1XB 2OQEA 3E99A 2J8XB 2D42A 1W6GA 4XBYA 2WOFA 4HOHA 4MMXB 4HM5B 1NWWA 2Y73A 1BAOA 2XFSA 2CC3A 3U97A 3HIIA 2UX0A 1KC84 1YHQ3 1BIRA 2GEXA 5KP3A 3WHOA 1W5ZA 4I4KA 3SOYA 1K8A4 2ZL8A 1KSIA 2W56A 4HVNA 1BUQA 3KSED 3WMDA 1HZ1A 3DMCA 3MPHA 5AYSC 1E97A 4RNTA 5LC7A 1O7HB 1BOXA 1X1UA 3Q1CA 3T8NA 1QVF2 3WDGB 2FXTA 2F5MA 3M8CA 4HJLB 5M1AA 1BSDA 4LEHA 1TRQA 3G4S3 3NV0B 1O7GB 3F8XA 2HMOB 3GSPA 1BUJA 1JN5A 2K0MA 1TP6A 3RGRA 3FGYA 1NJI4 4KT3B 1JBSA 2KAAA 3CCV3 1NNVA 2XSOB 3DUKA 4MEIA 3MWZA 3OWSA 3OWUA 5AI1A 3SLUA 3KN4A 3OW22 1NB5I 1RGCA 2BMQB 1GMPA 1N5HA 3CNMA 3DGYA 1RCKA 1RN1A 2CX1A 4IPBA 5G1KA 5STDA 2IA7A 1DMNA 4BIRA 1NO3A 3SX1A 4N6MA 1RGKA 1UUVB 1BNJA 1FUTA 2Z76A 1V74A 3DZLA 1LVNA 2CWVA 5D82A 1ZO2A 3CD63 1UUGB 1I2GA 3FG4A 3BB9A 1W02A 2CK3H 3ER7A 3AHWA 3SOAA 3CCE3 1BNGA 1JZDA 1IVWA 4HM1B 1B27A 3IMAB 1V57A 3I553 3EN1B 3LTBA 1EKMA 1BANA 4KVHA 1M1K4 1Q814 1BRHA 1GY6A 1OH0A 2CKFB 1TRPA 4WWUC 2KF6A 2GSPA 1ZGXA 3GZXB 1X1XA 1DMMA 2YFJB 3NBBA 2BIRA 1WQLB 3GZYB 3UJMA 2RGQA 3EQQB 4N6LA 1BRGA 1UI8A 1EQKA 3Q3FA 2XH9A 3K63A 1EUIC 3B4PA 5KP4A 3ZG5A 3BNCA 4O2HA 4LYLB 1IVVA 1IK3A 1DVCA 3X3XA 2ZHXB 3WOEB 3KIIA 4H3UA 4L8PA 1MGWA 1GY7A 1I3IA 1OGZA 1VQ73 2OWPA 3KFQC 1OCVA 1BGSA 1D6YA 4FCZA 3X3YA 1Q864 2W6JH 1D6ZA 1B20A 1MWUA 2P38A 3ECFA 3QRDA 5GSPA 4ZM8A 5AEUB 1DVDA 3A5EA 4N3VA 1LOXA 4LSOA 3WODG 1JKGA 1O7MB 3DGMA 5IG0A 1PFPA 3BNBA 2L4VA 3NBJA 3STDA 4BTXA 4GHOA 3FCSB 4FMDA 1GD4A 1A2VA 1LNIA 3VGNA 3KKGA 1MWRA 3CCR3 5JBSA 3RDEA 5IG5A 3D5GA 4XB5A 1JN5B 1Q7HA 1ROVA 1BNEA 1FA3A 2P0XA 1W7CA 5DREA 2WGQA 2CHCA 2E2TA 3NQZA 1Q40B 4WHAA 1A90A 3URPA 1PU4A 3MSOA 3EE1A 3AGOA 5ELUA 3JUQA 2ZA4A 1RSNA 1G02A 3CU3A 4N6NB 3T8UA 4XDWA 3JVCA 2XRXB 5CK6A 1VQ43 3HIGA 1RRLA 1ISKA 1U5OA 4O02B 3CPOA 3EBTA 1VQL3 1MNLA 1QALA 1OGXA 1AVKA 1TFKA 3N8BA 1IV7A 4HM6B 1WMPA 3D4AA 1RNTA 1FGRA 3X42A 3GWRA 5IG3A 1GS3A 1B3SA 6GSPA 1VQ83 5EEOA 3CCM3 1B2MA 1BRJA 1O7PB 4HYZA 3KE7A 4HM4B 3N9HA 4K1UA 4R9KA 1I2EA 1AV4A 1IV9A 2E2UA 4OUQA 1R4CA 3H51A 1W2B2 1S723 3RGAA 2K3DA 4HKVB 2R4IA 1W00A 2YX9A 3EX9A 2W56B 1IQXA 1JRQA 4R1KA 3LOYA 2W0QA 1LQGC 1C54A 3FG1A 1D6UA 1V58A 2ML5A 5JPUA 1O7NB 4Q53A 3EHCA 1WMOA 2WGOA 1QMAA 1QVG2 1RGFA 2Z6BA 3ZG0A 5ELJA 1ZS7A 1VQ53 1YI23 3V99A 3FH1A 1RRHA 2SARA 3D79A 4H61A 4WFOA 2XF3A 3LTDA 1ULIB 2HMNB 4U13A 2XEPA 3RNTA 2D1WA 3LMLA 1NU3A 1OF5B 3MG1A 5IF6A 4BL3A 3EBYA 1RHLA 2B24B 1LXEA 5JPPA 2KXGA 4JF8A 3IPTA 5EVHA 2RFRA 5AEWB 2CFLA 3X3ZA 1RJOA 1IVUA 1ZX2A 4R80A 1Q7Y4 4RNZA 1IDPA 3F14A 3NX0A 4GB5A 3FLJA 3CCJ3 1WMNA 1LNHA 1QAFA 2KF4A 5CXOA 1W4NA 5AIGA 4EW5A 5IENA 4N6OB 1W6CA 3CC23 2RCDA 2QA43 1O7WB 3G6E3 1T2HA 5M19A 2E2VA 3KZTA 1SARA 1OF5A 1X1WA 4STDA 1KD14 4J5KA 2SBLA 2XGLA 3PYJA 3DGLA 4WP5A 3CMA3 1B2SA 1I0VA 1JV2B 1YJN3 6STDA 1WTHA 3HOHA 1NB3I 1YJW3 2GXFA 1BRIA 1TIJA 2HOHA 2H0HA 1FYSA 1RKYA 1BSAA 3CCU3 3DGOA 4BTWA 1BU4A 1YIJ3 4HAAA 1STFI 2GBXB 3F7XA 4G1MB 8CHOA 5D81A 1M904 1BNSA 2CH9A 5I97A 2CIUA 2W03A 1JB4A 1N5PA 1Q9EA 4OK0A
chains in the Genus database with same CATH topology
1BSEA 1B2ZA 1JBTA 1GMQA 3D5GA 1LRAA 1TTOA 3BIRA 1RLSA 1LOYA 1UCIA 1RCLA 1BNEA 1RN4A 1B2UA 1RGHA 1DE3A 1UCKA 7GSPA 1RMSA 5HOHA 2KF5A 1BSBA 3URPA 1UCJA 1B21A 2BU4A 3AGOA 1BNFA 1BSCA 1UCLA 3SYUA 1LOVA 1RSNA 2ZA4A 4HOHA 1G02A 1LOWA 5BU4A 1BAOA 6RNTA 2AAEA 1IYYA 1FZUA 1GOVA 1BIRA 3WHOA 1PYLA 9RNTA 1T2IA 1BRNL 1HZ1A 1RGEA 1AQZA 5RNTA 4RNTA 1MGRA 4GSPA 3D4AA 1BOXA 1RGGA 1AY7A 1RNTA 1X1UA 1B3SA 1YGWA 6GSPA 1B2MA 1BRJA 1I2EA 2F5MA 1BSDA 1GOUA 1TRQA 1GMRA 3BU4A 3GSPA 1BUJA 1GSPA 1JBSA 1BRKA 2KAAA 3AHSA 1RNBA 1C54A 1RGAA 1RGCA 3DGYA 1GMPA 1I3FA 1RGFA 1RCKA 1PY3A 1RN1A 2AADA 4BU4A 3AGNA 4J5GA 4BIRA 2SARA 1RDSA 1RGKA 1BNJA 1FUTA 3WR2A 1I2GA 3RNTA 3AHWA 1BNGA 1BVIA 1R4YA 2RBIA 1BRSA 1RHLA 2F4YA 1B27A 1FW7A 1FUSA 7RNTA 1X1YA 3D5IA 1BANA 2C4BA 1BRHA 1CH0A 1GOYA 1TRPA 2KF3A 2KF6A 2GSPA 1ZGXA 1X1XA 1HYFA 2BIRA 2KF4A 1BRGA 8RNTA 1JBRA 3Q3FA 1YNVX 3KCHA 1T2HA 3DH2A 1BNIA 1SARA 1X1WA 1RTUA 2F5WA 2RNTA 1I0XA 1I2FA 4J5KA 1DETA 1YVSA 1BNRA 1RGLA 1B2SA 1I0VA 1MGWA 1I3IA 1B2XA 3HOHA 1BGSA 1BRIA 1B20A 1I8VA 5GSPA 1A2PA 2HOHA 3A5EA 1FYSA 1BSAA 1BU4A 4HAAA 2F56A 4GHOA 1I70A 1BNSA 5BIRA 1LNIA 1Q9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSE A;  1B2Z A;  1JBT A;  1GMQ A;  3D5G A;  1LRA A;  1TTO A;  3BIR A;  1RLS A;  1LOY A;  1UCI A;  1RCL A;  1BNE A;  1RN4 A;  1B2U A;  1RGH A;  1DE3 A;  1UCK A;  7GSP A;  1RMS A;  5HOH A;  2KF5 A;  1BSB A;  3URP A;  1UCJ A;  1B21 A;  2BU4 A;  3AGO A;  1BNF A;  1BSC A;  1UCL A;  3SYU A;  1LOV A;  1RSN A;  2ZA4 A;  4HOH A;  1G02 A;  1LOW A;  5BU4 A;  1BAO A;  6RNT A;  2AAE A;  1IYY A;  1FZU A;  1GOV A;  1BIR A;  3WHO A;  1PYL A;  9RNT A;  1T2I A;  1BRN L;  1HZ1 A;  1RGE A;  1AQZ A;  5RNT A;  4RNT A;  1MGR A;  4GSP A;  3D4A A;  1BOX A;  1RGG A;  1AY7 A;  1RNT A;  1X1U A;  1B3S A;  1YGW A;  6GSP A;  1B2M A;  1BRJ A;  1I2E A;  2F5M A;  1BSD A;  1GOU A;  1TRQ A;  1GMR A;  3BU4 A;  3GSP A;  1BUJ A;  1GSP A;  1JBS A;  1BRK A;  2KAA A;  3AHS A;  1RNB A;  1C54 A;  1RGA A;  1RGC A;  3DGY A;  1GMP A;  1I3F A;  1RGF A;  1RCK A;  1PY3 A;  1RN1 A;  2AAD A;  4BU4 A;  3AGN A;  4J5G A;  4BIR A;  2SAR A;  1RDS A;  1RGK A;  1BNJ A;  1FUT A;  3WR2 A;  1I2G A;  3RNT A;  3AHW A;  1BNG A;  1BVI A;  1R4Y A;  2RBI A;  1BRS A;  1RHL A;  2F4Y A;  1B27 A;  1FW7 A;  1FUS A;  7RNT A;  1X1Y A;  3D5I A;  1BAN A;  2C4B A;  1BRH A;  1CH0 A;  1GOY A;  1TRP A;  2KF3 A;  2KF6 A;  2GSP A;  1ZGX A;  1X1X A;  1HYF A;  2BIR A;  2KF4 A;  1BRG A;  8RNT A;  1JBR A;  3Q3F A;  1YNV X;  3KCH A;  1T2H A;  3DH2 A;  1BNI A;  1SAR A;  1X1W A;  1RTU A;  2F5W A;  2RNT A;  1I0X A;  1I2F A;  4J5K A;  1DET A;  1YVS A;  1BNR A;  1RGL A;  1B2S A;  1I0V A;  1MGW A;  1I3I A;  1B2X A;  3HOH A;  1BGS A;  1BRI A;  1B20 A;  1I8V A;  5GSP A;  1A2P A;  2HOH A;  3A5E A;  1FYS A;  1BSA A;  1BU4 A;  4HAA A;  2F56 A;  4GHO A;  1I70 A;  1BNS A;  5BIR A;  1LNI A;  1Q9E A; 
#chains in the Genus database with same CATH topology
 1MWT A;  3X40 A;  1OPY A;  1UW1 A;  1ASK A;  2HML B;  3OX9 A;  3S27 A;  1GMQ A;  3CNX A;  1VQM 3;  4ORL A;  2W2C A;  4CDL A;  1LOY A;  3Q2P A;  3WOF B;  1UGH I;  4NHF A;  1FGO A;  1W01 A;  4FCM A;  4X2H A;  1B2U A;  3MHE A;  5KP1 A;  1DE3 A;  4N6U A;  3T0U A;  1UCK A;  3S5C A;  3F9S A;  1CYU A;  2O9U X;  4HZB B;  1UCJ A;  4NPB A;  1B21 A;  2BU4 A;  1BNF A;  1UCL A;  6RNT A;  1LOV A;  4N6V 0;  1IT8 A;  1EA2 A;  1LOW A;  5BU4 A;  3JUM A;  2KCD A;  1IYY A;  3GAX A;  4BL2 A;  4KZ1 A;  1PYL A;  2IMJ A;  1T2I A;  3LXU X;  3U1W A;  2P05 A;  1AR0 A;  3GRD A;  4XM4 A;  2HMK B;  1UUW B;  4LMI A;  5CLK A;  5IEO A;  2XR8 B;  3FZW A;  5G1L A;  3J7Y d;  2LYX A;  3L0R A;  2XGN A;  4GSP A;  3FKA A;  1RGG A;  1AY7 A;  1CQS A;  3OXA A;  5EQL A;  1VQP 3;  1YGW A;  2YFL B;  1SQW A;  2UUG C;  3NM7 A;  3UL6 A;  3F40 A;  1HKX A;  3CPW 2;  3CCS 3;  3LZA A;  2BNG A;  2W9Q A;  4DKI A;  3I0Y A;  1J2B A;  3V92 A;  2IUK A;  1G0T A;  1GOU A;  3ALA A;  2QEX 3;  4TX4 A;  2OQE C;  3LTA A;  5DRV A;  4R9L A;  3LH4 A;  4O8S A;  4LGQ A;  3N54 B;  4EV2 A;  1BRK A;  4IIA A;  3F8H A;  3JUO A;  5IER A;  1RNB A;  4K90 B;  3UL5 A;  1RGA A;  4EYC A;  2BHM A;  4RBN A;  1I3F A;  4WYK A;  2OTL 3;  1PY3 A;  4J8T A;  2AAD A;  2IUJ A;  2STD A;  3IJE B;  2LQV A;  4AKY A;  3AGN A;  3MG3 A;  4J5G A;  4EBG A;  1RDS A;  4FR9 A;  4EXR A;  1VQN 3;  3WR2 A;  1JZO A;  4EV5 A;  2WOH A;  5BVB A;  1K73 4;  4XBX A;  3NXJ A;  3EF8 A;  3HZP A;  1N9E A;  1BVI A;  2RBI A;  3OWY A;  1S5A A;  3MYT A;  1VZZ A;  1FW7 A;  3ZFZ A;  3G71 3;  3NUV A;  2V1L A;  3SXX A;  2GU3 A;  3FF0 A;  2C4B A;  3HX8 A;  3K9M C;  1YGE A;  3V98 A;  2OOV C;  4N6T A;  4R4K A;  1K41 A;  2CWU A;  1CYV A;  4HM2 B;  5HGR A;  2CW9 A;  2QGU A;  4L7K A;  2QIY A;  1OUN A;  4WYK B;  5LC6 A;  8RNT A;  1YNV X;  2OCT A;  2MF7 A;  2GEY A;  3NBR A;  1Q82 4;  4LZI A;  1JNQ A;  3PCR A;  3DH2 A;  1RTU A;  5FW5 A;  2RNT A;  2KRT A;  2CFK A;  3BLZ A;  1FGQ A;  2JQ5 A;  1YVS A;  2OTJ 3;  3NHX A;  1YJ9 3;  1BNR A;  1RGL A;  2C11 A;  4XDV A;  3H3H A;  3QK9 A;  3G16 A;  3PZW A;  3O8Y A;  4FMA A;  3TDG A;  3X41 A;  4J9A A;  3GZB A;  4L8O A;  1I8V A;  1N9J A;  1Z1S A;  1YIT 3;  1MWS A;  3Q90 A;  1EEJ A;  1STD A;  2R41 A;  4JRF A;  1WNH A;  2F56 A;  1GY5 A;  2H0G A;  2P0M A;  3F7S A;  1I70 A;  2F98 A;  1EG9 B;  4FCJ A;  3LTC A;  5BIR A;  3SED A;  2YFI B;  2CWT A;  1IVX A;  1OAC A;  3BNE A;  1B2Z A;  3GZR A;  3NV0 A;  3UB1 A;  1LRA A;  1FUW A;  1RLS A;  2Z77 A;  1UCI A;  2A15 A;  1RCL A;  1RN4 A;  3WA2 X;  2CG0 A;  4OVM A;  5IW9 A;  3DM8 A;  1KWI A;  1RGH A;  1VQK 3;  1OHO A;  1ROA A;  1RMS A;  5BXQ A;  3EN8 A;  4MMZ B;  1RN7 A;  1BSB A;  1GD3 A;  3D9R A;  4HM8 B;  4I5Q A;  1KQS 2;  3SYU A;  3DGN A;  1BSC A;  3EC9 A;  2RSX A;  1K28 A;  2OOV A;  3LT8 A;  4CCV A;  1NDO B;  1SII A;  1FZU A;  2AAE A;  1LQM B;  2F99 A;  4AKZ A;  1GOV A;  1JB2 A;  4MMY B;  9RNT A;  3DXO A;  3CCQ 3;  2CX0 A;  1TU5 A;  1FGT A;  1BRN L;  3S67 A;  5AIF A;  1RGE A;  1AQZ A;  1T5Y A;  1UI7 A;  2XSH B;  3G8Z A;  3JUN A;  2GU1 A;  5CF1 A;  5RNT A;  5G2G A;  1MGR A;  3FG3 A;  1VQO 3;  1T3B A;  4CJN A;  3EB8 A;  4XBT A;  3FF2 A;  3K7C A;  2CFG A;  1OHP A;  1QJG A;  3MKI A;  5TGN A;  3AMO A;  1GMR A;  2BO9 B;  3BU4 A;  1VQQ A;  1HU9 A;  2WO0 A;  3FSD A;  2BMR B;  1FGM A;  3LT9 A;  1GSP A;  1AVL A;  1Y4K A;  3PGB A;  4ILF A;  5AII A;  1M9G A;  1Q40 A;  2B1X B;  3AHS A;  2ML6 A;  1GYB A;  2I9W A;  3HI7 A;  3MG2 A;  4GL6 A;  4HM0 B;  3CME 3;  1IQY A;  2IYJ A;  4K1V A;  1N8Q A;  2BMO B;  2JDI H;  1IT7 A;  1DMQ A;  1SPU A;  1A2K A;  3K5T A;  3ROB A;  3B8L A;  4BU4 A;  2L1S A;  5AIH A;  5M18 A;  3HK4 A;  3DY5 A;  3A76 A;  3AMO B;  3SVA A;  1E3V A;  2P09 A;  1TJD A;  4HZ9 B;  5AYR B;  7STD A;  2GBW B;  4KFF A;  3UNL A;  4IT7 A;  2CG1 A;  3CC4 3;  2W04 A;  1L5G B;  2C10 A;  1DYU A;  2CFD A;  4CPK A;  1R4Y A;  1BRS A;  2F4Y A;  2CFW A;  2K54 A;  1C7H A;  4HM7 B;  2HMJ B;  4O3V A;  1FUS A;  3PCS A;  7RNT A;  1X1Y A;  2PNC A;  2IY2 A;  2FGT A;  3D5I A;  2M7O A;  4HM3 B;  4PEJ A;  1CH0 A;  1N8R 4;  1GOY A;  2KF3 A;  2HMM B;  3CXC 2;  1TFO A;  2XFT A;  4EC6 A;  1HYF A;  3NM2 A;  5D83 A;  3EJV A;  3VF1 A;  4BTY A;  1A67 A;  3LYG A;  3BND A;  4HBR A;  1W6Y A;  4K61 A;  4RNY A;  1CEW I;  3JUP A;  5IEP A;  1JBR A;  1SIH A;  2Q07 A;  5A0O B;  4QWT A;  2W9P A;  3KCH A;  1TUH A;  1JKG B;  2Z7A A;  1MOL A;  2F86 B;  1SJW A;  1BNI A;  3VSY A;  4FMC A;  2F5W A;  1I0X A;  1I2F A;  2FNQ A;  2ZDJ A;  1DET A;  1UGI A;  4NRE A;  1E3R A;  1JB5 A;  1VQ9 3;  1B2X A;  2UGI A;  1UDI I;  1Q42 A;  4FMB A;  3PXM A;  5CF2 A;  4MJD A;  1A2P A;  3G0K A;  3I56 3;  3KSP A;  1G96 A;  3S28 A;  3CCL 3;  1VQ6 3;  2Y74 A;  1IQ8 A;  4KFD A;  5FGO A;  1OHS A;  3CC7 3;  3NQY A;  3WA3 A;  1W2Z A;  1US1 A;  2PZV A;  2H0I A;  3PS8 A;  2INX A;  1JJ2 2;  2O3O A;  4AEQ A;  1QAK A;  1BSE A;  2BT3 A;  1F8N A;  1JBT A;  3D3L A;  3K0Z A;  1TTO A;  1U8C B;  3BIR A;  4KFE A;  5IG4 A;  1ULJ B;  3OV4 A;  1K9M 4;  1IU7 A;  3B4O A;  3S29 A;  1YVB I;  4RZM A;  4X2O A;  3B7C A;  7GSP A;  2MC8 A;  5HOH A;  2KF5 A;  1M1X B;  2OQE A;  3E99 A;  2J8X B;  2D42 A;  1W6G A;  4XBY A;  2WOF A;  4HOH A;  4MMX B;  4HM5 B;  1NWW A;  2Y73 A;  1BAO A;  2XFS A;  2CC3 A;  3U97 A;  3HII A;  2UX0 A;  1KC8 4;  1YHQ 3;  1BIR A;  2GEX A;  5KP3 A;  3WHO A;  1W5Z A;  4I4K A;  3SOY A;  1K8A 4;  2ZL8 A;  1KSI A;  2W56 A;  4HVN A;  1BUQ A;  3KSE D;  3WMD A;  1HZ1 A;  3DMC A;  3MPH A;  5AYS C;  1E97 A;  4RNT A;  5LC7 A;  1O7H B;  1BOX A;  1X1U A;  3Q1C A;  3T8N A;  1QVF 2;  3WDG B;  2FXT A;  2F5M A;  3M8C A;  4HJL B;  5M1A A;  1BSD A;  4LEH A;  1TRQ A;  3G4S 3;  3NV0 B;  1O7G B;  3F8X A;  2HMO B;  3GSP A;  1BUJ A;  1JN5 A;  2K0M A;  1TP6 A;  3RGR A;  3FGY A;  1NJI 4;  4KT3 B;  1JBS A;  2KAA A;  3CCV 3;  1NNV A;  2XSO B;  3DUK A;  4MEI A;  3MWZ A;  3OWS A;  3OWU A;  5AI1 A;  3SLU A;  3KN4 A;  3OW2 2;  1NB5 I;  1RGC A;  2BMQ B;  1GMP A;  1N5H A;  3CNM A;  3DGY A;  1RCK A;  1RN1 A;  2CX1 A;  4IPB A;  5G1K A;  5STD A;  2IA7 A;  1DMN A;  4BIR A;  1NO3 A;  3SX1 A;  4N6M A;  1RGK A;  1UUV B;  1BNJ A;  1FUT A;  2Z76 A;  1V74 A;  3DZL A;  1LVN A;  2CWV A;  5D82 A;  1ZO2 A;  3CD6 3;  1UUG B;  1I2G A;  3FG4 A;  3BB9 A;  1W02 A;  2CK3 H;  3ER7 A;  3AHW A;  3SOA A;  3CCE 3;  1BNG A;  1JZD A;  1IVW A;  4HM1 B;  1B27 A;  3IMA B;  1V57 A;  3I55 3;  3EN1 B;  3LTB A;  1EKM A;  1BAN A;  4KVH A;  1M1K 4;  1Q81 4;  1BRH A;  1GY6 A;  1OH0 A;  2CKF B;  1TRP A;  4WWU C;  2KF6 A;  2GSP A;  1ZGX A;  3GZX B;  1X1X A;  1DMM A;  2YFJ B;  3NBB A;  2BIR A;  1WQL B;  3GZY B;  3UJM A;  2RGQ A;  3EQQ B;  4N6L A;  1BRG A;  1UI8 A;  1EQK A;  3Q3F A;  2XH9 A;  3K63 A;  1EUI C;  3B4P A;  5KP4 A;  3ZG5 A;  3BNC A;  4O2H A;  4LYL B;  1IVV A;  1IK3 A;  1DVC A;  3X3X A;  2ZHX B;  3WOE B;  3KII A;  4H3U A;  4L8P A;  1MGW A;  1GY7 A;  1I3I A;  1OGZ A;  1VQ7 3;  2OWP A;  3KFQ C;  1OCV A;  1BGS A;  1D6Y A;  4FCZ A;  3X3Y A;  1Q86 4;  2W6J H;  1D6Z A;  1B20 A;  1MWU A;  2P38 A;  3ECF A;  3QRD A;  5GSP A;  4ZM8 A;  5AEU B;  1DVD A;  3A5E A;  4N3V A;  1LOX A;  4LSO A;  3WOD G;  1JKG A;  1O7M B;  3DGM A;  5IG0 A;  1PFP A;  3BNB A;  2L4V A;  3NBJ A;  3STD A;  4BTX A;  4GHO A;  3FCS B;  4FMD A;  1GD4 A;  1A2V A;  1LNI A;  3VGN A;  3KKG A;  1MWR A;  3CCR 3;  5JBS A;  3RDE A;  5IG5 A;  3D5G A;  4XB5 A;  1JN5 B;  1Q7H A;  1ROV A;  1BNE A;  1FA3 A;  2P0X A;  1W7C A;  5DRE A;  2WGQ A;  2CHC A;  2E2T A;  3NQZ A;  1Q40 B;  4WHA A;  1A90 A;  3URP A;  1PU4 A;  3MSO A;  3EE1 A;  3AGO A;  5ELU A;  3JUQ A;  2ZA4 A;  1RSN A;  1G02 A;  3CU3 A;  4N6N B;  3T8U A;  4XDW A;  3JVC A;  2XRX B;  5CK6 A;  1VQ4 3;  3HIG A;  1RRL A;  1ISK A;  1U5O A;  4O02 B;  3CPO A;  3EBT A;  1VQL 3;  1MNL A;  1QAL A;  1OGX A;  1AVK A;  1TFK A;  3N8B A;  1IV7 A;  4HM6 B;  1WMP A;  3D4A A;  1RNT A;  1FGR A;  3X42 A;  3GWR A;  5IG3 A;  1GS3 A;  1B3S A;  6GSP A;  1VQ8 3;  5EEO A;  3CCM 3;  1B2M A;  1BRJ A;  1O7P B;  4HYZ A;  3KE7 A;  4HM4 B;  3N9H A;  4K1U A;  4R9K A;  1I2E A;  1AV4 A;  1IV9 A;  2E2U A;  4OUQ A;  1R4C A;  3H51 A;  1W2B 2;  1S72 3;  3RGA A;  2K3D A;  4HKV B;  2R4I A;  1W00 A;  2YX9 A;  3EX9 A;  2W56 B;  1IQX A;  1JRQ A;  4R1K A;  3LOY A;  2W0Q A;  1LQG C;  1C54 A;  3FG1 A;  1D6U A;  1V58 A;  2ML5 A;  5JPU A;  1O7N B;  4Q53 A;  3EHC A;  1WMO A;  2WGO A;  1QMA A;  1QVG 2;  1RGF A;  2Z6B A;  3ZG0 A;  5ELJ A;  1ZS7 A;  1VQ5 3;  1YI2 3;  3V99 A;  3FH1 A;  1RRH A;  2SAR A;  3D79 A;  4H61 A;  4WFO A;  2XF3 A;  3LTD A;  1ULI B;  2HMN B;  4U13 A;  2XEP A;  3RNT A;  2D1W A;  3LML A;  1NU3 A;  1OF5 B;  3MG1 A;  5IF6 A;  4BL3 A;  3EBY A;  1RHL A;  2B24 B;  1LXE A;  5JPP A;  2KXG A;  4JF8 A;  3IPT A;  5EVH A;  2RFR A;  5AEW B;  2CFL A;  3X3Z A;  1RJO A;  1IVU A;  1ZX2 A;  4R80 A;  1Q7Y 4;  4RNZ A;  1IDP A;  3F14 A;  3NX0 A;  4GB5 A;  3FLJ A;  3CCJ 3;  1WMN A;  1LNH A;  1QAF A;  2KF4 A;  5CXO A;  1W4N A;  5AIG A;  4EW5 A;  5IEN A;  4N6O B;  1W6C A;  3CC2 3;  2RCD A;  2QA4 3;  1O7W B;  3G6E 3;  1T2H A;  5M19 A;  2E2V A;  3KZT A;  1SAR A;  1OF5 A;  1X1W A;  4STD A;  1KD1 4;  4J5K A;  2SBL A;  2XGL A;  3PYJ A;  3DGL A;  4WP5 A;  3CMA 3;  1B2S A;  1I0V A;  1JV2 B;  1YJN 3;  6STD A;  1WTH A;  3HOH A;  1NB3 I;  1YJW 3;  2GXF A;  1BRI A;  1TIJ A;  2HOH A;  2H0H A;  1FYS A;  1RKY A;  1BSA A;  3CCU 3;  3DGO A;  4BTW A;  1BU4 A;  1YIJ 3;  4HAA A;  1STF I;  2GBX B;  3F7X A;  4G1M B;  8CHO A;  5D81 A;  1M90 4;  1BNS A;  2CH9 A;  5I97 A;  2CIU A;  2W03 A;  1JB4 A;  1N5P A;  1Q9E A;  4OK0 A; 
#chains in the Genus database with same CATH homology
 1BSE A;  1B2Z A;  1JBT A;  1GMQ A;  3D5G A;  1LRA A;  1TTO A;  3BIR A;  1RLS A;  1LOY A;  1UCI A;  1RCL A;  1BNE A;  1RN4 A;  1B2U A;  1RGH A;  1DE3 A;  1UCK A;  7GSP A;  1RMS A;  5HOH A;  2KF5 A;  1BSB A;  3URP A;  1UCJ A;  1B21 A;  2BU4 A;  3AGO A;  1BNF A;  1BSC A;  1UCL A;  3SYU A;  1LOV A;  1RSN A;  2ZA4 A;  4HOH A;  1G02 A;  1LOW A;  5BU4 A;  1BAO A;  6RNT A;  2AAE A;  1IYY A;  1FZU A;  1GOV A;  1BIR A;  3WHO A;  1PYL A;  9RNT A;  1T2I A;  1BRN L;  1HZ1 A;  1RGE A;  1AQZ A;  5RNT A;  4RNT A;  1MGR A;  4GSP A;  3D4A A;  1BOX A;  1RGG A;  1AY7 A;  1RNT A;  1X1U A;  1B3S A;  1YGW A;  6GSP A;  1B2M A;  1BRJ A;  1I2E A;  2F5M A;  1BSD A;  1GOU A;  1TRQ A;  1GMR A;  3BU4 A;  3GSP A;  1BUJ A;  1GSP A;  1JBS A;  1BRK A;  2KAA A;  3AHS A;  1RNB A;  1C54 A;  1RGA A;  1RGC A;  3DGY A;  1GMP A;  1I3F A;  1RGF A;  1RCK A;  1PY3 A;  1RN1 A;  2AAD A;  4BU4 A;  3AGN A;  4J5G A;  4BIR A;  2SAR A;  1RDS A;  1RGK A;  1BNJ A;  1FUT A;  3WR2 A;  1I2G A;  3RNT A;  3AHW A;  1BNG A;  1BVI A;  1R4Y A;  2RBI A;  1BRS A;  1RHL A;  2F4Y A;  1B27 A;  1FW7 A;  1FUS A;  7RNT A;  1X1Y A;  3D5I A;  1BAN A;  2C4B A;  1BRH A;  1CH0 A;  1GOY A;  1TRP A;  2KF3 A;  2KF6 A;  2GSP A;  1ZGX A;  1X1X A;  1HYF A;  2BIR A;  2KF4 A;  1BRG A;  8RNT A;  1JBR A;  3Q3F A;  1YNV X;  3KCH A;  1T2H A;  3DH2 A;  1BNI A;  1SAR A;  1X1W A;  1RTU A;  2F5W A;  2RNT A;  1I0X A;  1I2F A;  4J5K A;  1DET A;  1YVS A;  1BNR A;  1RGL A;  1B2S A;  1I0V A;  1MGW A;  1I3I A;  1B2X A;  3HOH A;  1BGS A;  1BRI A;  1B20 A;  1I8V A;  5GSP A;  1A2P A;  2HOH A;  3A5E A;  1FYS A;  1BSA A;  1BU4 A;  4HAA A;  2F56 A;  4GHO A;  1I70 A;  1BNS A;  5BIR A;  1LNI A;  1Q9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...