1T2IA

T76w mutant of rnase sa from streptomyces aureofaciens
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEAWQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of single tryptophan residues to the fluorescence and stability of ribonuclease sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 25
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1t2iA00
1RCLA 1C54A 1I8VA 2ZA4A 1CH0A 1IYYA 1DETA 5BIRA 4J5KA 1DE3A 1FYSA 6RNTA 3SYUA 5RNTA 1RGCA 4BIRA 4HOHA 2KF5A 1MGRA 1RGGA 1B21A 1BNIA 1BUJA 1I70A 1FUTA 1GSPA 1GOUA 3BIRA 1I2FA 2KF4A 1X1XA 1BANA 1BSAA 1RN4A 2KAAA 3WHOA 1Q9EA 1JBTA 1RTUA 1YNVX 1BU4A 1B2ZA 1X1YA 1BRJA 1RGLA 3RNTA 1LRAA 1BSCA 2HOHA 3HOHA 1RGEA 1B2XA 1I0VA 1BNJA 1X1WA 5BU4A 1BRSA 1RHLA 2BIRA 1PYLA 4GHOA 3D5GA 1BAOA 1AQZA 2AAEA 2F5MA 3DGYA 1RGKA 1BSEA 1GMQA 1MGWA 1GMPA 2BU4A 7GSPA 1BRGA 1BRKA 3KCHA 1I3IA 1RGFA 3WR2A 1BIRA 1GMRA 3DH2A 1GOYA 4HAAA 1FZUA 2KF6A 2F56A 2RBIA 3AGNA 9RNTA 1BGSA 1B2UA 1FUSA 1R4YA 3AHWA 5HOHA 1RDSA 1HYFA 1TRQA 1BRNL 4GSPA 1LNIA 1I0XA 1BVIA 1RGHA 1LOYA 1A2PA 1PY3A 1BNFA 2RNTA 1BNEA 3BU4A 1I2EA 1I2GA 3URPA 1AY7A 2GSPA 1RSNA 1BNSA 6GSPA 1B3SA 1BSDA 4RNTA 1B27A 1RCKA 1BNRA 3D4AA 1RNBA 1T2IA 1BOXA 1LOVA 1JBRA 1ZGXA 1B2MA 1RLSA 1JBSA 1FW7A 4BU4A 1YVSA 2KF3A 4J5GA 5GSPA 1BSBA 1B2SA 1TRPA 3AGOA 1HZ1A 1SARA 1BRIA 1B20A 1LOWA 2AADA 1T2HA 1UCIA 3A5EA 1YGWA 1TTOA 1BRHA 1I3FA 1X1UA 3GSPA 1RN1A 1RNTA 2F5WA 1UCLA 2C4BA 1G02A 3Q3FA 1UCJA 1RGAA 1GOVA 7RNTA 8RNTA 1UCKA 2SARA 3AHSA 1RMSA 3D5IA 2F4YA 1BNGA
chains in the Genus database with same CATH superfamily
1CEWI 1C54A 3NQYA 1K8A4 1IYYA 3CC73 1IV9A 4PEJA 1IVUA 1DMQA 2XFSA 4J5KA 1FYSA 3VGNA 3CCM3 6RNTA 5AYRB 1RGCA 3BB9A 2CWTA 4HOHA 3Q1CA 4GB5A 1STDA 2OWPA 5KP3A 3EBTA 1BUJA 4KZ1A 1I70A 3JUPA 1FUTA 3D9RA 3HX8A 1HU9A 4FMBA 1RN4A 1BSAA 2KAAA 4BTYA 4FCZA 1RTUA 2HMNB 1AV4A 5AI1A 4N6UA 2OQEA 3T8NA 2OCTA 1GS3A 1X1YA 1A90A 3RNTA 1CYVA 3HOHA 1AVLA 2W9QA 2CFDA 4EXRA 3CCQ3 2IUJA 1ROVA 3EB8A 3KZTA 4WYKB 4AKZA 1Y4KA 1Z1SA 2HMLB 1X1WA 3AMOB 3PZWA 5DRVA 1O7HB 3PGBA 3B8LA 4FMCA 1W2B2 1BAOA 2C10A 1RGKA 4HZ9B 1KQS2 4R1KA 2O3OA 1LXEA 1PFPA 2BT3A 1EQKA 3GZBA 1OHSA 1WQLB 2HMOB 3KIIA 1YI23 4I5QA 5STDA 1YIT3 2LQVA 3FF0A 5IENA 2HMKB 2F56A 2XFTA 1KC84 3F8XA 5IG5A 9RNTA 1B2UA 1FUSA 1NU3A 4L8OA 3I563 2E2VA 3H3HA 1RDSA 1HYFA 3EF8A 3JUMA 2C11A 1YVBI 2YFIB 1LQGC 2GEXA 1D6UA 5I97A 1I0XA 1JRQA 4XBYA 1LOYA 1SIIA 1RJOA 1A2PA 4LYLB 2D42A 3LMLA 2Z77A 3F9SA 4HM7B 4FMAA 1BNEA 4XDWA 2WGOA 3BU4A 4ZM8A 3NX0A 3OW22 1Q40B 3L0RA 1A67A 2INXA 1IQ8A 1B3SA 2Z6BA 4HKVB 2H0HA 3IPTA 4RNTA 3CNXA 1AR0A 4WWUC 3BNCA 4KFFA 4CPKA 5IW9A 1Q7HA 2XRXB 1IVVA 1TU5A 1B2MA 1RLSA 1N9JA 2CFGA 2BMOB 3FG3A 1G96A 2MC8A 3CCL3 1JBSA 1YVSA 4J9AA 1OHPA 1RRHA 1BSBA 2XR8B 2K0MA 4EV5A 1TRPA 1O7GB 3CC23 1VQ93 1IT8A 1PU4A 1HZ1A 3KSED 1ROAA 4HM2B 1HKXA 3B4PA 3B7CA 3KN4A 4K90B 1S5AA 1ZO2A 3Q2PA 5G1LA 3A5EA 4HM1B 3T0UA 1D6YA 1YGWA 1VQM3 1NJI4 1K41A 3G6E3 3DZLA 2GXFA 5CK6A 2GBXB 2YX9A 1N8R4 1RNTA 2P05A 3DUKA 2H0GA 4RNYA 4LGQA 1G02A 4MMZB 2K3DA 1WMPA 2OTJ3 4HM6B 3CXC2 1CQSA 1A2KA 1UCJA 1V57A 3DGOA 7RNTA 1UI7A 5BXQA 3ZG5A 1MWUA 1YIJ3 1Q42A 3EQQB 2SARA 3X3ZA 4WFOA 2Z76A 3MWZA 4EW5A 2QA43 4Q53A 1RCLA 3G713 2R41A 1E3VA 4KT3B 2W9PA 1OUNA 3SYUA 5RNTA 1ASKA 1OHOA 3QRDA 5M18A 1M1XB 1OGZA 1SJWA 1T5YA 1GSPA 1GOUA 1TIJA 2RGQA 2F99A 3A76A 1YGEA 3GZXB 3JVCA 1BANA 3CCV3 1W01A 3CC43 1Q9EA 3HK4A 1JBTA 4KFDA 1O7NB 1RKYA 1YNVX 1YJN3 1LVNA 3GZRA 3ALAA 3OXAA 3SXXA 1CYUA 1NDOB 1OF5A 2HOHA 4IPBA 4K61A 2W56A 1ULJB 5D81A 3N9HA 4EC6A 1RGEA 1B2XA 3FGYA 3MG1A 3RGRA 1OH0A 2CX1A 3LXUX 3SOYA 3V98A 4LMIA 4CCVA 1BRSA 1RHLA 1SQWA 2BIRA 2WGQA 4GHOA 1N5PA 3Q90A 1O7WB 1AQZA 4O8SA 1BSEA 1GMQA 7GSPA 1JN5B 1MWRA 2BU4A 2OOVA 1BRKA 1I3IA 5CF2A 4HVNA 3OV4A 1GY7A 3S28A 1UGIA 3SEDA 4J8TA 3VSYA 3B4OA 3OWUA 3S67A 2A15A 1QAFA 1FZUA 1W5ZA 2IYJA 2QGUA 1EEJA 1IU7A 3AGNA 2M7OA 2CX0A 3EJVA 3K63A 4FR9A 2OTL3 2ZL8A 3X3YA 3G4S3 2GU1A 3CMA3 1TRQA 4XBXA 3X3XA 1JB5A 4G1MB 2WO0A 1M1K4 1RRLA 3LTBA 2W04A 3NBJA 1SIHA 4N6LA 4OK0A 7STDA 2JDIH 1TFKA 4WYKA 3MSOA 3FG4A 3AMOA 5ELUA 4NREA 1MOLA 5AEWB 1I2EA 3RDEA 1BNSA 1RN7A 2JQ5A 1KWIA 1OGXA 1B27A 1U5OA 1KSIA 1W02A 1BNRA 5AYSC 3BNEA 3FG1A 5IG3A 3IMAB 3STDA 1K9M4 1W6GA 1VQ43 2SBLA 2HMMB 1JKGA 3EHCA 1IK3A 1LOVA 3X42A 1M9GA 1ZGXA 1U8CB 2CWVA 2UUGC 5AIHA 4MEIA 1T3BA 4U13A 1G0TA 3UL6A 4BU4A 4J5GA 3DM8A 5EVHA 3NBBA 1B2SA 1K28A 1ISKA 3ZG0A 1STFI 3CPW2 5AEUB 3V99A 1UUWB 3MG3A 1V74A 3UNLA 1TJDA 4IIAA 1GD3A 2H0IA 3EC9A 4MMYB 1UCIA 2QIYA 1Q40A 1I3FA 1JZDA 1UW1A 3F8HA 4RNZA 4O02B 3WA3A 1OACA 3NV0B 3GSPA 1US1A 2F5WA 1F8NA 1YJW3 1IVXA 4CJNA 1IV7A 3FH1A 1VQN3 3OWSA 1UGHI 2F98A 5D83A 2CKFB 1JB4A 2J8XB 1FGMA 3FCSB 4O2HA 1DYUA 4JF8A 2XEPA 3U97A 2K54A 1WMOA 1EA2A 4HYZA 6STDA 1EG9B 1JZOA 2XSHB 1TP6A 1FA3A 3HI7A 2ZA4A 3CCS3 1VQL3 5BIRA 1DVCA 1N5HA 1QALA 1DE3A 2GEYA 2XF3A 1VQ53 3LTCA 1K734 4CDLA 2XSOB 2KF5A 2P09A 1RGGA 2CFKA 2CW9A 1MNLA 4XM4A 4EBGA 1DMMA 2BHMA 2CIUA 2UX0A 3WDGB 2KF4A 1X1XA 3WHOA 1EUIC 2Q07A 3DMCA 2W2CA 3KKGA 1SPUA 3ECFA 5AIFA 3EN8A 2L4VA 3MYTA 1WNHA 1LRAA 3TDGA 3ZFZA 1Q814 4HM4B 3H51A 4HM3B 4IT7A 5IERA 1FGTA 2STDA 1UDII 1PYLA 4K1VA 1C7HA 3D5GA 2AAEA 2P0XA 3KCHA 1TFOA 8CHOA 1RGFA 5CLKA 5IEPA 4KFEA 4X2HA 5AIIA 1GY6A 1GMRA 3ROBA 1NWWA 4HAAA 2LYXA 4EYCA 3LTAA 3LZAA 5KP1A 2KF6A 3X40A 1BGSA 1W2ZA 2OQEC 4K1UA 3GAXA 2B1XB 3G0KA 1Q864 4MJDA 3WOFB 3EX9A 3KE7A 5HGRA 2FNQA 1N9EA 2L1SA 2UGIA 4FCMA 3J7Yd 1LNIA 2BMRB 1BVIA 3LH4A 4DKIA 4HJLB 4GL6A 5ELJA 3K9MC 3M8CA 1PY3A 1BNFA 2E2TA 2RNTA 2XGLA 5IG0A 2Y73A 3BNBA 1IT7A 1UI8A 3QK9A 3LYGA 5LC7A 2WOHA 3GRDA 5FGOA 5FW5A 1AY7A 4L7KA 2PNCA 1MWSA 2IMJA 1BSDA 1JN5A 2YFLB 5IG4A 1TUHA 1RCKA 4RBNA 1FUWA 3G8ZA 2BNGA 1RNBA 2KXGA 1ZS7A 3VF1A 3LTDA 1WMNA 1BOXA 1EKMA 2HMJB 1D6ZA 1NO3A 4R80A 2W56B 5AIGA 1W6YA 3F7XA 1N8QA 3T8UA 3WA2X 2KF3A 5GSPA 4RZMA 3SOAA 3F14A 5A0OB 5JPUA 3NM2A 1UUVB 3AGOA 4HM0B 2QEX3 1VQ73 5IF6A 3DXOA 4FCJA 3JUOA 1R4CA 2W0QA 3KSPA 2E2UA 1VQP3 1ULIB 1YHQ3 1QVG2 1J2BA 1LOWA 2AADA 3BLZA 4LSOA 2CWUA 3FSDA 1BRHA 2O9UX 3N8BA 3UB1A 1LOXA 3WMDA 3FKAA 3CME3 4R4KA 1S723 4XB5A 1VQO3 3K5TA 1W7CA 4XDVA 3PXMA 5JBSA 2RFRA 1UCLA 4TX4A 3CCE3 3SVAA 2PZVA 3CD63 2CHCA 4H61A 4KVHA 3CCJ3 1JJ22 3NHXA 5D82A 3S29A 1GOVA 3GWRA 5BVBA 3K0ZA 1LQMB 2P0MA 1W6CA 2IA7A 3D5IA 3DGYA 2F4YA 4HM8B 1BNGA 2IUKA 5TGNA 3UJMA 3CPOA 1VQK3 1Q824 1I8VA 1CH0A 1QJGA 1DETA 4N6V0 5CXOA 3NM7A 2Z7AA 5G1KA 1E3RA 1GD4A 3HIGA 4BL3A 1FGQA 4BIRA 4ORLA 3UL5A 3WOEB 1MGRA 3PYJA 3SLUA 1A2VA 3CNMA 3LOYA 1M904 2GBWB 1B21A 1BNIA 3FZWA 1JKGB 2P38A 3LT8A 1VQ63 1IQYA 3BIRA 1E97A 2GU3A 4O3VA 1I2FA 3BNDA 2KRTA 2CFLA 2CFWA 3D3LA 3D79A 3DGNA 3NV0A 3E99A 4WHAA 4N3VA 1VQQA 1Q7Y4 3CCU3 1BU4A 1B2ZA 1WTHA 1BRJA 1RGLA 4AKYA 4N6MA 1BSCA 2WOFA 3N54B 3SX1A 1NB3I 1W4NA 5LC6A 3OX9A 1I0VA 1BNJA 3HIIA 3DGMA 5BU4A 5M19A 1JNQA 4R9LA 3S27A 3MG2A 1AVKA 2MF7A 2F5MA 1UUGB 3GZYB 1MGWA 3IJEB 1GMPA 4N6TA 1V58A 1BRGA 2RSXA 1FGRA 4AEQA 3PS8A 1MWTA 2W03A 4HBRA 3WR2A 1BIRA 3DH2A 3S5CA 3V92A 2V1LA 1GOYA 5EEOA 4H3UA 5DREA 5JPPA 2ML5A 3MKIA 3LT9A 2RBIA 4MMXB 1JB2A 2R4IA 2IY2A 3EBYA 4NPBA 5M1AA 2FXTA 3PCSA 1VQ83 3JUNA 1R4YA 3AHWA 3NBRA 5HOHA 1JV2B 1GY5A 1NB5I 3F40A 1GYBA 2ZDJA 4GSPA 1BRNL 3K7CA 1BUQA 2CG1A 3MPHA 1RGHA 2CH9A 2CK3H 2W6JH 3FLJA 1QAKA 3OWYA 4NHFA 2ML6A 4XBTA 2XGNA 2YFJB 4HM5B 1I2GA 1OPYA 3URPA 4BTXA 2GSPA 2OOVC 1RSNA 1DMNA 2RCDA 6GSPA 2CG0A 4OVMA 4ILFA 2D1WA 4JRFA 4N6NB 1L5GB 3NUVA 3D4AA 4EV2A 3WODG 1T2IA 2CC3A 3EN1B 2FGTA 5KP4A 3F7SA 3EE1A 2ZHXB 3KFQC 5G2GA 4FMDA 1IQXA 1JBRA 4LZIA 3U1WA 3HZPA 4STDA 1FW7A 2XH9A 3O8YA 4N6OB 1YJ93 1OCVA 4LEHA 3DY5A 5IEOA 1IDPA 1KD14 4OUQA 2KCDA 1SARA 1LNHA 2I9WA 1ZX2A 2BO9B 1BRIA 3PCRA 1IVWA 1B20A 3FF2A 4BL2A 1T2HA 1O7MB 3JUQA 4WP5A 1TTOA 4R9KA 4BTWA 3DGLA 3I0YA 1X1UA 2BMQB 4L8PA 1W00A 3CCR3 1FGOA 3CU3A 1RN1A 2C4BA 4X2OA 2Y74A 2F86B 3NXJA 1O7PB 3ER7A 1NNVA 3NQZA 1DVDA 1OF5B 3X41A 3Q3FA 1QMAA 1RGAA 3RGAA 8RNTA 4QWTA 3MHEA 1VZZA 1UCKA 2B24B 5CF1A 3I553 1QVF2 3AHSA 5EQLA 1RMSA 4HZBB 3G16A 4I4KA
chains in the Genus database with same CATH topology
1RCLA 1C54A 1I8VA 2ZA4A 1CH0A 1IYYA 1DETA 5BIRA 4J5KA 1DE3A 1FYSA 6RNTA 3SYUA 5RNTA 1RGCA 4BIRA 4HOHA 2KF5A 1MGRA 1RGGA 1B21A 1BNIA 1BUJA 1I70A 1FUTA 1GSPA 1GOUA 3BIRA 1I2FA 2KF4A 1X1XA 1BANA 1BSAA 1RN4A 2KAAA 3WHOA 1Q9EA 1JBTA 1RTUA 1YNVX 1BU4A 1B2ZA 1X1YA 1BRJA 1RGLA 3RNTA 1LRAA 1BSCA 2HOHA 3HOHA 1RGEA 1B2XA 1I0VA 1BNJA 1X1WA 5BU4A 1BRSA 1RHLA 2BIRA 1PYLA 4GHOA 3D5GA 1BAOA 1AQZA 2AAEA 2F5MA 3DGYA 1RGKA 1BSEA 1GMQA 1MGWA 1GMPA 2BU4A 7GSPA 1BRGA 1BRKA 3KCHA 1I3IA 1RGFA 3WR2A 1BIRA 1GMRA 3DH2A 1GOYA 4HAAA 1FZUA 2KF6A 2F56A 2RBIA 3AGNA 9RNTA 1BGSA 1B2UA 1FUSA 1R4YA 3AHWA 5HOHA 1RDSA 1HYFA 1TRQA 1BRNL 4GSPA 1LNIA 1I0XA 1BVIA 1RGHA 1LOYA 1A2PA 1PY3A 1BNFA 2RNTA 1BNEA 3BU4A 1I2EA 1I2GA 3URPA 1AY7A 2GSPA 1RSNA 1BNSA 6GSPA 1B3SA 1BSDA 4RNTA 1B27A 1RCKA 1BNRA 3D4AA 1RNBA 1T2IA 1BOXA 1LOVA 1JBRA 1ZGXA 1B2MA 1RLSA 1JBSA 1FW7A 4BU4A 1YVSA 2KF3A 4J5GA 5GSPA 1BSBA 1B2SA 1TRPA 3AGOA 1HZ1A 1SARA 1BRIA 1B20A 1LOWA 2AADA 1T2HA 1UCIA 3A5EA 1YGWA 1TTOA 1BRHA 1I3FA 1X1UA 3GSPA 1RN1A 1RNTA 2F5WA 1UCLA 2C4BA 1G02A 3Q3FA 1UCJA 1RGAA 1GOVA 7RNTA 8RNTA 1UCKA 2SARA 3AHSA 1RMSA 3D5IA 2F4YA 1BNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCL A;  1C54 A;  1I8V A;  2ZA4 A;  1CH0 A;  1IYY A;  1DET A;  5BIR A;  4J5K A;  1DE3 A;  1FYS A;  6RNT A;  3SYU A;  5RNT A;  1RGC A;  4BIR A;  4HOH A;  2KF5 A;  1MGR A;  1RGG A;  1B21 A;  1BNI A;  1BUJ A;  1I70 A;  1FUT A;  1GSP A;  1GOU A;  3BIR A;  1I2F A;  2KF4 A;  1X1X A;  1BAN A;  1BSA A;  1RN4 A;  2KAA A;  3WHO A;  1Q9E A;  1JBT A;  1RTU A;  1YNV X;  1BU4 A;  1B2Z A;  1X1Y A;  1BRJ A;  1RGL A;  3RNT A;  1LRA A;  1BSC A;  2HOH A;  3HOH A;  1RGE A;  1B2X A;  1I0V A;  1BNJ A;  1X1W A;  5BU4 A;  1BRS A;  1RHL A;  2BIR A;  1PYL A;  4GHO A;  3D5G A;  1BAO A;  1AQZ A;  2AAE A;  2F5M A;  3DGY A;  1RGK A;  1BSE A;  1GMQ A;  1MGW A;  1GMP A;  2BU4 A;  7GSP A;  1BRG A;  1BRK A;  3KCH A;  1I3I A;  1RGF A;  3WR2 A;  1BIR A;  1GMR A;  3DH2 A;  1GOY A;  4HAA A;  1FZU A;  2KF6 A;  2F56 A;  2RBI A;  3AGN A;  9RNT A;  1BGS A;  1B2U A;  1FUS A;  1R4Y A;  3AHW A;  5HOH A;  1RDS A;  1HYF A;  1TRQ A;  1BRN L;  4GSP A;  1LNI A;  1I0X A;  1BVI A;  1RGH A;  1LOY A;  1A2P A;  1PY3 A;  1BNF A;  2RNT A;  1BNE A;  3BU4 A;  1I2E A;  1I2G A;  3URP A;  1AY7 A;  2GSP A;  1RSN A;  1BNS A;  6GSP A;  1B3S A;  1BSD A;  4RNT A;  1B27 A;  1RCK A;  1BNR A;  3D4A A;  1RNB A;  1T2I A;  1BOX A;  1LOV A;  1JBR A;  1ZGX A;  1B2M A;  1RLS A;  1JBS A;  1FW7 A;  4BU4 A;  1YVS A;  2KF3 A;  4J5G A;  5GSP A;  1BSB A;  1B2S A;  1TRP A;  3AGO A;  1HZ1 A;  1SAR A;  1BRI A;  1B20 A;  1LOW A;  2AAD A;  1T2H A;  1UCI A;  3A5E A;  1YGW A;  1TTO A;  1BRH A;  1I3F A;  1X1U A;  3GSP A;  1RN1 A;  1RNT A;  2F5W A;  1UCL A;  2C4B A;  1G02 A;  3Q3F A;  1UCJ A;  1RGA A;  1GOV A;  7RNT A;  8RNT A;  1UCK A;  2SAR A;  3AHS A;  1RMS A;  3D5I A;  2F4Y A;  1BNG A; 
#chains in the Genus database with same CATH topology
 1CEW I;  1C54 A;  3NQY A;  1K8A 4;  1IYY A;  3CC7 3;  1IV9 A;  4PEJ A;  1IVU A;  1DMQ A;  2XFS A;  4J5K A;  1FYS A;  3VGN A;  3CCM 3;  6RNT A;  5AYR B;  1RGC A;  3BB9 A;  2CWT A;  4HOH A;  3Q1C A;  4GB5 A;  1STD A;  2OWP A;  5KP3 A;  3EBT A;  1BUJ A;  4KZ1 A;  1I70 A;  3JUP A;  1FUT A;  3D9R A;  3HX8 A;  1HU9 A;  4FMB A;  1RN4 A;  1BSA A;  2KAA A;  4BTY A;  4FCZ A;  1RTU A;  2HMN B;  1AV4 A;  5AI1 A;  4N6U A;  2OQE A;  3T8N A;  2OCT A;  1GS3 A;  1X1Y A;  1A90 A;  3RNT A;  1CYV A;  3HOH A;  1AVL A;  2W9Q A;  2CFD A;  4EXR A;  3CCQ 3;  2IUJ A;  1ROV A;  3EB8 A;  3KZT A;  4WYK B;  4AKZ A;  1Y4K A;  1Z1S A;  2HML B;  1X1W A;  3AMO B;  3PZW A;  5DRV A;  1O7H B;  3PGB A;  3B8L A;  4FMC A;  1W2B 2;  1BAO A;  2C10 A;  1RGK A;  4HZ9 B;  1KQS 2;  4R1K A;  2O3O A;  1LXE A;  1PFP A;  2BT3 A;  1EQK A;  3GZB A;  1OHS A;  1WQL B;  2HMO B;  3KII A;  1YI2 3;  4I5Q A;  5STD A;  1YIT 3;  2LQV A;  3FF0 A;  5IEN A;  2HMK B;  2F56 A;  2XFT A;  1KC8 4;  3F8X A;  5IG5 A;  9RNT A;  1B2U A;  1FUS A;  1NU3 A;  4L8O A;  3I56 3;  2E2V A;  3H3H A;  1RDS A;  1HYF A;  3EF8 A;  3JUM A;  2C11 A;  1YVB I;  2YFI B;  1LQG C;  2GEX A;  1D6U A;  5I97 A;  1I0X A;  1JRQ A;  4XBY A;  1LOY A;  1SII A;  1RJO A;  1A2P A;  4LYL B;  2D42 A;  3LML A;  2Z77 A;  3F9S A;  4HM7 B;  4FMA A;  1BNE A;  4XDW A;  2WGO A;  3BU4 A;  4ZM8 A;  3NX0 A;  3OW2 2;  1Q40 B;  3L0R A;  1A67 A;  2INX A;  1IQ8 A;  1B3S A;  2Z6B A;  4HKV B;  2H0H A;  3IPT A;  4RNT A;  3CNX A;  1AR0 A;  4WWU C;  3BNC A;  4KFF A;  4CPK A;  5IW9 A;  1Q7H A;  2XRX B;  1IVV A;  1TU5 A;  1B2M A;  1RLS A;  1N9J A;  2CFG A;  2BMO B;  3FG3 A;  1G96 A;  2MC8 A;  3CCL 3;  1JBS A;  1YVS A;  4J9A A;  1OHP A;  1RRH A;  1BSB A;  2XR8 B;  2K0M A;  4EV5 A;  1TRP A;  1O7G B;  3CC2 3;  1VQ9 3;  1IT8 A;  1PU4 A;  1HZ1 A;  3KSE D;  1ROA A;  4HM2 B;  1HKX A;  3B4P A;  3B7C A;  3KN4 A;  4K90 B;  1S5A A;  1ZO2 A;  3Q2P A;  5G1L A;  3A5E A;  4HM1 B;  3T0U A;  1D6Y A;  1YGW A;  1VQM 3;  1NJI 4;  1K41 A;  3G6E 3;  3DZL A;  2GXF A;  5CK6 A;  2GBX B;  2YX9 A;  1N8R 4;  1RNT A;  2P05 A;  3DUK A;  2H0G A;  4RNY A;  4LGQ A;  1G02 A;  4MMZ B;  2K3D A;  1WMP A;  2OTJ 3;  4HM6 B;  3CXC 2;  1CQS A;  1A2K A;  1UCJ A;  1V57 A;  3DGO A;  7RNT A;  1UI7 A;  5BXQ A;  3ZG5 A;  1MWU A;  1YIJ 3;  1Q42 A;  3EQQ B;  2SAR A;  3X3Z A;  4WFO A;  2Z76 A;  3MWZ A;  4EW5 A;  2QA4 3;  4Q53 A;  1RCL A;  3G71 3;  2R41 A;  1E3V A;  4KT3 B;  2W9P A;  1OUN A;  3SYU A;  5RNT A;  1ASK A;  1OHO A;  3QRD A;  5M18 A;  1M1X B;  1OGZ A;  1SJW A;  1T5Y A;  1GSP A;  1GOU A;  1TIJ A;  2RGQ A;  2F99 A;  3A76 A;  1YGE A;  3GZX B;  3JVC A;  1BAN A;  3CCV 3;  1W01 A;  3CC4 3;  1Q9E A;  3HK4 A;  1JBT A;  4KFD A;  1O7N B;  1RKY A;  1YNV X;  1YJN 3;  1LVN A;  3GZR A;  3ALA A;  3OXA A;  3SXX A;  1CYU A;  1NDO B;  1OF5 A;  2HOH A;  4IPB A;  4K61 A;  2W56 A;  1ULJ B;  5D81 A;  3N9H A;  4EC6 A;  1RGE A;  1B2X A;  3FGY A;  3MG1 A;  3RGR A;  1OH0 A;  2CX1 A;  3LXU X;  3SOY A;  3V98 A;  4LMI A;  4CCV A;  1BRS A;  1RHL A;  1SQW A;  2BIR A;  2WGQ A;  4GHO A;  1N5P A;  3Q90 A;  1O7W B;  1AQZ A;  4O8S A;  1BSE A;  1GMQ A;  7GSP A;  1JN5 B;  1MWR A;  2BU4 A;  2OOV A;  1BRK A;  1I3I A;  5CF2 A;  4HVN A;  3OV4 A;  1GY7 A;  3S28 A;  1UGI A;  3SED A;  4J8T A;  3VSY A;  3B4O A;  3OWU A;  3S67 A;  2A15 A;  1QAF A;  1FZU A;  1W5Z A;  2IYJ A;  2QGU A;  1EEJ A;  1IU7 A;  3AGN A;  2M7O A;  2CX0 A;  3EJV A;  3K63 A;  4FR9 A;  2OTL 3;  2ZL8 A;  3X3Y A;  3G4S 3;  2GU1 A;  3CMA 3;  1TRQ A;  4XBX A;  3X3X A;  1JB5 A;  4G1M B;  2WO0 A;  1M1K 4;  1RRL A;  3LTB A;  2W04 A;  3NBJ A;  1SIH A;  4N6L A;  4OK0 A;  7STD A;  2JDI H;  1TFK A;  4WYK A;  3MSO A;  3FG4 A;  3AMO A;  5ELU A;  4NRE A;  1MOL A;  5AEW B;  1I2E A;  3RDE A;  1BNS A;  1RN7 A;  2JQ5 A;  1KWI A;  1OGX A;  1B27 A;  1U5O A;  1KSI A;  1W02 A;  1BNR A;  5AYS C;  3BNE A;  3FG1 A;  5IG3 A;  3IMA B;  3STD A;  1K9M 4;  1W6G A;  1VQ4 3;  2SBL A;  2HMM B;  1JKG A;  3EHC A;  1IK3 A;  1LOV A;  3X42 A;  1M9G A;  1ZGX A;  1U8C B;  2CWV A;  2UUG C;  5AIH A;  4MEI A;  1T3B A;  4U13 A;  1G0T A;  3UL6 A;  4BU4 A;  4J5G A;  3DM8 A;  5EVH A;  3NBB A;  1B2S A;  1K28 A;  1ISK A;  3ZG0 A;  1STF I;  3CPW 2;  5AEU B;  3V99 A;  1UUW B;  3MG3 A;  1V74 A;  3UNL A;  1TJD A;  4IIA A;  1GD3 A;  2H0I A;  3EC9 A;  4MMY B;  1UCI A;  2QIY A;  1Q40 A;  1I3F A;  1JZD A;  1UW1 A;  3F8H A;  4RNZ A;  4O02 B;  3WA3 A;  1OAC A;  3NV0 B;  3GSP A;  1US1 A;  2F5W A;  1F8N A;  1YJW 3;  1IVX A;  4CJN A;  1IV7 A;  3FH1 A;  1VQN 3;  3OWS A;  1UGH I;  2F98 A;  5D83 A;  2CKF B;  1JB4 A;  2J8X B;  1FGM A;  3FCS B;  4O2H A;  1DYU A;  4JF8 A;  2XEP A;  3U97 A;  2K54 A;  1WMO A;  1EA2 A;  4HYZ A;  6STD A;  1EG9 B;  1JZO A;  2XSH B;  1TP6 A;  1FA3 A;  3HI7 A;  2ZA4 A;  3CCS 3;  1VQL 3;  5BIR A;  1DVC A;  1N5H A;  1QAL A;  1DE3 A;  2GEY A;  2XF3 A;  1VQ5 3;  3LTC A;  1K73 4;  4CDL A;  2XSO B;  2KF5 A;  2P09 A;  1RGG A;  2CFK A;  2CW9 A;  1MNL A;  4XM4 A;  4EBG A;  1DMM A;  2BHM A;  2CIU A;  2UX0 A;  3WDG B;  2KF4 A;  1X1X A;  3WHO A;  1EUI C;  2Q07 A;  3DMC A;  2W2C A;  3KKG A;  1SPU A;  3ECF A;  5AIF A;  3EN8 A;  2L4V A;  3MYT A;  1WNH A;  1LRA A;  3TDG A;  3ZFZ A;  1Q81 4;  4HM4 B;  3H51 A;  4HM3 B;  4IT7 A;  5IER A;  1FGT A;  2STD A;  1UDI I;  1PYL A;  4K1V A;  1C7H A;  3D5G A;  2AAE A;  2P0X A;  3KCH A;  1TFO A;  8CHO A;  1RGF A;  5CLK A;  5IEP A;  4KFE A;  4X2H A;  5AII A;  1GY6 A;  1GMR A;  3ROB A;  1NWW A;  4HAA A;  2LYX A;  4EYC A;  3LTA A;  3LZA A;  5KP1 A;  2KF6 A;  3X40 A;  1BGS A;  1W2Z A;  2OQE C;  4K1U A;  3GAX A;  2B1X B;  3G0K A;  1Q86 4;  4MJD A;  3WOF B;  3EX9 A;  3KE7 A;  5HGR A;  2FNQ A;  1N9E A;  2L1S A;  2UGI A;  4FCM A;  3J7Y d;  1LNI A;  2BMR B;  1BVI A;  3LH4 A;  4DKI A;  4HJL B;  4GL6 A;  5ELJ A;  3K9M C;  3M8C A;  1PY3 A;  1BNF A;  2E2T A;  2RNT A;  2XGL A;  5IG0 A;  2Y73 A;  3BNB A;  1IT7 A;  1UI8 A;  3QK9 A;  3LYG A;  5LC7 A;  2WOH A;  3GRD A;  5FGO A;  5FW5 A;  1AY7 A;  4L7K A;  2PNC A;  1MWS A;  2IMJ A;  1BSD A;  1JN5 A;  2YFL B;  5IG4 A;  1TUH A;  1RCK A;  4RBN A;  1FUW A;  3G8Z A;  2BNG A;  1RNB A;  2KXG A;  1ZS7 A;  3VF1 A;  3LTD A;  1WMN A;  1BOX A;  1EKM A;  2HMJ B;  1D6Z A;  1NO3 A;  4R80 A;  2W56 B;  5AIG A;  1W6Y A;  3F7X A;  1N8Q A;  3T8U A;  3WA2 X;  2KF3 A;  5GSP A;  4RZM A;  3SOA A;  3F14 A;  5A0O B;  5JPU A;  3NM2 A;  1UUV B;  3AGO A;  4HM0 B;  2QEX 3;  1VQ7 3;  5IF6 A;  3DXO A;  4FCJ A;  3JUO A;  1R4C A;  2W0Q A;  3KSP A;  2E2U A;  1VQP 3;  1ULI B;  1YHQ 3;  1QVG 2;  1J2B A;  1LOW A;  2AAD A;  3BLZ A;  4LSO A;  2CWU A;  3FSD A;  1BRH A;  2O9U X;  3N8B A;  3UB1 A;  1LOX A;  3WMD A;  3FKA A;  3CME 3;  4R4K A;  1S72 3;  4XB5 A;  1VQO 3;  3K5T A;  1W7C A;  4XDV A;  3PXM A;  5JBS A;  2RFR A;  1UCL A;  4TX4 A;  3CCE 3;  3SVA A;  2PZV A;  3CD6 3;  2CHC A;  4H61 A;  4KVH A;  3CCJ 3;  1JJ2 2;  3NHX A;  5D82 A;  3S29 A;  1GOV A;  3GWR A;  5BVB A;  3K0Z A;  1LQM B;  2P0M A;  1W6C A;  2IA7 A;  3D5I A;  3DGY A;  2F4Y A;  4HM8 B;  1BNG A;  2IUK A;  5TGN A;  3UJM A;  3CPO A;  1VQK 3;  1Q82 4;  1I8V A;  1CH0 A;  1QJG A;  1DET A;  4N6V 0;  5CXO A;  3NM7 A;  2Z7A A;  5G1K A;  1E3R A;  1GD4 A;  3HIG A;  4BL3 A;  1FGQ A;  4BIR A;  4ORL A;  3UL5 A;  3WOE B;  1MGR A;  3PYJ A;  3SLU A;  1A2V A;  3CNM A;  3LOY A;  1M90 4;  2GBW B;  1B21 A;  1BNI A;  3FZW A;  1JKG B;  2P38 A;  3LT8 A;  1VQ6 3;  1IQY A;  3BIR A;  1E97 A;  2GU3 A;  4O3V A;  1I2F A;  3BND A;  2KRT A;  2CFL A;  2CFW A;  3D3L A;  3D79 A;  3DGN A;  3NV0 A;  3E99 A;  4WHA A;  4N3V A;  1VQQ A;  1Q7Y 4;  3CCU 3;  1BU4 A;  1B2Z A;  1WTH A;  1BRJ A;  1RGL A;  4AKY A;  4N6M A;  1BSC A;  2WOF A;  3N54 B;  3SX1 A;  1NB3 I;  1W4N A;  5LC6 A;  3OX9 A;  1I0V A;  1BNJ A;  3HII A;  3DGM A;  5BU4 A;  5M19 A;  1JNQ A;  4R9L A;  3S27 A;  3MG2 A;  1AVK A;  2MF7 A;  2F5M A;  1UUG B;  3GZY B;  1MGW A;  3IJE B;  1GMP A;  4N6T A;  1V58 A;  1BRG A;  2RSX A;  1FGR A;  4AEQ A;  3PS8 A;  1MWT A;  2W03 A;  4HBR A;  3WR2 A;  1BIR A;  3DH2 A;  3S5C A;  3V92 A;  2V1L A;  1GOY A;  5EEO A;  4H3U A;  5DRE A;  5JPP A;  2ML5 A;  3MKI A;  3LT9 A;  2RBI A;  4MMX B;  1JB2 A;  2R4I A;  2IY2 A;  3EBY A;  4NPB A;  5M1A A;  2FXT A;  3PCS A;  1VQ8 3;  3JUN A;  1R4Y A;  3AHW A;  3NBR A;  5HOH A;  1JV2 B;  1GY5 A;  1NB5 I;  3F40 A;  1GYB A;  2ZDJ A;  4GSP A;  1BRN L;  3K7C A;  1BUQ A;  2CG1 A;  3MPH A;  1RGH A;  2CH9 A;  2CK3 H;  2W6J H;  3FLJ A;  1QAK A;  3OWY A;  4NHF A;  2ML6 A;  4XBT A;  2XGN A;  2YFJ B;  4HM5 B;  1I2G A;  1OPY A;  3URP A;  4BTX A;  2GSP A;  2OOV C;  1RSN A;  1DMN A;  2RCD A;  6GSP A;  2CG0 A;  4OVM A;  4ILF A;  2D1W A;  4JRF A;  4N6N B;  1L5G B;  3NUV A;  3D4A A;  4EV2 A;  3WOD G;  1T2I A;  2CC3 A;  3EN1 B;  2FGT A;  5KP4 A;  3F7S A;  3EE1 A;  2ZHX B;  3KFQ C;  5G2G A;  4FMD A;  1IQX A;  1JBR A;  4LZI A;  3U1W A;  3HZP A;  4STD A;  1FW7 A;  2XH9 A;  3O8Y A;  4N6O B;  1YJ9 3;  1OCV A;  4LEH A;  3DY5 A;  5IEO A;  1IDP A;  1KD1 4;  4OUQ A;  2KCD A;  1SAR A;  1LNH A;  2I9W A;  1ZX2 A;  2BO9 B;  1BRI A;  3PCR A;  1IVW A;  1B20 A;  3FF2 A;  4BL2 A;  1T2H A;  1O7M B;  3JUQ A;  4WP5 A;  1TTO A;  4R9K A;  4BTW A;  3DGL A;  3I0Y A;  1X1U A;  2BMQ B;  4L8P A;  1W00 A;  3CCR 3;  1FGO A;  3CU3 A;  1RN1 A;  2C4B A;  4X2O A;  2Y74 A;  2F86 B;  3NXJ A;  1O7P B;  3ER7 A;  1NNV A;  3NQZ A;  1DVD A;  1OF5 B;  3X41 A;  3Q3F A;  1QMA A;  1RGA A;  3RGA A;  8RNT A;  4QWT A;  3MHE A;  1VZZ A;  1UCK A;  2B24 B;  5CF1 A;  3I55 3;  1QVF 2;  3AHS A;  5EQL A;  1RMS A;  4HZB B;  3G16 A;  4I4K A; 
#chains in the Genus database with same CATH homology
 1RCL A;  1C54 A;  1I8V A;  2ZA4 A;  1CH0 A;  1IYY A;  1DET A;  5BIR A;  4J5K A;  1DE3 A;  1FYS A;  6RNT A;  3SYU A;  5RNT A;  1RGC A;  4BIR A;  4HOH A;  2KF5 A;  1MGR A;  1RGG A;  1B21 A;  1BNI A;  1BUJ A;  1I70 A;  1FUT A;  1GSP A;  1GOU A;  3BIR A;  1I2F A;  2KF4 A;  1X1X A;  1BAN A;  1BSA A;  1RN4 A;  2KAA A;  3WHO A;  1Q9E A;  1JBT A;  1RTU A;  1YNV X;  1BU4 A;  1B2Z A;  1X1Y A;  1BRJ A;  1RGL A;  3RNT A;  1LRA A;  1BSC A;  2HOH A;  3HOH A;  1RGE A;  1B2X A;  1I0V A;  1BNJ A;  1X1W A;  5BU4 A;  1BRS A;  1RHL A;  2BIR A;  1PYL A;  4GHO A;  3D5G A;  1BAO A;  1AQZ A;  2AAE A;  2F5M A;  3DGY A;  1RGK A;  1BSE A;  1GMQ A;  1MGW A;  1GMP A;  2BU4 A;  7GSP A;  1BRG A;  1BRK A;  3KCH A;  1I3I A;  1RGF A;  3WR2 A;  1BIR A;  1GMR A;  3DH2 A;  1GOY A;  4HAA A;  1FZU A;  2KF6 A;  2F56 A;  2RBI A;  3AGN A;  9RNT A;  1BGS A;  1B2U A;  1FUS A;  1R4Y A;  3AHW A;  5HOH A;  1RDS A;  1HYF A;  1TRQ A;  1BRN L;  4GSP A;  1LNI A;  1I0X A;  1BVI A;  1RGH A;  1LOY A;  1A2P A;  1PY3 A;  1BNF A;  2RNT A;  1BNE A;  3BU4 A;  1I2E A;  1I2G A;  3URP A;  1AY7 A;  2GSP A;  1RSN A;  1BNS A;  6GSP A;  1B3S A;  1BSD A;  4RNT A;  1B27 A;  1RCK A;  1BNR A;  3D4A A;  1RNB A;  1T2I A;  1BOX A;  1LOV A;  1JBR A;  1ZGX A;  1B2M A;  1RLS A;  1JBS A;  1FW7 A;  4BU4 A;  1YVS A;  2KF3 A;  4J5G A;  5GSP A;  1BSB A;  1B2S A;  1TRP A;  3AGO A;  1HZ1 A;  1SAR A;  1BRI A;  1B20 A;  1LOW A;  2AAD A;  1T2H A;  1UCI A;  3A5E A;  1YGW A;  1TTO A;  1BRH A;  1I3F A;  1X1U A;  3GSP A;  1RN1 A;  1RNT A;  2F5W A;  1UCL A;  2C4B A;  1G02 A;  3Q3F A;  1UCJ A;  1RGA A;  1GOV A;  7RNT A;  8RNT A;  1UCK A;  2SAR A;  3AHS A;  1RMS A;  3D5I A;  2F4Y A;  1BNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...