1T2IA

T76w mutant of rnase sa from streptomyces aureofaciens
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEAWQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of single tryptophan residues to the fluorescence and stability of ribonuclease sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 25
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1t2iA00
2AAEA 1AY7A 1BSEA 1I0VA 3GSPA 1B3SA 1BUJA 2RNTA 4RNTA 1T2IA 1B2ZA 1RGHA 1BRIA 1BNGA 2KF4A 1I0XA 1YNVX 4GSPA 1BSAA 1MGWA 6RNTA 7RNTA 9RNTA 2AADA 3WR2A 4BIRA 1BNJA 1I3FA 3BU4A 4GHOA 2BIRA 1X1UA 1RCLA 1IYYA 1BSBA 3AHWA 1I2EA 3HOHA 1YVSA 4HOHA 1RHLA 1SARA 1BNSA 1BRSA 1CH0A 4J5KA 1I2GA 1BNFA 1TTOA 1UCJA 3D5IA 2KF3A 1BNIA 1JBTA 5GSPA 1FUTA 1PY3A 1GOVA 3SYUA 1GMQA 7GSPA 1RSNA 1HYFA 1BSDA 1X1YA 1UCKA 1I70A 2SARA 3URPA 1RDSA 1BSCA 1B21A 1BIRA 1RNBA 1DE3A 1RN1A 3D5GA 1B27A 2ZA4A 3BIRA 1JBSA 1BGSA 1GOYA 1YGWA 5RNTA 2KF5A 1B2XA 1ZGXA 1I8VA 1B2UA 2RBIA 3RNTA 3AHSA 3Q3FA 1LNIA 1C54A 1GSPA 1I2FA 1Q9EA 1X1WA 3DGYA 1RMSA 1TRPA 1GMRA 2C4BA 3WHOA 2KF6A 1TRQA 1MGRA 5BIRA 2HOHA 4HAAA 1LOWA 1BOXA 1LOVA 1BRGA 3DH2A 1RGLA 3AGOA 1G02A 2F4YA 3D4AA 1LRAA 2KAAA 3KCHA 1BRNL 4J5GA 1AQZA 1BRJA 5HOHA 1BANA 1RGAA 1B2SA 1JBRA 1RNTA 1R4YA 1UCLA 1BRKA 1T2HA 4BU4A 1BVIA 2BU4A 1B2MA 1A2PA 1GOUA 2F56A 1PYLA 1RGEA 1BNRA 1FYSA 1I3IA 8RNTA 1RN4A 1X1XA 1RGKA 5BU4A 1HZ1A 1BAOA 2F5MA 1UCIA 1RTUA 1RGFA 1RGGA 3A5EA 1BNEA 1GMPA 3AGNA 1BU4A 2GSPA 1BRHA 2F5WA 1RLSA 1B20A 6GSPA 1LOYA 1FUSA 1FW7A 1DETA 1RGCA 1RCKA 1FZUA
chains in the Genus database with same CATH superfamily
1AY7A 1LVNA 3B4PA 3F9SA 1M9GA 1W7CA 2Z77A 1BSEA 3PXMA 2CG0A 1EQKA 1N9JA 2J8XB 1N5HA 3FH1A 3X40A 3PCSA 1BUJA 4RNTA 2CW9A 2KF4A 4MJDA 3LT8A 1I0XA 2CX1A 2YFLB 1S5AA 4GSPA 1JKGB 2AADA 3FCSB 3T8UA 5CLKA 1W5ZA 1TJDA 3NHXA 3G16A 2XFSA 3BU4A 4GHOA 2MF7A 2W9QA 1RCLA 3BNCA 4L8OA 1BSBA 4N6MA 2E2VA 1OHSA 2P0XA 4WYKB 1JN5B 4HOHA 2QA43 3LMLA 2K0MA 3CCQ3 2GBWB 5EQLA 1WMNA 3ER7A 3H3HA 1BNSA 2QEX3 4J5KA 1OACA 2LYXA 4HJLB 1JZDA 1BNFA 2CWUA 2GU1A 3RDEA 1CQSA 2KF3A 1N5PA 3V99A 1IQYA 1FUTA 3DZLA 3ZG5A 4OVMA 2K54A 1U5OA 1BSDA 1X1YA 3S27A 2HMOB 5G2GA 1I70A 4GL6A 2F86B 2W04A 3X3YA 3CCM3 1GYBA 1BIRA 4XDVA 1UGIA 2CIUA 2WOHA 1N8QA 5I97A 1MNLA 2QIYA 3WA3A 1DE3A 3F14A 3F40A 3F7SA 5ELJA 2ZA4A 1ROVA 1BGSA 5EVHA 3K5TA 3UL6A 3LYGA 1NJI4 1YHQ3 3PZWA 1YJN3 1B2XA 1W4NA 3OV4A 3NV0B 4RNZA 1WMPA 1VQO3 1I8VA 4EYCA 3MHEA 3NM2A 1OHPA 3DY5A 3EB8A 4NREA 2IUKA 1O7MB 2ML6A 7STDA 2XGLA 1ROAA 3NBRA 2MC8A 1LOXA 2XSHB 4OK0A 2C4BA 2XEPA 3WHOA 1M1K4 1TRQA 1OGZA 3CNXA 3S29A 2O3OA 2KCDA 2IYJA 4CPKA 4K61A 4EXRA 2WGQA 3DGNA 3DH2A 3STDA 2O9UX 3D79A 1E3RA 5EEOA 1JKGA 3CPOA 2BMOB 1E97A 3BLZA 1YJW3 2F4YA 3ZG0A 3KCHA 1V58A 4N6NB 8CHOA 4X2OA 1GY5A 1K9M4 3GRDA 1A2KA 1T3BA 3VGNA 2A15A 1HKXA 1D6YA 3PCRA 3H51A 2H0HA 1WMOA 1RNTA 1GD3A 1WNHA 1W6YA 3HX8A 3WOEB 1AVLA 1IDPA 2IUJA 5IG4A 1T2HA 1MOLA 1KWIA 1Q40A 1IV7A 4KFFA 2JDIH 1KD14 2CFDA 3DMCA 1BUQA 3SOAA 1RGEA 1BNRA 3KIIA 2CFKA 4H3UA 1RN4A 1K8A4 1RGKA 3Q90A 1VQ63 3K0ZA 4LEHA 1UCIA 3GZXB 1BU4A 1VQ53 3HZPA 2Z76A 2F5WA 4J8TA 2B24B 1LQGC 2W2CA 1RLSA 1B20A 4EW5A 2H0IA 3CCR3 1RGCA 1O7NB 4K90B 3SEDA 1U8CB 1WTHA 1FZUA 2BMQB 1ZX2A 1NU3A 3NV0A 4FCJA 2OOVA 3S5CA 4STDA 1OHOA 1UUGB 3MG3A 3CD63 3BB9A 1AV4A 1JZOA 3GSPA 4OUQA 1VQM3 3UB1A 1BRIA 1BNGA 4HM0B 1YNVX 2KRTA 2PZVA 3MSOA 1MGWA 5KP3A 5D81A 1QAFA 1PU4A 1Q7Y4 1EKMA 1SIHA 4MEIA 1QALA 1UUWB 3VF1A 5JPPA 1AR0A 1YJ93 1FGTA 1I3FA 1OH0A 3T8NA 3NUVA 3FSDA 1S723 4RNYA 1X1UA 1OPYA 1ZO2A 2CX0A 1LNHA 5LC6A 2E2TA 3AHWA 1RKYA 2HMLB 3HOHA 3CC73 1YIT3 1K41A 4HM1B 1VQ83 4EBGA 1RHLA 1K28A 2Z7AA 1CH0A 1VQQA 4ZM8A 4KFEA 4HM6B 1QVG2 1BNIA 2GU3A 4HZ9B 2RGQA 5GSPA 3TDGA 1UUVB 1GOVA 3NBBA 3OWUA 1VQ93 1HYFA 1W02A 2CHCA 2GBXB 1UCKA 2F99A 4XBYA 4HM4B 2SARA 3S67A 4IIAA 1RDSA 3EBTA 1BSCA 3KSPA 4EC6A 3FF0A 3JVCA 1RNBA 1JB2A 1W2ZA 3CXC2 3D5GA 1B27A 3O8YA 1O7GB 3I563 1GOYA 1YGWA 5RNTA 1VQL3 4HM7B 1JV2B 1PFPA 1ZGXA 4BTXA 1O7WB 1MWRA 3KZTA 1B2UA 2OTL3 3NBJA 1W6CA 5IEOA 2RCDA 3JUMA 3AHSA 3DM8A 1TFOA 1V74A 3Q3FA 4ILFA 4WWUC 1US1A 2XSOB 1C54A 1I2FA 1D6ZA 1GD4A 2W56B 1RRHA 3DUKA 2PNCA 3KE7A 4FCZA 4N6V0 2FGTA 3F8HA 5AIHA 5CF2A 4BL2A 5CF1A 1TRPA 1GMRA 1T5YA 4AEQA 2CC3A 3I0YA 3B8LA 3GWRA 4KT3B 4R4KA 2KF6A 5AIIA 5AEWB 1UW1A 2ZL8A 5BIRA 2C11A 3IPTA 1LOWA 1VQ43 1RGLA 4FMCA 2IY2A 3AGOA 4BL3A 3SX1A 1TIJA 1TFKA 1W01A 2H0GA 3BNEA 3D4AA 3N8BA 3DGLA 5LC7A 4J5GA 1AQZA 1MWSA 2BNGA 4KFDA 4ORLA 1YI23 1DMMA 1NO3A 1J2BA 4JRFA 1B2SA 1R4YA 3AMOB 1OUNA 1UCLA 3K63A 1JB4A 4HKVB 3MYTA 2Y73A 4R1KA 2BMRB 1QVF2 1BVIA 1LXEA 3LTBA 1KC84 1A2PA 1ASKA 1E3VA 1FGQA 1GOUA 2F56A 4WFOA 1I3IA 3F7XA 8RNTA 2CFLA 1X1XA 4RZMA 2W0QA 2WOFA 4CCVA 2HMJB 1ISKA 1Z1SA 1HZ1A 3SVAA 4CJNA 1RTUA 2JQ5A 3DGMA 1GY6A 3LH4A 3LTDA 1FGMA 5D83A 5IENA 1KSIA 2FNQA 2GSPA 4N6LA 1BRHA 3NQYA 2KXGA 3OW22 1Q42A 5IEPA 3CCV3 1FGOA 2FXTA 3EQQB 6GSPA 1FUSA 3LXUX 1HU9A 1DETA 3V92A 2M7OA 4PEJA 1SJWA 1YVBI 2AAEA 3IMAB 4WYKA 1JN5A 2UGIA 5D82A 2ZHXB 1I0VA 4LYLB 1B3SA 4U13A 1YGEA 4TX4A 1T2IA 1B2ZA 2CWTA 4AKYA 2K3DA 2P09A 4Q53A 1Q814 4RBNA 6RNTA 7RNTA 9RNTA 4HM2B 4MMXB 4I4KA 1IQ8A 5CXOA 1CYUA 2R4IA 2W6JH 3WR2A 5BXQA 2HMMB 1IVWA 3ROBA 2HMNB 4XDWA 4O02B 3SOYA 1VQK3 3FG1A 1M904 2V1LA 4HM8B 1JNQA 2P38A 2WO0A 3JUPA 1I2EA 1JB5A 1YVSA 2BO9B 1QMAA 1GY7A 3Q2PA 1IT8A 1O7HB 1SARA 3N54B 5FW5A 4LMIA 4WP5A 4LGQA 4KVHA 1IT7A 1TTOA 2L4VA 4L7KA 3CMA3 3D5IA 4R80A 3WOFB 1VQ73 3QRDA 5IG0A 4EV5A 1C7HA 1RN7A 1Q7HA 1GMQA 3RGAA 7GSPA 1L5GB 3CCE3 1RSNA 2OWPA 4FMDA 5TGNA 3ALAA 2RFRA 1ULIB 3CPW2 1LQMB 3URPA 1DYUA 1G0TA 3CNMA 4BTYA 3EF8A 2OTJ3 1Q864 3I553 1STFI 2UUGC 3HK4A 1RN1A 3ECFA 3OWYA 3UNLA 3MG1A 1A90A 1V57A 2F98A 3CCS3 2GXFA 5M19A 3CME3 5STDA 4H61A 3KFQC 3EC9A 3RNTA 2YX9A 6STDA 4IPBA 3A76A 3U97A 3EHCA 3X3ZA 3FG3A 3L0RA 3SXXA 1Q9EA 3G0KA 1D6UA 3DGYA 1RMSA 5M1AA 4CDLA 4R9KA 3GAXA 1MGRA 2SBLA 1IK3A 3NQZA 2XFTA 2HOHA 3LTCA 4K1VA 5G1LA 3WA2X 4HAAA 4HM5B 2R41A 1BOXA 1LOVA 4XBXA 1BRGA 2CFWA 3FKAA 5AIFA 3ZFZA 1ULJB 3U1WA 1G02A 2P05A 2CH9A 2CK3H 4WHAA 3E99A 1BRNL 1BRJA 5HOHA 2OQEC 1N9EA 1STDA 1BANA 5DRVA 1NB3I 3SLUA 4KZ1A 3MPHA 1EA2A 3Q1CA 4FR9A 4N3VA 2BHMA 2XH9A 5AYSC 2BT3A 1A2VA 3K7CA 1BRKA 1EUIC 1OF5B 2CKFB 2CWVA 2STDA 3B7CA 2W03A 5AIGA 5HGRA 5G1KA 1UI8A 1M1XB 3CCU3 5IERA 1UGHI 1B2MA 4L8PA 1Q824 4AKZA 1MWTA 2B1XB 5M18A 1KQS2 5BU4A 4HZBB 3UJMA 2ML5A 1UI7A 1RGGA 3NX0A 1ZS7A 1BNEA 1GMPA 3A5EA 1IU7A 3OXAA 3LZAA 3LOYA 1LOYA 4LSOA 2L1SA 1IVXA 3S28A 2D1WA 3DGOA 3GZBA 3NXJA 3FGYA 1Q40B 1SIIA 4JF8A 3X42A 2YFJB 3KN4A 5AI1A 4GB5A 1G96A 4QWTA 2WGOA 3NM7A 4X2HA 3JUQA 4XBTA 1W2B2 2RNTA 3GZYB 1RGHA 2OQEA 1YIJ3 4IT7A 1QJGA 3X41A 1Y4KA 1VQN3 1BSAA 3EN8A 2E2UA 2LQVA 2I9WA 5AEUB 3G6E3 4N6OB 1VZZA 3CU3A 1BNJA 3VSYA 4BIRA 5IG5A 2BIRA 3F8XA 3M8CA 3LTAA 4K1UA 1IYYA 2INXA 3MG2A 3B4OA 4NPBA 4O3VA 3G713 4N6UA 1NDOB 5KP4A 1OCVA 3X3XA 2IA7A 3G8ZA 1RRLA 1BRSA 1I2GA 1EG9B 5DREA 1FUWA 2Z6BA 3N9HA 1UCJA 1FGRA 1A67A 3KKGA 3FG4A 1JBTA 3LT9A 1NWWA 1PY3A 3SYUA 1GS3A 3FF2A 2Q07A 1JRQA 4XB5A 3OWSA 5FGOA 2OCTA 1F8NA 4I5QA 3KSED 1OF5A 1TP6A 1DVDA 2W56A 1JJ22 2XF3A 5JBSA 3GZRA 1B21A 3WDGB 3PS8A 5IG3A 4XM4A 3FZWA 2OOVC 3JUOA 4HM3B 1TUHA 3BIRA 1JBSA 4G1MB 1IVVA 4DKIA 4HYZA 4FMBA 2GEYA 2KF5A 1SQWA 2CFGA 3PGBA 3G4S3 1TU5A 1N8R4 2RBIA 1W00A 3FLJA 5BVBA 2YFIB 3PYJA 1EEJA 2P0MA 4EV2A 3JUNA 1LNIA 2GEXA 3IJEB 1GSPA 1W6GA 3EBYA 1MWUA 2Y74A 3HI7A 1X1WA 4HVNA 3WODG 1K734 4O2HA 1VQP3 2CG1A 3CCJ3 1UDII 1RJOA 3AMOA 3MWZA 5A0OB 3CC23 2RSXA 4NHFA 3CCL3 3HIIA 3QK9A 1DMQA 1OGXA 3EX9A 4J9AA 5CK6A 1DVCA 5AYRB 3WMDA 1NNVA 3DXOA 4FMAA 4HBRA 3UL5A 1LRAA 2IMJA 2KAAA 1IV9A 1R4CA 2C10A 2XRXB 2W9PA 3BNDA 3T0UA 3EJVA 1CEWI 3K9MC 4R9LA 1RGAA 3D9RA 1JBRA 1DMNA 3HIGA 2UX0A 3OX9A 3RGRA 1O7PB 3CC43 1IQXA 4FCMA 2HMKB 1AVKA 5JPUA 4BU4A 5KP1A 2BU4A 2D42A 1WQLB 3V98A 1SPUA 5IW9A 1PYLA 2ZDJA 1FYSA 4N6TA 5IF6A 5ELUA 2QGUA 4LZIA 1IVUA 1CYVA 1BAOA 2XGNA 2F5MA 3J7Yd 3D3LA 3BNBA 1RGFA 3AGNA 1QAKA 3EE1A 4BTWA 1FA3A 4MMYB 2XR8B 1FW7A 4O8SA 3EN1B 4MMZB 1RCKA 3MKIA 1NB5I
chains in the Genus database with same CATH topology
2AAEA 1AY7A 1BSEA 1I0VA 3GSPA 1B3SA 1BUJA 2RNTA 4RNTA 1T2IA 1B2ZA 1RGHA 1BRIA 1BNGA 2KF4A 1I0XA 1YNVX 4GSPA 1BSAA 1MGWA 6RNTA 7RNTA 9RNTA 2AADA 3WR2A 4BIRA 1BNJA 1I3FA 3BU4A 4GHOA 2BIRA 1X1UA 1RCLA 1IYYA 1BSBA 3AHWA 1I2EA 3HOHA 1YVSA 4HOHA 1RHLA 1SARA 1BNSA 1BRSA 1CH0A 4J5KA 1I2GA 1BNFA 1TTOA 1UCJA 3D5IA 2KF3A 1BNIA 1JBTA 5GSPA 1FUTA 1PY3A 1GOVA 3SYUA 1GMQA 7GSPA 1RSNA 1HYFA 1BSDA 1X1YA 1UCKA 1I70A 2SARA 3URPA 1RDSA 1BSCA 1B21A 1BIRA 1RNBA 1DE3A 1RN1A 3D5GA 1B27A 2ZA4A 3BIRA 1JBSA 1BGSA 1GOYA 1YGWA 5RNTA 2KF5A 1B2XA 1ZGXA 1I8VA 1B2UA 2RBIA 3RNTA 3AHSA 3Q3FA 1LNIA 1C54A 1GSPA 1I2FA 1Q9EA 1X1WA 3DGYA 1RMSA 1TRPA 1GMRA 2C4BA 3WHOA 2KF6A 1TRQA 1MGRA 5BIRA 2HOHA 4HAAA 1LOWA 1BOXA 1LOVA 1BRGA 3DH2A 1RGLA 3AGOA 1G02A 2F4YA 3D4AA 1LRAA 2KAAA 3KCHA 1BRNL 4J5GA 1AQZA 1BRJA 5HOHA 1BANA 1RGAA 1B2SA 1JBRA 1RNTA 1R4YA 1UCLA 1BRKA 1T2HA 4BU4A 1BVIA 2BU4A 1B2MA 1A2PA 1GOUA 2F56A 1PYLA 1RGEA 1BNRA 1FYSA 1I3IA 8RNTA 1RN4A 1X1XA 1RGKA 5BU4A 1HZ1A 1BAOA 2F5MA 1UCIA 1RTUA 1RGFA 1RGGA 3A5EA 1BNEA 1GMPA 3AGNA 1BU4A 2GSPA 1BRHA 2F5WA 1RLSA 1B20A 6GSPA 1LOYA 1FUSA 1FW7A 1DETA 1RGCA 1RCKA 1FZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAE A;  1AY7 A;  1BSE A;  1I0V A;  3GSP A;  1B3S A;  1BUJ A;  2RNT A;  4RNT A;  1T2I A;  1B2Z A;  1RGH A;  1BRI A;  1BNG A;  2KF4 A;  1I0X A;  1YNV X;  4GSP A;  1BSA A;  1MGW A;  6RNT A;  7RNT A;  9RNT A;  2AAD A;  3WR2 A;  4BIR A;  1BNJ A;  1I3F A;  3BU4 A;  4GHO A;  2BIR A;  1X1U A;  1RCL A;  1IYY A;  1BSB A;  3AHW A;  1I2E A;  3HOH A;  1YVS A;  4HOH A;  1RHL A;  1SAR A;  1BNS A;  1BRS A;  1CH0 A;  4J5K A;  1I2G A;  1BNF A;  1TTO A;  1UCJ A;  3D5I A;  2KF3 A;  1BNI A;  1JBT A;  5GSP A;  1FUT A;  1PY3 A;  1GOV A;  3SYU A;  1GMQ A;  7GSP A;  1RSN A;  1HYF A;  1BSD A;  1X1Y A;  1UCK A;  1I70 A;  2SAR A;  3URP A;  1RDS A;  1BSC A;  1B21 A;  1BIR A;  1RNB A;  1DE3 A;  1RN1 A;  3D5G A;  1B27 A;  2ZA4 A;  3BIR A;  1JBS A;  1BGS A;  1GOY A;  1YGW A;  5RNT A;  2KF5 A;  1B2X A;  1ZGX A;  1I8V A;  1B2U A;  2RBI A;  3RNT A;  3AHS A;  3Q3F A;  1LNI A;  1C54 A;  1GSP A;  1I2F A;  1Q9E A;  1X1W A;  3DGY A;  1RMS A;  1TRP A;  1GMR A;  2C4B A;  3WHO A;  2KF6 A;  1TRQ A;  1MGR A;  5BIR A;  2HOH A;  4HAA A;  1LOW A;  1BOX A;  1LOV A;  1BRG A;  3DH2 A;  1RGL A;  3AGO A;  1G02 A;  2F4Y A;  3D4A A;  1LRA A;  2KAA A;  3KCH A;  1BRN L;  4J5G A;  1AQZ A;  1BRJ A;  5HOH A;  1BAN A;  1RGA A;  1B2S A;  1JBR A;  1RNT A;  1R4Y A;  1UCL A;  1BRK A;  1T2H A;  4BU4 A;  1BVI A;  2BU4 A;  1B2M A;  1A2P A;  1GOU A;  2F56 A;  1PYL A;  1RGE A;  1BNR A;  1FYS A;  1I3I A;  8RNT A;  1RN4 A;  1X1X A;  1RGK A;  5BU4 A;  1HZ1 A;  1BAO A;  2F5M A;  1UCI A;  1RTU A;  1RGF A;  1RGG A;  3A5E A;  1BNE A;  1GMP A;  3AGN A;  1BU4 A;  2GSP A;  1BRH A;  2F5W A;  1RLS A;  1B20 A;  6GSP A;  1LOY A;  1FUS A;  1FW7 A;  1DET A;  1RGC A;  1RCK A;  1FZU A; 
#chains in the Genus database with same CATH topology
 1AY7 A;  1LVN A;  3B4P A;  3F9S A;  1M9G A;  1W7C A;  2Z77 A;  1BSE A;  3PXM A;  2CG0 A;  1EQK A;  1N9J A;  2J8X B;  1N5H A;  3FH1 A;  3X40 A;  3PCS A;  1BUJ A;  4RNT A;  2CW9 A;  2KF4 A;  4MJD A;  3LT8 A;  1I0X A;  2CX1 A;  2YFL B;  1S5A A;  4GSP A;  1JKG B;  2AAD A;  3FCS B;  3T8U A;  5CLK A;  1W5Z A;  1TJD A;  3NHX A;  3G16 A;  2XFS A;  3BU4 A;  4GHO A;  2MF7 A;  2W9Q A;  1RCL A;  3BNC A;  4L8O A;  1BSB A;  4N6M A;  2E2V A;  1OHS A;  2P0X A;  4WYK B;  1JN5 B;  4HOH A;  2QA4 3;  3LML A;  2K0M A;  3CCQ 3;  2GBW B;  5EQL A;  1WMN A;  3ER7 A;  3H3H A;  1BNS A;  2QEX 3;  4J5K A;  1OAC A;  2LYX A;  4HJL B;  1JZD A;  1BNF A;  2CWU A;  2GU1 A;  3RDE A;  1CQS A;  2KF3 A;  1N5P A;  3V99 A;  1IQY A;  1FUT A;  3DZL A;  3ZG5 A;  4OVM A;  2K54 A;  1U5O A;  1BSD A;  1X1Y A;  3S27 A;  2HMO B;  5G2G A;  1I70 A;  4GL6 A;  2F86 B;  2W04 A;  3X3Y A;  3CCM 3;  1GYB A;  1BIR A;  4XDV A;  1UGI A;  2CIU A;  2WOH A;  1N8Q A;  5I97 A;  1MNL A;  2QIY A;  3WA3 A;  1DE3 A;  3F14 A;  3F40 A;  3F7S A;  5ELJ A;  2ZA4 A;  1ROV A;  1BGS A;  5EVH A;  3K5T A;  3UL6 A;  3LYG A;  1NJI 4;  1YHQ 3;  3PZW A;  1YJN 3;  1B2X A;  1W4N A;  3OV4 A;  3NV0 B;  4RNZ A;  1WMP A;  1VQO 3;  1I8V A;  4EYC A;  3MHE A;  3NM2 A;  1OHP A;  3DY5 A;  3EB8 A;  4NRE A;  2IUK A;  1O7M B;  2ML6 A;  7STD A;  2XGL A;  1ROA A;  3NBR A;  2MC8 A;  1LOX A;  2XSH B;  4OK0 A;  2C4B A;  2XEP A;  3WHO A;  1M1K 4;  1TRQ A;  1OGZ A;  3CNX A;  3S29 A;  2O3O A;  2KCD A;  2IYJ A;  4CPK A;  4K61 A;  4EXR A;  2WGQ A;  3DGN A;  3DH2 A;  3STD A;  2O9U X;  3D79 A;  1E3R A;  5EEO A;  1JKG A;  3CPO A;  2BMO B;  1E97 A;  3BLZ A;  1YJW 3;  2F4Y A;  3ZG0 A;  3KCH A;  1V58 A;  4N6N B;  8CHO A;  4X2O A;  1GY5 A;  1K9M 4;  3GRD A;  1A2K A;  1T3B A;  3VGN A;  2A15 A;  1HKX A;  1D6Y A;  3PCR A;  3H51 A;  2H0H A;  1WMO A;  1RNT A;  1GD3 A;  1WNH A;  1W6Y A;  3HX8 A;  3WOE B;  1AVL A;  1IDP A;  2IUJ A;  5IG4 A;  1T2H A;  1MOL A;  1KWI A;  1Q40 A;  1IV7 A;  4KFF A;  2JDI H;  1KD1 4;  2CFD A;  3DMC A;  1BUQ A;  3SOA A;  1RGE A;  1BNR A;  3KII A;  2CFK A;  4H3U A;  1RN4 A;  1K8A 4;  1RGK A;  3Q90 A;  1VQ6 3;  3K0Z A;  4LEH A;  1UCI A;  3GZX B;  1BU4 A;  1VQ5 3;  3HZP A;  2Z76 A;  2F5W A;  4J8T A;  2B24 B;  1LQG C;  2W2C A;  1RLS A;  1B20 A;  4EW5 A;  2H0I A;  3CCR 3;  1RGC A;  1O7N B;  4K90 B;  3SED A;  1U8C B;  1WTH A;  1FZU A;  2BMQ B;  1ZX2 A;  1NU3 A;  3NV0 A;  4FCJ A;  2OOV A;  3S5C A;  4STD A;  1OHO A;  1UUG B;  3MG3 A;  3CD6 3;  3BB9 A;  1AV4 A;  1JZO A;  3GSP A;  4OUQ A;  1VQM 3;  3UB1 A;  1BRI A;  1BNG A;  4HM0 B;  1YNV X;  2KRT A;  2PZV A;  3MSO A;  1MGW A;  5KP3 A;  5D81 A;  1QAF A;  1PU4 A;  1Q7Y 4;  1EKM A;  1SIH A;  4MEI A;  1QAL A;  1UUW B;  3VF1 A;  5JPP A;  1AR0 A;  1YJ9 3;  1FGT A;  1I3F A;  1OH0 A;  3T8N A;  3NUV A;  3FSD A;  1S72 3;  4RNY A;  1X1U A;  1OPY A;  1ZO2 A;  2CX0 A;  1LNH A;  5LC6 A;  2E2T A;  3AHW A;  1RKY A;  2HML B;  3HOH A;  3CC7 3;  1YIT 3;  1K41 A;  4HM1 B;  1VQ8 3;  4EBG A;  1RHL A;  1K28 A;  2Z7A A;  1CH0 A;  1VQQ A;  4ZM8 A;  4KFE A;  4HM6 B;  1QVG 2;  1BNI A;  2GU3 A;  4HZ9 B;  2RGQ A;  5GSP A;  3TDG A;  1UUV B;  1GOV A;  3NBB A;  3OWU A;  1VQ9 3;  1HYF A;  1W02 A;  2CHC A;  2GBX B;  1UCK A;  2F99 A;  4XBY A;  4HM4 B;  2SAR A;  3S67 A;  4IIA A;  1RDS A;  3EBT A;  1BSC A;  3KSP A;  4EC6 A;  3FF0 A;  3JVC A;  1RNB A;  1JB2 A;  1W2Z A;  3CXC 2;  3D5G A;  1B27 A;  3O8Y A;  1O7G B;  3I56 3;  1GOY A;  1YGW A;  5RNT A;  1VQL 3;  4HM7 B;  1JV2 B;  1PFP A;  1ZGX A;  4BTX A;  1O7W B;  1MWR A;  3KZT A;  1B2U A;  2OTL 3;  3NBJ A;  1W6C A;  5IEO A;  2RCD A;  3JUM A;  3AHS A;  3DM8 A;  1TFO A;  1V74 A;  3Q3F A;  4ILF A;  4WWU C;  1US1 A;  2XSO B;  1C54 A;  1I2F A;  1D6Z A;  1GD4 A;  2W56 B;  1RRH A;  3DUK A;  2PNC A;  3KE7 A;  4FCZ A;  4N6V 0;  2FGT A;  3F8H A;  5AIH A;  5CF2 A;  4BL2 A;  5CF1 A;  1TRP A;  1GMR A;  1T5Y A;  4AEQ A;  2CC3 A;  3I0Y A;  3B8L A;  3GWR A;  4KT3 B;  4R4K A;  2KF6 A;  5AII A;  5AEW B;  1UW1 A;  2ZL8 A;  5BIR A;  2C11 A;  3IPT A;  1LOW A;  1VQ4 3;  1RGL A;  4FMC A;  2IY2 A;  3AGO A;  4BL3 A;  3SX1 A;  1TIJ A;  1TFK A;  1W01 A;  2H0G A;  3BNE A;  3D4A A;  3N8B A;  3DGL A;  5LC7 A;  4J5G A;  1AQZ A;  1MWS A;  2BNG A;  4KFD A;  4ORL A;  1YI2 3;  1DMM A;  1NO3 A;  1J2B A;  4JRF A;  1B2S A;  1R4Y A;  3AMO B;  1OUN A;  1UCL A;  3K63 A;  1JB4 A;  4HKV B;  3MYT A;  2Y73 A;  4R1K A;  2BMR B;  1QVF 2;  1BVI A;  1LXE A;  3LTB A;  1KC8 4;  1A2P A;  1ASK A;  1E3V A;  1FGQ A;  1GOU A;  2F56 A;  4WFO A;  1I3I A;  3F7X A;  8RNT A;  2CFL A;  1X1X A;  4RZM A;  2W0Q A;  2WOF A;  4CCV A;  2HMJ B;  1ISK A;  1Z1S A;  1HZ1 A;  3SVA A;  4CJN A;  1RTU A;  2JQ5 A;  3DGM A;  1GY6 A;  3LH4 A;  3LTD A;  1FGM A;  5D83 A;  5IEN A;  1KSI A;  2FNQ A;  2GSP A;  4N6L A;  1BRH A;  3NQY A;  2KXG A;  3OW2 2;  1Q42 A;  5IEP A;  3CCV 3;  1FGO A;  2FXT A;  3EQQ B;  6GSP A;  1FUS A;  3LXU X;  1HU9 A;  1DET A;  3V92 A;  2M7O A;  4PEJ A;  1SJW A;  1YVB I;  2AAE A;  3IMA B;  4WYK A;  1JN5 A;  2UGI A;  5D82 A;  2ZHX B;  1I0V A;  4LYL B;  1B3S A;  4U13 A;  1YGE A;  4TX4 A;  1T2I A;  1B2Z A;  2CWT A;  4AKY A;  2K3D A;  2P09 A;  4Q53 A;  1Q81 4;  4RBN A;  6RNT A;  7RNT A;  9RNT A;  4HM2 B;  4MMX B;  4I4K A;  1IQ8 A;  5CXO A;  1CYU A;  2R4I A;  2W6J H;  3WR2 A;  5BXQ A;  2HMM B;  1IVW A;  3ROB A;  2HMN B;  4XDW A;  4O02 B;  3SOY A;  1VQK 3;  3FG1 A;  1M90 4;  2V1L A;  4HM8 B;  1JNQ A;  2P38 A;  2WO0 A;  3JUP A;  1I2E A;  1JB5 A;  1YVS A;  2BO9 B;  1QMA A;  1GY7 A;  3Q2P A;  1IT8 A;  1O7H B;  1SAR A;  3N54 B;  5FW5 A;  4LMI A;  4WP5 A;  4LGQ A;  4KVH A;  1IT7 A;  1TTO A;  2L4V A;  4L7K A;  3CMA 3;  3D5I A;  4R80 A;  3WOF B;  1VQ7 3;  3QRD A;  5IG0 A;  4EV5 A;  1C7H A;  1RN7 A;  1Q7H A;  1GMQ A;  3RGA A;  7GSP A;  1L5G B;  3CCE 3;  1RSN A;  2OWP A;  4FMD A;  5TGN A;  3ALA A;  2RFR A;  1ULI B;  3CPW 2;  1LQM B;  3URP A;  1DYU A;  1G0T A;  3CNM A;  4BTY A;  3EF8 A;  2OTJ 3;  1Q86 4;  3I55 3;  1STF I;  2UUG C;  3HK4 A;  1RN1 A;  3ECF A;  3OWY A;  3UNL A;  3MG1 A;  1A90 A;  1V57 A;  2F98 A;  3CCS 3;  2GXF A;  5M19 A;  3CME 3;  5STD A;  4H61 A;  3KFQ C;  3EC9 A;  3RNT A;  2YX9 A;  6STD A;  4IPB A;  3A76 A;  3U97 A;  3EHC A;  3X3Z A;  3FG3 A;  3L0R A;  3SXX A;  1Q9E A;  3G0K A;  1D6U A;  3DGY A;  1RMS A;  5M1A A;  4CDL A;  4R9K A;  3GAX A;  1MGR A;  2SBL A;  1IK3 A;  3NQZ A;  2XFT A;  2HOH A;  3LTC A;  4K1V A;  5G1L A;  3WA2 X;  4HAA A;  4HM5 B;  2R41 A;  1BOX A;  1LOV A;  4XBX A;  1BRG A;  2CFW A;  3FKA A;  5AIF A;  3ZFZ A;  1ULJ B;  3U1W A;  1G02 A;  2P05 A;  2CH9 A;  2CK3 H;  4WHA A;  3E99 A;  1BRN L;  1BRJ A;  5HOH A;  2OQE C;  1N9E A;  1STD A;  1BAN A;  5DRV A;  1NB3 I;  3SLU A;  4KZ1 A;  3MPH A;  1EA2 A;  3Q1C A;  4FR9 A;  4N3V A;  2BHM A;  2XH9 A;  5AYS C;  2BT3 A;  1A2V A;  3K7C A;  1BRK A;  1EUI C;  1OF5 B;  2CKF B;  2CWV A;  2STD A;  3B7C A;  2W03 A;  5AIG A;  5HGR A;  5G1K A;  1UI8 A;  1M1X B;  3CCU 3;  5IER A;  1UGH I;  1B2M A;  4L8P A;  1Q82 4;  4AKZ A;  1MWT A;  2B1X B;  5M18 A;  1KQS 2;  5BU4 A;  4HZB B;  3UJM A;  2ML5 A;  1UI7 A;  1RGG A;  3NX0 A;  1ZS7 A;  1BNE A;  1GMP A;  3A5E A;  1IU7 A;  3OXA A;  3LZA A;  3LOY A;  1LOY A;  4LSO A;  2L1S A;  1IVX A;  3S28 A;  2D1W A;  3DGO A;  3GZB A;  3NXJ A;  3FGY A;  1Q40 B;  1SII A;  4JF8 A;  3X42 A;  2YFJ B;  3KN4 A;  5AI1 A;  4GB5 A;  1G96 A;  4QWT A;  2WGO A;  3NM7 A;  4X2H A;  3JUQ A;  4XBT A;  1W2B 2;  2RNT A;  3GZY B;  1RGH A;  2OQE A;  1YIJ 3;  4IT7 A;  1QJG A;  3X41 A;  1Y4K A;  1VQN 3;  1BSA A;  3EN8 A;  2E2U A;  2LQV A;  2I9W A;  5AEU B;  3G6E 3;  4N6O B;  1VZZ A;  3CU3 A;  1BNJ A;  3VSY A;  4BIR A;  5IG5 A;  2BIR A;  3F8X A;  3M8C A;  3LTA A;  4K1U A;  1IYY A;  2INX A;  3MG2 A;  3B4O A;  4NPB A;  4O3V A;  3G71 3;  4N6U A;  1NDO B;  5KP4 A;  1OCV A;  3X3X A;  2IA7 A;  3G8Z A;  1RRL A;  1BRS A;  1I2G A;  1EG9 B;  5DRE A;  1FUW A;  2Z6B A;  3N9H A;  1UCJ A;  1FGR A;  1A67 A;  3KKG A;  3FG4 A;  1JBT A;  3LT9 A;  1NWW A;  1PY3 A;  3SYU A;  1GS3 A;  3FF2 A;  2Q07 A;  1JRQ A;  4XB5 A;  3OWS A;  5FGO A;  2OCT A;  1F8N A;  4I5Q A;  3KSE D;  1OF5 A;  1TP6 A;  1DVD A;  2W56 A;  1JJ2 2;  2XF3 A;  5JBS A;  3GZR A;  1B21 A;  3WDG B;  3PS8 A;  5IG3 A;  4XM4 A;  3FZW A;  2OOV C;  3JUO A;  4HM3 B;  1TUH A;  3BIR A;  1JBS A;  4G1M B;  1IVV A;  4DKI A;  4HYZ A;  4FMB A;  2GEY A;  2KF5 A;  1SQW A;  2CFG A;  3PGB A;  3G4S 3;  1TU5 A;  1N8R 4;  2RBI A;  1W00 A;  3FLJ A;  5BVB A;  2YFI B;  3PYJ A;  1EEJ A;  2P0M A;  4EV2 A;  3JUN A;  1LNI A;  2GEX A;  3IJE B;  1GSP A;  1W6G A;  3EBY A;  1MWU A;  2Y74 A;  3HI7 A;  1X1W A;  4HVN A;  3WOD G;  1K73 4;  4O2H A;  1VQP 3;  2CG1 A;  3CCJ 3;  1UDI I;  1RJO A;  3AMO A;  3MWZ A;  5A0O B;  3CC2 3;  2RSX A;  4NHF A;  3CCL 3;  3HII A;  3QK9 A;  1DMQ A;  1OGX A;  3EX9 A;  4J9A A;  5CK6 A;  1DVC A;  5AYR B;  3WMD A;  1NNV A;  3DXO A;  4FMA A;  4HBR A;  3UL5 A;  1LRA A;  2IMJ A;  2KAA A;  1IV9 A;  1R4C A;  2C10 A;  2XRX B;  2W9P A;  3BND A;  3T0U A;  3EJV A;  1CEW I;  3K9M C;  4R9L A;  1RGA A;  3D9R A;  1JBR A;  1DMN A;  3HIG A;  2UX0 A;  3OX9 A;  3RGR A;  1O7P B;  3CC4 3;  1IQX A;  4FCM A;  2HMK B;  1AVK A;  5JPU A;  4BU4 A;  5KP1 A;  2BU4 A;  2D42 A;  1WQL B;  3V98 A;  1SPU A;  5IW9 A;  1PYL A;  2ZDJ A;  1FYS A;  4N6T A;  5IF6 A;  5ELU A;  2QGU A;  4LZI A;  1IVU A;  1CYV A;  1BAO A;  2XGN A;  2F5M A;  3J7Y d;  3D3L A;  3BNB A;  1RGF A;  3AGN A;  1QAK A;  3EE1 A;  4BTW A;  1FA3 A;  4MMY B;  2XR8 B;  1FW7 A;  4O8S A;  3EN1 B;  4MMZ B;  1RCK A;  3MKI A;  1NB5 I; 
#chains in the Genus database with same CATH homology
 2AAE A;  1AY7 A;  1BSE A;  1I0V A;  3GSP A;  1B3S A;  1BUJ A;  2RNT A;  4RNT A;  1T2I A;  1B2Z A;  1RGH A;  1BRI A;  1BNG A;  2KF4 A;  1I0X A;  1YNV X;  4GSP A;  1BSA A;  1MGW A;  6RNT A;  7RNT A;  9RNT A;  2AAD A;  3WR2 A;  4BIR A;  1BNJ A;  1I3F A;  3BU4 A;  4GHO A;  2BIR A;  1X1U A;  1RCL A;  1IYY A;  1BSB A;  3AHW A;  1I2E A;  3HOH A;  1YVS A;  4HOH A;  1RHL A;  1SAR A;  1BNS A;  1BRS A;  1CH0 A;  4J5K A;  1I2G A;  1BNF A;  1TTO A;  1UCJ A;  3D5I A;  2KF3 A;  1BNI A;  1JBT A;  5GSP A;  1FUT A;  1PY3 A;  1GOV A;  3SYU A;  1GMQ A;  7GSP A;  1RSN A;  1HYF A;  1BSD A;  1X1Y A;  1UCK A;  1I70 A;  2SAR A;  3URP A;  1RDS A;  1BSC A;  1B21 A;  1BIR A;  1RNB A;  1DE3 A;  1RN1 A;  3D5G A;  1B27 A;  2ZA4 A;  3BIR A;  1JBS A;  1BGS A;  1GOY A;  1YGW A;  5RNT A;  2KF5 A;  1B2X A;  1ZGX A;  1I8V A;  1B2U A;  2RBI A;  3RNT A;  3AHS A;  3Q3F A;  1LNI A;  1C54 A;  1GSP A;  1I2F A;  1Q9E A;  1X1W A;  3DGY A;  1RMS A;  1TRP A;  1GMR A;  2C4B A;  3WHO A;  2KF6 A;  1TRQ A;  1MGR A;  5BIR A;  2HOH A;  4HAA A;  1LOW A;  1BOX A;  1LOV A;  1BRG A;  3DH2 A;  1RGL A;  3AGO A;  1G02 A;  2F4Y A;  3D4A A;  1LRA A;  2KAA A;  3KCH A;  1BRN L;  4J5G A;  1AQZ A;  1BRJ A;  5HOH A;  1BAN A;  1RGA A;  1B2S A;  1JBR A;  1RNT A;  1R4Y A;  1UCL A;  1BRK A;  1T2H A;  4BU4 A;  1BVI A;  2BU4 A;  1B2M A;  1A2P A;  1GOU A;  2F56 A;  1PYL A;  1RGE A;  1BNR A;  1FYS A;  1I3I A;  8RNT A;  1RN4 A;  1X1X A;  1RGK A;  5BU4 A;  1HZ1 A;  1BAO A;  2F5M A;  1UCI A;  1RTU A;  1RGF A;  1RGG A;  3A5E A;  1BNE A;  1GMP A;  3AGN A;  1BU4 A;  2GSP A;  1BRH A;  2F5W A;  1RLS A;  1B20 A;  6GSP A;  1LOY A;  1FUS A;  1FW7 A;  1DET A;  1RGC A;  1RCK A;  1FZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...