2JDIH

Ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
88
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ground State Structure of F1-ATPase from Bovine Heart Mitochondria at 1.9 A Resolution
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
total genus 11
structure length 88
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2jdiH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2jdiH01
1AQTA 2E5YA 2WSSH 4QMAA 1BSHA 1E79H 2W6JH 4YXWH 2V7QH 1FS0E 4TLFA 3USSA 4WVZA 2CK3H 4DJGA 1BSNA 2E5TA 1JEKA 2XNDH 3EFFK 1IFPA 2QE7H 3PJSK 2JDIH
chains in the Genus database with same CATH superfamily
2KOGA 4O9BA 1LOVA 1B20A 3MD0A 1VQ6P 3CX5H 3CCVP 2CC3A 1S9KE 3EF8A 5CHXA 1E79H 1BE3G 2YXQB 3HD7C 2BMQB 4LEHA 1X8YA 1H89A 2KF5A 2XZRA 2GBWB 1RGCA 1A90A 2A15A 2GA1A 1T2IA 3AECC 2XH9A 2E5TA 4O02B 3Q2YA 3A5EA 1SFCA 5APQA 3CNXA 3PJSK 2KI7B 2D2CC 2GU3A 1AFOA 1LOYA 2GM4A 3HZPA 4N6UA 2NPSC 4HM8B 4BRYA 2OYIC 2K9JB 2KNCB 1NNVA 3AE1C 1M56D 1Q2NA 3A3YB 1NB3I 4H13D 3L75J 1GOUA 4MEIA 1LTJA 1IVVA 1IT7A 3CD63 1KILB 3O6QA 1W2EA 1L4AD 4HM6B 1N73C 1FUWA 1Y9BA 1NTKD 3SLUA 1RCKA 1CYVA 3T0UA 3ER7A 1IFNA 1BNIA 1GS3A 5KJ7D 4D6TE 1W02A 2KUBA 3A0HH 2M5AB 1NOHA 3CMEP 2MC8A 4FR9A 4J9AA 2Y74A 5ELJA 1M1JC 4N6V0 3I553 1HBWA 3U1WA 2SBLA 1VQ93 1OXZA 2R5DA 1HJ0A 3I0YA 4EIJA 3M06A 3S29A 5CBOA 2YMKA 3CCRP 1CZQA 4CPGA 1QVG2 1O7HB 4UB6E 3UJMA 1JMMA 4OWFA 3JUPA 4C7RA 1V58A 4R80A 1QVF2 1U7JA 1B21A 1YYCA 3RBXA 2B87A 2E76B 1B27A 1RJOA 3M0DC 1EDLA 3K63A 4FMCA 5AEUB 1YIJP 2IDBA 1UUWB 1SQPK 1UIXA 2Y9YA 2CWUA 1NWQA 1N5PA 1CYUA 4FCJA 3D4AA 1DH3A 1YJ9P 1VF5D 2CWTA 1QAKA 2WSCJ 5AVWB 5TJHA 3E7KA 3SWKA 1X22A 2HODB 1SQQE 3RK3D 2B1XB 3JUQA 4WHAA 2WSCH 3ECFA 3RL0g 1JV2B 1GK4A 5AW8B 3OV4A 4N78E 1NO3A 3GZBA 4PV1D 5B66H 1Y4KA 5AVRB 4Q53A 3CCU3 1K8A4 2QIYA 5JBSA 3H1JJ 2B24B 1L0ND 1NTZG 3CC7P 1FZCC 4JF8A 4DT0A 2FYZA 2INXA 3AMOB 3AE8C 1PGPA 1STDA 3D9RA 2YKOA 2IZ1A 5GTHE 2YO3A 3SSUA 1VQMP 1RN4A 2IUJA 5EQLA 1FUSA 4K61A 1J1EC 1SIHA 5IG0A 2RN0A 1Q40A 1IU7A 1EZVG 3U97A 2XSHB 4XBTA 5KLIB 1LP1A 2XFSA 1PP9J 2IYJA 2R3SA 3JUNA 3ZG0A 3A76A 2J5UA 1KTMA 3VSYA 2IY2A 5AYSC 3KN4A 4O8SA 1AVKA 3CCV3 2XF3A 4HB1A 2BMOB 1X9VA 2N9BA 2LR2A 2RSXA 3H1IE 1HVVA 1NHLA 4JF7A 1A2PA 4J8TA 5CJ4A 1PP9G 2YFIB 1UI8A 3DXOA 3LT9A 3UB1A 1SFCD 2WOFA 4L75A 4U3FJ 1KYOE 1VQ83 1X1UA 1U8CB 3HTKA 4FCZA 2Q7CA 2QG4A 3NHXA 2UUGC 1S723 4DJGA 1ZOYC 4H13B 3AEAC 3X3YA 3PRJA 4HM4B 7GSPA 2OYOA 1BSBA 1BOXA 1JY3O 3QRDA 1W5CE 3KXDA 1M7LA 1L4AB 1NVOA 3H6PA 3II6A 4HAAA 3Q3DA 3HE5B 1VQPP 1JUNA 4L7KA 3AGOA 3FF0A 1J2JB 4U3FG 3WUVA 2L1SA 1GU5A 3L72D 4GB5A 1EZVI 4K35A 2L4VA 1KQGB 2OTKE 5GTIE 1XTGB 3X41A 1LNQA 4D6TG 1MWRA 1FGOA 4H44C 4GKGA 1VQ43 1NTKK 1NU1J 1LWUA 2KSEA 1M90Q 4WY4C 4PD4E 3S9OA 2FY8A 4MMZB 2C11A 1RGLA 2F56A 1KB9H 3NUVA 2YMYA 2P38A 2Y73A 2POHA 2R44A 2E2VA 1M1JA 1ROAA 4IL6X 1K8AQ 3HIGA 4H44B 5LC6A 1BUJA 1LTBC 2H0GA 3EN1B 3CXC2 1KYOD 3D6YA 3EB8A 5RNTA 1T2KC 3HRNA 1MFZA 1U5OA 5AIIA 1BAOA 3LW5H 5AVQB 3MHEA 1GMJA 4ILFA 1ULIB 1LJ2A 2QE7H 1BDCA 4BTYA 3P8CD 1GD4A 2JEEA 5KAFE 2P0XA 2D42A 1BNRA 5AVVB 3LXUX 3C1LA 1LTSC 1PY3A 2P10A 3U59A 4UB6H 3C9IA 2BEZF 1FZCA 4N6TA 2YO2A 2QGUA 4LSOA 3RK3B 1WTHA 3WOFB 1RH5B 1FZCB 3CME3 1BSNA 3PP5A 1NKZB 2K37A 3VTPC 2IPPA 2XNDH 1GMPA 1K9M4 3I55P 3L70G 1LNIA 2ZL8A 1J1EB 1OIPA 4BRYB 3M9BA 5EEOA 2Z5HA 4KT0J 7STDA 2RMZA 3B4OA 3WR2A 1N8QA 2ZYGA 5GTIH 1AR0A 2F99A 2JP3A 1JB2A 1STFI 3V2PA 2O3OA 3HUSA 3O8YA 1LTTC 1ZRTD 3HOHA 4L76A 2QEXP 4QWTA 1PIXA 3M0DA 1KILE 1NB5I 2WOHA 1OF5A 3BCCD 1AA0A 1AY7A 1EQ7A 3CCM3 4ORLA 5KP4A 1BUQA 1SQVE 3PH0A 1LOWA 3L75G 1MGWA 2JWDA 3LW5J 3RDEA 1FZFA 1L0NE 1IDPA 1R4CA 1SQBD 1Q86Q 1J1DC 3HX8A 3H1HD 1FGRA 1I70A 1JY3P 1HYFA 3GMAA 4EOTA 1OACA 3G4SP 2XRXB 4BXLA 1E3VA 5AIHA 3B7CA 5APTA 4N78D 1SFCB 4EDFA 1RRHA 2CFKA 2ZDJA 3ROBA 1URQC 3FXEA 4I7ZC 3PCSA 3CXHE 4ZNCA 1T2HA 1FZGA 2BU4A 4RZMA 2E76D 3CC23 1ZW0A 1RE3A 1NJI4 2GXFA 1YIT3 3UL5A 1LTJC 4MN4C 1IQ8A 2ZXEB 5KLVK 3K0ZA 4H61A 1NU1E 4LGDE 3GRDA 3AEGC 3TF5A 2WSSH 2ITAA 2WPRA 3FX0A 2CX0A 3A5TA 1S1CX 2HMKB 3NM2A 3USSA 3HI7A 3VP9A 2WQYC 2LKMA 4L74A 4HVNA 2IFNA 1Q7YQ 1TUHA 3E1RA 2N1TB 2FGTA 1BRKA 1S2EA 3Q90A 1LRAA 5CBNA 5AVYB 1O7PB 1EXIA 3GW6A 2Q3IA 2F98A 3BNEA 1RNBA 3NXJA 4DOJA 1X1WA 3DGLA 1K04A 1NTKG 1G96A 1HGZA 1T3UA 2I8DA 1L5GB 1GSPA 3FSDA 2GUVA 2W0QA 1SQXD 2OTJ3 2FFDC 1I2EA 2I1JA 2CG0A 4HM5B 3F14A 2RKLA 3SYUA 1KD14 1OMIA 1GW4A 2IYPA 2KZJA 3H1KG 1N7SB 1NKNA 1KB9I 2NRGA 4CPKA 2JKVA 1W6YA 1ZMEC 1UUVB 5JPPA 1P84D 3K5BA 2MJZA 1G2CA 5G2GA 1K73Q 2R41A 1LWUC 2OTL3 3FGYA 1U7MA 3VMZA 1IVWA 2HMJB 2K3DA 4XFJA 2PRRA 3V2RA 4LLHA 1RQUA 4HYTB 1UDII 2BCCJ 1VQ4P 5E79H 1VQ53 1YHQP 3KZIE 3LTCA 1LWUB 1WT6A 3NMDA 2PFXA 1L0NK 3SOYA 4WB4A 3D5GA 2HMOB 2JR8A 4KJMA 3HE5A 2E75B 4IT7A 1PZQA 3AEDC 1SQVJ 2C0WA 5AIFA 2ZXXA 3O8ZA 2MF7A 2W56A 3WOEB 2UWJE 4NPDA 3V99A 2A06D 3CNMA 1LT9B 3L71G 1N86A 1PFIA 2M8RA 1SQXE 1Q824 1YVBI 1K28A 5AW0B 2WPSA 3L73D 1ULJB 1WMPA 1SFCC 4Y99C 2W04A 3JVCA 1SQVG 5AIGA 1IYYA 1JM0A 3BU4A 5M19A 1CSBA 3M91A 4DZOA 1FW7A 4YTPC 1KQLA 3HD7B 4PD4I 1SIIA 2C9LY 3VMXA 3H32B 3HD7A 3CMAP 3G4S3 1AVYA 1PPJE 3AE4C 1YGEA 3CXHI 2ZA4A 3ALAA 1BSAA 3B8LA 1N5HA 2HMLB 3GZRA 2I9WA 1MNLA 3AE6C 1GU4A 1OGXA 1IFPA 3NTNA 3CC2P 2H0HA 1FZBA 1GZLA 4HM1B 1SQWA 1URQB 1YITP 1B2MA 2CW9A 4G1MB 3LTBA 5TGNA 3GHGA 1IT8A 5CCGC 2KLVA 5CJ0A 2JJLA 3RL0C 3WU2H 4WFOA 3WDGB 1OVRA 1M1KQ 3MSOA 4BTWA 1S5LX 2RH0A 4TLFA 3AHSA 3FG3A 4Z1MH 1HF9A 1GL2B 2C10A 3QK9A 4RNYA 1DEEG 2WSEJ 1YVSA 2HOHA 5C39A 3L74G 1BNGA 6RNTA 1DE3A 3TNUB 4A7PA 1T2KD 3VYIA 3UNLA 1FJKA 1RY3A 1Y47A 1SQBE 4ZM8A 3D70A 2BO9B 3QWOC 2HPCB 3T97B 1RMSA 1R5LA 1EA2A 4R9LA 1BVIA 2K0MA 3L73J 3EN8A 3B4SA 4HKZH 1MWSA 4WY4D 2Z76A 3MG3A 1NTKE 1Z1SA 2D2CD 1QAFA 5AI1A 2BASA 5M18A 2OTJP 3SEDA 1YTZI 2FYUE 3D71A 3WUUA 1UGIA 1KYOH 5KAIH 4HM3B 3EJVA 1LT9C 4CJNA 1B2ZA 1HWTC 3BASA 1O7GB 2ZVOB 3F7SA 1YGWA 1OW8A 2CFGA 3CWBJ 4IFMA 3GSPA 3ZDMA 2ML5A 1NGMB 3G6EP 2R4IA 2G8YA 1VQLP 1RGKA 3KSPA 1VQ5P 5AW9B 1EC5A 3BATA 1OWAA 2YKPA 2JWAA 1KWIA 5AW2B 1Q814 2ZVNB 1DMNA 3F8XA 4IIAA 3RK2D 4I1LA 4TX4A 3L71E 4AUWA 3EQ2A 2XNXA 3E99A 2P1JA 1M8OB 3OWYA 2W6AA 5APVA 4RNZA 1SQVK 1EZVE 2J58A 4MJDA 1QLED 2P09A 3NM7A 3DUKA 1VQ7P 1D6UA 1ZX2A 1W5ZA 2IMJA 1N7SD 3OWSA 2IYOA 4NREA 2OTLP 1R8EA 1OHSA 3VGNA 2WSFH 1AV1A 1J1DB 4L8OA 1DD3A 3ZG5A 1W00A 1Q7HA 3WODG 4O2HA 5KAFH 4MMYB 4NPFX 2Q3EA 4CCVA 1JBRA 1BGYE 2VRSA 4NHFA 4AKYA 4ZKUA 5AEWB 1TRPA 3CCL3 1NDOB 2AEMA 3U1CA 1UCLA 2IBZG 4L73A 3F89A 2FYUD 1MUUA 2XKMA 2H0IA 3TGUJ 1J2BA 4PD4H 4J5KA 1M1K4 3M0AA 2K1AA 3H1LE 3CPW2 3DZLA 1L0NJ 3PXMA 2W56B 1ZP0C 1BCCE 1L0LG 3F7XA 1EEJA 5CMZA 1WMKA 3VF1A 1Q864 3GG2A 3D79A 2KAAA 2QVAA 1DD4A 2W90A 2ZYDA 2WWWA 1GL2D 1JRQA 4KHXA 2QRXA 2L91A 2BNGA 1DMMA 3FZWA 4U7JA 3X42A 2WITA 3FCSB 1GL2A 1JB0J 1JB5A 1PP9D 2AEJA 1VQOP 3K5TA 3TDGA 1H88A 5KJ7A 1TFKA 4WWUC 4FMDA 1E5WA 1UCKA 1RQVA 3WMDA 3MTUE 3FG1A 1BSDA 1LXEA 5AVSB 3DGOA 3CCE3 3L72J 3JUMA 2XDJA 3HD7D 2W83C 3LTDA 2IFMA 2E75D 1PYLA 4WY4B 1HH0A 1BGYD 3PHLA 2FYUG 4D6TJ 1IVUA 1SARA 3I563 1M1XB 1S5LE 4IL6E 3H1JE 4J5GA 4OUQA 1VQ8P 3BVHA 1YJN3 3I5CA 4ASVA 1OF5B 2WMMA 5DRVA 1JN5B 1W01A 1MOLA 4EV5A 4HOHA 4M3LA 2HODA 5B5EH 1RN7A 2CPBA 2CKFB 3GZYB 2QJKB 1QJGA 1KV4A 1V74A 5IG4A 4GT1A 1JZOA 1MZ9A 1U57A 4IFFA 2B87B 2M3EA 3K9MC 2BCCE 3LIDA 1ROVA 2ZT9B 3L70E 2P58A 2NPSD 3WU2E 1FDMA 1YJW3 1AV4A 3CX5E 2CFWA 3H25A 1VZZA 5KLVJ 1WMNA 5B66E 4WYKB 3RK2B 2PP6A 2Y0DA 1RGHA 1KMIZ 1B2UA 5LC7A 3WHOA 2OYHB 1BCCD 2KXGA 1QEXA 2XV5A 1TU5A 1YI23 3KSED 1RLSA 1SJWA 2BHMA 1YNVX 5TISE 1OCVA 1SQPG 1B2SA 5GTHH 2CIUA 1RDSA 4RKUJ 1KD1Q 1AQZA 2V1LA 1S5AA 1KILA 2K9JA 2KNCA 1VDFA 4Y99B 4XE5B 1VQK3 2M3BA 2R5BA 1VQ73 1IFJA 1UCJA 3FF2A 3IPTA 2P0MA 2N1TA 2H88C 1HKXA 4W7YA 3SFDC 4JYCA 1W2ZA 5DJTB 2E74C 4FMBA 2IA7A 1X79B 1N9EA 1BDDA 3Q1CA 3GWRA 4WVZA 4LC1A 1UGHI 4RESB 4DCKA 3H1LG 3CXHD 1Q7Y4 1QGKB 3CX5D 4N3YB 3G9RA 1KQFB 1G1JA 1L0LE 3MIWA 4IPBA 2IBZI 3KHUA 3IN6A 2KIKA 1IK3A 2IBZE 2QM8A 1OH0A 1RF1B 2A45H 1IQXA 1BANA 1CI6A 5I97A 1I3FA 1PU4A 4WWIA 3EBYA 3GHGB 2YX9A 2QEX3 1HJBA 1BGYJ 3S28A 4HM0B 3CCQP 3FXDA 3HTKB 3L74D 1KORA 2J59M 3FLJA 5AW7B 1TRQA 2D1WA 1FDIA 2WSFJ 1NU1K 1NTKJ 1GL2C 3V2QA 5KP3A 5AYRB 3V92A 1NTMG 3CCJP 1FS0E 1KC8Q 3S1KA 1DEBA 1SP4A 1ZLLA 2XU6A 2L5GB 3LZAA 1C7HA 2OOVA 1MWUA 3CCUP 3G3ZA 3LIEA 2Z7AA 2OYIB 1RCLA 1KN7A 2KS1B 2AADA 2PAJA 3H1KJ 1EDJA 5E79E 3FWNA 3B5NC 1JY2N 2YIUB 4H3UA 3RK2C 3AE7C 4C7NB 1DVCA 4HJGH 1G02A 4R9KA 1VQM3 3AGNA 4IFDK 1CQSA 2QSIA 1H8AA 3H1KE 3S4RA 3RL0D 1BSEA 4AKZA 3VMAA 1QL2A 3WUTA 5CCGD 2UX0A 2GU1A 3LT8A 1WQLB 3DMCA 1UW1A 2PNCA 4HH2A 4H0LD 2E75C 3D5IA 1LOXA 1T5YA 2ZAEB 2IX7C 3HIIA 4PJ0E 4YXDC 2ZT9D 1QALA 1JKGB 3VMYA 1JCDA 2KZIA 2NPSB 2AXCA 3NV0B 4TT3H 1IVXA 2HLOA 3PS8A 1VQ63 1K9MQ 1GY5A 3H1HG 4KFFA 4GIFA 2M5AA 2H43A 3S27A 4XDWA 1PFPA 2DW3A 5K5GB 9RNTA 5DJUB 1SLQA 1NYHA 3TK1A 4JQ0D 1BRGA 1FGMA 2GUSA 2OQEA 2FXPA 1BSHA 1YTZT 2OYHA 3L74J 1S72P 1I0VA 4EV2A 2ZHXB 1ZGXA 5APSA 4CDLA 3Q3FA 1A2VA 2K54A 3WMM0 3N54B 3M9QA 3NQZA 4EBGA 1TIJA 3BCCE 5BVZA 4BL2A 5IERA 1FYSA 1OHOA 4OGQD 4GOFA 3F8HA 1SQXG 1G0TA 2JO1A 1WRGA 2O01J 3CPWO 5KKZC 1JBSA 1UUGB 1B3SA 3AEBC 1GY6A 1RF0A 3FH1A 2E5YA 3R4YA 3TNUA 6STDA 2J8XB 4GSPA 1RE4C 2W6JH 4JYBA 3RBZA 1CEWI 2XGNA 4AQRD 2OYHC 2P7JA 4I5QA 4R4LA 2YKQA 3H1HJ 1JZDA 3CC43 2R3CA 1OGZA 2Y0EA 3M9HA 1EQKA 4I6MC 4RO0A 3D6ZA 2HMNB 3L72E 1KC84 1AQ5A 2JQ5A 2KRTA 3S5CA 5IF6A 2LQVA 2WTYA 1IK7A 3FWLA 1AQTA 3KE7A 3PGBA 1N7SC 5FW5A 1URQA 1IFMA 1M1JB 2O01N 1VQ9P 1VQQA 2XFTA 1OW6A 1IJDB 2OQQA 1Q42A 3L71J 4PEJA 2O9UX 3FGAD 1E97A 5TISH 1I2GA 4L8PA 2FYNC 5DREA 1BNEA 1OHPA 4PD4D 5APUA 1RGAA 3R2PA 1EDIA 1YQ4C 1BCCJ 3IR9A 1RF1C 2RBIA 1SQQD 2AXTH 3RK3E 5BVBA 3TGUG 3NBBA 3KFQC 3CX5I 1VQNP 2N1TD 3TYYA 1AVLA 4OH8B 1LQMB 1N73A 4KZ1A 5AVUB 3S67A 1SQBG 2OQEC 1UCIA 1JEKA 2KF3A 3A2AA 2XSOB 2QJKC 2LYXA 5AW1B 3JUOA 4QMAA 1JY3N 3H1JD 3H1IG 5BU4A 5L8RJ 3BLZA 3AE2C 2B9BA 1G1IA 3OWUA 1BU4A 3RL0B 2E42A 5AVZB 1PP9E 2O3JA 1LTIC 2W2CA 2HMMB 1S9KD 2GEYA 4I4KA 1EDKA 1T3BA 1MWTA 3B4PA 3NBRA 5IW9A 3AEEC 5HOHA 1T6AA 3L36A 5KLVD 2RCDA 1IC2A 2H8PD 3L4FA 4LGQA 2F4YA 2KK7A 3H1HE 2HR3A 3K7CA 1NH4A 2RNTA 5CCHD 1ZS7A 4HM2B 1N7SA 3LTAA 2FFDA 1JY2O 5BXQA 4I7ZB 4U3FE 3KCHA 2FNQA 3B8EB 1R5SA 1KB9E 1IZNB 3EE1A 1HZ1A 4HBRA 2CPSA 3L70J 1OFCX 1BGSA 5D82A 3H1ID 1UIIA 2CWVA 2OOVC 2SARA 3OW22 4WY4A 5KTBA 4EI2A 2A06E 2V7QJ 1S4XA 4OGQB 4KT3B 3L70D 3OW2O 1WMOA 1MGRA 4D6TD 1PPJD 2W8ZA 4XB5A 3WA3A 3G71P 2CH9A 2H7HA 3CWBG 3G16A 3MG1A 2QJPB 1NTZD 3DGYA 3EHCA 2Q6QA 2Z6BA 2I1KA 3MHVA 2CHCA 3SOAA 1FA3A 1GMQA 3EC9A 4R4MA 4U13A 3KZIH 4H0LB 1T3JA 1JTHB 1JOCA 4UB8H 1NTZK 3OX9A 1PGOA 1JY2P 1NAYA 2P05A 1FGTA 5EVHA 2WZ7A 1O7MB 5BU8B 3FKAA 3OXAA 1FZEA 1VQL3 1M57D 3L72G 5ELUA 4U3FD 2A45I 2E76C 3IF4A 4HZ9B 2P2UA 2OWPA 3BB9A 3X3XA 1URQD 3L73G 1T8ZA 2W27A 3V4QA 3IMAB 1E3RA 1RHLA 3G8ZA 1BNJA 4AEQA 4B86A 5D83A 2ZFCA 1W2B2 1K05A 2O01H 1O7WB 1GYBA 1I3IA 1I0XA 1FE6A 3TGUE 2QJPC 1RGFA 1AJYA 1KZUB 2M0BA 3PZWA 2O1JA 3CC4P 3H1LD 1N73B 3NX0A 5KLIC 7RNTA 1BE3E 4UB8E 1SS1A 1FBMA 2KB7P 1VL2A 4I2LC 2IZ0A 1N9JA 3GZXB 3MWZA 2O1KA 2BMRB 3KYQA 3CCR3 1ZRTE 3GF7A 3V4WA 3H1JG 1O7NB 4GHOA 3UL6A 1L0NG 5CF1A 3L0RA 4KVHA 3CI9A 1NO4A 5B5EE 4OVNF 3JC22 4XM4A 2KCDA 5M1BA 1QMAA 5HGRA 3H1KD 1RTUA 4FMAA 2CFDA 4WBAA 4GOEA 1GK6A 2C9NY 2JDIH 2FXTA 1L2PA 2WGOA 3A0BE 5FGOA 3BRTB 1Q40B 3AMOA 2IUKA 5H2FE 4HYZA 5KKZB 4RBNA 2WSEH 1FUTA 2BCCG 1D6YA 1OX3A 4BWNA 1NU1G 3B5NB 3OJAB 3P7KA 3CCS3 1EZVD 1S3JA 3DGNA 5APXA 1NTZJ 3HK4A 3N4XA 1VQO3 3KKGA 1KQSO 1H0TB 2QA4P 3CMA3 2KF4A 2Z77A 5CF2A 2LXBA 4K1UA 4LZIA 2QJYC 2WPVB 2HYNA 2FFDB 2ZYAA 5AVTB 4JRFA 1BE3D 1GMRA 3D3LA 3LMLA 4HJLB 4XDVA 1KQS2 4C46A 1R4YA 5APYA 1JO5A 5EFWB 2P67A 3GLMA 4WYKA 3CC73 5KLVE 2A45G 1OZHA 1N8R4 4OVMA 4W80A 1OPYA 3I56P 1P84H 1SQPE 1NTMJ 2Q1KA 4K1VA 1BE3J 3AEFC 1A2KA 2A06G 2HFED 3N7NA 5IEOA 5KP1A 4H44D 4JPZB 1TP6A 1SPUA 2KF6A 1L0LJ 2FYUJ 4HKVB 3AE5C 1NTMD 2OGUA 3B5NA 2K9YA 3OAKA 1CW5A 3EBTA 3DM8A 2HG5D 3SFEC 3C8VA 1IV7A 1X1YA 3SX1A 3GHGC 1RGGA 1TJDA 3N8BA 3VN0A 4XA4A 3NQYA 1IFDA 2NPSA 2F5WA 3NV0A 4PV1C 4R1KA 3G0KA 2BIRA 1W6CA 4OGQC 1FJPA 3HE4A 2K88A 1FZAA 2Y9ZA 1V57A 3RK3C 1SQQJ 2STDA 1QL1A 3ABVC 3CL3D 3L75D 1LP1B 1AVOA 2YIUC 3EX9A 3CLQA 1IV9A 3Q5SA 1QVGO 1YI2P 1W4NA 3FG4A 2YXRB 1KSIA 3URPA 4BTXA 1SQPD 1OVVA 1USDA 1RNTA 3JCUE 3L74E 4N3VA 1LQGC 3G713 3KZTA 2C0XA 2C4BA 1JCCA 3EFGA 1VQP3 1FAVA 1BRHA 1LTJB 3JSVC 4EC6A 2ZT9C 1NTME 1VPCA 2Q9IA 4HZBB 4DKIA 2IBZD 3V98A 4H0LC 3PLNA 4RNTA 3CU3A 3Q5RA 5D81A 2F5MA 4MMXB 3H3HA 2AXTE 2W9PA 3H51A 2Z5IA 3T8UA 1GY7A 1LGHB 1USEA 2G3AA 5CCHA 1YHQ3 1RF0C 2N1TC 5KJ7C 1A67A 2BEQD 4Y28J 4BIRA 1X0TA 1GD3A 1BNFA 4GL6A 5IEPA 4IL6H 3V2NA 3A0BH 4LMIA 2Z4EA 3HUSB 1CI6B 2KXPB 1K41A 1PPJG 1PGQA 3DGMA 5CCHC 4NPEA 1LT9A 3V5BA 1N2DC 1LTAC 1A02J 1NU1D 3PYJA 5CLKA 3BRVB 3SWFA 1GW3A 2PGDA 1IQYA 3MUDC 2BCCD 3P8MC 3MPHA 3KPEA 1DX7A 1Q9EA 5IENA 3E1IA 4K90B 1PGJA 4JBZA 1TU3F 3KQGA 3NXSA 1I8VA 2XR8B 1JNQA 3CCSP 3CWBD 3NFQA 3W67A 2F86B 2UGIA 3CCJ3 1SQPJ 1YBKA 2E2TA 3CCLP 1ZXGA 5M1AA 1PV3A 1HUCA 5BU5A 3MUDA 5AVXB 2KSJA 3GF3A 5H2FH 2CX1A 1RKYA 1Y8AA 3VOPA 4N6LA 3UIAA 1JTHA 4LYLB 2E74B 2W6BA 4N6JA 1N8RQ 1MV8A 4GDOA 2KS1A 1BIRA 5IG3A 4BL3A 1Q81Q 5KLVG 3BCCG 1QVFO 1DMQA 2KLUA 3EQQB 1G2CB 3RGUA 2WT7B 3HE4B 4W7ZA 2NZ2A 5KAIE 5CXOA 2QIWA 3WA2X 2W9QA 3CCMP 5IG5A 2R32A 2PZVA 3Q2PA 1VF5C 3RGRA 2XGLA 1SQQK 2H89C 1W2BO 3P8CE 4N6OB 3F9SA 3B71A 4GODA 1FGQA 3MYTA 1GD2E 1BSCA 3LH4A 3U1AA 2OYIA 1BRNL 3NBJA 6GSPA 1NU3A 2QA43 4IOIH 4KFEA 1RHZB 1RE3C 3Q5PA 2GBXB 1M9GA 1ZO2A 2GSPA 1BCCG 3X3ZA 3F40A 1BRIA 2FYNB 1HGVA 2HPCA 2FYUK 1X1XA 2V4HA 3EFFK 1ZN5A 3L35A 5G1LA 2N9YB 4EYYQ 2B88A 1MFTA 1P84E 5AW5B 3MZWB 4YPCA 1OW7A 3N9HA 3TDKA 1ASKA 2RGQA 4BU4A 1NTMK 1FU1A 2V7QH 1W6GA 1Z56A 1EKMA 4N6MA 3A7OA 1KILD 1NJIQ 2LXCB 2ML6A 2YFJB 3B5ND 4STDA 3V6IA 2E2UA 4EW5A 1L4AA 1IK9A 1L4AC 2YFLB 3L37A 1ZV8A 3SWYA 1GOVA 2YNYA 5CK6A 1F8NA 3L75E 3T97A 1YJWP 3KDPB 4OK0A 1FZUA 1UI7A 3PTZA 2WVRA 1L0LK 3H1LJ 3HUSC 3IAOA 3AHWA 1BRJA 1JB4A 3Q1MA 4RJTA 4X2HA 3M8CA 1GOYA 1RRLA 2QM7A 3G6E3 2FBWC 2RFRA 3BIRA 1JBTA 1BNSA 5GSPA 3IFMA 3DY5A 1I2FA 1BGYG 1KFMA 3MKIA 4AYCA 3TGUD 2B89A 3H32A 1XTCC 1EG9B 1FC2C 1RF1A 1SQXK 2CG1A 2M7OA 1GTWA 1TTOA 2FKWB 2XEPA 1VQKP 8RNTA 1JNMA 5CCGA 3CD6P 1MKMA 4FCMA 5AW6B 1YIJ3 2OARA 5BIRA 1SQBJ 5AW3B 2WO0A 8CHOA 1VQN3 1Q82Q 2KYVA 4K3AA 1GDTA 1L0LD 2Y0CA 1H0TA 1Q90D 5STDA 3LOYA 2WPQA 3RGAA 3IJEB 3AE3C 1KB9D 5G1KA 1W7CA 2E74D 3BCCJ 1EXJA 3F5HA 2Q07A 4N6NB 1P84I 1JMBA 3BNBA 2ZJSE 1TFOA 1DVDA 3A0HE 1OUNA 3BNDA 1D7MA 3ITKA 2AEFA 1DYUA 1RE4A 4ZMDA 4ZKPA 3DH2A 1NAFA 1BRSA 4EYCA 1RN1A 4R4KA 3T8NA 1LVNA 4H13C 4YXWH 1QX8A 2D2CB 2CFLA 3QH9A 3PCRA 2BT3A 1FDOA 1KYOI 1IO4A 1KILC 5JPUA 5AW4B 3CCQ3 3CWBE 2WT7A 4PJ0H 1JN5A 2CK3H 3P32A 3J7Yd 4HM7B 3VP8A 3H1IJ 1DIPA 2WGQA 4XBYA 1C54A 1KFNA 1ISKA 3SXXA 1YJ93 1K734 3MP7B 1DETA 2W03A 1SQQG 4EXRA 3W68A 1M904 1VF5B 1SQBK 1NWWA 1PL5A 2MKVA 2AAEA 1D6ZA 3O6QB 2QJYB 2Q5UA 3BNCA 3OA7A 1LT1A 1FOSE 3EWKA 1JKGA 1WNHA 3MG2A 5A0OB 2K3RA 2SPZA 3CCEP 2OCTA 1SQVD 4PV1B 1N7LA 1IFIA 4C7NA 3KIIA 2FXMA 1SQXJ 4XBXA 3L73E 1NTZE 3STDA 5APWA 3RNTA 1ZR4A 1HTLC 3CPOA 1RGEA 2KP8A 3SVAA 1YQ3C 4KFDA 3JCUH 1S5LH 1HU9A 3L71D 3AE9C 4NPBA 1JJ22 1LTGC 3X40A 2GEXA 4O3VA 1YJNP 3TSIA 2E43A 3CXHH 1OVUA 1FOSF 1SVFA 1ZR2A 1A02F 1US1A 3LYGA 1LNHA 3ZFZA 1EUIC 1CH0A 1RSNA 3GAXA 4X2OA 4ASWA 1B2XA 3MGNA 2FXOA 4WP5A
chains in the Genus database with same CATH topology
1IK3A 4JRFA 2CC3A 3EF8A 1OH0A 3D3LA 1E79H 3LMLA 1W6YA 4HJLB 1IQXA 1UUVB 4XDVA 1KQS2 2BMQB 4LEHA 5JPPA 5I97A 1PU4A 5G2GA 4WYKA 3EBYA 3CC73 2GBWB 1A90A 2A15A 1N8R4 4OVMA 2YX9A 1OPYA 2QEX3 2OTL3 3FGYA 3S28A 2HMJB 1IVWA 4HM0B 4K1VA 2XH9A 2E5TA 4O02B 3FLJA 1A2KA 3CNXA 3PJSK 5IEOA 5KP1A 1TP6A 2D1WA 1VQ53 1SPUA 2GU3A 3LTCA 5KP3A 5AYRB 4HKVB 3V92A 1FS0E 3SOYA 3HZPA 4N6UA 4HM8B 3EBTA 3LZAA 1C7HA 2OOVA 1NB3I 2HMOB 3DM8A 1IV7A 4MEIA 4IT7A 2Z7AA 3SX1A 1IVVA 1IT7A 5AIFA 3N8BA 3CD63 2MF7A 2W56A 3WOEB 3V99A 3NQYA 3CNMA 3NV0A 4HM6B 1FUWA 3SLUA 4R1KA 3G0KA 4H3UA 1CYVA 1W6CA 3T0UA 1DVCA 3ER7A 4R9KA 1GS3A 1VQM3 1Q824 1YVBI 1W02A 1K28A 1CQSA 2STDA 2MC8A 4FR9A 1ULJB 4J9AA 2Y74A 1WMPA 4AKZA 5ELJA 4N6V0 3EX9A 2W04A 3I553 3JVCA 2UX0A 2GU1A 3LT8A 1WQLB 5AIGA 3U1WA 1IV9A 3DMCA 1UW1A 2SBLA 1VQ93 1W4NA 3FG4A 3I0YA 1KSIA 2PNCA 3S29A 1SIIA 4BTXA 1LOXA 1T5YA 3HIIA 1QALA 4N3VA 3G713 1JKGB 3KZTA 1O7HB 1QVG2 3UJMA 3G4S3 3NV0B 1VQP3 1IVXA 3JUPA 3PS8A 1VQ63 4R80A 1YGEA 1QVF2 3ALAA 3B8LA 1N5HA 2HMLB 1GY5A 3GZRA 4EC6A 4KFFA 2I9WA 1MNLA 1RJOA 4HZBB 3S27A 3V98A 3K63A 4FMCA 4XDWA 1OGXA 5AEUB 1PFPA 1UUWB 1IFPA 2CWUA 3CU3A 4HM1B 1SQWA 5D81A 1N5PA 2CW9A 3LTBA 4G1MB 1IT8A 4MMXB 5TGNA 1CYUA 3H3HA 1FGMA 2W9PA 3H51A 4FCJA 2CWTA 2OQEA 3T8UA 1BSHA 1GY7A 1QAKA 4BTWA 4WFOA 4EV2A 3WDGB 3MSOA 4CDLA 4TLFA 1A2VA 1YHQ3 2K54A 2B1XB 3JUQA 4WHAA 3FG3A 3N54B 1A67A 3NQZA 3ECFA 1TIJA 2C10A 3QK9A 4RNYA 4EBGA 5IERA 1OHOA 1JV2B 3F8HA 3OV4A 1GD3A 1NO3A 3GZBA 4GL6A 5IEPA 4LMIA 1Y4KA 4Q53A 3CCU3 1K8A4 1GY6A 1K41A 2QIYA 3FH1A 2E5YA 3UNLA 5JBSA 6STDA 2B24B 3DGMA 2W6JH 4JF8A 4ZM8A 2BO9B 2INXA 1CEWI 2XGNA 3AMOB 1EA2A 1STDA 3PYJA 4R9LA 5CLKA 3D9RA 3CC43 1IQYA 2K0MA 3EN8A 1OGZA 2IUJA 5EQLA 3MPHA 2Z76A 3MG3A 4K61A 1EQKA 1SIHA 2HMNB 5IG0A 1Z1SA 5IENA 1KC84 4K90B 1Q40A 2JQ5A 2KRTA 3S5CA 1QAFA 1IU7A 5IF6A 2LQVA 5AI1A 3U97A 2XSHB 4XBTA 2XR8B 1JNQA 2XFSA 1AQTA 3KE7A 3PGBA 3SEDA 5FW5A 2F86B 3CCJ3 3JUNA 3A76A 2E2TA 2XFTA 3VSYA 5AYSC 1Q42A 3KN4A 4PEJA 4O8SA 2O9UX 1AVKA 1RKYA 4HM3B 4N6LA 2XF3A 1E97A 3EJVA 3CCV3 2BMOB 4L8PA 5DREA 2RSXA 1OHPA 5IG3A 1O7GB 3F7SA 4J8TA 2CFGA 1DMQA 3EQQB 2YFIB 1UI8A 5BVBA 3DXOA 3NBBA 3LT9A 3KFQC 2ML5A 3UB1A 5CXOA 2WOFA 1VQ83 2R4IA 3WA2X 2W9QA 1U8CB 3KSPA 5IG5A 1AVLA 2PZVA 4FCZA 3Q2PA 3NHXA 3RGRA 1KWIA 2XGLA 1S723 4DJGA 1Q814 4KZ1A 4IIAA 1DMNA 3F8XA 3S67A 3X3YA 4HM4B 4N6OB 2OQEC 3F9SA 4TX4A 1JEKA 1FGQA 3MYTA 3QRDA 3E99A 3LH4A 3NBJA 2XSOB 1NU3A 2LYXA 3JUOA 2QA43 4L7KA 3FF0A 3OWYA 4KFEA 4QMAA 4RNZA 4GB5A 3BLZA 4MJDA 2P09A 2L4VA 2GBXB 1M9GA 3NM7A 1ZO2A 3DUKA 3OWUA 1D6UA 1ZX2A 1W5ZA 2IMJA 3X3ZA 3F40A 3X41A 3OWSA 2W2CA 2HMMB 1FGOA 2GEYA 4I4KA 4NREA 3EFFK 1OHSA 3VGNA 1VQ43 3NBRA 3B4PA 5IW9A 4L8OA 1W00A 3WODG 4O2HA 4MMYB 2RCDA 4MMZB 2C11A 4CCVA 3N9HA 1ASKA 4LGQA 3NUVA 4NHFA 2P38A 2RGQA 2Y73A 4AKYA 2E2VA 2V7QH 1W6GA 1EKMA 1ROAA 3K7CA 4N6MA 5AEWB 3HIGA 2ML6A 5LC6A 3CCL3 1NDOB 4HM2B 2YFJB 3LTAA 3CXC2 3EN1B 4STDA 2E2UA 3EB8A 1U5OA 2YFLB 5AIIA 5BXQA 3MHEA 2FNQA 1ULIB 2QE7H 5CK6A 1F8NA 4BTYA 1GD4A 3EE1A 2P0XA 1J2BA 1M1K4 4HBRA 3CPW2 4OK0A 1UI7A 2D42A 3DZLA 3LXUX 3PXMA 2W56B 5D82A 3F7XA 2CWVA 2OOVC 3OW22 1JB4A 3VF1A 4N6TA 1Q864 4X2HA 2QGUA 3M8CA 4LSOA 1RRLA 1WTHA 3WOFB 2RFRA 3G6E3 1JRQA 3CME3 1BSNA 2BNGA 1DMMA 3FZWA 3DY5A 1WMOA 2XNDH 1K9M4 3MKIA 3X42A 3FCSB 4XB5A 1JB5A 3WA3A 2ZL8A 2CH9A 3K5TA 3TDGA 1EG9B 5EEOA 3G16A 1TFKA 3MG1A 4WWUC 2CG1A 7STDA 4FMDA 3B4OA 3EHCA 1N8QA 2M7OA 3WMDA 2Z6BA 3FG1A 1LXEA 3DGOA 1AR0A 2CHCA 2F99A 3SOAA 3CCE3 1FA3A 1JB2A 1STFI 3JUMA 2XEPA 3EC9A 2O3OA 4U13A 3LTDA 3O8YA 4FCMA 1YIJ3 3OX9A 1IVUA 2P05A 3I563 1FGTA 1M1XB 4QWTA 5EVHA 1NB5I 2WOHA 1OF5A 1O7MB 2WO0A 3FKAA 3OXAA 4OUQA 8CHOA 1VQN3 1YJN3 3CCM3 1VQL3 5ELUA 4ORLA 1OF5B 5DRVA 1JN5B 4HZ9B 5KP4A 1BUQA 1W01A 2OWPA 3BB9A 1MOLA 4EV5A 5STDA 3X3XA 3LOYA 3RGAA 3IJEB 1W7CA 3IMAB 1E3RA 1RN7A 2Q07A 3G8ZA 4N6NB 3RDEA 3BNBA 2CKFB 3GZYB 1IDPA 1QJGA 1TFOA 1DVDA 1OUNA 1R4CA 4AEQA 3BNDA 5D83A 3HX8A 1V74A 1DYUA 1FGRA 5IG4A 1W2B2 1OACA 1O7WB 1GYBA 2XRXB 3K9MC 4EYCA 4R4KA 1ROVA 3T8NA 1E3VA 1LVNA 5AIHA 3B7CA 2CFKA 3ROBA 1RRHA 2ZDJA 4YXWH 2CFLA 3PCRA 2BT3A 1YJW3 3PCSA 5JPUA 1AV4A 3CCQ3 1JN5A 2CK3H 4RZMA 2CFWA 1VZZA 3CC23 1WMNA 4WYKB 3J7Yd 3PZWA 1NJI4 2GXFA 4HM7B 3UL5A 1YIT3 4XBYA 2WGQA 5LC7A 3NX0A 1ISKA 1IQ8A 3SXXA 1YJ93 2KXGA 3K0ZA 4H61A 1K734 3GRDA 3GZXB 1N9JA 1TU5A 1YI23 2W03A 3KSED 3MWZA 2WSSH 1SJWA 4EXRA 2BMRB 1M904 2BHMA 1NWWA 3CCR3 1D6ZA 1O7NB 3UL6A 1OCVA 3BNCA 2HMKB 3NM2A 5CF1A 3USSA 3HI7A 3L0RA 2CIUA 4KVHA 1JKGA 1WNHA 4HVNA 3MG2A 5A0OB 2V1LA 1TUHA 1S5AA 4XM4A 2OCTA 2KCDA 1VQK3 1QMAA 5HGRA 2FGTA 3KIIA 3Q90A 1VQ73 4XBXA 3FF2A 3STDA 3IPTA 1O7PB 2CFDA 2P0MA 4FMAA 2JDIH 2FXTA 1HKXA 2F98A 3CPOA 1W2ZA 2WGOA 3BNEA 5FGOA 3NXJA 3SVAA 3AMOA 1Q40B 4FMBA 2IUKA 4KFDA 1HU9A 3DGLA 4HYZA 2IA7A 1JJ22 1N9EA 3X40A 2GEXA 4RBNA 4O3VA 4K1UA 3Q1CA 3GWRA 1G96A 4WVZA 1D6YA 1L5GB 3FSDA 1US1A 3LYGA 2W0QA 3CCS3 1LNHA 3DGNA 2OTJ3 1Q7Y4 3HK4A 1VQO3 3KKGA 2CG0A 3CMA3 4HM5B 3F14A 3GAXA 4X2OA 2Z77A 5CF2A 1KD14 4IPBA 4LZIA 4WP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQT A;  2E5Y A;  2WSS H;  4QMA A;  1BSH A;  1E79 H;  2W6J H;  4YXW H;  2V7Q H;  1FS0 E;  4TLF A;  3USS A;  4WVZ A;  2CK3 H;  4DJG A;  1BSN A;  2E5T A;  1JEK A;  2XND H;  3EFF K;  1IFP A;  2QE7 H;  3PJS K;  2JDI H; 
#chains in the Genus database with same CATH topology
 2KOG A;  4O9B A;  1LOV A;  1B20 A;  3MD0 A;  1VQ6 P;  3CX5 H;  3CCV P;  2CC3 A;  1S9K E;  3EF8 A;  5CHX A;  1E79 H;  1BE3 G;  2YXQ B;  3HD7 C;  2BMQ B;  4LEH A;  1X8Y A;  1H89 A;  2KF5 A;  2XZR A;  2GBW B;  1RGC A;  1A90 A;  2A15 A;  2GA1 A;  1T2I A;  3AEC C;  2XH9 A;  2E5T A;  4O02 B;  3Q2Y A;  3A5E A;  1SFC A;  5APQ A;  3CNX A;  3PJS K;  2KI7 B;  2D2C C;  2GU3 A;  1AFO A;  1LOY A;  2GM4 A;  3HZP A;  4N6U A;  2NPS C;  4HM8 B;  4BRY A;  2OYI C;  2K9J B;  2KNC B;  1NNV A;  3AE1 C;  1M56 D;  1Q2N A;  3A3Y B;  1NB3 I;  4H13 D;  3L75 J;  1GOU A;  4MEI A;  1LTJ A;  1IVV A;  1IT7 A;  3CD6 3;  1KIL B;  3O6Q A;  1W2E A;  1L4A D;  4HM6 B;  1N73 C;  1FUW A;  1Y9B A;  1NTK D;  3SLU A;  1RCK A;  1CYV A;  3T0U A;  3ER7 A;  1IFN A;  1BNI A;  1GS3 A;  5KJ7 D;  4D6T E;  1W02 A;  2KUB A;  3A0H H;  2M5A B;  1NOH A;  3CME P;  2MC8 A;  4FR9 A;  4J9A A;  2Y74 A;  5ELJ A;  1M1J C;  4N6V 0;  3I55 3;  1HBW A;  3U1W A;  2SBL A;  1VQ9 3;  1OXZ A;  2R5D A;  1HJ0 A;  3I0Y A;  4EIJ A;  3M06 A;  3S29 A;  5CBO A;  2YMK A;  3CCR P;  1CZQ A;  4CPG A;  1QVG 2;  1O7H B;  4UB6 E;  3UJM A;  1JMM A;  4OWF A;  3JUP A;  4C7R A;  1V58 A;  4R80 A;  1QVF 2;  1U7J A;  1B21 A;  1YYC A;  3RBX A;  2B87 A;  2E76 B;  1B27 A;  1RJO A;  3M0D C;  1EDL A;  3K63 A;  4FMC A;  5AEU B;  1YIJ P;  2IDB A;  1UUW B;  1SQP K;  1UIX A;  2Y9Y A;  2CWU A;  1NWQ A;  1N5P A;  1CYU A;  4FCJ A;  3D4A A;  1DH3 A;  1YJ9 P;  1VF5 D;  2CWT A;  1QAK A;  2WSC J;  5AVW B;  5TJH A;  3E7K A;  3SWK A;  1X22 A;  2HOD B;  1SQQ E;  3RK3 D;  2B1X B;  3JUQ A;  4WHA A;  2WSC H;  3ECF A;  3RL0 g;  1JV2 B;  1GK4 A;  5AW8 B;  3OV4 A;  4N78 E;  1NO3 A;  3GZB A;  4PV1 D;  5B66 H;  1Y4K A;  5AVR B;  4Q53 A;  3CCU 3;  1K8A 4;  2QIY A;  5JBS A;  3H1J J;  2B24 B;  1L0N D;  1NTZ G;  3CC7 P;  1FZC C;  4JF8 A;  4DT0 A;  2FYZ A;  2INX A;  3AMO B;  3AE8 C;  1PGP A;  1STD A;  3D9R A;  2YKO A;  2IZ1 A;  5GTH E;  2YO3 A;  3SSU A;  1VQM P;  1RN4 A;  2IUJ A;  5EQL A;  1FUS A;  4K61 A;  1J1E C;  1SIH A;  5IG0 A;  2RN0 A;  1Q40 A;  1IU7 A;  1EZV G;  3U97 A;  2XSH B;  4XBT A;  5KLI B;  1LP1 A;  2XFS A;  1PP9 J;  2IYJ A;  2R3S A;  3JUN A;  3ZG0 A;  3A76 A;  2J5U A;  1KTM A;  3VSY A;  2IY2 A;  5AYS C;  3KN4 A;  4O8S A;  1AVK A;  3CCV 3;  2XF3 A;  4HB1 A;  2BMO B;  1X9V A;  2N9B A;  2LR2 A;  2RSX A;  3H1I E;  1HVV A;  1NHL A;  4JF7 A;  1A2P A;  4J8T A;  5CJ4 A;  1PP9 G;  2YFI B;  1UI8 A;  3DXO A;  3LT9 A;  3UB1 A;  1SFC D;  2WOF A;  4L75 A;  4U3F J;  1KYO E;  1VQ8 3;  1X1U A;  1U8C B;  3HTK A;  4FCZ A;  2Q7C A;  2QG4 A;  3NHX A;  2UUG C;  1S72 3;  4DJG A;  1ZOY C;  4H13 B;  3AEA C;  3X3Y A;  3PRJ A;  4HM4 B;  7GSP A;  2OYO A;  1BSB A;  1BOX A;  1JY3 O;  3QRD A;  1W5C E;  3KXD A;  1M7L A;  1L4A B;  1NVO A;  3H6P A;  3II6 A;  4HAA A;  3Q3D A;  3HE5 B;  1VQP P;  1JUN A;  4L7K A;  3AGO A;  3FF0 A;  1J2J B;  4U3F G;  3WUV A;  2L1S A;  1GU5 A;  3L72 D;  4GB5 A;  1EZV I;  4K35 A;  2L4V A;  1KQG B;  2OTK E;  5GTI E;  1XTG B;  3X41 A;  1LNQ A;  4D6T G;  1MWR A;  1FGO A;  4H44 C;  4GKG A;  1VQ4 3;  1NTK K;  1NU1 J;  1LWU A;  2KSE A;  1M90 Q;  4WY4 C;  4PD4 E;  3S9O A;  2FY8 A;  4MMZ B;  2C11 A;  1RGL A;  2F56 A;  1KB9 H;  3NUV A;  2YMY A;  2P38 A;  2Y73 A;  2POH A;  2R44 A;  2E2V A;  1M1J A;  1ROA A;  4IL6 X;  1K8A Q;  3HIG A;  4H44 B;  5LC6 A;  1BUJ A;  1LTB C;  2H0G A;  3EN1 B;  3CXC 2;  1KYO D;  3D6Y A;  3EB8 A;  5RNT A;  1T2K C;  3HRN A;  1MFZ A;  1U5O A;  5AII A;  1BAO A;  3LW5 H;  5AVQ B;  3MHE A;  1GMJ A;  4ILF A;  1ULI B;  1LJ2 A;  2QE7 H;  1BDC A;  4BTY A;  3P8C D;  1GD4 A;  2JEE A;  5KAF E;  2P0X A;  2D42 A;  1BNR A;  5AVV B;  3LXU X;  3C1L A;  1LTS C;  1PY3 A;  2P10 A;  3U59 A;  4UB6 H;  3C9I A;  2BEZ F;  1FZC A;  4N6T A;  2YO2 A;  2QGU A;  4LSO A;  3RK3 B;  1WTH A;  3WOF B;  1RH5 B;  1FZC B;  3CME 3;  1BSN A;  3PP5 A;  1NKZ B;  2K37 A;  3VTP C;  2IPP A;  2XND H;  1GMP A;  1K9M 4;  3I55 P;  3L70 G;  1LNI A;  2ZL8 A;  1J1E B;  1OIP A;  4BRY B;  3M9B A;  5EEO A;  2Z5H A;  4KT0 J;  7STD A;  2RMZ A;  3B4O A;  3WR2 A;  1N8Q A;  2ZYG A;  5GTI H;  1AR0 A;  2F99 A;  2JP3 A;  1JB2 A;  1STF I;  3V2P A;  2O3O A;  3HUS A;  3O8Y A;  1LTT C;  1ZRT D;  3HOH A;  4L76 A;  2QEX P;  4QWT A;  1PIX A;  3M0D A;  1KIL E;  1NB5 I;  2WOH A;  1OF5 A;  3BCC D;  1AA0 A;  1AY7 A;  1EQ7 A;  3CCM 3;  4ORL A;  5KP4 A;  1BUQ A;  1SQV E;  3PH0 A;  1LOW A;  3L75 G;  1MGW A;  2JWD A;  3LW5 J;  3RDE A;  1FZF A;  1L0N E;  1IDP A;  1R4C A;  1SQB D;  1Q86 Q;  1J1D C;  3HX8 A;  3H1H D;  1FGR A;  1I70 A;  1JY3 P;  1HYF A;  3GMA A;  4EOT A;  1OAC A;  3G4S P;  2XRX B;  4BXL A;  1E3V A;  5AIH A;  3B7C A;  5APT A;  4N78 D;  1SFC B;  4EDF A;  1RRH A;  2CFK A;  2ZDJ A;  3ROB A;  1URQ C;  3FXE A;  4I7Z C;  3PCS A;  3CXH E;  4ZNC A;  1T2H A;  1FZG A;  2BU4 A;  4RZM A;  2E76 D;  3CC2 3;  1ZW0 A;  1RE3 A;  1NJI 4;  2GXF A;  1YIT 3;  3UL5 A;  1LTJ C;  4MN4 C;  1IQ8 A;  2ZXE B;  5KLV K;  3K0Z A;  4H61 A;  1NU1 E;  4LGD E;  3GRD A;  3AEG C;  3TF5 A;  2WSS H;  2ITA A;  2WPR A;  3FX0 A;  2CX0 A;  3A5T A;  1S1C X;  2HMK B;  3NM2 A;  3USS A;  3HI7 A;  3VP9 A;  2WQY C;  2LKM A;  4L74 A;  4HVN A;  2IFN A;  1Q7Y Q;  1TUH A;  3E1R A;  2N1T B;  2FGT A;  1BRK A;  1S2E A;  3Q90 A;  1LRA A;  5CBN A;  5AVY B;  1O7P B;  1EXI A;  3GW6 A;  2Q3I A;  2F98 A;  3BNE A;  1RNB A;  3NXJ A;  4DOJ A;  1X1W A;  3DGL A;  1K04 A;  1NTK G;  1G96 A;  1HGZ A;  1T3U A;  2I8D A;  1L5G B;  1GSP A;  3FSD A;  2GUV A;  2W0Q A;  1SQX D;  2OTJ 3;  2FFD C;  1I2E A;  2I1J A;  2CG0 A;  4HM5 B;  3F14 A;  2RKL A;  3SYU A;  1KD1 4;  1OMI A;  1GW4 A;  2IYP A;  2KZJ A;  3H1K G;  1N7S B;  1NKN A;  1KB9 I;  2NRG A;  4CPK A;  2JKV A;  1W6Y A;  1ZME C;  1UUV B;  5JPP A;  1P84 D;  3K5B A;  2MJZ A;  1G2C A;  5G2G A;  1K73 Q;  2R41 A;  1LWU C;  2OTL 3;  3FGY A;  1U7M A;  3VMZ A;  1IVW A;  2HMJ B;  2K3D A;  4XFJ A;  2PRR A;  3V2R A;  4LLH A;  1RQU A;  4HYT B;  1UDI I;  2BCC J;  1VQ4 P;  5E79 H;  1VQ5 3;  1YHQ P;  3KZI E;  3LTC A;  1LWU B;  1WT6 A;  3NMD A;  2PFX A;  1L0N K;  3SOY A;  4WB4 A;  3D5G A;  2HMO B;  2JR8 A;  4KJM A;  3HE5 A;  2E75 B;  4IT7 A;  1PZQ A;  3AED C;  1SQV J;  2C0W A;  5AIF A;  2ZXX A;  3O8Z A;  2MF7 A;  2W56 A;  3WOE B;  2UWJ E;  4NPD A;  3V99 A;  2A06 D;  3CNM A;  1LT9 B;  3L71 G;  1N86 A;  1PFI A;  2M8R A;  1SQX E;  1Q82 4;  1YVB I;  1K28 A;  5AW0 B;  2WPS A;  3L73 D;  1ULJ B;  1WMP A;  1SFC C;  4Y99 C;  2W04 A;  3JVC A;  1SQV G;  5AIG A;  1IYY A;  1JM0 A;  3BU4 A;  5M19 A;  1CSB A;  3M91 A;  4DZO A;  1FW7 A;  4YTP C;  1KQL A;  3HD7 B;  4PD4 I;  1SII A;  2C9L Y;  3VMX A;  3H32 B;  3HD7 A;  3CMA P;  3G4S 3;  1AVY A;  1PPJ E;  3AE4 C;  1YGE A;  3CXH I;  2ZA4 A;  3ALA A;  1BSA A;  3B8L A;  1N5H A;  2HML B;  3GZR A;  2I9W A;  1MNL A;  3AE6 C;  1GU4 A;  1OGX A;  1IFP A;  3NTN A;  3CC2 P;  2H0H A;  1FZB A;  1GZL A;  4HM1 B;  1SQW A;  1URQ B;  1YIT P;  1B2M A;  2CW9 A;  4G1M B;  3LTB A;  5TGN A;  3GHG A;  1IT8 A;  5CCG C;  2KLV A;  5CJ0 A;  2JJL A;  3RL0 C;  3WU2 H;  4WFO A;  3WDG B;  1OVR A;  1M1K Q;  3MSO A;  4BTW A;  1S5L X;  2RH0 A;  4TLF A;  3AHS A;  3FG3 A;  4Z1M H;  1HF9 A;  1GL2 B;  2C10 A;  3QK9 A;  4RNY A;  1DEE G;  2WSE J;  1YVS A;  2HOH A;  5C39 A;  3L74 G;  1BNG A;  6RNT A;  1DE3 A;  3TNU B;  4A7P A;  1T2K D;  3VYI A;  3UNL A;  1FJK A;  1RY3 A;  1Y47 A;  1SQB E;  4ZM8 A;  3D70 A;  2BO9 B;  3QWO C;  2HPC B;  3T97 B;  1RMS A;  1R5L A;  1EA2 A;  4R9L A;  1BVI A;  2K0M A;  3L73 J;  3EN8 A;  3B4S A;  4HKZ H;  1MWS A;  4WY4 D;  2Z76 A;  3MG3 A;  1NTK E;  1Z1S A;  2D2C D;  1QAF A;  5AI1 A;  2BAS A;  5M18 A;  2OTJ P;  3SED A;  1YTZ I;  2FYU E;  3D71 A;  3WUU A;  1UGI A;  1KYO H;  5KAI H;  4HM3 B;  3EJV A;  1LT9 C;  4CJN A;  1B2Z A;  1HWT C;  3BAS A;  1O7G B;  2ZVO B;  3F7S A;  1YGW A;  1OW8 A;  2CFG A;  3CWB J;  4IFM A;  3GSP A;  3ZDM A;  2ML5 A;  1NGM B;  3G6E P;  2R4I A;  2G8Y A;  1VQL P;  1RGK A;  3KSP A;  1VQ5 P;  5AW9 B;  1EC5 A;  3BAT A;  1OWA A;  2YKP A;  2JWA A;  1KWI A;  5AW2 B;  1Q81 4;  2ZVN B;  1DMN A;  3F8X A;  4IIA A;  3RK2 D;  4I1L A;  4TX4 A;  3L71 E;  4AUW A;  3EQ2 A;  2XNX A;  3E99 A;  2P1J A;  1M8O B;  3OWY A;  2W6A A;  5APV A;  4RNZ A;  1SQV K;  1EZV E;  2J58 A;  4MJD A;  1QLE D;  2P09 A;  3NM7 A;  3DUK A;  1VQ7 P;  1D6U A;  1ZX2 A;  1W5Z A;  2IMJ A;  1N7S D;  3OWS A;  2IYO A;  4NRE A;  2OTL P;  1R8E A;  1OHS A;  3VGN A;  2WSF H;  1AV1 A;  1J1D B;  4L8O A;  1DD3 A;  3ZG5 A;  1W00 A;  1Q7H A;  3WOD G;  4O2H A;  5KAF H;  4MMY B;  4NPF X;  2Q3E A;  4CCV A;  1JBR A;  1BGY E;  2VRS A;  4NHF A;  4AKY A;  4ZKU A;  5AEW B;  1TRP A;  3CCL 3;  1NDO B;  2AEM A;  3U1C A;  1UCL A;  2IBZ G;  4L73 A;  3F89 A;  2FYU D;  1MUU A;  2XKM A;  2H0I A;  3TGU J;  1J2B A;  4PD4 H;  4J5K A;  1M1K 4;  3M0A A;  2K1A A;  3H1L E;  3CPW 2;  3DZL A;  1L0N J;  3PXM A;  2W56 B;  1ZP0 C;  1BCC E;  1L0L G;  3F7X A;  1EEJ A;  5CMZ A;  1WMK A;  3VF1 A;  1Q86 4;  3GG2 A;  3D79 A;  2KAA A;  2QVA A;  1DD4 A;  2W90 A;  2ZYD A;  2WWW A;  1GL2 D;  1JRQ A;  4KHX A;  2QRX A;  2L91 A;  2BNG A;  1DMM A;  3FZW A;  4U7J A;  3X42 A;  2WIT A;  3FCS B;  1GL2 A;  1JB0 J;  1JB5 A;  1PP9 D;  2AEJ A;  1VQO P;  3K5T A;  3TDG A;  1H88 A;  5KJ7 A;  1TFK A;  4WWU C;  4FMD A;  1E5W A;  1UCK A;  1RQV A;  3WMD A;  3MTU E;  3FG1 A;  1BSD A;  1LXE A;  5AVS B;  3DGO A;  3CCE 3;  3L72 J;  3JUM A;  2XDJ A;  3HD7 D;  2W83 C;  3LTD A;  2IFM A;  2E75 D;  1PYL A;  4WY4 B;  1HH0 A;  1BGY D;  3PHL A;  2FYU G;  4D6T J;  1IVU A;  1SAR A;  3I56 3;  1M1X B;  1S5L E;  4IL6 E;  3H1J E;  4J5G A;  4OUQ A;  1VQ8 P;  3BVH A;  1YJN 3;  3I5C A;  4ASV A;  1OF5 B;  2WMM A;  5DRV A;  1JN5 B;  1W01 A;  1MOL A;  4EV5 A;  4HOH A;  4M3L A;  2HOD A;  5B5E H;  1RN7 A;  2CPB A;  2CKF B;  3GZY B;  2QJK B;  1QJG A;  1KV4 A;  1V74 A;  5IG4 A;  4GT1 A;  1JZO A;  1MZ9 A;  1U57 A;  4IFF A;  2B87 B;  2M3E A;  3K9M C;  2BCC E;  3LID A;  1ROV A;  2ZT9 B;  3L70 E;  2P58 A;  2NPS D;  3WU2 E;  1FDM A;  1YJW 3;  1AV4 A;  3CX5 E;  2CFW A;  3H25 A;  1VZZ A;  5KLV J;  1WMN A;  5B66 E;  4WYK B;  3RK2 B;  2PP6 A;  2Y0D A;  1RGH A;  1KMI Z;  1B2U A;  5LC7 A;  3WHO A;  2OYH B;  1BCC D;  2KXG A;  1QEX A;  2XV5 A;  1TU5 A;  1YI2 3;  3KSE D;  1RLS A;  1SJW A;  2BHM A;  1YNV X;  5TIS E;  1OCV A;  1SQP G;  1B2S A;  5GTH H;  2CIU A;  1RDS A;  4RKU J;  1KD1 Q;  1AQZ A;  2V1L A;  1S5A A;  1KIL A;  2K9J A;  2KNC A;  1VDF A;  4Y99 B;  4XE5 B;  1VQK 3;  2M3B A;  2R5B A;  1VQ7 3;  1IFJ A;  1UCJ A;  3FF2 A;  3IPT A;  2P0M A;  2N1T A;  2H88 C;  1HKX A;  4W7Y A;  3SFD C;  4JYC A;  1W2Z A;  5DJT B;  2E74 C;  4FMB A;  2IA7 A;  1X79 B;  1N9E A;  1BDD A;  3Q1C A;  3GWR A;  4WVZ A;  4LC1 A;  1UGH I;  4RES B;  4DCK A;  3H1L G;  3CXH D;  1Q7Y 4;  1QGK B;  3CX5 D;  4N3Y B;  3G9R A;  1KQF B;  1G1J A;  1L0L E;  3MIW A;  4IPB A;  2IBZ I;  3KHU A;  3IN6 A;  2KIK A;  1IK3 A;  2IBZ E;  2QM8 A;  1OH0 A;  1RF1 B;  2A45 H;  1IQX A;  1BAN A;  1CI6 A;  5I97 A;  1I3F A;  1PU4 A;  4WWI A;  3EBY A;  3GHG B;  2YX9 A;  2QEX 3;  1HJB A;  1BGY J;  3S28 A;  4HM0 B;  3CCQ P;  3FXD A;  3HTK B;  3L74 D;  1KOR A;  2J59 M;  3FLJ A;  5AW7 B;  1TRQ A;  2D1W A;  1FDI A;  2WSF J;  1NU1 K;  1NTK J;  1GL2 C;  3V2Q A;  5KP3 A;  5AYR B;  3V92 A;  1NTM G;  3CCJ P;  1FS0 E;  1KC8 Q;  3S1K A;  1DEB A;  1SP4 A;  1ZLL A;  2XU6 A;  2L5G B;  3LZA A;  1C7H A;  2OOV A;  1MWU A;  3CCU P;  3G3Z A;  3LIE A;  2Z7A A;  2OYI B;  1RCL A;  1KN7 A;  2KS1 B;  2AAD A;  2PAJ A;  3H1K J;  1EDJ A;  5E79 E;  3FWN A;  3B5N C;  1JY2 N;  2YIU B;  4H3U A;  3RK2 C;  3AE7 C;  4C7N B;  1DVC A;  4HJG H;  1G02 A;  4R9K A;  1VQM 3;  3AGN A;  4IFD K;  1CQS A;  2QSI A;  1H8A A;  3H1K E;  3S4R A;  3RL0 D;  1BSE A;  4AKZ A;  3VMA A;  1QL2 A;  3WUT A;  5CCG D;  2UX0 A;  2GU1 A;  3LT8 A;  1WQL B;  3DMC A;  1UW1 A;  2PNC A;  4HH2 A;  4H0L D;  2E75 C;  3D5I A;  1LOX A;  1T5Y A;  2ZAE B;  2IX7 C;  3HII A;  4PJ0 E;  4YXD C;  2ZT9 D;  1QAL A;  1JKG B;  3VMY A;  1JCD A;  2KZI A;  2NPS B;  2AXC A;  3NV0 B;  4TT3 H;  1IVX A;  2HLO A;  3PS8 A;  1VQ6 3;  1K9M Q;  1GY5 A;  3H1H G;  4KFF A;  4GIF A;  2M5A A;  2H43 A;  3S27 A;  4XDW A;  1PFP A;  2DW3 A;  5K5G B;  9RNT A;  5DJU B;  1SLQ A;  1NYH A;  3TK1 A;  4JQ0 D;  1BRG A;  1FGM A;  2GUS A;  2OQE A;  2FXP A;  1BSH A;  1YTZ T;  2OYH A;  3L74 J;  1S72 P;  1I0V A;  4EV2 A;  2ZHX B;  1ZGX A;  5APS A;  4CDL A;  3Q3F A;  1A2V A;  2K54 A;  3WMM 0;  3N54 B;  3M9Q A;  3NQZ A;  4EBG A;  1TIJ A;  3BCC E;  5BVZ A;  4BL2 A;  5IER A;  1FYS A;  1OHO A;  4OGQ D;  4GOF A;  3F8H A;  1SQX G;  1G0T A;  2JO1 A;  1WRG A;  2O01 J;  3CPW O;  5KKZ C;  1JBS A;  1UUG B;  1B3S A;  3AEB C;  1GY6 A;  1RF0 A;  3FH1 A;  2E5Y A;  3R4Y A;  3TNU A;  6STD A;  2J8X B;  4GSP A;  1RE4 C;  2W6J H;  4JYB A;  3RBZ A;  1CEW I;  2XGN A;  4AQR D;  2OYH C;  2P7J A;  4I5Q A;  4R4L A;  2YKQ A;  3H1H J;  1JZD A;  3CC4 3;  2R3C A;  1OGZ A;  2Y0E A;  3M9H A;  1EQK A;  4I6M C;  4RO0 A;  3D6Z A;  2HMN B;  3L72 E;  1KC8 4;  1AQ5 A;  2JQ5 A;  2KRT A;  3S5C A;  5IF6 A;  2LQV A;  2WTY A;  1IK7 A;  3FWL A;  1AQT A;  3KE7 A;  3PGB A;  1N7S C;  5FW5 A;  1URQ A;  1IFM A;  1M1J B;  2O01 N;  1VQ9 P;  1VQQ A;  2XFT A;  1OW6 A;  1IJD B;  2OQQ A;  1Q42 A;  3L71 J;  4PEJ A;  2O9U X;  3FGA D;  1E97 A;  5TIS H;  1I2G A;  4L8P A;  2FYN C;  5DRE A;  1BNE A;  1OHP A;  4PD4 D;  5APU A;  1RGA A;  3R2P A;  1EDI A;  1YQ4 C;  1BCC J;  3IR9 A;  1RF1 C;  2RBI A;  1SQQ D;  2AXT H;  3RK3 E;  5BVB A;  3TGU G;  3NBB A;  3KFQ C;  3CX5 I;  1VQN P;  2N1T D;  3TYY A;  1AVL A;  4OH8 B;  1LQM B;  1N73 A;  4KZ1 A;  5AVU B;  3S67 A;  1SQB G;  2OQE C;  1UCI A;  1JEK A;  2KF3 A;  3A2A A;  2XSO B;  2QJK C;  2LYX A;  5AW1 B;  3JUO A;  4QMA A;  1JY3 N;  3H1J D;  3H1I G;  5BU4 A;  5L8R J;  3BLZ A;  3AE2 C;  2B9B A;  1G1I A;  3OWU A;  1BU4 A;  3RL0 B;  2E42 A;  5AVZ B;  1PP9 E;  2O3J A;  1LTI C;  2W2C A;  2HMM B;  1S9K D;  2GEY A;  4I4K A;  1EDK A;  1T3B A;  1MWT A;  3B4P A;  3NBR A;  5IW9 A;  3AEE C;  5HOH A;  1T6A A;  3L36 A;  5KLV D;  2RCD A;  1IC2 A;  2H8P D;  3L4F A;  4LGQ A;  2F4Y A;  2KK7 A;  3H1H E;  2HR3 A;  3K7C A;  1NH4 A;  2RNT A;  5CCH D;  1ZS7 A;  4HM2 B;  1N7S A;  3LTA A;  2FFD A;  1JY2 O;  5BXQ A;  4I7Z B;  4U3F E;  3KCH A;  2FNQ A;  3B8E B;  1R5S A;  1KB9 E;  1IZN B;  3EE1 A;  1HZ1 A;  4HBR A;  2CPS A;  3L70 J;  1OFC X;  1BGS A;  5D82 A;  3H1I D;  1UII A;  2CWV A;  2OOV C;  2SAR A;  3OW2 2;  4WY4 A;  5KTB A;  4EI2 A;  2A06 E;  2V7Q J;  1S4X A;  4OGQ B;  4KT3 B;  3L70 D;  3OW2 O;  1WMO A;  1MGR A;  4D6T D;  1PPJ D;  2W8Z A;  4XB5 A;  3WA3 A;  3G71 P;  2CH9 A;  2H7H A;  3CWB G;  3G16 A;  3MG1 A;  2QJP B;  1NTZ D;  3DGY A;  3EHC A;  2Q6Q A;  2Z6B A;  2I1K A;  3MHV A;  2CHC A;  3SOA A;  1FA3 A;  1GMQ A;  3EC9 A;  4R4M A;  4U13 A;  3KZI H;  4H0L B;  1T3J A;  1JTH B;  1JOC A;  4UB8 H;  1NTZ K;  3OX9 A;  1PGO A;  1JY2 P;  1NAY A;  2P05 A;  1FGT A;  5EVH A;  2WZ7 A;  1O7M B;  5BU8 B;  3FKA A;  3OXA A;  1FZE A;  1VQL 3;  1M57 D;  3L72 G;  5ELU A;  4U3F D;  2A45 I;  2E76 C;  3IF4 A;  4HZ9 B;  2P2U A;  2OWP A;  3BB9 A;  3X3X A;  1URQ D;  3L73 G;  1T8Z A;  2W27 A;  3V4Q A;  3IMA B;  1E3R A;  1RHL A;  3G8Z A;  1BNJ A;  4AEQ A;  4B86 A;  5D83 A;  2ZFC A;  1W2B 2;  1K05 A;  2O01 H;  1O7W B;  1GYB A;  1I3I A;  1I0X A;  1FE6 A;  3TGU E;  2QJP C;  1RGF A;  1AJY A;  1KZU B;  2M0B A;  3PZW A;  2O1J A;  3CC4 P;  3H1L D;  1N73 B;  3NX0 A;  5KLI C;  7RNT A;  1BE3 E;  4UB8 E;  1SS1 A;  1FBM A;  2KB7 P;  1VL2 A;  4I2L C;  2IZ0 A;  1N9J A;  3GZX B;  3MWZ A;  2O1K A;  2BMR B;  3KYQ A;  3CCR 3;  1ZRT E;  3GF7 A;  3V4W A;  3H1J G;  1O7N B;  4GHO A;  3UL6 A;  1L0N G;  5CF1 A;  3L0R A;  4KVH A;  3CI9 A;  1NO4 A;  5B5E E;  4OVN F;  3JC2 2;  4XM4 A;  2KCD A;  5M1B A;  1QMA A;  5HGR A;  3H1K D;  1RTU A;  4FMA A;  2CFD A;  4WBA A;  4GOE A;  1GK6 A;  2C9N Y;  2JDI H;  2FXT A;  1L2P A;  2WGO A;  3A0B E;  5FGO A;  3BRT B;  1Q40 B;  3AMO A;  2IUK A;  5H2F E;  4HYZ A;  5KKZ B;  4RBN A;  2WSE H;  1FUT A;  2BCC G;  1D6Y A;  1OX3 A;  4BWN A;  1NU1 G;  3B5N B;  3OJA B;  3P7K A;  3CCS 3;  1EZV D;  1S3J A;  3DGN A;  5APX A;  1NTZ J;  3HK4 A;  3N4X A;  1VQO 3;  3KKG A;  1KQS O;  1H0T B;  2QA4 P;  3CMA 3;  2KF4 A;  2Z77 A;  5CF2 A;  2LXB A;  4K1U A;  4LZI A;  2QJY C;  2WPV B;  2HYN A;  2FFD B;  2ZYA A;  5AVT B;  4JRF A;  1BE3 D;  1GMR A;  3D3L A;  3LML A;  4HJL B;  4XDV A;  1KQS 2;  4C46 A;  1R4Y A;  5APY A;  1JO5 A;  5EFW B;  2P67 A;  3GLM A;  4WYK A;  3CC7 3;  5KLV E;  2A45 G;  1OZH A;  1N8R 4;  4OVM A;  4W80 A;  1OPY A;  3I56 P;  1P84 H;  1SQP E;  1NTM J;  2Q1K A;  4K1V A;  1BE3 J;  3AEF C;  1A2K A;  2A06 G;  2HFE D;  3N7N A;  5IEO A;  5KP1 A;  4H44 D;  4JPZ B;  1TP6 A;  1SPU A;  2KF6 A;  1L0L J;  2FYU J;  4HKV B;  3AE5 C;  1NTM D;  2OGU A;  3B5N A;  2K9Y A;  3OAK A;  1CW5 A;  3EBT A;  3DM8 A;  2HG5 D;  3SFE C;  3C8V A;  1IV7 A;  1X1Y A;  3SX1 A;  3GHG C;  1RGG A;  1TJD A;  3N8B A;  3VN0 A;  4XA4 A;  3NQY A;  1IFD A;  2NPS A;  2F5W A;  3NV0 A;  4PV1 C;  4R1K A;  3G0K A;  2BIR A;  1W6C A;  4OGQ C;  1FJP A;  3HE4 A;  2K88 A;  1FZA A;  2Y9Z A;  1V57 A;  3RK3 C;  1SQQ J;  2STD A;  1QL1 A;  3ABV C;  3CL3 D;  3L75 D;  1LP1 B;  1AVO A;  2YIU C;  3EX9 A;  3CLQ A;  1IV9 A;  3Q5S A;  1QVG O;  1YI2 P;  1W4N A;  3FG4 A;  2YXR B;  1KSI A;  3URP A;  4BTX A;  1SQP D;  1OVV A;  1USD A;  1RNT A;  3JCU E;  3L74 E;  4N3V A;  1LQG C;  3G71 3;  3KZT A;  2C0X A;  2C4B A;  1JCC A;  3EFG A;  1VQP 3;  1FAV A;  1BRH A;  1LTJ B;  3JSV C;  4EC6 A;  2ZT9 C;  1NTM E;  1VPC A;  2Q9I A;  4HZB B;  4DKI A;  2IBZ D;  3V98 A;  4H0L C;  3PLN A;  4RNT A;  3CU3 A;  3Q5R A;  5D81 A;  2F5M A;  4MMX B;  3H3H A;  2AXT E;  2W9P A;  3H51 A;  2Z5I A;  3T8U A;  1GY7 A;  1LGH B;  1USE A;  2G3A A;  5CCH A;  1YHQ 3;  1RF0 C;  2N1T C;  5KJ7 C;  1A67 A;  2BEQ D;  4Y28 J;  4BIR A;  1X0T A;  1GD3 A;  1BNF A;  4GL6 A;  5IEP A;  4IL6 H;  3V2N A;  3A0B H;  4LMI A;  2Z4E A;  3HUS B;  1CI6 B;  2KXP B;  1K41 A;  1PPJ G;  1PGQ A;  3DGM A;  5CCH C;  4NPE A;  1LT9 A;  3V5B A;  1N2D C;  1LTA C;  1A02 J;  1NU1 D;  3PYJ A;  5CLK A;  3BRV B;  3SWF A;  1GW3 A;  2PGD A;  1IQY A;  3MUD C;  2BCC D;  3P8M C;  3MPH A;  3KPE A;  1DX7 A;  1Q9E A;  5IEN A;  3E1I A;  4K90 B;  1PGJ A;  4JBZ A;  1TU3 F;  3KQG A;  3NXS A;  1I8V A;  2XR8 B;  1JNQ A;  3CCS P;  3CWB D;  3NFQ A;  3W67 A;  2F86 B;  2UGI A;  3CCJ 3;  1SQP J;  1YBK A;  2E2T A;  3CCL P;  1ZXG A;  5M1A A;  1PV3 A;  1HUC A;  5BU5 A;  3MUD A;  5AVX B;  2KSJ A;  3GF3 A;  5H2F H;  2CX1 A;  1RKY A;  1Y8A A;  3VOP A;  4N6L A;  3UIA A;  1JTH A;  4LYL B;  2E74 B;  2W6B A;  4N6J A;  1N8R Q;  1MV8 A;  4GDO A;  2KS1 A;  1BIR A;  5IG3 A;  4BL3 A;  1Q81 Q;  5KLV G;  3BCC G;  1QVF O;  1DMQ A;  2KLU A;  3EQQ B;  1G2C B;  3RGU A;  2WT7 B;  3HE4 B;  4W7Z A;  2NZ2 A;  5KAI E;  5CXO A;  2QIW A;  3WA2 X;  2W9Q A;  3CCM P;  5IG5 A;  2R32 A;  2PZV A;  3Q2P A;  1VF5 C;  3RGR A;  2XGL A;  1SQQ K;  2H89 C;  1W2B O;  3P8C E;  4N6O B;  3F9S A;  3B71 A;  4GOD A;  1FGQ A;  3MYT A;  1GD2 E;  1BSC A;  3LH4 A;  3U1A A;  2OYI A;  1BRN L;  3NBJ A;  6GSP A;  1NU3 A;  2QA4 3;  4IOI H;  4KFE A;  1RHZ B;  1RE3 C;  3Q5P A;  2GBX B;  1M9G A;  1ZO2 A;  2GSP A;  1BCC G;  3X3Z A;  3F40 A;  1BRI A;  2FYN B;  1HGV A;  2HPC A;  2FYU K;  1X1X A;  2V4H A;  3EFF K;  1ZN5 A;  3L35 A;  5G1L A;  2N9Y B;  4EYY Q;  2B88 A;  1MFT A;  1P84 E;  5AW5 B;  3MZW B;  4YPC A;  1OW7 A;  3N9H A;  3TDK A;  1ASK A;  2RGQ A;  4BU4 A;  1NTM K;  1FU1 A;  2V7Q H;  1W6G A;  1Z56 A;  1EKM A;  4N6M A;  3A7O A;  1KIL D;  1NJI Q;  2LXC B;  2ML6 A;  2YFJ B;  3B5N D;  4STD A;  3V6I A;  2E2U A;  4EW5 A;  1L4A A;  1IK9 A;  1L4A C;  2YFL B;  3L37 A;  1ZV8 A;  3SWY A;  1GOV A;  2YNY A;  5CK6 A;  1F8N A;  3L75 E;  3T97 A;  1YJW P;  3KDP B;  4OK0 A;  1FZU A;  1UI7 A;  3PTZ A;  2WVR A;  1L0L K;  3H1L J;  3HUS C;  3IAO A;  3AHW A;  1BRJ A;  1JB4 A;  3Q1M A;  4RJT A;  4X2H A;  3M8C A;  1GOY A;  1RRL A;  2QM7 A;  3G6E 3;  2FBW C;  2RFR A;  3BIR A;  1JBT A;  1BNS A;  5GSP A;  3IFM A;  3DY5 A;  1I2F A;  1BGY G;  1KFM A;  3MKI A;  4AYC A;  3TGU D;  2B89 A;  3H32 A;  1XTC C;  1EG9 B;  1FC2 C;  1RF1 A;  1SQX K;  2CG1 A;  2M7O A;  1GTW A;  1TTO A;  2FKW B;  2XEP A;  1VQK P;  8RNT A;  1JNM A;  5CCG A;  3CD6 P;  1MKM A;  4FCM A;  5AW6 B;  1YIJ 3;  2OAR A;  5BIR A;  1SQB J;  5AW3 B;  2WO0 A;  8CHO A;  1VQN 3;  1Q82 Q;  2KYV A;  4K3A A;  1GDT A;  1L0L D;  2Y0C A;  1H0T A;  1Q90 D;  5STD A;  3LOY A;  2WPQ A;  3RGA A;  3IJE B;  3AE3 C;  1KB9 D;  5G1K A;  1W7C A;  2E74 D;  3BCC J;  1EXJ A;  3F5H A;  2Q07 A;  4N6N B;  1P84 I;  1JMB A;  3BNB A;  2ZJS E;  1TFO A;  1DVD A;  3A0H E;  1OUN A;  3BND A;  1D7M A;  3ITK A;  2AEF A;  1DYU A;  1RE4 A;  4ZMD A;  4ZKP A;  3DH2 A;  1NAF A;  1BRS A;  4EYC A;  1RN1 A;  4R4K A;  3T8N A;  1LVN A;  4H13 C;  4YXW H;  1QX8 A;  2D2C B;  2CFL A;  3QH9 A;  3PCR A;  2BT3 A;  1FDO A;  1KYO I;  1IO4 A;  1KIL C;  5JPU A;  5AW4 B;  3CCQ 3;  3CWB E;  2WT7 A;  4PJ0 H;  1JN5 A;  2CK3 H;  3P32 A;  3J7Y d;  4HM7 B;  3VP8 A;  3H1I J;  1DIP A;  2WGQ A;  4XBY A;  1C54 A;  1KFN A;  1ISK A;  3SXX A;  1YJ9 3;  1K73 4;  3MP7 B;  1DET A;  2W03 A;  1SQQ G;  4EXR A;  3W68 A;  1M90 4;  1VF5 B;  1SQB K;  1NWW A;  1PL5 A;  2MKV A;  2AAE A;  1D6Z A;  3O6Q B;  2QJY B;  2Q5U A;  3BNC A;  3OA7 A;  1LT1 A;  1FOS E;  3EWK A;  1JKG A;  1WNH A;  3MG2 A;  5A0O B;  2K3R A;  2SPZ A;  3CCE P;  2OCT A;  1SQV D;  4PV1 B;  1N7L A;  1IFI A;  4C7N A;  3KII A;  2FXM A;  1SQX J;  4XBX A;  3L73 E;  1NTZ E;  3STD A;  5APW A;  3RNT A;  1ZR4 A;  1HTL C;  3CPO A;  1RGE A;  2KP8 A;  3SVA A;  1YQ3 C;  4KFD A;  3JCU H;  1S5L H;  1HU9 A;  3L71 D;  3AE9 C;  4NPB A;  1JJ2 2;  1LTG C;  3X40 A;  2GEX A;  4O3V A;  1YJN P;  3TSI A;  2E43 A;  3CXH H;  1OVU A;  1FOS F;  1SVF A;  1ZR2 A;  1A02 F;  1US1 A;  3LYG A;  1LNH A;  3ZFZ A;  1EUI C;  1CH0 A;  1RSN A;  3GAX A;  4X2O A;  4ASW A;  1B2X A;  3MGN A;  2FXO A;  4WP5 A; 
#chains in the Genus database with same CATH homology
 1IK3 A;  4JRF A;  2CC3 A;  3EF8 A;  1OH0 A;  3D3L A;  1E79 H;  3LML A;  1W6Y A;  4HJL B;  1IQX A;  1UUV B;  4XDV A;  1KQS 2;  2BMQ B;  4LEH A;  5JPP A;  5I97 A;  1PU4 A;  5G2G A;  4WYK A;  3EBY A;  3CC7 3;  2GBW B;  1A90 A;  2A15 A;  1N8R 4;  4OVM A;  2YX9 A;  1OPY A;  2QEX 3;  2OTL 3;  3FGY A;  3S28 A;  2HMJ B;  1IVW A;  4HM0 B;  4K1V A;  2XH9 A;  2E5T A;  4O02 B;  3FLJ A;  1A2K A;  3CNX A;  3PJS K;  5IEO A;  5KP1 A;  1TP6 A;  2D1W A;  1VQ5 3;  1SPU A;  2GU3 A;  3LTC A;  5KP3 A;  5AYR B;  4HKV B;  3V92 A;  1FS0 E;  3SOY A;  3HZP A;  4N6U A;  4HM8 B;  3EBT A;  3LZA A;  1C7H A;  2OOV A;  1NB3 I;  2HMO B;  3DM8 A;  1IV7 A;  4MEI A;  4IT7 A;  2Z7A A;  3SX1 A;  1IVV A;  1IT7 A;  5AIF A;  3N8B A;  3CD6 3;  2MF7 A;  2W56 A;  3WOE B;  3V99 A;  3NQY A;  3CNM A;  3NV0 A;  4HM6 B;  1FUW A;  3SLU A;  4R1K A;  3G0K A;  4H3U A;  1CYV A;  1W6C A;  3T0U A;  1DVC A;  3ER7 A;  4R9K A;  1GS3 A;  1VQM 3;  1Q82 4;  1YVB I;  1W02 A;  1K28 A;  1CQS A;  2STD A;  2MC8 A;  4FR9 A;  1ULJ B;  4J9A A;  2Y74 A;  1WMP A;  4AKZ A;  5ELJ A;  4N6V 0;  3EX9 A;  2W04 A;  3I55 3;  3JVC A;  2UX0 A;  2GU1 A;  3LT8 A;  1WQL B;  5AIG A;  3U1W A;  1IV9 A;  3DMC A;  1UW1 A;  2SBL A;  1VQ9 3;  1W4N A;  3FG4 A;  3I0Y A;  1KSI A;  2PNC A;  3S29 A;  1SII A;  4BTX A;  1LOX A;  1T5Y A;  3HII A;  1QAL A;  4N3V A;  3G71 3;  1JKG B;  3KZT A;  1O7H B;  1QVG 2;  3UJM A;  3G4S 3;  3NV0 B;  1VQP 3;  1IVX A;  3JUP A;  3PS8 A;  1VQ6 3;  4R80 A;  1YGE A;  1QVF 2;  3ALA A;  3B8L A;  1N5H A;  2HML B;  1GY5 A;  3GZR A;  4EC6 A;  4KFF A;  2I9W A;  1MNL A;  1RJO A;  4HZB B;  3S27 A;  3V98 A;  3K63 A;  4FMC A;  4XDW A;  1OGX A;  5AEU B;  1PFP A;  1UUW B;  1IFP A;  2CWU A;  3CU3 A;  4HM1 B;  1SQW A;  5D81 A;  1N5P A;  2CW9 A;  3LTB A;  4G1M B;  1IT8 A;  4MMX B;  5TGN A;  1CYU A;  3H3H A;  1FGM A;  2W9P A;  3H51 A;  4FCJ A;  2CWT A;  2OQE A;  3T8U A;  1BSH A;  1GY7 A;  1QAK A;  4BTW A;  4WFO A;  4EV2 A;  3WDG B;  3MSO A;  4CDL A;  4TLF A;  1A2V A;  1YHQ 3;  2K54 A;  2B1X B;  3JUQ A;  4WHA A;  3FG3 A;  3N54 B;  1A67 A;  3NQZ A;  3ECF A;  1TIJ A;  2C10 A;  3QK9 A;  4RNY A;  4EBG A;  5IER A;  1OHO A;  1JV2 B;  3F8H A;  3OV4 A;  1GD3 A;  1NO3 A;  3GZB A;  4GL6 A;  5IEP A;  4LMI A;  1Y4K A;  4Q53 A;  3CCU 3;  1K8A 4;  1GY6 A;  1K41 A;  2QIY A;  3FH1 A;  2E5Y A;  3UNL A;  5JBS A;  6STD A;  2B24 B;  3DGM A;  2W6J H;  4JF8 A;  4ZM8 A;  2BO9 B;  2INX A;  1CEW I;  2XGN A;  3AMO B;  1EA2 A;  1STD A;  3PYJ A;  4R9L A;  5CLK A;  3D9R A;  3CC4 3;  1IQY A;  2K0M A;  3EN8 A;  1OGZ A;  2IUJ A;  5EQL A;  3MPH A;  2Z76 A;  3MG3 A;  4K61 A;  1EQK A;  1SIH A;  2HMN B;  5IG0 A;  1Z1S A;  5IEN A;  1KC8 4;  4K90 B;  1Q40 A;  2JQ5 A;  2KRT A;  3S5C A;  1QAF A;  1IU7 A;  5IF6 A;  2LQV A;  5AI1 A;  3U97 A;  2XSH B;  4XBT A;  2XR8 B;  1JNQ A;  2XFS A;  1AQT A;  3KE7 A;  3PGB A;  3SED A;  5FW5 A;  2F86 B;  3CCJ 3;  3JUN A;  3A76 A;  2E2T A;  2XFT A;  3VSY A;  5AYS C;  1Q42 A;  3KN4 A;  4PEJ A;  4O8S A;  2O9U X;  1AVK A;  1RKY A;  4HM3 B;  4N6L A;  2XF3 A;  1E97 A;  3EJV A;  3CCV 3;  2BMO B;  4L8P A;  5DRE A;  2RSX A;  1OHP A;  5IG3 A;  1O7G B;  3F7S A;  4J8T A;  2CFG A;  1DMQ A;  3EQQ B;  2YFI B;  1UI8 A;  5BVB A;  3DXO A;  3NBB A;  3LT9 A;  3KFQ C;  2ML5 A;  3UB1 A;  5CXO A;  2WOF A;  1VQ8 3;  2R4I A;  3WA2 X;  2W9Q A;  1U8C B;  3KSP A;  5IG5 A;  1AVL A;  2PZV A;  4FCZ A;  3Q2P A;  3NHX A;  3RGR A;  1KWI A;  2XGL A;  1S72 3;  4DJG A;  1Q81 4;  4KZ1 A;  4IIA A;  1DMN A;  3F8X A;  3S67 A;  3X3Y A;  4HM4 B;  4N6O B;  2OQE C;  3F9S A;  4TX4 A;  1JEK A;  1FGQ A;  3MYT A;  3QRD A;  3E99 A;  3LH4 A;  3NBJ A;  2XSO B;  1NU3 A;  2LYX A;  3JUO A;  2QA4 3;  4L7K A;  3FF0 A;  3OWY A;  4KFE A;  4QMA A;  4RNZ A;  4GB5 A;  3BLZ A;  4MJD A;  2P09 A;  2L4V A;  2GBX B;  1M9G A;  3NM7 A;  1ZO2 A;  3DUK A;  3OWU A;  1D6U A;  1ZX2 A;  1W5Z A;  2IMJ A;  3X3Z A;  3F40 A;  3X41 A;  3OWS A;  2W2C A;  2HMM B;  1FGO A;  2GEY A;  4I4K A;  4NRE A;  3EFF K;  1OHS A;  3VGN A;  1VQ4 3;  3NBR A;  3B4P A;  5IW9 A;  4L8O A;  1W00 A;  3WOD G;  4O2H A;  4MMY B;  2RCD A;  4MMZ B;  2C11 A;  4CCV A;  3N9H A;  1ASK A;  4LGQ A;  3NUV A;  4NHF A;  2P38 A;  2RGQ A;  2Y73 A;  4AKY A;  2E2V A;  2V7Q H;  1W6G A;  1EKM A;  1ROA A;  3K7C A;  4N6M A;  5AEW B;  3HIG A;  2ML6 A;  5LC6 A;  3CCL 3;  1NDO B;  4HM2 B;  2YFJ B;  3LTA A;  3CXC 2;  3EN1 B;  4STD A;  2E2U A;  3EB8 A;  1U5O A;  2YFL B;  5AII A;  5BXQ A;  3MHE A;  2FNQ A;  1ULI B;  2QE7 H;  5CK6 A;  1F8N A;  4BTY A;  1GD4 A;  3EE1 A;  2P0X A;  1J2B A;  1M1K 4;  4HBR A;  3CPW 2;  4OK0 A;  1UI7 A;  2D42 A;  3DZL A;  3LXU X;  3PXM A;  2W56 B;  5D82 A;  3F7X A;  2CWV A;  2OOV C;  3OW2 2;  1JB4 A;  3VF1 A;  4N6T A;  1Q86 4;  4X2H A;  2QGU A;  3M8C A;  4LSO A;  1RRL A;  1WTH A;  3WOF B;  2RFR A;  3G6E 3;  1JRQ A;  3CME 3;  1BSN A;  2BNG A;  1DMM A;  3FZW A;  3DY5 A;  1WMO A;  2XND H;  1K9M 4;  3MKI A;  3X42 A;  3FCS B;  4XB5 A;  1JB5 A;  3WA3 A;  2ZL8 A;  2CH9 A;  3K5T A;  3TDG A;  1EG9 B;  5EEO A;  3G16 A;  1TFK A;  3MG1 A;  4WWU C;  2CG1 A;  7STD A;  4FMD A;  3B4O A;  3EHC A;  1N8Q A;  2M7O A;  3WMD A;  2Z6B A;  3FG1 A;  1LXE A;  3DGO A;  1AR0 A;  2CHC A;  2F99 A;  3SOA A;  3CCE 3;  1FA3 A;  1JB2 A;  1STF I;  3JUM A;  2XEP A;  3EC9 A;  2O3O A;  4U13 A;  3LTD A;  3O8Y A;  4FCM A;  1YIJ 3;  3OX9 A;  1IVU A;  2P05 A;  3I56 3;  1FGT A;  1M1X B;  4QWT A;  5EVH A;  1NB5 I;  2WOH A;  1OF5 A;  1O7M B;  2WO0 A;  3FKA A;  3OXA A;  4OUQ A;  8CHO A;  1VQN 3;  1YJN 3;  3CCM 3;  1VQL 3;  5ELU A;  4ORL A;  1OF5 B;  5DRV A;  1JN5 B;  4HZ9 B;  5KP4 A;  1BUQ A;  1W01 A;  2OWP A;  3BB9 A;  1MOL A;  4EV5 A;  5STD A;  3X3X A;  3LOY A;  3RGA A;  3IJE B;  1W7C A;  3IMA B;  1E3R A;  1RN7 A;  2Q07 A;  3G8Z A;  4N6N B;  3RDE A;  3BNB A;  2CKF B;  3GZY B;  1IDP A;  1QJG A;  1TFO A;  1DVD A;  1OUN A;  1R4C A;  4AEQ A;  3BND A;  5D83 A;  3HX8 A;  1V74 A;  1DYU A;  1FGR A;  5IG4 A;  1W2B 2;  1OAC A;  1O7W B;  1GYB A;  2XRX B;  3K9M C;  4EYC A;  4R4K A;  1ROV A;  3T8N A;  1E3V A;  1LVN A;  5AIH A;  3B7C A;  2CFK A;  3ROB A;  1RRH A;  2ZDJ A;  4YXW H;  2CFL A;  3PCR A;  2BT3 A;  1YJW 3;  3PCS A;  5JPU A;  1AV4 A;  3CCQ 3;  1JN5 A;  2CK3 H;  4RZM A;  2CFW A;  1VZZ A;  3CC2 3;  1WMN A;  4WYK B;  3J7Y d;  3PZW A;  1NJI 4;  2GXF A;  4HM7 B;  3UL5 A;  1YIT 3;  4XBY A;  2WGQ A;  5LC7 A;  3NX0 A;  1ISK A;  1IQ8 A;  3SXX A;  1YJ9 3;  2KXG A;  3K0Z A;  4H61 A;  1K73 4;  3GRD A;  3GZX B;  1N9J A;  1TU5 A;  1YI2 3;  2W03 A;  3KSE D;  3MWZ A;  2WSS H;  1SJW A;  4EXR A;  2BMR B;  1M90 4;  2BHM A;  1NWW A;  3CCR 3;  1D6Z A;  1O7N B;  3UL6 A;  1OCV A;  3BNC A;  2HMK B;  3NM2 A;  5CF1 A;  3USS A;  3HI7 A;  3L0R A;  2CIU A;  4KVH A;  1JKG A;  1WNH A;  4HVN A;  3MG2 A;  5A0O B;  2V1L A;  1TUH A;  1S5A A;  4XM4 A;  2OCT A;  2KCD A;  1VQK 3;  1QMA A;  5HGR A;  2FGT A;  3KII A;  3Q90 A;  1VQ7 3;  4XBX A;  3FF2 A;  3STD A;  3IPT A;  1O7P B;  2CFD A;  2P0M A;  4FMA A;  2JDI H;  2FXT A;  1HKX A;  2F98 A;  3CPO A;  1W2Z A;  2WGO A;  3BNE A;  5FGO A;  3NXJ A;  3SVA A;  3AMO A;  1Q40 B;  4FMB A;  2IUK A;  4KFD A;  1HU9 A;  3DGL A;  4HYZ A;  2IA7 A;  1JJ2 2;  1N9E A;  3X40 A;  2GEX A;  4RBN A;  4O3V A;  4K1U A;  3Q1C A;  3GWR A;  1G96 A;  4WVZ A;  1D6Y A;  1L5G B;  3FSD A;  1US1 A;  3LYG A;  2W0Q A;  3CCS 3;  1LNH A;  3DGN A;  2OTJ 3;  1Q7Y 4;  3HK4 A;  1VQO 3;  3KKG A;  2CG0 A;  3CMA 3;  4HM5 B;  3F14 A;  3GAX A;  4X2O A;  2Z77 A;  5CF2 A;  1KD1 4;  4IPB A;  4LZI A;  4WP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...