2JDIH

Ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
88
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
publication title Ground State Structure of F1-ATPase from Bovine Heart Mitochondria at 1.9 A Resolution
pubmed doi rcsb
molecule tags Hydrolase
total genus 11
structure length 88
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2jdiH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2jdiH01
3PJSK 2V7QH 4WVZA 4YXWH 2W6JH 1BSNA 4QMAA 2WSSH 2JDIH 4TLFA 3USSA 2E5YA 2XNDH 4DJGA 1AQTA 2QE7H 1JEKA 1IFPA 1BSHA 1E79H 2E5TA 2CK3H 1FS0E 3EFFK
chains in the Genus database with same CATH superfamily
2H0IA 3KE7A 3AEFC 2HODA 3L73E 2WT7B 4O8SA 2IYPA 3RL0g 3H1HG 3CC7P 2F5MA 1VF5D 1NWQA 3GMAA 1JMMA 2QJYB 3OA7A 1PGOA 1FJPA 2K54A 4OK0A 4XFJA 2CWTA 2WT7A 2F5WA 2OTKE 3P32A 1PV3A 3NUVA 3VN0A 1IFPA 5IEOA 2LQVA 3MG3A 3KYQA 2WSFH 2B9BA 2O01N 3MIWA 2KIKA 3CCJP 2SARA 3HD7C 1J2JB 3L75G 3Q2YA 4C7NA 3O8ZA 3RL0B 1DVCA 1HGVA 1BSNA 3TNUB 1SPUA 1D6YA 2MC8A 2BMRB 2WZ7A 1MZ9A 4FMAA 2PRRA 4EYYQ 3TGUJ 2XEPA 3SEDA 3TNUA 7GSPA 2GXFA 1KYOE 1RE3A 1M1XB 1T3BA 1DD3A 1ZR4A 1S9KE 2B1XB 3EFFK 1YI2P 3EJVA 1ISKA 3S1KA 1GMPA 1SQVJ 4LMIA 1BE3J 2KZIA 1ZR2A 2STDA 1I70A 8CHOA 1BCCJ 3C1LA 4I7ZC 1K9MQ 1KB9E 5D83A 2YKOA 4U13A 1VQM3 1ROAA 1GW3A 2CC3A 1VQK3 3G713 2D2CB 3G6E3 3NFQA 4WY4D 1IVXA 3CI9A 1L0LG 2J8XB 3PZWA 3EBTA 1QLED 1S5AA 4EV2A 2RMZA 1RF0A 2P2UA 1P84I 3AEGC 1QEXA 4PV1C 1GMRA 5IW9A 1BRIA 4L76A 2XFSA 3AE7C 4U3FD 4GIFA 5BIRA 2Q3EA 3MKIA 2M8RA 3BCCJ 3U59A 1Q7HA 3FF2A 1B2MA 1OH0A 3PHLA 4IL6X 3F7XA 1LQMB 1BGYE 2OQEA 3IF4A 2N1TA 2C0XA 3D79A 1LGHB 3V2PA 1E97A 1LOYA 2QJPC 3EBYA 1Q9EA 3GSPA 4AYCA 4IFDK 1NHLA 5KLIB 3LW5H 1RTUA 2ZVNB 2C0WA 1L0NE 4LC1A 3CNXA 1NKNA 1VF5C 2M3BA 4H13D 4L75A 3H1JJ 4HM3B 1IK9A 4WBAA 3MG2A 2OCTA 2XKMA 1LT1A 3CMEP 1BNGA 5LC6A 2V4HA 3G4SP 2LXBA 4AQRD 1I2GA 3L72D 2ZJSE 2F4YA 1JKGB 3MHEA 4K1VA 2PAJA 1URQB 4BTXA 4C46A 1BRGA 1JKGA 5AVXB 5AW0B 1URQA 2RKLA 3OWSA 3R2PA 1BNIA 4K90B 3WUVA 1YGWA 3DMCA 2JWAA 5KLVK 2L91A 3MP7B 4H0LD 3FF0A 1VQ63 4GB5A 1QVFO 5KKZB 5TISH 3M0DC 1FAVA 3X42A 3ITKA 1RF1B 2A06E 2R4IA 3SVAA 1SQBD 1YJ9P 1QAFA 1W2BO 5HOHA 3WU2E 1PFPA 3CCSP 1RE4C 1JUNA 3MSOA 3L71E 4EW5A 3L70E 3O6QA 1RF1A 3RK3B 2OTJ3 3V4QA 4DZOA 1NTZD 2P0MA 2V7QH 1ZP0C 4O9BA 2ZVOB 4X2OA 1S9KD 1OACA 1M1JB 2RCDA 1BU4A 1T3UA 4XM4A 1FW7A 1USEA 3RBXA 2MF7A 2Z7AA 1M1JA 2JQ5A 5B66E 2NZ2A 5AIIA 3CCL3 3H1IG 2XGNA 3S4RA 4IL6E 3Q3FA 1T8ZA 2OTLP 2BNGA 4WY4C 3HUSC 1YYCA 5CK6A 1PPJG 2ZT9B 5KLVG 2W6JH 2W9PA 1BSAA 2BEQD 4HM5B 2BMOB 2I9WA 1WNHA 3I563 2PP6A 2MKVA 1MGRA 3TGUE 2A45G 2UGIA 2NPSB 4OVNF 1OUNA 3KDPB 1STDA 1NAYA 1K734 3DXOA 1LT9C 1KORA 1SQBK 1JO5A 1SQQD 3L74J 3WU2H 3LTDA 3V98A 4PD4E 2C10A 5APSA 1RCLA 1BE3E 1KQSO 4HM2B 1KFMA 1BCCE 1N9EA 2R44A 3R4YA 3VSYA 1TU3F 2K1AA 2AXTH 3L73G 3GWRA 1J1EC 1EDIA 2IYJA 2W27A 1HKXA 2YX9A 2E75D 3FSDA 3V6IA 5KAIE 1LTGC 1NNVA 4AUWA 1KMIZ 3AE5C 3Q1MA 1O7HB 3AGNA 1VQ73 3STDA 4GSPA 4N6LA 3WA2X 1FGTA 4H13C 3HI7A 1GK6A 4BIRA 3BRVB 1R8EA 1GOYA 1NDOB 1IV7A 2KF5A 3LT8A 3IMAB 2ZXXA 3BRTB 1JN5B 5STDA 1BSHA 3ALAA 3B7CA 1B3SA 3I0YA 1BUQA 1N8R4 3SLUA 2Q6QA 3OV4A 3BCCE 3NXSA 2H89C 1ZW0A 3PJSK 1GMJA 2Z5HA 1JBTA 4LYLB 1UIXA 4H0LC 5APQA 1U8CB 2FYNC 1Z56A 1ZN5A 3FZWA 5EEOA 2CPBA 1EDJA 2W04A 2E74B 2C9LY 1QMAA 4HB1A 1K05A 1ZRTD 4BL2A 1BAOA 4FR9A 2YIUB 5KAIH 3P8MC 1W5ZA 1SQXE 4C7RA 5CCGA 4OVMA 1GW4A 4STDA 5IG5A 1NU1E 3H6PA 1LQGC 4J9AA 2CFWA 2QG4A 1MOLA 1GOUA 3H1JE 5GSPA 3EX9A 3NM7A 1RNBA 1L0NK 2CW9A 2ZYGA 1GD3A 3QH9A 1OX3A 3DGNA 4JPZB 1G0TA 1AA0A 5CJ0A 1Y4KA 1X1XA 1SFCD 4U3FJ 2O01J 2Y0DA 2ITAA 3B8EB 3TYYA 2HMMB 4NHFA 1R5SA 1LNQA 1OHSA 3QK9A 2WSFJ 2CFGA 3HX8A 3B4PA 3JVCA 2BCCE 1A90A 3T0UA 2WVRA 2IDBA 1QX8A 2BEZF 3H1KE 1PP9D 3T97B 1VQMP 3UJMA 1YIT3 1BGYG 1JB4A 3BIRA 2ZA4A 2Z76A 1AY7A 2F56A 3EQ2A 1AVOA 3G6EP 1O7MB 3P8CE 1LTSC 1B2SA 4D6TD 3WODG 4XE5B 1YGEA 3BASA 5KJ7A 1P84E 4TT3H 5AYRB 1G96A 4N3VA 1NTKE 3K5TA 1QVGO 2GEXA 1HF9A 1TTOA 3H1LD 1LTIC 3A0HH 2E75C 3L73J 2KOGA 3ABVC 3AMOB 2CG1A 2H43A 3KFQC 1GDTA 1SQPD 3LIEA 1DX7A 5APYA 3L72J 1L4AA 2KYVA 1W6YA 1LWUB 2CK3H 3AMOA 5TGNA 5L8RJ 2OYIB 1S3JA 1ZV8A 3ZDMA 3V99A 3GAXA 3DGMA 3B71A 7RNTA 1LWUA 1WMNA 4GHOA 1T2KD 1OPYA 2KSEA 1BRHA 2KUBA 4N6V0 3A5EA 4OUQA 1ASKA 2LYXA 3MG1A 1SQBJ 2A06G 2C9NY 1EKMA 2RSXA 3CME3 3MWZA 3Q90A 1N8RQ 3L70G 1DYUA 4Q53A 3PP5A 1NTZJ 4A7PA 1FGRA 2J58A 4CCVA 5EFWB 1P84H 2K9YA 3HTKB 1T3JA 4N6UA 1OF5A 1IO4A 2CKFB 3SXXA 4KT3B 1ZMEC 4BU4A 3L36A 4UB8E 1MUUA 4M3LA 4N6NB 5AVWB 2FFDC 2KK7A 4KT0J 3B4SA 7STDA 1UGIA 1W6CA 1GD4A 3EN1B 3U1AA 2PFXA 5D81A 3E7KA 1VQ53 2CX0A 4FMBA 2F98A 2QRXA 1OXZA 2XSOB 1OW6A 3JUMA 1A02J 1VQ6P 3BNEA 4RBNA 3FXDA 5EQLA 3D6YA 3TDGA 1LTJB 1NU1D 3LW5J 5APWA 3SWFA 3TGUG 4K3AA 1J1DB 3PS8A 3JCUH 5GTHE 3S67A 1RHLA 1LTJA 3BVHA 1NTME 1G02A 3OWYA 3LXUX 4GDOA 5JPUA 4JYBA 2D42A 1SFCC 1LOXA 1SQVG 1BE3G 3CXHH 1KN7A 3KQGA 1BCCG 1SVFA 5AW4B 2OTL3 1Q40A 5KAFE 3PCSA 3CCLP 2BCCD 3H1KD 1V57A 1JOCA 2HMOB 4RNYA 1VDFA 3CCR3 1NB5I 5AVRB 1AVKA 3FXEA 5M1BA 3K0ZA 1BSBA 3I56P 2BHMA 1SQXK 4DOJA 4B86A 3L75D 2QIYA 3KSED 1CSBA 1NU1K 2V7QJ 2WSSH 3G3ZA 4LSOA 4NPDA 1KD14 1P84D 1L0NJ 3QWOC 1NTKD 5AW3B 4N3YB 2Q5UA 2W8ZA 4U3FE 2IY2A 4K1UA 2FXPA 4HVNA 1R5LA 4PV1D 3BCCG 1LJ2A 1T2KC 4BXLA 3WMDA 3ER7A 4HKVB 3D3LA 4EC6A 2JJLA 5AW1B 4BWNA 4RESB 1H8AA 1TUHA 1A67A 5IEPA 4DJGA 3S9OA 3AE6C 1C54A 3CNMA 1VQ7P 1KILB 4QWTA 1YVBI 3RK2B 1YIJ3 5GTIH 2Y0CA 5AEUB 1BNJA 1IVWA 1MWTA 3L71J 3L70J 1LTTC 1KILA 4XDVA 3M9HA 1B2XA 3FG3A 3H1JG 2Z77A 5H2FH 3CXHD 4FCZA 1NTKK 3L72E 2IMJA 3SWYA 2YKPA 3HD7B 2N1TD 1W2ZA 1BOXA 3M9QA 4ZKPA 1VQ43 3C9IA 4L73A 4YPCA 3KHUA 2FYZA 5ELUA 4JF7A 2CPSA 2K37A 3CPW2 1MWRA 1QJGA 3MPHA 1W00A 4HYTB 2IBZG 1DEEG 1X1UA 1SQBE 1PP9J 2HYNA 3BNDA 3BATA 4RO0A 2VRSA 4EYCA 2QEXP 1VQN3 1LVNA 3FH1A 2QJYC 1NTZE 1N86A 2OYHB 5B5EH 1NTMD 5KTBA 4JRFA 3RDEA 4D6TJ 1O7PB 2YXQB 4K35A 2OYHA 2HPCB 3CCVP 4JBZA 3AEBC 2Z5IA 1URQD 1M7LA 2C4BA 4I7ZB 3KIIA 4GOEA 3G8ZA 5AVVB 5M1AA 3H1LJ 4YTPC 5CHXA 4OGQD 4N6JA 4ZMDA 1UW1A 4AEQA 1LNIA 1DVDA 1EXJA 2XF3A 3ROBA 4WHAA 1RE3C 3TK1A 1FS0E 3F89A 4MMYB 1KQFB 2P7JA 2UWJE 4EDFA 2WPVB 2HFED 1AQ5A 1M90Q 1YITP 2K9JB 2JDIH 1K28A 1I0XA 1ULJB 1QGKB 1SQQE 3F8HA 3VGNA 2XNDH 1KD1Q 1H0TB 4O3VA 1W01A 4XDWA 3L74G 1MV8A 3LH4A 3NV0B 2XZRA 1JTHB 1OCVA 2M3EA 3MUDA 1H0TA 1AV1A 1NTMK 4IT7A 1FZCB 4LEHA 4UB6E 3NV0A 3LT9A 4HKZH 1OGXA 3D5GA 1PGPA 2LKMA 1FZCA 4QMAA 1YJW3 1E5WA 5AW5B 1FDMA 2C11A 1FZFA 3A76A 2N9YB 1LP1B 3FX0A 5TISE 2ZT9D 3G9RA 1FZAA 2J59M 1TP6A 5AW9B 2ZYDA 2CFLA 5IERA 5KP3A 2O1JA 1RF0C 4LLHA 3G16A 2KI7B 2Q07A 2BMQB 1N5HA 3F9SA 5LC7A 1VF5B 1NOHA 3WDGB 1BNRA 1U57A 2CX1A 5IF6A 1SQXJ 3HE4B 1JCCA 1GYBA 3RNTA 3A3YB 2ZDJA 1NU1J 4W7ZA 1GK4A 1B2UA 4JYCA 2OQEC 2HG5D 3X40A 3HE4A 4L8OA 1BIRA 1NJI4 2N1TC 4I5QA 4CPGA 2YNYA 3D6ZA 3CXHI 2H0HA 1M8OB 2W6AA 3RGRA 3OJAB 2R3CA 1RNTA 3K9MC 3S29A 4UB6H 3WR2A 2PNCA 5E79H 1S723 3Q5PA 3FWLA 3CC2P 3IR9A 2L5GB 1KZUB 1ZOYC 2RGQA 2JR8A 5KLIC 4GKGA 4ZNCA 1RMSA 2KSJA 1ZRTE 1N5PA 2BCCJ 4Y99B 3H1KJ 1X22A 4MEIA 5AW6B 1JZDA 1VQ5P 3OXAA 4N78D 2B87B 5DRVA 2IUJA 4ILFA 5IG0A 4N6OB 1O7NB 1VQ83 1MFZA 1Q814 1FBMA 3EF8A 1FOSE 2B87A 5DJTB 1URQC 4DT0A 1JY2P 2FYUD 2QIWA 4R4MA 5DJUB 2WPRA 3LYGA 3GF3A 1GMQA 4U7JA 4XB5A 1W7CA 2AXTE 1DMNA 2IYOA 1FZUA 4OGQC 1RH5B 1NTKJ 1LRAA 2YKQA 3V2QA 1JEKA 3HUSB 3LTAA 5KKZC 2PGDA 1AR0A 3SFEC 4U3FG 1RF1C 5CCGD 1EEJA 4HM7B 2E74D 2HMNB 3SOAA 4IFFA 1JNQA 1TJDA 3AGOA 2P58A 1OMIA 1FGOA 1FDOA 1PP9E 1GD2E 1FUTA 1FU1A 1RGLA 1WMPA 2HMJB 4HOHA 3CCQ3 1QAKA 2YXRB 2KF3A 1M1JC 2YMKA 1AQTA 5G1LA 1FDIA 1JY3O 3CCRP 4HZ9B 1NH4A 1M1K4 2YFLB 3J7Yd 4D6TE 2NPSA 1FJKA 3DGLA 3FCSB 1BRSA 2XGLA 1NTZK 4WVZA 1VQOP 3IPTA 4CJNA 1ZLLA 3IFMA 3H1LE 2XRXB 1Q824 1SQPE 2ZT9C 2CHCA 3TF5A 4NREA 2AEJA 1S4XA 3L72G 1D6UA 2E2UA 5JBSA 3LMLA 3NBBA 4FCJA 5CXOA 1TRPA 3N7NA 3CWBE 2RN0A 5KJ7D 2XH9A 5DREA 3WMM0 3CC43 1DMMA 3AE1C 5AVQB 2KB7P 2E5YA 1YJN3 3KSPA 1UI7A 3BNCA 1SQBG 3A7OA 3HIGA 3ZFZA 1SQQK 5A0OB 1HBWA 1IZNB 1YIJP 4L7KA 1K04A 1L4AD 1M9GA 2Q7CA 1BSCA 3CMA3 4H0LB 2PZVA 5HGRA 1JY2N 2YMYA 1NTZG 1NTMJ 2FYNB 1KV4A 2UX0A 3DZLA 3MTUE 1AJYA 1JN5A 3ECFA 3N54B 3GRDA 1SJWA 1Y8AA 2KCDA 5CLKA 1SP4A 2OOVA 1N73B 1BSEA 3L37A 3VYIA 3H51A 1VQ4P 3U1WA 1CYUA 4MMXB 3L4FA 1N73A 2FXTA 1N2DC 2BT3A 4I4KA 4GODA 4R4KA 3V2NA 3M9BA 4EXRA 5CF2A 2QEX3 3SOYA 2XFTA 4RKUJ 2LXCB 5M18A 1Q81Q 3FGYA 1XTGB 2P0XA 5C39A 2KXPB 4HBRA 5ELJA 1G1IA 3WOEB 2H88C 1NGMB 4H3UA 1FGMA 1VQNP 3CCV3 4NPBA 3A0HE 1L2PA 4NPEA 1UUVB 2ZXEB 1SLQA 2QA43 2R5DA 1GZLA 3MD0A 1MNLA 2QJKB 1B2ZA 2GUVA 2P1JA 5CCGC 2E74C 3OW2O 1A02F 2E76B 1JNMA 3AE4C 5BVBA 2YIUC 4HYZA 1NO4A 2CG0A 3OX9A 2W90A 1T2IA 4HZBB 2IFMA 3F14A 4HJLB 6RNTA 2KXGA 2GU3A 3E99A 3CL3D 5BU5A 3GLMA 3BU4A 1J2BA 3KKGA 1UIIA 1DE3A 4EI2A 1K73Q 1M56D 1VQP3 1M1KQ 1BGSA 2RNTA 5CCHA 4AKYA 3T97A 3EHCA 3L75E 3UNLA 1GOVA 1M57D 1JRQA 3M8CA 4RZMA 1YVSA 1NB3I 3VP9A 5G1KA 2XU6A 1VQQA 3NXJA 1L0NG 2R5BA 3TDKA 1S5LX 4DKIA 1FZEA 1N7LA 4WB4A 2CWVA 3X3YA 3P7KA 1TU5A 2ZAEB 4EBGA 1HWTC 4IIAA 2QGUA 1BSDA 3PRJA 1OZHA 2I8DA 5KJ7C 1YJWP 2Z6BA 2KAAA 2IA7A 3WA3A 1ZXGA 3HIIA 4J5KA 4GOFA 3EWKA 3DGOA 2OYIA 1UCJA 3AE9C 3CWBD 2WGQA 2HLOA 3CX5H 3F7SA 2E2VA 3V5BA 2W83C 3JCUE 4KFEA 4R1KA 1RSNA 1L4AC 3NBJA 3FGAD 5APVA 3VOPA 1EZVD 2WITA 2FKWB 3L71G 1V74A 1BRNL 5JPPA 1L0LE 2HR3A 1LWUC 3HOHA 4WYKB 1VL2A 3CXHE 3SSUA 1BNSA 4R9LA 2FYUJ 3AE2C 5APUA 1YTZT 1PL5A 1BANA 3CC23 1IYYA 1Y47A 4WYKA 3HTKA 3KXDA 1Q90D 3Q5RA 1SQPK 2D1WA 1FUSA 1EA2A 2W2CA 3JUQA 1S72P 5AIFA 4H44B 3U1CA 2E42A 3BNBA 4HM4B 1FOSF 1KILD 3A2AA 3ZG0A 2UUGC 3RK2D 1BDCA 1UDII 3GHGB 6STDA 2H8PD 1PP9G 2OYOA 3NTNA 3V92A 4WWUC 2IPPA 3JSVC 3GHGA 1WMKA 3A0BH 1VQ8P 1SIIA 1SQQJ 1DETA 1E79H 5CBOA 3HE5B 4N6MA 1S5LE 4D6TG 4EOTA 1A2KA 1JB2A 5CBNA 2OGUA 2GEYA 3CCM3 1HGZA 3HE5A 3I553 2BU4A 3GZRA 3H1LG 1OVRA 1B20A 3H1HD 3GZXB 5BXQA 2JEEA 1SQPG 4KFFA 5TJHA 1LTJC 3RL0D 3CX5D 1BDDA 3SFDC 3B5NB 2HMLB 3Q2PA 4ZKUA 2BASA 3CCQP 3OAKA 5GTIE 4KFDA 2XSHB 2P67A 3B5NA 2F86B 3UL6A 1IU7A 1WTHA 4OH8B 1AVLA 1PGQA 2WSEH 1VQO3 3KZTA 5H2FE 1K9M4 3SYUA 1RDSA 4PEJA 1DD4A 1K41A 2Q9IA 2IFNA 3RGAA 1HU9A 1IQ8A 6GSPA 1S5LH 1JM0A 3HRNA 4XBYA 1WQLB 3KZIH 1GL2B 3I5CA 2WO0A 3JUNA 4J5GA 4I6MC 1RRLA 1N7SB 3SX1A 3GZYB 1N8QA 1GL2A 3A5TA 2ZYAA 4FMDA 2D2CD 3AECC 2QM7A 4KVHA 1N7SA 4W7YA 3H1IE 3S5CA 1T5YA 2FGTA 2N9BA 1W2EA 5B5EE 2CWUA 1IFDA 1T2HA 2R41A 4ORLA 2HOHA 1SQXG 9RNTA 3CC4P 4YXWH 1QVF2 3FWNA 1NU1G 1YJNP 1D6ZA 1YHQ3 1YQ3C 3L35A 1L0LD 3IAOA 3VP8A 1EZVI 1X0TA 4Z1MH 3B8LA 3N8BA 1W2B2 2FY8A 4RNZA 3CMAP 3NX0A 1LTAC 2ML5A 1CW5A 1EUIC 1FE6A 2HODB 3JC22 1O7WB 1IFJA 4O2HA 1PFIA 3HD7A 2H7HA 3IJEB 4JQ0D 1EXIA 1KILC 3RK2C 2KS1B 3PGBA 1W4NA 1JBRA 3CCU3 3USSA 3GF7A 3WHOA 2BCCG 1JY3P 3H1KG 4N78E 2WQYC 2RH0A 1B21A 3CU3A 2KS1A 3PTZA 2O01H 3BLZA 2W56B 3CCEP 1U5OA 2WSCH 1ZO2A 1HUCA 1X1YA 4C7NB 1KC84 3H3HA 1X1WA 1RN4A 4XA4A 2L1SA 2FYUE 2W56A 1KWIA 2A45H 1RCKA 3T8UA 4CPKA 1BUJA 1KQLA 1L0LK 3MGNA 1UCLA 2QA4P 1NTKG 2IX7C 2HPCA 3RL0C 1LOWA 3M06A 1SQPJ 1HZ1A 1MWUA 1I8VA 2E5TA 1KQS2 3E1RA 1DIPA 2O3OA 5I97A 1V58A 3W67A 2M7OA 3CX5I 3FLJA 2OYHC 1AVYA 1MGWA 3S28A 2Y9ZA 1IVVA 5G2GA 3CWBJ 3RK3D 1BVIA 2W0QA 4HM6B 2KLUA 4HM8B 1K8A4 1NU3A 4BTYA 2H0GA 2WGOA 4PV1B 1US1A 1VQPP 3II6A 3NHXA 5APTA 5AVZB 2K9JA 1FUWA 4LGDE 2IBZI 1VQLP 1ZGXA 2YFJB 2YO3A 1CQSA 1S2EA 1JTHA 2NRGA 5E79E 1IK3A 3UL5A 2INXA 3PH0A 4IFMA 2D2CC 5AIHA 1FZBA 5FW5A 2FXOA 4WWIA 3DUKA 2QJPB 1UUWB 3NBRA 1KYOH 2P10A 1BNFA 2DW3A 3MUDC 4BTWA 3H1ID 1LP1A 2NPSD 5AW7B 2JP3A 4HM1B 3VMAA 1JY3N 1HYFA 1SARA 1PPJD 2N1TB 5KLVD 1FZCC 4FMCA 1GU4A 1FGQA 1PY3A 1HH0A 1DH3A 1KB9H 1I2FA 5D82A 4H61A 3MHVA 1NTMG 2ZHXB 2BO9B 4HAAA 4I1LA 3LZAA 2F99A 1PIXA 5BVZA 3DH2A 2B24B 3MYTA 5AW2B 1MKMA 3EE1A 5FGOA 1FYSA 3G0KA 3X3ZA 3AHWA 3IN6A 1TRQA 1OGZA 4PJ0E 1W02A 1OHPA 1TIJA 3GW6A 3V2RA 3H1HJ 3L73D 3M0DA 1WT6A 1GY6A 3OW22 1BNEA 1RE4A 4X2HA 2RFRA 1G2CB 2O1KA 3C8VA 1KC8Q 4KZ1A 1X8YA 2GUSA 2P38A 4OGQB 5AW8B 4I2LC 1WRGA 3L75J 1G2CA 1L5GB 3HK4A 2V1LA 4BL3A 1LXEA 1LNHA 1Y9BA 3D71A 1OW8A 3NMDA 3O6QB 3Q5SA 1UI8A 1RGHA 2R3SA 1IC2A 1IQYA 1H88A 3T8NA 4WY4B 2GU1A 5BU8B 2M5AB 3TSIA 2QM8A 3RGUA 3QRDA 1KYOD 3CCMP 3WUTA 4Y99C 5KP4A 1RN1A 1EG9B 4XBTA 1JJ22 3I55P 1C7HA 4WY4A 3HUSA 1BRKA 2M5AA 1O7GB 4O02B 1PGJA 2WPSA 1QVG2 3EC9A 1LT9B 3CPWO 3RK3C 1QALA 4PJ0H 3GG2A 1UCIA 1CZQA 3KPEA 1U7JA 1K8AQ 4R9KA 1LT9A 1ULIB 1FA3A 1IFNA 2CFDA 2L4VA 2G3AA 1VPCA 2KLVA 1KB9D 2KNCB 2OQQA 1R4CA 3K5BA 2JWDA 3NQYA 1J1EB 1YTZI 1I3IA 1VQ9P 2KNCA 3LIDA 3H25A 3K63A 2FYUK 1GTWA 3CXC2 1G1JA 1L0LJ 2K3RA 3CD63 2E76D 2WOHA 1OFCX 1DMQA 2ZL8A 3SWKA 1RKYA 4TX4A 1E3VA 2K3DA 3NM2A 2KRTA 2NPSC 2YO2A 3WUUA 1UGHI 1SQVE 1IFMA 3ZG5A 5CCHD 4H13B 1AQZA 3VMXA 3CLQA 1HVVA 4EIJA 2IZ0A 1I2EA 2JKVA 4Y28J 5APXA 1RGAA 3PCRA 4HJGH 1SS1A 3O8YA 1IDPA 5B66H 2JO1A 2WSEJ 1BGYD 4L74A 1EZVE 1QL1A 1XTCC 4IL6H 1NJIQ 2A45I 1OVVA 2Y9YA 5IENA 4XBXA 1IK7A 1YHQP 2XNXA 1RY3A 4R80A 2FYUG 1Z1SA 3AHSA 1LTBC 3JUPA 1L0ND 2WTYA 2SBLA 4TLFA 1X9VA 2KF6A 2WOFA 4ZM8A 3K7CA 4DCKA 3CC73 4N6TA 4HM0B 1SIHA 1A2VA 2LR2A 4PD4H 1YBKA 4FCMA 2Y0EA 4CDLA 1EQ7A 2W9QA 1I3FA 1KTMA 1IT7A 2B88A 1OVUA 3CCE3 1HJBA 1KILE 1DEBA 3AE8C 3AEAC 1W5CE 2CIUA 3CCUP 1ROVA 4K61A 3CCJ3 2E2TA 2OOVC 1ZS7A 1WMOA 3BB9A 1AV4A 5AYSC 2FNQA 1JBSA 1N73C 1SQQG 3F5HA 1E3RA 1NWWA 4IPBA 2AADA 5BU4A 1FZGA 1UCKA 2GSPA 2A06D 4HH2A 3KCHA 1RGFA 1RGKA 1YNVX 1RJOA 2O9UX 3L71D 3L70D 1IQXA 1RGCA 4MMZB 2AAEA 1YI23 3H1HE 1KYOI 3DY5A 5AEWB 4H44D 4YXDC 3PLNA 2XDJA 3CX5E 2GBWB 1PU4A 1VZZA 2P05A 4GT1A 2Z4EA 3D5IA 2SPZA 1PZQA 3H1IJ 2I1JA 3DGYA 5KP1A 2WSCJ 4R4LA 1LOVA 1EDKA 1H89A 2QJKC 1RQVA 4KJMA 1CEWI 1VQL3 2E75B 2IBZE 1W6GA 5KLVJ 1KB9I 3D70A 1NVOA 1OWAA 2E76C 3JUOA 5RNTA 1Q82Q 4WP5A 3TGUD 1VQKP 2WWWA 1FC2C 3M0AA 2FXMA 2B89A 2WMMA 3G71P 3AEEC 3NQZA 4L8PA 5M19A 5CCHC 3UB1A 1U7MA 1GSPA 2IZ1A 3EB8A 4PD4D 3N9HA 1Q864 1USDA 3PYJA 1SQVD 3B4OA 3EQQB 2QSIA 1BE3D 3B5ND 4J8TA 1JY2O 1BCCD 1L4AB 1KFNA 3X3XA 4EV5A 1GS3A 1GY7A 2E43A 5CMZA 4GL6A 5AI1A 1MFTA 2IUKA 3A0BE 1AFOA 2AEFA 5K5GB 1Q7Y4 1TFOA 4MN4C 5AVSB 2P09A 2POHA 5EVHA 1RQUA 1S1CX 3Q1CA 2R32A 1JMBA 1NKZB 1GU5A 1NO3A 2OYIC 1JZOA 2K88A 2FFDB 1GL2D 3FKAA 3L74E 3VF1A 1RGEA 2O3JA 3CPOA 1N7SD 2Q1KA 1CI6B 2FFDA 3EFGA 3LTBA 2MJZA 1OF5B 3X41A 2I1KA 3KN4A 1CH0A 3G4S3 3AEDC 1CI6A 1KSIA 1B27A 1SQVK 1KQGB 3BCCD 1BRJA 3VMZA 1EDLA 4JF8A 1IVUA 5AVTB 1RHZB 4G1MB 1CYVA 1SQWA 1JCDA 3S27A 1SFCB 1TFKA 2Y73A 2FBWC 2RBIA 3Q3DA 3U97A 2Q3IA 1GY5A 4ASVA 1OHOA 5IG3A 1SFCA 4W80A 3DM8A 1YJ93 3KZIE 3CCS3 1SQXD 2A15A 3HD7D 1HJ0A 2W03A 3V4WA 1IT8A 5CF1A 2CH9A 4H44C 2HMKB 2YFIB 1RN7A 3H1JD 4ASWA 1D7MA 3GZBA 3E1IA 1RGGA 2OTJP 3HZPA 3GHGC 4IOIH 2OARA 4WFOA 1X79B 2BIRA 1J1DC 2OWPA 3H32B 1Q40B 2Y74A 2KF4A 4RJTA 3VTPC 2KZJA 1I0VA 3RK3E 3CWBG 3H32A 1ZX2A 4NPFX 2GM4A 4OWFA 5AVYB 4KHXA 4UB8H 1F8NA 1VQ93 2IBZD 1STFI 2CFKA 3OWUA 2GBXB 3N4XA 1BGYJ 3W68A 4LZIA 5CJ4A 8RNTA 1T6AA 1A2PA 2G8YA 2GA1A 1EZVG 2XV5A 1JB0J 2QVAA 2ML6A 1M904 3M91A 4BRYB 3P8CD 3CD6P 1IFIA 3B5NC 2KP8A 1NYHA 1Q86Q 1PYLA 5AVUB 1EC5A 1RLSA 3D9RA 4BRYA 2WPQA 4PD4I 3UIAA 5GTHH 1JB5A 5AIGA 2ZFCA 4LGQA 1Q2NA 3F8XA 1OW7A 1JV2B 3LTCA 2M0BA 5IG4A 1R4YA 3AE3C 3WOFB 1EQKA 1IJDB 1N9JA 1RRHA 3F40A 1PPJE 3MZWB 4RNTA 5KLVE 1Q7YQ 1YQ4C 3D4AA 3EN8A 3URPA 2W6BA 1IV9A 1Q42A 5KAFH 1NAFA 2AXCA 1UUGB 1GL2C 2XR8B 3RBZA 2J5UA 1OIPA 2K0MA 1N7SC 4MJDA 2AEMA 2QE7H 3LOYA 1MWSA 3L74D 1QL2A 3FG1A 3L0RA 3PXMA 3VMYA 1HTLC 3FG4A 4AKZA
chains in the Genus database with same CATH topology
4Q53A 1DYUA 2B24B 1JN5A 3ECFA 1FGRA 3GRDA 3MYTA 3N54B 4CCVA 3EE1A 1SJWA 3KE7A 4N6UA 1OF5A 5FGOA 3X3ZA 3G0KA 2KCDA 5CLKA 2OOVA 2CKFB 3SXXA 1OGZA 4O8SA 1W02A 1OHPA 1TIJA 3H51A 3U1WA 1CYUA 4MMXB 2K54A 4OK0A 4N6NB 2CWTA 1GY6A 2FXTA 2BT3A 4I4KA 3OW22 3NUVA 4R4KA 1IFPA 7STDA 5IEOA 2LQVA 1W6CA 1GD4A 3MG3A 4X2HA 3EN1B 2RFRA 5D81A 4EXRA 1VQ53 5CF2A 2QEX3 4FMBA 2F98A 4KZ1A 3JUMA 2XSOB 3SOYA 2XFTA 2P38A 3BNEA 4RBNA 1DVCA 3FGYA 5EQLA 2P0XA 1BSNA 1L5GB 1SPUA 3HK4A 4HBRA 3TDGA 5ELJA 2V1LA 1D6YA 2MC8A 1LXEA 1LNHA 2BMRB 3WOEB 4FMAA 4H3UA 1FGMA 3CCV3 3PS8A 1UI8A 2XEPA 3SEDA 3S67A 1UUVB 2QA43 1IQYA 2GXFA 1MNLA 3T8NA 2GU1A 3OWYA 3LXUX 5JPUA 2D42A 3QRDA 1M1XB 1LOXA 2B1XB 3EFFK 3EJVA 5BVBA 5KP4A 1EG9B 4XBTA 1JJ22 1ISKA 1C7HA 4HYZA 1O7GB 4LMIA 4O02B 2CG0A 3OX9A 1QVG2 2STDA 3EC9A 4HZBB 8CHOA 2OTL3 1QALA 1Q40A 3F14A 3PCSA 4HJLB 2KXGA 2GU3A 3E99A 4R9KA 1ULIB 1FA3A 1J2BA 5D83A 3KKGA 2CFDA 2HMOB 2L4VA 4U13A 1VQM3 4RNYA 1ROAA 2CC3A 1VQP3 4AKYA 1VQK3 3CCR3 3EHCA 1NB5I 1AVKA 3G713 3UNLA 1R4CA 1JRQA 3M8CA 3K0ZA 3G6E3 3NQYA 4RZMA 2BHMA 1NB3I 1IVXA 2QIYA 3K63A 3KSED 3NXJA 3CXC2 2WSSH 4LSOA 1KD14 3CD63 3PZWA 2WOHA 3X3YA 1DMQA 2CWVA 2ZL8A 1TU5A 1RKYA 3EBTA 4TX4A 1E3VA 1S5AA 4EBGA 4EV2A 4IIAA 2QGUA 3NM2A 2KRTA 4AKZA 5IW9A 4K1UA 4HVNA 2XFSA 2Z6BA 3MKIA 2IA7A 3FF2A 3WA3A 3HIIA 3DGOA 3WMDA 1OH0A 3PCRA 3ER7A 4HKVB 3D3LA 3O8YA 3F7XA 4EC6A 2WGQA 2OQEA 1TUHA 3F7SA 1A67A 2E2VA 5IEPA 4DJGA 1IDPA 4KFEA 4R1KA 1E97A 3CNMA 3NBJA 3EBYA 4QWTA 5IENA 4XBXA 1YVBI 1YIJ3 1V74A 5AEUB 5JPPA 1IVWA 4R80A 4WYKB 4XDVA 1Z1SA 4R9LA 3CNXA 3FG3A 2Z77A 3JUPA 2SBLA 4TLFA 4HM3B 3CC23 4WYKA 2WOFA 3MG2A 2OCTA 3K7CA 4FCZA 4ZM8A 2IMJA 3CC73 5LC6A 4N6TA 4HM0B 1SIHA 1VQ43 1W2ZA 2D1WA 1A2VA 1EA2A 1JKGB 3MHEA 4K1VA 2W2CA 4FCMA 4CDLA 2W9QA 4BTXA 3JUQA 5ELUA 1IT7A 3CCE3 5AIFA 1JKGA 3CPW2 2CIUA 3BNBA 3OWSA 1QJGA 1ROVA 4HM4B 4K61A 4K90B 3CCJ3 2E2TA 2OOVC 3DMCA 1WMOA 3FF0A 3MPHA 1VQ63 1W00A 4GB5A 6STDA 3BB9A 1AV4A 5AYSC 2FNQA 3V92A 4WWUC 3X42A 3BNDA 2R4IA 3SVAA 4EYCA 1VQN3 1E3RA 4IPBA 1NWWA 1LVNA 1QAFA 1SIIA 1PFPA 1E79H 3FH1A 3MSOA 4N6MA 2OTJ3 4JRFA 3RDEA 1A2KA 1O7PB 1RJOA 2O9UX 2V7QH 1JB2A 2P0MA 1IQXA 2GEYA 3CCM3 4MMZB 4X2OA 1OACA 1YI23 3KIIA 3I553 2RCDA 3DY5A 4XM4A 5AEWB 3GZRA 3G8ZA 3GZXB 5BXQA 2MF7A 2Z7AA 2GBWB 1UW1A 4KFFA 4AEQA 1PU4A 2JQ5A 5AIIA 1VZZA 3CCL3 1DVDA 2P05A 3ROBA 2XF3A 2XGNA 4WHAA 1FS0E 2HMLB 4MMYB 3Q2PA 5KP1A 2BNGA 4KFDA 5CK6A 1CEWI 2XSHB 1VQL3 2W6JH 2W9PA 2F86B 4HM5B 3UL6A 1IU7A 1W6GA 2BMOB 2I9WA 1WNHA 1WTHA 3I563 2JDIH 1AVLA 3JUOA 1K28A 1VQO3 3KZTA 1ULJB 1K9M4 1OUNA 3F8HA 3VGNA 2XNDH 1STDA 4O3VA 4WP5A 1K734 1W01A 3DXOA 4PEJA 1K41A 4XDWA 3LH4A 3RGAA 3NV0B 1OCVA 3NQZA 4L8PA 3LTDA 1HU9A 1IQ8A 3V98A 3UB1A 2C10A 4XBYA 1WQLB 4IT7A 3EB8A 2WO0A 4HM2B 3N9HA 4LEHA 3JUNA 1Q864 3NV0A 3LT9A 3PYJA 3B4OA 3EQQB 1RRLA 1OGXA 3SX1A 4J8TA 1N9EA 4QMAA 1N8QA 3GZYB 3VSYA 1YJW3 3GWRA 3X3XA 2C11A 3A76A 4FMDA 4EV5A 1GS3A 4KVHA 1GY7A 1HKXA 1TP6A 2YX9A 3FSDA 3S5CA 2CFLA 5IERA 5KP3A 1T5YA 2FGTA 4GL6A 5AI1A 2IUKA 3G16A 2Q07A 2BMQB 1N5HA 3F9SA 2CWUA 1TFOA 1Q7Y4 1O7HB 2P09A 4ORLA 5LC7A 5EVHA 3WDGB 1VQ73 3STDA 4YXWH 5IF6A 4N6LA 1QVF2 3Q1CA 1FGTA 3WA2X 1GYBA 1D6ZA 1NO3A 3HI7A 1YHQ3 2ZDJA 1NDOB 1IV7A 3B8LA 3FKAA 2OQEC 3N8BA 3LT8A 3VF1A 3X40A 3IMAB 4L8OA 3CPOA 1W2B2 4RNZA 1NJI4 3NX0A 1JN5B 2ML5A 5STDA 3LTBA 1BSHA 3ALAA 3X41A 1OF5B 3B7CA 3I0YA 1BUQA 1N8R4 3KN4A 3G4S3 3RGRA 3SLUA 3OV4A 3K9MC 1O7WB 4O2HA 3PJSK 1KSIA 3S29A 3IJEB 2PNCA 1S723 4JF8A 1U8CB 1IVUA 2RGQA 3PGBA 1W4NA 3FZWA 3CCU3 3USSA 5EEOA 4G1MB 1CYVA 1SQWA 1N5PA 2W04A 3S27A 1TFKA 2Y73A 1QMAA 3CU3A 4MEIA 3BLZA 2W56B 1U5OA 1ZO2A 3OXAA 4FR9A 1KC84 5DRVA 2IUJA 3H3HA 5IG0A 3U97A 1W5ZA 1GY5A 4N6OB 1O7NB 1OHOA 4OVMA 5IG3A 1VQ83 3DM8A 1YJ93 4STDA 5IG5A 2W56A 4J9AA 3CCS3 1Q814 3EF8A 2A15A 2CFWA 2W03A 1KWIA 1MOLA 3T8UA 1IT8A 3LYGA 5CF1A 2CH9A 3EX9A 2HMKB 3NM7A 1W7CA 1RN7A 2YFIB 4XB5A 1DMNA 2CW9A 1GD3A 3GZBA 3HZPA 1JEKA 3DGNA 3LTAA 2E5TA 1AR0A 4WFOA 1KQS2 2OWPA 2O3OA 1Q40B 1Y4KA 4HM7B 2Y74A 2HMNB 3SOAA 5I97A 1JNQA 2HMMB 2M7OA 4NHFA 3FLJA 1OHSA 3QK9A 2CFGA 3S28A 3HX8A 1WMPA 1FGOA 3B4PA 2HMJB 3JVCA 1A90A 1IVVA 1ZX2A 5G2GA 3T0UA 3CCQ3 2W0QA 1QAKA 4HM6B 1K8A4 4HM8B 1NU3A 4BTYA 1VQ93 1F8NA 2WGOA 1STFI 3UJMA 1YIT3 2CFKA 3OWUA 1JB4A 1US1A 1AQTA 3NHXA 2GBXB 2Z76A 4HZ9B 4LZIA 1M1K4 1FUWA 2YFLB 3J7Yd 1O7MB 3DGLA 3FCSB 2ML6A 2XGLA 2YFJB 1M904 3WODG 1CQSA 1YGEA 4WVZA 3IPTA 1IK3A 3UL5A 5AYRB 3D9RA 1G96A 2INXA 2XRXB 4N3VA 1Q824 3K5TA 2GEXA 5AIHA 5FW5A 3DUKA 2CHCA 1UUWB 1JB5A 3AMOB 4NREA 5AIGA 4LGQA 3NBRA 2CG1A 3F8XA 3KFQC 1JV2B 1D6UA 3LTCA 2E2UA 5IG4A 5JBSA 3LMLA 3NBBA 1W6YA 3WOFB 4FCJA 4BTWA 2CK3H 3AMOA 5TGNA 1EQKA 5CXOA 3V99A 1N9JA 1RRHA 3F40A 3GAXA 3DGMA 4HM1B 3EN8A 1WMNA 1IV9A 2XH9A 5DREA 1Q42A 1OPYA 4FMCA 3CC43 2XR8B 1DMMA 2E5YA 1YJN3 3KSPA 1UI7A 2K0MA 3BNCA 1FGQA 4N6V0 4OUQA 1ASKA 4MJDA 2QE7H 2LYXA 3HIGA 3MG1A 3LOYA 5D82A 5A0OB 3FG1A 3L0RA 3PXMA 4L7KA 4H61A 1M9GA 1EKMA 2RSXA 3CME3 2BO9B 3CMA3 2PZVA 3LZAA 3MWZA 2F99A 5HGRA 3FG4A 2UX0A 3Q90A 3DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJS K;  2V7Q H;  4WVZ A;  4YXW H;  2W6J H;  1BSN A;  4QMA A;  2WSS H;  2JDI H;  4TLF A;  3USS A;  2E5Y A;  2XND H;  4DJG A;  1AQT A;  2QE7 H;  1JEK A;  1IFP A;  1BSH A;  1E79 H;  2E5T A;  2CK3 H;  1FS0 E;  3EFF K; 
#chains in the Genus database with same CATH topology
 2H0I A;  3KE7 A;  3AEF C;  2HOD A;  3L73 E;  2WT7 B;  4O8S A;  2IYP A;  3RL0 g;  3H1H G;  3CC7 P;  2F5M A;  1VF5 D;  1NWQ A;  3GMA A;  1JMM A;  2QJY B;  3OA7 A;  1PGO A;  1FJP A;  2K54 A;  4OK0 A;  4XFJ A;  2CWT A;  2WT7 A;  2F5W A;  2OTK E;  3P32 A;  1PV3 A;  3NUV A;  3VN0 A;  1IFP A;  5IEO A;  2LQV A;  3MG3 A;  3KYQ A;  2WSF H;  2B9B A;  2O01 N;  3MIW A;  2KIK A;  3CCJ P;  2SAR A;  3HD7 C;  1J2J B;  3L75 G;  3Q2Y A;  4C7N A;  3O8Z A;  3RL0 B;  1DVC A;  1HGV A;  1BSN A;  3TNU B;  1SPU A;  1D6Y A;  2MC8 A;  2BMR B;  2WZ7 A;  1MZ9 A;  4FMA A;  2PRR A;  4EYY Q;  3TGU J;  2XEP A;  3SED A;  3TNU A;  7GSP A;  2GXF A;  1KYO E;  1RE3 A;  1M1X B;  1T3B A;  1DD3 A;  1ZR4 A;  1S9K E;  2B1X B;  3EFF K;  1YI2 P;  3EJV A;  1ISK A;  3S1K A;  1GMP A;  1SQV J;  4LMI A;  1BE3 J;  2KZI A;  1ZR2 A;  2STD A;  1I70 A;  8CHO A;  1BCC J;  3C1L A;  4I7Z C;  1K9M Q;  1KB9 E;  5D83 A;  2YKO A;  4U13 A;  1VQM 3;  1ROA A;  1GW3 A;  2CC3 A;  1VQK 3;  3G71 3;  2D2C B;  3G6E 3;  3NFQ A;  4WY4 D;  1IVX A;  3CI9 A;  1L0L G;  2J8X B;  3PZW A;  3EBT A;  1QLE D;  1S5A A;  4EV2 A;  2RMZ A;  1RF0 A;  2P2U A;  1P84 I;  3AEG C;  1QEX A;  4PV1 C;  1GMR A;  5IW9 A;  1BRI A;  4L76 A;  2XFS A;  3AE7 C;  4U3F D;  4GIF A;  5BIR A;  2Q3E A;  3MKI A;  2M8R A;  3BCC J;  3U59 A;  1Q7H A;  3FF2 A;  1B2M A;  1OH0 A;  3PHL A;  4IL6 X;  3F7X A;  1LQM B;  1BGY E;  2OQE A;  3IF4 A;  2N1T A;  2C0X A;  3D79 A;  1LGH B;  3V2P A;  1E97 A;  1LOY A;  2QJP C;  3EBY A;  1Q9E A;  3GSP A;  4AYC A;  4IFD K;  1NHL A;  5KLI B;  3LW5 H;  1RTU A;  2ZVN B;  2C0W A;  1L0N E;  4LC1 A;  3CNX A;  1NKN A;  1VF5 C;  2M3B A;  4H13 D;  4L75 A;  3H1J J;  4HM3 B;  1IK9 A;  4WBA A;  3MG2 A;  2OCT A;  2XKM A;  1LT1 A;  3CME P;  1BNG A;  5LC6 A;  2V4H A;  3G4S P;  2LXB A;  4AQR D;  1I2G A;  3L72 D;  2ZJS E;  2F4Y A;  1JKG B;  3MHE A;  4K1V A;  2PAJ A;  1URQ B;  4BTX A;  4C46 A;  1BRG A;  1JKG A;  5AVX B;  5AW0 B;  1URQ A;  2RKL A;  3OWS A;  3R2P A;  1BNI A;  4K90 B;  3WUV A;  1YGW A;  3DMC A;  2JWA A;  5KLV K;  2L91 A;  3MP7 B;  4H0L D;  3FF0 A;  1VQ6 3;  4GB5 A;  1QVF O;  5KKZ B;  5TIS H;  3M0D C;  1FAV A;  3X42 A;  3ITK A;  1RF1 B;  2A06 E;  2R4I A;  3SVA A;  1SQB D;  1YJ9 P;  1QAF A;  1W2B O;  5HOH A;  3WU2 E;  1PFP A;  3CCS P;  1RE4 C;  1JUN A;  3MSO A;  3L71 E;  4EW5 A;  3L70 E;  3O6Q A;  1RF1 A;  3RK3 B;  2OTJ 3;  3V4Q A;  4DZO A;  1NTZ D;  2P0M A;  2V7Q H;  1ZP0 C;  4O9B A;  2ZVO B;  4X2O A;  1S9K D;  1OAC A;  1M1J B;  2RCD A;  1BU4 A;  1T3U A;  4XM4 A;  1FW7 A;  1USE A;  3RBX A;  2MF7 A;  2Z7A A;  1M1J A;  2JQ5 A;  5B66 E;  2NZ2 A;  5AII A;  3CCL 3;  3H1I G;  2XGN A;  3S4R A;  4IL6 E;  3Q3F A;  1T8Z A;  2OTL P;  2BNG A;  4WY4 C;  3HUS C;  1YYC A;  5CK6 A;  1PPJ G;  2ZT9 B;  5KLV G;  2W6J H;  2W9P A;  1BSA A;  2BEQ D;  4HM5 B;  2BMO B;  2I9W A;  1WNH A;  3I56 3;  2PP6 A;  2MKV A;  1MGR A;  3TGU E;  2A45 G;  2UGI A;  2NPS B;  4OVN F;  1OUN A;  3KDP B;  1STD A;  1NAY A;  1K73 4;  3DXO A;  1LT9 C;  1KOR A;  1SQB K;  1JO5 A;  1SQQ D;  3L74 J;  3WU2 H;  3LTD A;  3V98 A;  4PD4 E;  2C10 A;  5APS A;  1RCL A;  1BE3 E;  1KQS O;  4HM2 B;  1KFM A;  1BCC E;  1N9E A;  2R44 A;  3R4Y A;  3VSY A;  1TU3 F;  2K1A A;  2AXT H;  3L73 G;  3GWR A;  1J1E C;  1EDI A;  2IYJ A;  2W27 A;  1HKX A;  2YX9 A;  2E75 D;  3FSD A;  3V6I A;  5KAI E;  1LTG C;  1NNV A;  4AUW A;  1KMI Z;  3AE5 C;  3Q1M A;  1O7H B;  3AGN A;  1VQ7 3;  3STD A;  4GSP A;  4N6L A;  3WA2 X;  1FGT A;  4H13 C;  3HI7 A;  1GK6 A;  4BIR A;  3BRV B;  1R8E A;  1GOY A;  1NDO B;  1IV7 A;  2KF5 A;  3LT8 A;  3IMA B;  2ZXX A;  3BRT B;  1JN5 B;  5STD A;  1BSH A;  3ALA A;  3B7C A;  1B3S A;  3I0Y A;  1BUQ A;  1N8R 4;  3SLU A;  2Q6Q A;  3OV4 A;  3BCC E;  3NXS A;  2H89 C;  1ZW0 A;  3PJS K;  1GMJ A;  2Z5H A;  1JBT A;  4LYL B;  1UIX A;  4H0L C;  5APQ A;  1U8C B;  2FYN C;  1Z56 A;  1ZN5 A;  3FZW A;  5EEO A;  2CPB A;  1EDJ A;  2W04 A;  2E74 B;  2C9L Y;  1QMA A;  4HB1 A;  1K05 A;  1ZRT D;  4BL2 A;  1BAO A;  4FR9 A;  2YIU B;  5KAI H;  3P8M C;  1W5Z A;  1SQX E;  4C7R A;  5CCG A;  4OVM A;  1GW4 A;  4STD A;  5IG5 A;  1NU1 E;  3H6P A;  1LQG C;  4J9A A;  2CFW A;  2QG4 A;  1MOL A;  1GOU A;  3H1J E;  5GSP A;  3EX9 A;  3NM7 A;  1RNB A;  1L0N K;  2CW9 A;  2ZYG A;  1GD3 A;  3QH9 A;  1OX3 A;  3DGN A;  4JPZ B;  1G0T A;  1AA0 A;  5CJ0 A;  1Y4K A;  1X1X A;  1SFC D;  4U3F J;  2O01 J;  2Y0D A;  2ITA A;  3B8E B;  3TYY A;  2HMM B;  4NHF A;  1R5S A;  1LNQ A;  1OHS A;  3QK9 A;  2WSF J;  2CFG A;  3HX8 A;  3B4P A;  3JVC A;  2BCC E;  1A90 A;  3T0U A;  2WVR A;  2IDB A;  1QX8 A;  2BEZ F;  3H1K E;  1PP9 D;  3T97 B;  1VQM P;  3UJM A;  1YIT 3;  1BGY G;  1JB4 A;  3BIR A;  2ZA4 A;  2Z76 A;  1AY7 A;  2F56 A;  3EQ2 A;  1AVO A;  3G6E P;  1O7M B;  3P8C E;  1LTS C;  1B2S A;  4D6T D;  3WOD G;  4XE5 B;  1YGE A;  3BAS A;  5KJ7 A;  1P84 E;  4TT3 H;  5AYR B;  1G96 A;  4N3V A;  1NTK E;  3K5T A;  1QVG O;  2GEX A;  1HF9 A;  1TTO A;  3H1L D;  1LTI C;  3A0H H;  2E75 C;  3L73 J;  2KOG A;  3ABV C;  3AMO B;  2CG1 A;  2H43 A;  3KFQ C;  1GDT A;  1SQP D;  3LIE A;  1DX7 A;  5APY A;  3L72 J;  1L4A A;  2KYV A;  1W6Y A;  1LWU B;  2CK3 H;  3AMO A;  5TGN A;  5L8R J;  2OYI B;  1S3J A;  1ZV8 A;  3ZDM A;  3V99 A;  3GAX A;  3DGM A;  3B71 A;  7RNT A;  1LWU A;  1WMN A;  4GHO A;  1T2K D;  1OPY A;  2KSE A;  1BRH A;  2KUB A;  4N6V 0;  3A5E A;  4OUQ A;  1ASK A;  2LYX A;  3MG1 A;  1SQB J;  2A06 G;  2C9N Y;  1EKM A;  2RSX A;  3CME 3;  3MWZ A;  3Q90 A;  1N8R Q;  3L70 G;  1DYU A;  4Q53 A;  3PP5 A;  1NTZ J;  4A7P A;  1FGR A;  2J58 A;  4CCV A;  5EFW B;  1P84 H;  2K9Y A;  3HTK B;  1T3J A;  4N6U A;  1OF5 A;  1IO4 A;  2CKF B;  3SXX A;  4KT3 B;  1ZME C;  4BU4 A;  3L36 A;  4UB8 E;  1MUU A;  4M3L A;  4N6N B;  5AVW B;  2FFD C;  2KK7 A;  4KT0 J;  3B4S A;  7STD A;  1UGI A;  1W6C A;  1GD4 A;  3EN1 B;  3U1A A;  2PFX A;  5D81 A;  3E7K A;  1VQ5 3;  2CX0 A;  4FMB A;  2F98 A;  2QRX A;  1OXZ A;  2XSO B;  1OW6 A;  3JUM A;  1A02 J;  1VQ6 P;  3BNE A;  4RBN A;  3FXD A;  5EQL A;  3D6Y A;  3TDG A;  1LTJ B;  1NU1 D;  3LW5 J;  5APW A;  3SWF A;  3TGU G;  4K3A A;  1J1D B;  3PS8 A;  3JCU H;  5GTH E;  3S67 A;  1RHL A;  1LTJ A;  3BVH A;  1NTM E;  1G02 A;  3OWY A;  3LXU X;  4GDO A;  5JPU A;  4JYB A;  2D42 A;  1SFC C;  1LOX A;  1SQV G;  1BE3 G;  3CXH H;  1KN7 A;  3KQG A;  1BCC G;  1SVF A;  5AW4 B;  2OTL 3;  1Q40 A;  5KAF E;  3PCS A;  3CCL P;  2BCC D;  3H1K D;  1V57 A;  1JOC A;  2HMO B;  4RNY A;  1VDF A;  3CCR 3;  1NB5 I;  5AVR B;  1AVK A;  3FXE A;  5M1B A;  3K0Z A;  1BSB A;  3I56 P;  2BHM A;  1SQX K;  4DOJ A;  4B86 A;  3L75 D;  2QIY A;  3KSE D;  1CSB A;  1NU1 K;  2V7Q J;  2WSS H;  3G3Z A;  4LSO A;  4NPD A;  1KD1 4;  1P84 D;  1L0N J;  3QWO C;  1NTK D;  5AW3 B;  4N3Y B;  2Q5U A;  2W8Z A;  4U3F E;  2IY2 A;  4K1U A;  2FXP A;  4HVN A;  1R5L A;  4PV1 D;  3BCC G;  1LJ2 A;  1T2K C;  4BXL A;  3WMD A;  3ER7 A;  4HKV B;  3D3L A;  4EC6 A;  2JJL A;  5AW1 B;  4BWN A;  4RES B;  1H8A A;  1TUH A;  1A67 A;  5IEP A;  4DJG A;  3S9O A;  3AE6 C;  1C54 A;  3CNM A;  1VQ7 P;  1KIL B;  4QWT A;  1YVB I;  3RK2 B;  1YIJ 3;  5GTI H;  2Y0C A;  5AEU B;  1BNJ A;  1IVW A;  1MWT A;  3L71 J;  3L70 J;  1LTT C;  1KIL A;  4XDV A;  3M9H A;  1B2X A;  3FG3 A;  3H1J G;  2Z77 A;  5H2F H;  3CXH D;  4FCZ A;  1NTK K;  3L72 E;  2IMJ A;  3SWY A;  2YKP A;  3HD7 B;  2N1T D;  1W2Z A;  1BOX A;  3M9Q A;  4ZKP A;  1VQ4 3;  3C9I A;  4L73 A;  4YPC A;  3KHU A;  2FYZ A;  5ELU A;  4JF7 A;  2CPS A;  2K37 A;  3CPW 2;  1MWR A;  1QJG A;  3MPH A;  1W00 A;  4HYT B;  2IBZ G;  1DEE G;  1X1U A;  1SQB E;  1PP9 J;  2HYN A;  3BND A;  3BAT A;  4RO0 A;  2VRS A;  4EYC A;  2QEX P;  1VQN 3;  1LVN A;  3FH1 A;  2QJY C;  1NTZ E;  1N86 A;  2OYH B;  5B5E H;  1NTM D;  5KTB A;  4JRF A;  3RDE A;  4D6T J;  1O7P B;  2YXQ B;  4K35 A;  2OYH A;  2HPC B;  3CCV P;  4JBZ A;  3AEB C;  2Z5I A;  1URQ D;  1M7L A;  2C4B A;  4I7Z B;  3KII A;  4GOE A;  3G8Z A;  5AVV B;  5M1A A;  3H1L J;  4YTP C;  5CHX A;  4OGQ D;  4N6J A;  4ZMD A;  1UW1 A;  4AEQ A;  1LNI A;  1DVD A;  1EXJ A;  2XF3 A;  3ROB A;  4WHA A;  1RE3 C;  3TK1 A;  1FS0 E;  3F89 A;  4MMY B;  1KQF B;  2P7J A;  2UWJ E;  4EDF A;  2WPV B;  2HFE D;  1AQ5 A;  1M90 Q;  1YIT P;  2K9J B;  2JDI H;  1K28 A;  1I0X A;  1ULJ B;  1QGK B;  1SQQ E;  3F8H A;  3VGN A;  2XND H;  1KD1 Q;  1H0T B;  4O3V A;  1W01 A;  4XDW A;  3L74 G;  1MV8 A;  3LH4 A;  3NV0 B;  2XZR A;  1JTH B;  1OCV A;  2M3E A;  3MUD A;  1H0T A;  1AV1 A;  1NTM K;  4IT7 A;  1FZC B;  4LEH A;  4UB6 E;  3NV0 A;  3LT9 A;  4HKZ H;  1OGX A;  3D5G A;  1PGP A;  2LKM A;  1FZC A;  4QMA A;  1YJW 3;  1E5W A;  5AW5 B;  1FDM A;  2C11 A;  1FZF A;  3A76 A;  2N9Y B;  1LP1 B;  3FX0 A;  5TIS E;  2ZT9 D;  3G9R A;  1FZA A;  2J59 M;  1TP6 A;  5AW9 B;  2ZYD A;  2CFL A;  5IER A;  5KP3 A;  2O1J A;  1RF0 C;  4LLH A;  3G16 A;  2KI7 B;  2Q07 A;  2BMQ B;  1N5H A;  3F9S A;  5LC7 A;  1VF5 B;  1NOH A;  3WDG B;  1BNR A;  1U57 A;  2CX1 A;  5IF6 A;  1SQX J;  3HE4 B;  1JCC A;  1GYB A;  3RNT A;  3A3Y B;  2ZDJ A;  1NU1 J;  4W7Z A;  1GK4 A;  1B2U A;  4JYC A;  2OQE C;  2HG5 D;  3X40 A;  3HE4 A;  4L8O A;  1BIR A;  1NJI 4;  2N1T C;  4I5Q A;  4CPG A;  2YNY A;  3D6Z A;  3CXH I;  2H0H A;  1M8O B;  2W6A A;  3RGR A;  3OJA B;  2R3C A;  1RNT A;  3K9M C;  3S29 A;  4UB6 H;  3WR2 A;  2PNC A;  5E79 H;  1S72 3;  3Q5P A;  3FWL A;  3CC2 P;  3IR9 A;  2L5G B;  1KZU B;  1ZOY C;  2RGQ A;  2JR8 A;  5KLI C;  4GKG A;  4ZNC A;  1RMS A;  2KSJ A;  1ZRT E;  1N5P A;  2BCC J;  4Y99 B;  3H1K J;  1X22 A;  4MEI A;  5AW6 B;  1JZD A;  1VQ5 P;  3OXA A;  4N78 D;  2B87 B;  5DRV A;  2IUJ A;  4ILF A;  5IG0 A;  4N6O B;  1O7N B;  1VQ8 3;  1MFZ A;  1Q81 4;  1FBM A;  3EF8 A;  1FOS E;  2B87 A;  5DJT B;  1URQ C;  4DT0 A;  1JY2 P;  2FYU D;  2QIW A;  4R4M A;  5DJU B;  2WPR A;  3LYG A;  3GF3 A;  1GMQ A;  4U7J A;  4XB5 A;  1W7C A;  2AXT E;  1DMN A;  2IYO A;  1FZU A;  4OGQ C;  1RH5 B;  1NTK J;  1LRA A;  2YKQ A;  3V2Q A;  1JEK A;  3HUS B;  3LTA A;  5KKZ C;  2PGD A;  1AR0 A;  3SFE C;  4U3F G;  1RF1 C;  5CCG D;  1EEJ A;  4HM7 B;  2E74 D;  2HMN B;  3SOA A;  4IFF A;  1JNQ A;  1TJD A;  3AGO A;  2P58 A;  1OMI A;  1FGO A;  1FDO A;  1PP9 E;  1GD2 E;  1FUT A;  1FU1 A;  1RGL A;  1WMP A;  2HMJ B;  4HOH A;  3CCQ 3;  1QAK A;  2YXR B;  2KF3 A;  1M1J C;  2YMK A;  1AQT A;  5G1L A;  1FDI A;  1JY3 O;  3CCR P;  4HZ9 B;  1NH4 A;  1M1K 4;  2YFL B;  3J7Y d;  4D6T E;  2NPS A;  1FJK A;  3DGL A;  3FCS B;  1BRS A;  2XGL A;  1NTZ K;  4WVZ A;  1VQO P;  3IPT A;  4CJN A;  1ZLL A;  3IFM A;  3H1L E;  2XRX B;  1Q82 4;  1SQP E;  2ZT9 C;  2CHC A;  3TF5 A;  4NRE A;  2AEJ A;  1S4X A;  3L72 G;  1D6U A;  2E2U A;  5JBS A;  3LML A;  3NBB A;  4FCJ A;  5CXO A;  1TRP A;  3N7N A;  3CWB E;  2RN0 A;  5KJ7 D;  2XH9 A;  5DRE A;  3WMM 0;  3CC4 3;  1DMM A;  3AE1 C;  5AVQ B;  2KB7 P;  2E5Y A;  1YJN 3;  3KSP A;  1UI7 A;  3BNC A;  1SQB G;  3A7O A;  3HIG A;  3ZFZ A;  1SQQ K;  5A0O B;  1HBW A;  1IZN B;  1YIJ P;  4L7K A;  1K04 A;  1L4A D;  1M9G A;  2Q7C A;  1BSC A;  3CMA 3;  4H0L B;  2PZV A;  5HGR A;  1JY2 N;  2YMY A;  1NTZ G;  1NTM J;  2FYN B;  1KV4 A;  2UX0 A;  3DZL A;  3MTU E;  1AJY A;  1JN5 A;  3ECF A;  3N54 B;  3GRD A;  1SJW A;  1Y8A A;  2KCD A;  5CLK A;  1SP4 A;  2OOV A;  1N73 B;  1BSE A;  3L37 A;  3VYI A;  3H51 A;  1VQ4 P;  3U1W A;  1CYU A;  4MMX B;  3L4F A;  1N73 A;  2FXT A;  1N2D C;  2BT3 A;  4I4K A;  4GOD A;  4R4K A;  3V2N A;  3M9B A;  4EXR A;  5CF2 A;  2QEX 3;  3SOY A;  2XFT A;  4RKU J;  2LXC B;  5M18 A;  1Q81 Q;  3FGY A;  1XTG B;  2P0X A;  5C39 A;  2KXP B;  4HBR A;  5ELJ A;  1G1I A;  3WOE B;  2H88 C;  1NGM B;  4H3U A;  1FGM A;  1VQN P;  3CCV 3;  4NPB A;  3A0H E;  1L2P A;  4NPE A;  1UUV B;  2ZXE B;  1SLQ A;  2QA4 3;  2R5D A;  1GZL A;  3MD0 A;  1MNL A;  2QJK B;  1B2Z A;  2GUV A;  2P1J A;  5CCG C;  2E74 C;  3OW2 O;  1A02 F;  2E76 B;  1JNM A;  3AE4 C;  5BVB A;  2YIU C;  4HYZ A;  1NO4 A;  2CG0 A;  3OX9 A;  2W90 A;  1T2I A;  4HZB B;  2IFM A;  3F14 A;  4HJL B;  6RNT A;  2KXG A;  2GU3 A;  3E99 A;  3CL3 D;  5BU5 A;  3GLM A;  3BU4 A;  1J2B A;  3KKG A;  1UII A;  1DE3 A;  4EI2 A;  1K73 Q;  1M56 D;  1VQP 3;  1M1K Q;  1BGS A;  2RNT A;  5CCH A;  4AKY A;  3T97 A;  3EHC A;  3L75 E;  3UNL A;  1GOV A;  1M57 D;  1JRQ A;  3M8C A;  4RZM A;  1YVS A;  1NB3 I;  3VP9 A;  5G1K A;  2XU6 A;  1VQQ A;  3NXJ A;  1L0N G;  2R5B A;  3TDK A;  1S5L X;  4DKI A;  1FZE A;  1N7L A;  4WB4 A;  2CWV A;  3X3Y A;  3P7K A;  1TU5 A;  2ZAE B;  4EBG A;  1HWT C;  4IIA A;  2QGU A;  1BSD A;  3PRJ A;  1OZH A;  2I8D A;  5KJ7 C;  1YJW P;  2Z6B A;  2KAA A;  2IA7 A;  3WA3 A;  1ZXG A;  3HII A;  4J5K A;  4GOF A;  3EWK A;  3DGO A;  2OYI A;  1UCJ A;  3AE9 C;  3CWB D;  2WGQ A;  2HLO A;  3CX5 H;  3F7S A;  2E2V A;  3V5B A;  2W83 C;  3JCU E;  4KFE A;  4R1K A;  1RSN A;  1L4A C;  3NBJ A;  3FGA D;  5APV A;  3VOP A;  1EZV D;  2WIT A;  2FKW B;  3L71 G;  1V74 A;  1BRN L;  5JPP A;  1L0L E;  2HR3 A;  1LWU C;  3HOH A;  4WYK B;  1VL2 A;  3CXH E;  3SSU A;  1BNS A;  4R9L A;  2FYU J;  3AE2 C;  5APU A;  1YTZ T;  1PL5 A;  1BAN A;  3CC2 3;  1IYY A;  1Y47 A;  4WYK A;  3HTK A;  3KXD A;  1Q90 D;  3Q5R A;  1SQP K;  2D1W A;  1FUS A;  1EA2 A;  2W2C A;  3JUQ A;  1S72 P;  5AIF A;  4H44 B;  3U1C A;  2E42 A;  3BNB A;  4HM4 B;  1FOS F;  1KIL D;  3A2A A;  3ZG0 A;  2UUG C;  3RK2 D;  1BDC A;  1UDI I;  3GHG B;  6STD A;  2H8P D;  1PP9 G;  2OYO A;  3NTN A;  3V92 A;  4WWU C;  2IPP A;  3JSV C;  3GHG A;  1WMK A;  3A0B H;  1VQ8 P;  1SII A;  1SQQ J;  1DET A;  1E79 H;  5CBO A;  3HE5 B;  4N6M A;  1S5L E;  4D6T G;  4EOT A;  1A2K A;  1JB2 A;  5CBN A;  2OGU A;  2GEY A;  3CCM 3;  1HGZ A;  3HE5 A;  3I55 3;  2BU4 A;  3GZR A;  3H1L G;  1OVR A;  1B20 A;  3H1H D;  3GZX B;  5BXQ A;  2JEE A;  1SQP G;  4KFF A;  5TJH A;  1LTJ C;  3RL0 D;  3CX5 D;  1BDD A;  3SFD C;  3B5N B;  2HML B;  3Q2P A;  4ZKU A;  2BAS A;  3CCQ P;  3OAK A;  5GTI E;  4KFD A;  2XSH B;  2P67 A;  3B5N A;  2F86 B;  3UL6 A;  1IU7 A;  1WTH A;  4OH8 B;  1AVL A;  1PGQ A;  2WSE H;  1VQO 3;  3KZT A;  5H2F E;  1K9M 4;  3SYU A;  1RDS A;  4PEJ A;  1DD4 A;  1K41 A;  2Q9I A;  2IFN A;  3RGA A;  1HU9 A;  1IQ8 A;  6GSP A;  1S5L H;  1JM0 A;  3HRN A;  4XBY A;  1WQL B;  3KZI H;  1GL2 B;  3I5C A;  2WO0 A;  3JUN A;  4J5G A;  4I6M C;  1RRL A;  1N7S B;  3SX1 A;  3GZY B;  1N8Q A;  1GL2 A;  3A5T A;  2ZYA A;  4FMD A;  2D2C D;  3AEC C;  2QM7 A;  4KVH A;  1N7S A;  4W7Y A;  3H1I E;  3S5C A;  1T5Y A;  2FGT A;  2N9B A;  1W2E A;  5B5E E;  2CWU A;  1IFD A;  1T2H A;  2R41 A;  4ORL A;  2HOH A;  1SQX G;  9RNT A;  3CC4 P;  4YXW H;  1QVF 2;  3FWN A;  1NU1 G;  1YJN P;  1D6Z A;  1YHQ 3;  1YQ3 C;  3L35 A;  1L0L D;  3IAO A;  3VP8 A;  1EZV I;  1X0T A;  4Z1M H;  3B8L A;  3N8B A;  1W2B 2;  2FY8 A;  4RNZ A;  3CMA P;  3NX0 A;  1LTA C;  2ML5 A;  1CW5 A;  1EUI C;  1FE6 A;  2HOD B;  3JC2 2;  1O7W B;  1IFJ A;  4O2H A;  1PFI A;  3HD7 A;  2H7H A;  3IJE B;  4JQ0 D;  1EXI A;  1KIL C;  3RK2 C;  2KS1 B;  3PGB A;  1W4N A;  1JBR A;  3CCU 3;  3USS A;  3GF7 A;  3WHO A;  2BCC G;  1JY3 P;  3H1K G;  4N78 E;  2WQY C;  2RH0 A;  1B21 A;  3CU3 A;  2KS1 A;  3PTZ A;  2O01 H;  3BLZ A;  2W56 B;  3CCE P;  1U5O A;  2WSC H;  1ZO2 A;  1HUC A;  1X1Y A;  4C7N B;  1KC8 4;  3H3H A;  1X1W A;  1RN4 A;  4XA4 A;  2L1S A;  2FYU E;  2W56 A;  1KWI A;  2A45 H;  1RCK A;  3T8U A;  4CPK A;  1BUJ A;  1KQL A;  1L0L K;  3MGN A;  1UCL A;  2QA4 P;  1NTK G;  2IX7 C;  2HPC A;  3RL0 C;  1LOW A;  3M06 A;  1SQP J;  1HZ1 A;  1MWU A;  1I8V A;  2E5T A;  1KQS 2;  3E1R A;  1DIP A;  2O3O A;  5I97 A;  1V58 A;  3W67 A;  2M7O A;  3CX5 I;  3FLJ A;  2OYH C;  1AVY A;  1MGW A;  3S28 A;  2Y9Z A;  1IVV A;  5G2G A;  3CWB J;  3RK3 D;  1BVI A;  2W0Q A;  4HM6 B;  2KLU A;  4HM8 B;  1K8A 4;  1NU3 A;  4BTY A;  2H0G A;  2WGO A;  4PV1 B;  1US1 A;  1VQP P;  3II6 A;  3NHX A;  5APT A;  5AVZ B;  2K9J A;  1FUW A;  4LGD E;  2IBZ I;  1VQL P;  1ZGX A;  2YFJ B;  2YO3 A;  1CQS A;  1S2E A;  1JTH A;  2NRG A;  5E79 E;  1IK3 A;  3UL5 A;  2INX A;  3PH0 A;  4IFM A;  2D2C C;  5AIH A;  1FZB A;  5FW5 A;  2FXO A;  4WWI A;  3DUK A;  2QJP B;  1UUW B;  3NBR A;  1KYO H;  2P10 A;  1BNF A;  2DW3 A;  3MUD C;  4BTW A;  3H1I D;  1LP1 A;  2NPS D;  5AW7 B;  2JP3 A;  4HM1 B;  3VMA A;  1JY3 N;  1HYF A;  1SAR A;  1PPJ D;  2N1T B;  5KLV D;  1FZC C;  4FMC A;  1GU4 A;  1FGQ A;  1PY3 A;  1HH0 A;  1DH3 A;  1KB9 H;  1I2F A;  5D82 A;  4H61 A;  3MHV A;  1NTM G;  2ZHX B;  2BO9 B;  4HAA A;  4I1L A;  3LZA A;  2F99 A;  1PIX A;  5BVZ A;  3DH2 A;  2B24 B;  3MYT A;  5AW2 B;  1MKM A;  3EE1 A;  5FGO A;  1FYS A;  3G0K A;  3X3Z A;  3AHW A;  3IN6 A;  1TRQ A;  1OGZ A;  4PJ0 E;  1W02 A;  1OHP A;  1TIJ A;  3GW6 A;  3V2R A;  3H1H J;  3L73 D;  3M0D A;  1WT6 A;  1GY6 A;  3OW2 2;  1BNE A;  1RE4 A;  4X2H A;  2RFR A;  1G2C B;  2O1K A;  3C8V A;  1KC8 Q;  4KZ1 A;  1X8Y A;  2GUS A;  2P38 A;  4OGQ B;  5AW8 B;  4I2L C;  1WRG A;  3L75 J;  1G2C A;  1L5G B;  3HK4 A;  2V1L A;  4BL3 A;  1LXE A;  1LNH A;  1Y9B A;  3D71 A;  1OW8 A;  3NMD A;  3O6Q B;  3Q5S A;  1UI8 A;  1RGH A;  2R3S A;  1IC2 A;  1IQY A;  1H88 A;  3T8N A;  4WY4 B;  2GU1 A;  5BU8 B;  2M5A B;  3TSI A;  2QM8 A;  3RGU A;  3QRD A;  1KYO D;  3CCM P;  3WUT A;  4Y99 C;  5KP4 A;  1RN1 A;  1EG9 B;  4XBT A;  1JJ2 2;  3I55 P;  1C7H A;  4WY4 A;  3HUS A;  1BRK A;  2M5A A;  1O7G B;  4O02 B;  1PGJ A;  2WPS A;  1QVG 2;  3EC9 A;  1LT9 B;  3CPW O;  3RK3 C;  1QAL A;  4PJ0 H;  3GG2 A;  1UCI A;  1CZQ A;  3KPE A;  1U7J A;  1K8A Q;  4R9K A;  1LT9 A;  1ULI B;  1FA3 A;  1IFN A;  2CFD A;  2L4V A;  2G3A A;  1VPC A;  2KLV A;  1KB9 D;  2KNC B;  2OQQ A;  1R4C A;  3K5B A;  2JWD A;  3NQY A;  1J1E B;  1YTZ I;  1I3I A;  1VQ9 P;  2KNC A;  3LID A;  3H25 A;  3K63 A;  2FYU K;  1GTW A;  3CXC 2;  1G1J A;  1L0L J;  2K3R A;  3CD6 3;  2E76 D;  2WOH A;  1OFC X;  1DMQ A;  2ZL8 A;  3SWK A;  1RKY A;  4TX4 A;  1E3V A;  2K3D A;  3NM2 A;  2KRT A;  2NPS C;  2YO2 A;  3WUU A;  1UGH I;  1SQV E;  1IFM A;  3ZG5 A;  5CCH D;  4H13 B;  1AQZ A;  3VMX A;  3CLQ A;  1HVV A;  4EIJ A;  2IZ0 A;  1I2E A;  2JKV A;  4Y28 J;  5APX A;  1RGA A;  3PCR A;  4HJG H;  1SS1 A;  3O8Y A;  1IDP A;  5B66 H;  2JO1 A;  2WSE J;  1BGY D;  4L74 A;  1EZV E;  1QL1 A;  1XTC C;  4IL6 H;  1NJI Q;  2A45 I;  1OVV A;  2Y9Y A;  5IEN A;  4XBX A;  1IK7 A;  1YHQ P;  2XNX A;  1RY3 A;  4R80 A;  2FYU G;  1Z1S A;  3AHS A;  1LTB C;  3JUP A;  1L0N D;  2WTY A;  2SBL A;  4TLF A;  1X9V A;  2KF6 A;  2WOF A;  4ZM8 A;  3K7C A;  4DCK A;  3CC7 3;  4N6T A;  4HM0 B;  1SIH A;  1A2V A;  2LR2 A;  4PD4 H;  1YBK A;  4FCM A;  2Y0E A;  4CDL A;  1EQ7 A;  2W9Q A;  1I3F A;  1KTM A;  1IT7 A;  2B88 A;  1OVU A;  3CCE 3;  1HJB A;  1KIL E;  1DEB A;  3AE8 C;  3AEA C;  1W5C E;  2CIU A;  3CCU P;  1ROV A;  4K61 A;  3CCJ 3;  2E2T A;  2OOV C;  1ZS7 A;  1WMO A;  3BB9 A;  1AV4 A;  5AYS C;  2FNQ A;  1JBS A;  1N73 C;  1SQQ G;  3F5H A;  1E3R A;  1NWW A;  4IPB A;  2AAD A;  5BU4 A;  1FZG A;  1UCK A;  2GSP A;  2A06 D;  4HH2 A;  3KCH A;  1RGF A;  1RGK A;  1YNV X;  1RJO A;  2O9U X;  3L71 D;  3L70 D;  1IQX A;  1RGC A;  4MMZ B;  2AAE A;  1YI2 3;  3H1H E;  1KYO I;  3DY5 A;  5AEW B;  4H44 D;  4YXD C;  3PLN A;  2XDJ A;  3CX5 E;  2GBW B;  1PU4 A;  1VZZ A;  2P05 A;  4GT1 A;  2Z4E A;  3D5I A;  2SPZ A;  1PZQ A;  3H1I J;  2I1J A;  3DGY A;  5KP1 A;  2WSC J;  4R4L A;  1LOV A;  1EDK A;  1H89 A;  2QJK C;  1RQV A;  4KJM A;  1CEW I;  1VQL 3;  2E75 B;  2IBZ E;  1W6G A;  5KLV J;  1KB9 I;  3D70 A;  1NVO A;  1OWA A;  2E76 C;  3JUO A;  5RNT A;  1Q82 Q;  4WP5 A;  3TGU D;  1VQK P;  2WWW A;  1FC2 C;  3M0A A;  2FXM A;  2B89 A;  2WMM A;  3G71 P;  3AEE C;  3NQZ A;  4L8P A;  5M19 A;  5CCH C;  3UB1 A;  1U7M A;  1GSP A;  2IZ1 A;  3EB8 A;  4PD4 D;  3N9H A;  1Q86 4;  1USD A;  3PYJ A;  1SQV D;  3B4O A;  3EQQ B;  2QSI A;  1BE3 D;  3B5N D;  4J8T A;  1JY2 O;  1BCC D;  1L4A B;  1KFN A;  3X3X A;  4EV5 A;  1GS3 A;  1GY7 A;  2E43 A;  5CMZ A;  4GL6 A;  5AI1 A;  1MFT A;  2IUK A;  3A0B E;  1AFO A;  2AEF A;  5K5G B;  1Q7Y 4;  1TFO A;  4MN4 C;  5AVS B;  2P09 A;  2POH A;  5EVH A;  1RQU A;  1S1C X;  3Q1C A;  2R32 A;  1JMB A;  1NKZ B;  1GU5 A;  1NO3 A;  2OYI C;  1JZO A;  2K88 A;  2FFD B;  1GL2 D;  3FKA A;  3L74 E;  3VF1 A;  1RGE A;  2O3J A;  3CPO A;  1N7S D;  2Q1K A;  1CI6 B;  2FFD A;  3EFG A;  3LTB A;  2MJZ A;  1OF5 B;  3X41 A;  2I1K A;  3KN4 A;  1CH0 A;  3G4S 3;  3AED C;  1CI6 A;  1KSI A;  1B27 A;  1SQV K;  1KQG B;  3BCC D;  1BRJ A;  3VMZ A;  1EDL A;  4JF8 A;  1IVU A;  5AVT B;  1RHZ B;  4G1M B;  1CYV A;  1SQW A;  1JCD A;  3S27 A;  1SFC B;  1TFK A;  2Y73 A;  2FBW C;  2RBI A;  3Q3D A;  3U97 A;  2Q3I A;  1GY5 A;  4ASV A;  1OHO A;  5IG3 A;  1SFC A;  4W80 A;  3DM8 A;  1YJ9 3;  3KZI E;  3CCS 3;  1SQX D;  2A15 A;  3HD7 D;  1HJ0 A;  2W03 A;  3V4W A;  1IT8 A;  5CF1 A;  2CH9 A;  4H44 C;  2HMK B;  2YFI B;  1RN7 A;  3H1J D;  4ASW A;  1D7M A;  3GZB A;  3E1I A;  1RGG A;  2OTJ P;  3HZP A;  3GHG C;  4IOI H;  2OAR A;  4WFO A;  1X79 B;  2BIR A;  1J1D C;  2OWP A;  3H32 B;  1Q40 B;  2Y74 A;  2KF4 A;  4RJT A;  3VTP C;  2KZJ A;  1I0V A;  3RK3 E;  3CWB G;  3H32 A;  1ZX2 A;  4NPF X;  2GM4 A;  4OWF A;  5AVY B;  4KHX A;  4UB8 H;  1F8N A;  1VQ9 3;  2IBZ D;  1STF I;  2CFK A;  3OWU A;  2GBX B;  3N4X A;  1BGY J;  3W68 A;  4LZI A;  5CJ4 A;  8RNT A;  1T6A A;  1A2P A;  2G8Y A;  2GA1 A;  1EZV G;  2XV5 A;  1JB0 J;  2QVA A;  2ML6 A;  1M90 4;  3M91 A;  4BRY B;  3P8C D;  3CD6 P;  1IFI A;  3B5N C;  2KP8 A;  1NYH A;  1Q86 Q;  1PYL A;  5AVU B;  1EC5 A;  1RLS A;  3D9R A;  4BRY A;  2WPQ A;  4PD4 I;  3UIA A;  5GTH H;  1JB5 A;  5AIG A;  2ZFC A;  4LGQ A;  1Q2N A;  3F8X A;  1OW7 A;  1JV2 B;  3LTC A;  2M0B A;  5IG4 A;  1R4Y A;  3AE3 C;  3WOF B;  1EQK A;  1IJD B;  1N9J A;  1RRH A;  3F40 A;  1PPJ E;  3MZW B;  4RNT A;  5KLV E;  1Q7Y Q;  1YQ4 C;  3D4A A;  3EN8 A;  3URP A;  2W6B A;  1IV9 A;  1Q42 A;  5KAF H;  1NAF A;  2AXC A;  1UUG B;  1GL2 C;  2XR8 B;  3RBZ A;  2J5U A;  1OIP A;  2K0M A;  1N7S C;  4MJD A;  2AEM A;  2QE7 H;  3LOY A;  1MWS A;  3L74 D;  1QL2 A;  3FG1 A;  3L0R A;  3PXM A;  3VMY A;  1HTL C;  3FG4 A;  4AKZ A; 
#chains in the Genus database with same CATH homology
 4Q53 A;  1DYU A;  2B24 B;  1JN5 A;  3ECF A;  1FGR A;  3GRD A;  3MYT A;  3N54 B;  4CCV A;  3EE1 A;  1SJW A;  3KE7 A;  4N6U A;  1OF5 A;  5FGO A;  3X3Z A;  3G0K A;  2KCD A;  5CLK A;  2OOV A;  2CKF B;  3SXX A;  1OGZ A;  4O8S A;  1W02 A;  1OHP A;  1TIJ A;  3H51 A;  3U1W A;  1CYU A;  4MMX B;  2K54 A;  4OK0 A;  4N6N B;  2CWT A;  1GY6 A;  2FXT A;  2BT3 A;  4I4K A;  3OW2 2;  3NUV A;  4R4K A;  1IFP A;  7STD A;  5IEO A;  2LQV A;  1W6C A;  1GD4 A;  3MG3 A;  4X2H A;  3EN1 B;  2RFR A;  5D81 A;  4EXR A;  1VQ5 3;  5CF2 A;  2QEX 3;  4FMB A;  2F98 A;  4KZ1 A;  3JUM A;  2XSO B;  3SOY A;  2XFT A;  2P38 A;  3BNE A;  4RBN A;  1DVC A;  3FGY A;  5EQL A;  2P0X A;  1BSN A;  1L5G B;  1SPU A;  3HK4 A;  4HBR A;  3TDG A;  5ELJ A;  2V1L A;  1D6Y A;  2MC8 A;  1LXE A;  1LNH A;  2BMR B;  3WOE B;  4FMA A;  4H3U A;  1FGM A;  3CCV 3;  3PS8 A;  1UI8 A;  2XEP A;  3SED A;  3S67 A;  1UUV B;  2QA4 3;  1IQY A;  2GXF A;  1MNL A;  3T8N A;  2GU1 A;  3OWY A;  3LXU X;  5JPU A;  2D42 A;  3QRD A;  1M1X B;  1LOX A;  2B1X B;  3EFF K;  3EJV A;  5BVB A;  5KP4 A;  1EG9 B;  4XBT A;  1JJ2 2;  1ISK A;  1C7H A;  4HYZ A;  1O7G B;  4LMI A;  4O02 B;  2CG0 A;  3OX9 A;  1QVG 2;  2STD A;  3EC9 A;  4HZB B;  8CHO A;  2OTL 3;  1QAL A;  1Q40 A;  3F14 A;  3PCS A;  4HJL B;  2KXG A;  2GU3 A;  3E99 A;  4R9K A;  1ULI B;  1FA3 A;  1J2B A;  5D83 A;  3KKG A;  2CFD A;  2HMO B;  2L4V A;  4U13 A;  1VQM 3;  4RNY A;  1ROA A;  2CC3 A;  1VQP 3;  4AKY A;  1VQK 3;  3CCR 3;  3EHC A;  1NB5 I;  1AVK A;  3G71 3;  3UNL A;  1R4C A;  1JRQ A;  3M8C A;  3K0Z A;  3G6E 3;  3NQY A;  4RZM A;  2BHM A;  1NB3 I;  1IVX A;  2QIY A;  3K63 A;  3KSE D;  3NXJ A;  3CXC 2;  2WSS H;  4LSO A;  1KD1 4;  3CD6 3;  3PZW A;  2WOH A;  3X3Y A;  1DMQ A;  2CWV A;  2ZL8 A;  1TU5 A;  1RKY A;  3EBT A;  4TX4 A;  1E3V A;  1S5A A;  4EBG A;  4EV2 A;  4IIA A;  2QGU A;  3NM2 A;  2KRT A;  4AKZ A;  5IW9 A;  4K1U A;  4HVN A;  2XFS A;  2Z6B A;  3MKI A;  2IA7 A;  3FF2 A;  3WA3 A;  3HII A;  3DGO A;  3WMD A;  1OH0 A;  3PCR A;  3ER7 A;  4HKV B;  3D3L A;  3O8Y A;  3F7X A;  4EC6 A;  2WGQ A;  2OQE A;  1TUH A;  3F7S A;  1A67 A;  2E2V A;  5IEP A;  4DJG A;  1IDP A;  4KFE A;  4R1K A;  1E97 A;  3CNM A;  3NBJ A;  3EBY A;  4QWT A;  5IEN A;  4XBX A;  1YVB I;  1YIJ 3;  1V74 A;  5AEU B;  5JPP A;  1IVW A;  4R80 A;  4WYK B;  4XDV A;  1Z1S A;  4R9L A;  3CNX A;  3FG3 A;  2Z77 A;  3JUP A;  2SBL A;  4TLF A;  4HM3 B;  3CC2 3;  4WYK A;  2WOF A;  3MG2 A;  2OCT A;  3K7C A;  4FCZ A;  4ZM8 A;  2IMJ A;  3CC7 3;  5LC6 A;  4N6T A;  4HM0 B;  1SIH A;  1VQ4 3;  1W2Z A;  2D1W A;  1A2V A;  1EA2 A;  1JKG B;  3MHE A;  4K1V A;  2W2C A;  4FCM A;  4CDL A;  2W9Q A;  4BTX A;  3JUQ A;  5ELU A;  1IT7 A;  3CCE 3;  5AIF A;  1JKG A;  3CPW 2;  2CIU A;  3BNB A;  3OWS A;  1QJG A;  1ROV A;  4HM4 B;  4K61 A;  4K90 B;  3CCJ 3;  2E2T A;  2OOV C;  3DMC A;  1WMO A;  3FF0 A;  3MPH A;  1VQ6 3;  1W00 A;  4GB5 A;  6STD A;  3BB9 A;  1AV4 A;  5AYS C;  2FNQ A;  3V92 A;  4WWU C;  3X42 A;  3BND A;  2R4I A;  3SVA A;  4EYC A;  1VQN 3;  1E3R A;  4IPB A;  1NWW A;  1LVN A;  1QAF A;  1SII A;  1PFP A;  1E79 H;  3FH1 A;  3MSO A;  4N6M A;  2OTJ 3;  4JRF A;  3RDE A;  1A2K A;  1O7P B;  1RJO A;  2O9U X;  2V7Q H;  1JB2 A;  2P0M A;  1IQX A;  2GEY A;  3CCM 3;  4MMZ B;  4X2O A;  1OAC A;  1YI2 3;  3KII A;  3I55 3;  2RCD A;  3DY5 A;  4XM4 A;  5AEW B;  3GZR A;  3G8Z A;  3GZX B;  5BXQ A;  2MF7 A;  2Z7A A;  2GBW B;  1UW1 A;  4KFF A;  4AEQ A;  1PU4 A;  2JQ5 A;  5AII A;  1VZZ A;  3CCL 3;  1DVD A;  2P05 A;  3ROB A;  2XF3 A;  2XGN A;  4WHA A;  1FS0 E;  2HML B;  4MMY B;  3Q2P A;  5KP1 A;  2BNG A;  4KFD A;  5CK6 A;  1CEW I;  2XSH B;  1VQL 3;  2W6J H;  2W9P A;  2F86 B;  4HM5 B;  3UL6 A;  1IU7 A;  1W6G A;  2BMO B;  2I9W A;  1WNH A;  1WTH A;  3I56 3;  2JDI H;  1AVL A;  3JUO A;  1K28 A;  1VQO 3;  3KZT A;  1ULJ B;  1K9M 4;  1OUN A;  3F8H A;  3VGN A;  2XND H;  1STD A;  4O3V A;  4WP5 A;  1K73 4;  1W01 A;  3DXO A;  4PEJ A;  1K41 A;  4XDW A;  3LH4 A;  3RGA A;  3NV0 B;  1OCV A;  3NQZ A;  4L8P A;  3LTD A;  1HU9 A;  1IQ8 A;  3V98 A;  3UB1 A;  2C10 A;  4XBY A;  1WQL B;  4IT7 A;  3EB8 A;  2WO0 A;  4HM2 B;  3N9H A;  4LEH A;  3JUN A;  1Q86 4;  3NV0 A;  3LT9 A;  3PYJ A;  3B4O A;  3EQQ B;  1RRL A;  1OGX A;  3SX1 A;  4J8T A;  1N9E A;  4QMA A;  1N8Q A;  3GZY B;  3VSY A;  1YJW 3;  3GWR A;  3X3X A;  2C11 A;  3A76 A;  4FMD A;  4EV5 A;  1GS3 A;  4KVH A;  1GY7 A;  1HKX A;  1TP6 A;  2YX9 A;  3FSD A;  3S5C A;  2CFL A;  5IER A;  5KP3 A;  1T5Y A;  2FGT A;  4GL6 A;  5AI1 A;  2IUK A;  3G16 A;  2Q07 A;  2BMQ B;  1N5H A;  3F9S A;  2CWU A;  1TFO A;  1Q7Y 4;  1O7H B;  2P09 A;  4ORL A;  5LC7 A;  5EVH A;  3WDG B;  1VQ7 3;  3STD A;  4YXW H;  5IF6 A;  4N6L A;  1QVF 2;  3Q1C A;  1FGT A;  3WA2 X;  1GYB A;  1D6Z A;  1NO3 A;  3HI7 A;  1YHQ 3;  2ZDJ A;  1NDO B;  1IV7 A;  3B8L A;  3FKA A;  2OQE C;  3N8B A;  3LT8 A;  3VF1 A;  3X40 A;  3IMA B;  4L8O A;  3CPO A;  1W2B 2;  4RNZ A;  1NJI 4;  3NX0 A;  1JN5 B;  2ML5 A;  5STD A;  3LTB A;  1BSH A;  3ALA A;  3X41 A;  1OF5 B;  3B7C A;  3I0Y A;  1BUQ A;  1N8R 4;  3KN4 A;  3G4S 3;  3RGR A;  3SLU A;  3OV4 A;  3K9M C;  1O7W B;  4O2H A;  3PJS K;  1KSI A;  3S29 A;  3IJE B;  2PNC A;  1S72 3;  4JF8 A;  1U8C B;  1IVU A;  2RGQ A;  3PGB A;  1W4N A;  3FZW A;  3CCU 3;  3USS A;  5EEO A;  4G1M B;  1CYV A;  1SQW A;  1N5P A;  2W04 A;  3S27 A;  1TFK A;  2Y73 A;  1QMA A;  3CU3 A;  4MEI A;  3BLZ A;  2W56 B;  1U5O A;  1ZO2 A;  3OXA A;  4FR9 A;  1KC8 4;  5DRV A;  2IUJ A;  3H3H A;  5IG0 A;  3U97 A;  1W5Z A;  1GY5 A;  4N6O B;  1O7N B;  1OHO A;  4OVM A;  5IG3 A;  1VQ8 3;  3DM8 A;  1YJ9 3;  4STD A;  5IG5 A;  2W56 A;  4J9A A;  3CCS 3;  1Q81 4;  3EF8 A;  2A15 A;  2CFW A;  2W03 A;  1KWI A;  1MOL A;  3T8U A;  1IT8 A;  3LYG A;  5CF1 A;  2CH9 A;  3EX9 A;  2HMK B;  3NM7 A;  1W7C A;  1RN7 A;  2YFI B;  4XB5 A;  1DMN A;  2CW9 A;  1GD3 A;  3GZB A;  3HZP A;  1JEK A;  3DGN A;  3LTA A;  2E5T A;  1AR0 A;  4WFO A;  1KQS 2;  2OWP A;  2O3O A;  1Q40 B;  1Y4K A;  4HM7 B;  2Y74 A;  2HMN B;  3SOA A;  5I97 A;  1JNQ A;  2HMM B;  2M7O A;  4NHF A;  3FLJ A;  1OHS A;  3QK9 A;  2CFG A;  3S28 A;  3HX8 A;  1WMP A;  1FGO A;  3B4P A;  2HMJ B;  3JVC A;  1A90 A;  1IVV A;  1ZX2 A;  5G2G A;  3T0U A;  3CCQ 3;  2W0Q A;  1QAK A;  4HM6 B;  1K8A 4;  4HM8 B;  1NU3 A;  4BTY A;  1VQ9 3;  1F8N A;  2WGO A;  1STF I;  3UJM A;  1YIT 3;  2CFK A;  3OWU A;  1JB4 A;  1US1 A;  1AQT A;  3NHX A;  2GBX B;  2Z76 A;  4HZ9 B;  4LZI A;  1M1K 4;  1FUW A;  2YFL B;  3J7Y d;  1O7M B;  3DGL A;  3FCS B;  2ML6 A;  2XGL A;  2YFJ B;  1M90 4;  3WOD G;  1CQS A;  1YGE A;  4WVZ A;  3IPT A;  1IK3 A;  3UL5 A;  5AYR B;  3D9R A;  1G96 A;  2INX A;  2XRX B;  4N3V A;  1Q82 4;  3K5T A;  2GEX A;  5AIH A;  5FW5 A;  3DUK A;  2CHC A;  1UUW B;  1JB5 A;  3AMO B;  4NRE A;  5AIG A;  4LGQ A;  3NBR A;  2CG1 A;  3F8X A;  3KFQ C;  1JV2 B;  1D6U A;  3LTC A;  2E2U A;  5IG4 A;  5JBS A;  3LML A;  3NBB A;  1W6Y A;  3WOF B;  4FCJ A;  4BTW A;  2CK3 H;  3AMO A;  5TGN A;  1EQK A;  5CXO A;  3V99 A;  1N9J A;  1RRH A;  3F40 A;  3GAX A;  3DGM A;  4HM1 B;  3EN8 A;  1WMN A;  1IV9 A;  2XH9 A;  5DRE A;  1Q42 A;  1OPY A;  4FMC A;  3CC4 3;  2XR8 B;  1DMM A;  2E5Y A;  1YJN 3;  3KSP A;  1UI7 A;  2K0M A;  3BNC A;  1FGQ A;  4N6V 0;  4OUQ A;  1ASK A;  4MJD A;  2QE7 H;  2LYX A;  3HIG A;  3MG1 A;  3LOY A;  5D82 A;  5A0O B;  3FG1 A;  3L0R A;  3PXM A;  4L7K A;  4H61 A;  1M9G A;  1EKM A;  2RSX A;  3CME 3;  2BO9 B;  3CMA 3;  2PZV A;  3LZA A;  3MWZ A;  2F99 A;  5HGR A;  3FG4 A;  2UX0 A;  3Q90 A;  3DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...