2JDIH

Ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
88
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
publication title Ground State Structure of F1-ATPase from Bovine Heart Mitochondria at 1.9 A Resolution
pubmed doi rcsb
total genus 11
structure length 88
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2jdiH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2jdiH01
2XNDH 4QMAA 3USSA 2QE7H 4WVZA 2JDIH 2W6JH 4DJGA 1FS0E 2E5YA 3EFFK 4TLFA 1AQTA 2V7QH 1IFPA 2E5TA 2WSSH 1BSNA 4YXWH 1BSHA 2CK3H 3PJSK 1E79H 1JEKA
chains in the Genus database with same CATH superfamily
1C7HA 5CBNA 2D1WA 3O6QA 3OW22 4N6MA 1T8ZA 4PD4E 1T2KD 2FYNB 2HMMB 2O1JA 4HKZH 3CCUP 1OWAA 2IYOA 2QVAA 2ZT9B 4H0LD 4RESB 4DOJA 2W56A 4DCKA 1L0ND 3H1LE 1FU1A 1ZXGA 3FG4A 4H13C 4N3YB 2CPBA 1BNFA 1U7JA 1RCKA 2XDJA 3AECC 4HYZA 1DEEG 2IYJA 2H88C 1NJI4 3CX5D 4GSPA 3L72E 4L74A 2W9PA 2A06E 2Z76A 1SQXJ 1GZLA 1AV1A 5RNTA 4R80A 2FYNC 1AVKA 3FF2A 2ZT9C 5KAFH 1PFIA 2E2VA 1DETA 3LMLA 1NWQA 1JCDA 1JY2N 1HTLC 1KD1Q 2XGLA 1TP6A 1SQXG 1DH3A 1JBSA 4AQRD 3S1KA 4RKUJ 3BNCA 1SQVJ 1BCCE 1LTBC 1IQYA 3NQYA 4JYCA 2P38A 1NTZK 3EQQB 4N6V0 2KNCA 1RGFA 1VQ53 1E3RA 3G8ZA 1FJPA 2Q3IA 2GA1A 3N7NA 1SQVG 4R9KA 3AE1C 4C7NB 1OGXA 1S4XA 2ZYGA 1I2GA 4M3LA 1LOVA 2H43A 2CK3H 3CCQP 1VF5D 2XR8B 5LC6A 1M1K4 3EE1A 4Y99B 1W2BO 3AE4C 3OV4A 3M0AA 1TIJA 1ZN5A 1OZHA 3TDGA 5CJ4A 2WGQA 2CFDA 3CWBD 1KYOI 1I2EA 1AVOA 1NTZE 2OTLP 1BANA 4G1MB 5GTHH 1R5SA 1BNRA 1IVWA 3F7SA 2M3BA 3RBZA 2XSOB 3GZYB 3ZFZA 3T97A 1LVNA 1VQPP 3MPHA 1BSDA 1ULJB 1YHQ3 3MHVA 3ER7A 1QVFO 3V6IA 1CYUA 2E43A 5FGOA 4Y99C 4IPBA 1BSBA 2C10A 1UIXA 4IT7A 1B2ZA 2O1KA 3L75J 4IFMA 2CX1A 2IBZI 2P09A 1UCIA 1W5ZA 1IK9A 2QJYB 5AIHA 2O01H 3NM2A 1RF0A 3CCU3 5G2GA 5CCHD 1PPJE 3ALAA 3G4S3 2P7JA 4I1LA 1PL5A 4R4MA 1RGLA 4WWUC 1OX3A 3L75G 1UI8A 1FW7A 3CCM3 1T6AA 2PRRA 2GBXB 1OCVA 1OPYA 1KYOH 3PCRA 1N2DC 1CH0A 1UDII 1MOLA 2XV5A 3CNMA 4ZM8A 1MZ9A 1B2MA 2KF6A 4K1UA 1RE3C 3EFFK 3HIIA 2E75D 3KPEA 1OVVA 1BE3D 2QA43 1NVOA 3V2NA 1LP1B 5AIFA 2WT7A 5APQA 3E7KA 3KSPA 2F5MA 2QJYC 4NPFX 1LOYA 4R9LA 3K0ZA 2H0GA 2YKQA 3AEGC 3GZBA 2OYOA 2Z77A 3QK9A 1YQ4C 5IG0A 3X3ZA 5M18A 5JPPA 1YBKA 2HPCA 4GHOA 1YQ3C 4JPZB 1WQLB 3WODG 2CFWA 1TRPA 1IDPA 3MIWA 3BCCJ 3PZWA 3JVCA 7GSPA 4PD4D 4OK0A 1A90A 1A02J 5GTIH 1RRHA 4I5QA 1YJN3 1PGOA 4H61A 1H0TB 4FMCA 3NBBA 4CDLA 1LTGC 1SQQG 2K3DA 2GXFA 1W7CA 5CCHA 4K3AA 5APXA 2IDBA 3CCQ3 1X1XA 1S2EA 3QH9A 3O8YA 3SSUA 1N5PA 3H1KJ 2R5DA 1KD14 4XDVA 1FGRA 2YKPA 3KYQA 4ZMDA 4HB1A 5K5GB 2Q3EA 1FZCA 2QIYA 3GW6A 2UUGC 1O7WB 2WGOA 2H0IA 2HMLB 2OYHA 1MWUA 3EQ2A 2A06D 3UL6A 3H1KG 4BRYA 3G71P 3M0DA 1JZDA 5AVWB 1OMIA 2BCCJ 2GEYA 2P58A 1SQXD 1YITP 2J59M 1EDKA 3MG3A 1FDIA 1MWRA 5CBOA 5KJ7D 4GKGA 3A76A 3H3HA 4X2OA 3H32A 1FDOA 1S5LE 2V7QH 1R8EA 3CPOA 2BCCG 3A0BE 1BDCA 4LLHA 1AFOA 4O3VA 4KFFA 3KQGA 3IN6A 5BXQA 1A2VA 4D6TE 1EA2A 1YGWA 1HJ0A 3G3ZA 3BASA 1BRKA 1FOSF 4L8PA 1RF1A 3CCRP 1BRHA 1STFI 4HM4B 2W04A 2W6JH 1HGVA 3L35A 1MWSA 4H44B 4LEHA 1VQ9P 2UGIA 3UIAA 3KSED 2KCDA 5KAIE 3F8XA 1N7SB 4FR9A 1NTMK 3KXDA 1BNIA 1BDDA 3E1IA 3FSDA 1LT9A 4FMAA 4EOTA 1YTZT 2KLVA 3I55P 4RJTA 1NYHA 2I1KA 1NWWA 3H1HD 1WMNA 2FNQA 1JMBA 1LQGC 2CWVA 3L74E 1SFCD 4GODA 1OF5B 1EZVD 2KYVA 5TJHA 5CLKA 1IZNB 3D6YA 1NU1J 2WPVB 5KJ7A 1NTME 4H44C 2XF3A 2NRGA 3EC9A 1BUQA 1N7SC 3RDEA 1L0LD 1JB0J 2KLUA 5CCGD 3CI9A 3ECFA 3A5EA 2IYPA 1EDJA 1NU1G 3WU2H 1JBRA 1VQOP 1J2JB 3Q5SA 2QM8A 1HWTC 4N6TA 4HYTB 3FZWA 1JB5A 3PCSA 2ZFCA 1PP9D 1SP4A 2VRSA 1BUJA 2P1JA 2H0HA 2FGTA 1JY3N 2P0MA 1A2KA 3H6PA 1LNQA 1MV8A 4HZBB 3HUSA 1VQMP 3AE9C 2KSEA 4WBAA 2O01J 1AQZA 3WOFB 5A0OB 2HYNA 4ASVA 5TGNA 4HJLB 2N1TB 2CG1A 1GK4A 1SFCA 1GYBA 1JBTA 1QMAA 1QVGO 1IFPA 5DJUB 3X42A 1BU4A 1MFTA 2E76D 3TF5A 2FXMA 1KQGB 1N86A 4IL6E 2PFXA 1YJWP 2NPSB 1W2B2 2Q1KA 4AUWA 1SQPK 1BNGA 3RK2B 1SQQD 3MUDA 1SQBE 5CCGA 4U7JA 2BMRB 2KRTA 2XGNA 1FS0E 2F86B 2J58A 3MWZA 2K0MA 1VQ4P 4WP5A 3WA2X 2W83C 1I70A 3NXSA 2N1TC 4UB8H 4KHXA 4JRFA 2HMOB 1QVF2 1E3VA 3L73D 1J1DB 3H1KD 3B8EB 1VQLP 4B86A 5E79E 4O2HA 2NPSC 2HLOA 1L0NK 1L2PA 3I553 3V4QA 3RL0B 2IBZG 3RK2C 3VGNA 1BRNL 1VQ63 2MKVA 3V2RA 2OQQA 4TX4A 3EX9A 4C46A 1O7PB 2SPZA 1WRGA 2AAEA 3VMXA 4XE5B 1RDSA 1FA3A 1W2ZA 2HODA 3KZIE 1GW3A 3Q2YA 2IMJA 1PU4A 3EWKA 2WSCH 1L0NE 2K54A 3SFDC 2YO2A 1GY7A 1J1DC 5IW9A 4I7ZB 4D6TD 2KB7P 4WY4B 2A45I 3WDGB 1MKMA 2JJLA 1FUSA 2B88A 2OGUA 4XM4A 2RSXA 3STDA 4K90B 3RL0C 3FX0A 1FZGA 3I563 4EYYQ 3C9IA 3ZG5A 3EB8A 3CX5E 2M8RA 3OJAB 3M9QA 8CHOA 2V7QJ 1IJDB 1UW1A 3RNTA 2N9BA 1M56D 1JRQA 4FCJA 3JUOA 1IK7A 1M1JB 5KLVJ 1E97A 1VQM3 2RBIA 3BIRA 1NB5I 2ZXXA 5APWA 1NJIQ 4I2LC 4I7ZC 4WY4C 2BIRA 3L74D 2L4VA 1VPCA 1QALA 1JNMA 1ZR4A 3U1AA 4ZKUA 5KLVG 5HOHA 2AEFA 1NTMD 1S1CX 3L0RA 3O8ZA 1ULIB 4NPEA 2KXGA 2A45H 1IU7A 1NU1D 4EIJA 1EKMA 2IX7C 3BNBA 4TLFA 3PRJA 2KK7A 3HD7B 1IFIA 1M1JC 2B9BA 3T8NA 1ZLLA 2CIUA 1KB9D 3FCSB 1X1UA 1M57D 2GU1A 3CWBE 3NM7A 2GSPA 1HGZA 4NREA 5IG4A 1D6YA 3O6QB 4EV5A 3E1RA 3A0HH 3H1JJ 1AV4A 3E99A 3H1IJ 2KAAA 2WO0A 1RRLA 1Q81Q 3FF0A 5B66H 2HFED 2CWUA 2YNYA 1VQL3 3HTKA 2W56B 4J5GA 1A2PA 4OH8B 1BGYJ 3H1JG 5CMZA 3VTPC 4LGQA 3H1IG 3WR2A 3HD7C 2B87A 4N78D 4HZ9B 1H8AA 1VQ5P 3CXHI 1RQUA 1BGYG 2CFKA 1K05A 1Y9BA 4EC6A 3WUUA 3PS8A 1W4NA 5IF6A 3P8CD 5IG3A 3CC23 1YVSA 5AYSC 1RGHA 3G0KA 4GB5A 2G8YA 1OACA 1N8RQ 1GMPA 1KMIZ 4MEIA 3T0UA 2E74D 1EG9B 4HM2B 1K9M4 4RO0A 1BE3E 3TNUA 4XDWA 3IPTA 3QRDA 3EJVA 2KNCB 2K9JA 3N4XA 1UUGB 2ZJSE 1SQPD 4W80A 1LXEA 3GSPA 4H0LB 3NXJA 2XEPA 2LQVA 1T2IA 2KOGA 2Z7AA 1DD3A 2FKWB 3CXHH 1URQA 1EDIA 1O7MB 1HZ1A 4XBTA 1LOXA 4IOIH 1JMMA 1AVLA 1J1EB 1K04A 1IFMA 3GZXB 3JUMA 2KI7B 3K9MC 1CI6A 3G4SP 3X3XA 1UI7A 1U57A 1QL1A 1ZR2A 3HE4A 3CCMP 1FDMA 1IC2A 2FY8A 1M7LA 4JBZA 3T97B 2H7HA 1T3UA 3PJSK 1T2KC 1AJYA 1SQXK 4HM5B 1Q40A 1NKNA 3G6E3 4H0LC 4KT0J 1ROAA 1KC8Q 4XB5A 2KIKA 5AEUB 1NTKJ 1FZBA 1X22A 1JB4A 1KQFB 2ITAA 5AVRB 1IQXA 1KSIA 4CCVA 2QA4P 4DT0A 3GMAA 3UNLA 4OGQD 1SQVK 1J1EC 1BRIA 1S5LH 1RNBA 3PXMA 3NX0A 1NTKG 4N6OB 3X3YA 1QVG2 2WSCJ 2P0XA 1YIJ3 1D6ZA 1SQXE 4LGDE 1WMOA 3MZWB 2C11A 3L72J 5APVA 1P84I 1VF5B 3LH4A 2KF4A 3CCLP 2OTKE 4I4KA 2GU3A 1FAVA 1YJNP 1USDA 3L72G 4MN4C 2UX0A 1UIIA 1SQVE 3BRVB 4YPCA 1JZOA 1WMPA 5KAIH 4BTYA 1MGWA 3RGUA 2WTYA 4KFDA 2IUKA 2WT7B 1Q814 3WHOA 1JY2O 4XFJA 3TYYA 6GSPA 1I0VA 5IEOA 1RF0C 1A02F 3L36A 2Y0DA 1VF5C 2HPCB 4HKVB 5FW5A 1L0LK 1Z1SA 2BNGA 5TISE 1MNLA 1IVXA 5BVBA 1P84H 4HM6B 1NTZJ 2I1JA 3H1HE 3BLZA 5M1AA 3GRDA 3H1JD 3ITKA 3OX9A 3H1ID 4KZ1A 3IF4A 1RH5B 3SVAA 5AW7B 1EZVE 2BU4A 1HU9A 3OWSA 4U3FJ 2PNCA 3EBYA 4LC1A 2MC8A 3CMAP 2A45G 2W27A 1IFNA 3S27A 1NTZG 1Z56A 4DJGA 4FMBA 1BGYD 5HGRA 3FG1A 3UB1A 3RK3B 1IFJA 4RZMA 1L0LE 1FZCB 4WB4A 1LT1A 1N8R4 1I2FA 4U3FG 2SARA 1Q2NA 1OGZA 2YO3A 2OYHB 2H8PD 4RNTA 4N6JA 5DREA 4BRYB 1NH4A 3FLJA 1YNVX 2QE7H 3G16A 1KORA 4PJ0E 3TGUD 1V57A 2R41A 4IFDK 3SXXA 1PP9E 4ASWA 4PV1D 5CCHC 3GLMA 3AE7C 4GDOA 4H3UA 1BVIA 3M8CA 1BNJA 5H2FH 1BSEA 3H32B 2GM4A 1FZUA 3LTAA 2POHA 5APSA 3AEAC 3AE6C 1RE4A 3L70D 2KS1A 3RK3C 1SQQK 1OVUA 1YI2P 1JY2P 1FZCC 5IENA 4IL6H 3KDPB 2OYHC 3AE2C 2BHMA 2FXOA 3CME3 1HJBA 3M0DC 3X40A 4OVNF 1RF1B 2XZRA 1AY7A 2QJPB 3AMOA 3KCHA 3PH0A 2JQ5A 3CCL3 1KC84 3CC4P 1AQTA 1JCCA 1F8NA 2OQEA 1XTCC 1LT9B 1NHLA 1SQQE 4RBNA 1T2HA 3G9RA 4UB6E 4Y28J 1NU3A 1RNTA 1DX7A 3BCCG 2KP8A 1DMQA 3CCE3 4L75A 1T3JA 3SX1A 4K35A 3V2PA 7RNTA 2KF5A 3D5GA 2CPSA 1RF1C 3NV0A 1GU5A 5JBSA 2QJPC 1SPUA 4HAAA 1RN7A 3L73E 3H1KE 3RGRA 3NHXA 5JPUA 4OVMA 2RCDA 1RGEA 2D42A 1W2EA 1LT9C 2YKOA 3NTNA 2WPSA 2YFLB 1EXIA 1VQ7P 1HVVA 4W7YA 1GMJA 2W0QA 3GHGA 1G2CA 1EXJA 3CMA3 3WMDA 1RGAA 4AKYA 1OXZA 2IPPA 4HM1B 1G1IA 2Q5UA 3AEEC 1SQVD 3DGYA 5KJ7C 1RQVA 3JUPA 3HUSB 4Q53A 1EQKA 4N6NB 1CW5A 1GL2D 1X0TA 1O7NB 3CL3D 1KQSO 3W68A 1BSCA 2R44A 5AIIA 4Z1MH 3LXUX 1SFCB 2ZVNB 1PFPA 5KAFE 1EEJA 2A15A 1VQ83 3DZLA 4MJDA 4BWNA 2BEZF 2W03A 1JTHA 3KFQC 2OTJ3 1NU1K 2FXPA 1VQ6P 1I3FA 1YI23 1GD2E 3HUSC 3KE7A 2V4HA 1VQKP 1NGMB 1OVRA 2WVRA 1AQ5A 2W90A 3P7KA 1HUCA 1RGGA 4WFOA 2NZ2A 1WTHA 4O02B 2F99A 3T8UA 5AVYB 3B4PA 1SFCC 4JQ0D 4U3FD 1OIPA 1SQWA 3CC43 1UUVB 1NU1E 3B5ND 1AVYA 3FWLA 3AHWA 5KP4A 4H44D 4AEQA 3CD63 1YTZI 2JDIH 1O7HB 3L75D 1V58A 3IR9A 2PP6A 4LSOA 1KB9E 2XU6A 3I56P 1GL2A 2IZ0A 3MUDC 3I5CA 3V2QA 3VMAA 1YYCA 5CCGC 3II6A 1IYYA 2WSSH 3Q90A 1BSNA 1FE6A 3FGAD 3R2PA 3OW2O 1OW8A 2W6AA 2KF3A 1S3JA 3USSA 1LWUA 2HODB 5EQLA 1Q7HA 4RNYA 4AKZA 3VMZA 3HE5B 1PYLA 5KP3A 1N7LA 4MMZB 1RHZB 2CFGA 3KKGA 2RH0A 1GSPA 5CK6A 1X8YA 2Y9ZA 2D2CD 4PD4I 2P2UA 5L8RJ 3Q2PA 4N78E 1GMQA 3DY5A 3L71J 1VQ73 3OWYA 3LZAA 3LW5J 1JEKA 2AXTE 1JY3O 1OUNA 5BU5A 1W01A 1BNSA 3K5BA 3SFEC 3JCUE 1KYOE 3SWKA 3AEFC 3DM8A 3L71G 5LC7A 3MYTA 2F5WA 3P8CE 2I8DA 1QX8A 2LXBA 3B5NA 2OYIA 4AYCA 1FOSE 1QLED 1WNHA 3BCCD 2C0XA 4R4KA 2YX9A 3HZPA 1DD4A 2C0WA 1QEXA 3NFQA 4GIFA 1M8OB 3K5TA 4J5KA 1PZQA 3NBJA 1SQBJ 1BIRA 2YFIB 3PP5A 3F8HA 4N6UA 1BOXA 1SVFA 5BU4A 1SQPE 3WA3A 1N8QA 1EDLA 1Q7YQ 2K9YA 4PD4H 4MMXB 1SQBG 4JF7A 3S67A 1U5OA 5G1LA 3UJMA 2Y0EA 3WUTA 1GD3A 3TDKA 1KILD 1X9VA 2NPSD 3LIDA 3VSYA 1R4YA 3MP7B 1K9MQ 1VQK3 1TFOA 2BCCD 2XSHB 3DGMA 4J8TA 2YMKA 3LTCA 1D7MA 1ASKA 3S9OA 3CC2P 1PGJA 1Y8AA 4FCZA 1YGEA 1N73A 5D81A 1JN5A 3SWYA 3CCJP 2WZ7A 1UGHI 4LYLB 3V98A 4YXWH 1Y47A 1PV3A 3JC22 1FZEA 1JY3P 3FXEA 1E79H 1L0NJ 5KLVK 1GD4A 2B87B 4EDFA 2GUSA 3NBRA 1N5HA 4L76A 1U7MA 2V1LA 1VQNP 1RSNA 3DXOA 3S5CA 1XTGB 3EN8A 1EZVI 1FGTA 2RKLA 1L4AD 2G3AA 2C4BA 2O3JA 3BNEA 4GL6A 2DW3A 5AVQB 3CPWO 1CQSA 2P67A 1OW6A 3M9HA 1KILA 5KLVE 1J2BA 1GW4A 3EN1B 4KFEA 3AHSA 2FYUJ 1ZP0C 3TNUB 5AW5B 5APUA 5STDA 3FKAA 1GDTA 3DGLA 3WOEB 2K9JB 4OWFA 2FYUG 1RLSA 1SIHA 3G6EP 3Q3DA 3F89A 1MFZA 3GZRA 3L37A 2AEMA 1TJDA 2F4YA 1URQB 1NNVA 4HJGH 1P84D 2J5UA 3GF3A 1OHOA 5KP1A 2I9WA 1GS3A 3CWBJ 4ILFA 1HYFA 1YIJP 1CI6B 2Y0CA 2O9UX 3H1JE 3HE4B 1L4AA 1S9KD 3H1IE 5IERA 1Y4KA 4R1KA 1HBWA 2W8ZA 5BIRA 2STDA 1BGSA 1Q40B 2WQYC 2WOFA 4YXDC 2ZDJA 3X41A 3W67A 2B24B 2YFJB 1ISKA 4PJ0H 1QL2A 3WU2E 1BGYE 1FGMA 4J9AA 1PIXA 1S5AA 1URQC 5AVUB 6STDA 2P10A 1ZRTD 3L71D 3WMM0 1KQS2 1KYOD 1TU3F 3AE8C 1N9EA 1NOHA 1O7GB 1LTJA 1GOVA 1UCLA 3TGUE 2CKFB 2QEXP 2LXCB 1Q7Y4 3CCJ3 3MTUE 1YVBI 2XKMA 3VMYA 3FXDA 4DKIA 3C8VA 2IUJA 3HOHA 1BAOA 3URPA 3L4FA 1NAYA 2ZYDA 3B4OA 3AGNA 2OOVA 4MMYB 3L70E 3LT8A 1VL2A 3RL0g 2WMMA 1VDFA 3R4YA 4I6MC 2FFDC 1VQN3 3H51A 1FZFA 1RJOA 3GG2A 2M5AA 2ML5A 1JOCA 2K1AA 2E5TA 2IBZD 3RBXA 3OA7A 2B1XB 3NMDA 4IIAA 1JB2A 3N9HA 3OAKA 1IV7A 1SIIA 2HMNB 1E5WA 3FH1A 1Q9EA 2B89A 4L73A 3FG3A 3S4RA 2CFLA 1AR0A 2M7OA 5AW4B 4K1VA 1L5GB 3C1LA 1I0XA 1UCKA 1NTKK 2CW9A 1ROVA 3Q1CA 4OGQB 4UB8E 4QWTA 1R5LA 3IFMA 1G1JA 1G02A 3M06A 4W7ZA 3CC7P 2WITA 1TTOA 5EEOA 2ZA4A 2Z5HA 1B2XA 1RCLA 4H13D 2FFDA 3H1LJ 1DMNA 5BU8B 2BMOB 1NTKE 2XNXA 3A0BH 9RNTA 3VN0A 3CMEP 4KJMA 3H1LG 1SJWA 2XH9A 1QAKA 4OGQC 4JYBA 2AEJA 2N9YB 3S29A 1KFMA 4O8SA 3HK4A 2Q9IA 3CXC2 1G96A 2WSEJ 2ZT9D 1QJGA 2BO9B 5KLVD 3OWUA 2KXPB 2QRXA 1KN7A 4R4LA 1Q42A 2E5YA 1H88A 4CJNA 2A06G 3AGOA 4WYKA 1MGRA 1KB9I 3M91A 1UUWB 2QGUA 3EHCA 1BCCJ 2KS1B 4WWIA 2LYXA 3CCEP 2FYUD 1GU4A 2OCTA 3V92A 1SLQA 2OARA 3EFGA 1JKGA 1I3IA 1ZS7A 5AVZB 1W6CA 3CCSP 2QEX3 1UGIA 4HVNA 1BCCG 4HBRA 3AE3C 1R4CA 4HM8B 1CSBA 3AMOB 3FGYA 1AA0A 4YTPC 2Y73A 1S5LX 1GY5A 3B7CA 1JJ22 1GOUA 2HMJB 1KQLA 3A5TA 2ZHXB 1U8CB 3VYIA 1RE4C 1ZV8A 1ZO2A 5AYRB 2R32A 3GF7A 1TU5A 1JV2B 5AW1B 2IFNA 1HH0A 5B5EE 3N8BA 1EUIC 1KB9H 1LNHA 4WHAA 3H1HJ 1IFDA 4PV1B 3K63A 4U3FE 4EW5A 3NV0B 1Q90D 5AW6B 3PLNA 2E75B 1RKYA 3L75E 3H1HG 1B20A 3VP9A 3N54B 2OQEC 2R3CA 1LQMB 3A0HE 5KLIB 1L0LJ 1UCJA 1S723 1EZVG 3GWRA 1BRJA 3LW5H 3LTBA 5B66E 1VQ8P 3GHGB 3CC73 2RN0A 3BATA 1G2CB 1L0LG 2OTJP 2XFSA 5AIGA 5G1KA 1PP9J 1CEWI 3J7Yd 3CPW2 4PV1C 3A7OA 2AXTH 3I0YA 5AW8B 1STDA 1PPJG 2PAJA 1GOYA 3JCUH 3LTDA 3M9BA 2E75C 3H25A 1OH0A 1DEBA 3RK3D 1PP9G 2HR3A 3B71A 4L8OA 5KLIC 3HRNA 1LOWA 3D71A 3ZG0A 5CXOA 2E42A 3SYUA 4C7NA 3D79A 3GHGC 1W02A 2M3EA 2R3SA 1CZQA 3CD6P 1PY3A 1JTHB 4LMIA 2XFTA 3BCCE 1NO4A 2YMYA 3CX5I 5E79H 1FGOA 4U13A 1DIPA 3BB9A 1SQQJ 1CYVA 3U1CA 3MHEA 2K37A 1W6YA 1FGQA 1IVVA 3CCS3 4ORLA 4XBYA 4L7KA 2Q6QA 5KKZB 6RNTA 2ML6A 5CHXA 3MGNA 5AW3B 4FCMA 2WOHA 3CXHE 4HM0B 1NTKD 4QMAA 2XRXB 4IL6X 3H1LD 3KZIH 3U97A 1RE3A 5ELJA 2JWDA 4NPDA 1KILE 3L73J 3P32A 1H89A 2CC3A 1GL2B 2QJKB 1RN4A 1K8AQ 2BCCE 3MG1A 1FZAA 2OTL3 3L72D 1X1YA 1IK3A 3L73G 2YXRB 3Q1MA 1TUHA 3F7XA 3CCVP 5KKZC 3CX5H 3QWOC 3NUVA 1LWUB 1WT6A 3U59A 5KTBA 2BASA 2IY2A 2JP3A 1VQP3 2RNTA 4BTWA 3SWFA 1PGPA 2YIUB 2J8XB 2YXQB 2BMQB 1BCCD 2CHCA 3D3LA 5AVSB 1YJ9P 4D6TJ 1ZW0A 5AW2B 3LT9A 1GL2C 2QJKC 2HG5D 1B2UA 1LP1A 2KUBA 1USEA 5ELUA 2IFMA 2RFRA 1FC2C 4GOEA 2RGQA 2W6BA 1DMMA 5I97A 4D6TG 4C7RA 2JKVA 3Q5PA 3VP8A 3B5NB 1LWUC 2OYIB 4K61A 3ABVC 4EYCA 1A67A 4HM3B 5CF1A 3CU3A 1BSAA 1IVUA 1DYUA 2YIUC 3PHLA 1NTZD 1K28A 1H0TA 1DVCA 2F56A 3BRTB 3MSOA 1B27A 2OWPA 2RMZA 1M9GA 1NAFA 3RGAA 1KZUB 3L74J 1EQ7A 3SEDA 1N9JA 1JM0A 1EC5A 1FJKA 3V4WA 3ROBA 3D9RA 2E2TA 1NTMJ 1SS1A 4FMDA 5GTHE 1N7SD 3KZTA 5D82A 3AEDC 5AEWB 3L74G 1KTMA 4IFFA 3B5NC 3UL5A 2OYIC 1B2SA 3KN4A 2LKMA 2GUVA 2D2CB 3KIIA 1LNIA 3KHUA 1NTMG 1P84E 2FYZA 5D83A 5DRVA 1RY3A 1Q82Q 1VQQA 1I8VA 2E76B 1HF9A 4XA4A 5AW9B 4WVZA 2AXCA 1PPJD 1QGKB 3NQZA 1S9KE 3VOPA 1N73B 3HX8A 4CPKA 1IQ8A 1JN5B 1QAFA 2UWJE 3F40A 3DMCA 3WUVA 4HH2A 3LYGA 2L91A 4EXRA 1RHLA 1W5CE 1BSHA 1Q86Q 2Y74A 1LRAA 1GTWA 2ZYAA 1K73Q 3JUQA 2Z6BA 2M0BA 2D2CC 1ZRTE 3L71E 2P05A 4RNZA 3D4AA 1T3BA 3PYJA 1X79B 1SQBK 3G713 3CCV3 2AADA 2E76C 4EI2A 5H2FE 1JNQA 3D70A 2FXTA 2Y9YA 5APYA 1LJ2A 2SBLA 1OW7A 1YIT3 1N7SA 1N73C 4BXLA 1ZGXA 3V99A 2QIWA 1US1A 1KILB 1V74A 3BU4A 3A3YB 1YJ93 1K8A4 4BIRA 1M90Q 1BRGA 1W6GA 2CH9A 3VF1A 4EBGA 4DZOA 2Q07A 3BVHA 3LIEA 4N6LA 2WSFH 2N1TD 3CXHD 1PGQA 3MD0A 2IBZE 2JR8A 1OF5A 1WMKA 4CPGA 2E2UA 3CCR3 3S28A 1SQPJ 5GTIE 1VQ93 3B4SA 3RK2D 1TFKA 2BEQD 4NPBA 3U1WA 1JUNA 2PZVA 1NO3A 5EFWB 5C39A 1TRQA 1RTUA 2CX0A 1KILC 4TT3H 2LR2A 1SQPG 3EBTA 2MJZA 4X2HA 1T5YA 1MWTA 4BL2A 2BT3A 3PGBA 1LTTC 3HTKB 1L4AB 1RN1A 3DGNA 2WSEH 3SOYA 3IJEB 2Z4EA 1GY6A 2GEXA 3HIGA 1KFNA 3JSVC 5M1BA 2Z5IA 4BU4A 3HE5A 4ZKPA 3TSIA 4KVHA 4HM7B 1ZOYC 3RL0D 1GMRA 2INXA 2K88A 4N3VA 3AEBC 2MF7A 3PTZA 1IO4A 1L0NG 1B3SA 2W2CA 3B8LA 2FYUK 2CWTA 2N1TA 4GT1A 5CF2A 1VQO3 5EVHA 3SOAA 1LTJB 1B21A 5M19A 2WPQA 3FWNA 1L4AC 2KZIA 2L1SA 2NPSA 8RNTA 4HOHA 5DJTB 4O9BA 2W9QA 3A2AA 2K3RA 1GK6A 2O01N 1OHSA 5APTA 3IMAB 5IG5A 4WY4D 3OXAA 4GOFA 4BTXA 3MG2A 2O3OA 1MUUA 2C9NY 1RGKA 4A7PA 3BNDA 5GSPA 1Q824 2FYUE 2R5BA 2M5AB 1FYSA 3GAXA 1DE3A 4STDA 5TISH 1LTJC 2QG4A 2L5GB 1BRSA 2XNDH 3CLQA 3Q3FA 4EV2A 1OHPA 1M1XB 5B5EH 1YJW3 5AVTB 3MKIA 1Q864 1G0TA 1K734 3P8MC 1X1WA 4LZIA 5IEPA 1LTSC 2OOVC 1ZX2A 2ZAEB 1DVDA 1C54A 1OFCX 3V5BA 3CWBG 1BNEA 2IA7A 2ZL8A 1IT7A 1NDOB 1VQ43 2QM7A 2FBWC 3D6ZA 2IZ1A 5CJ0A 2C9LY 1NB3I 2QSIA 1IT8A 4PEJA 2PGDA 2H89C 1VZZA 3CNXA 2FFDB 3HD7D 1LTAC 2WPRA 1RGCA 1M1KQ 5AI1A 2KZJA 3ZDMA 4WY4A 3TK1A 2GBWB 2E74B 1NKZB 2R4IA 1M904 3DUKA 2HMKB 3LOYA 1URQD 1FUTA 2WWWA 1K41A 2JWAA 3Q5RA 3DH2A 4ZNCA 4XBXA 1RMSA 1FBMA 1FUWA 4KT3B 2JO1A 4JF8A 3TGUJ 3D5IA 4NHFA 3K7CA 3IAOA 1M1JA 3EF8A 3F14A 1HKXA 2ZXEB 5AVXB 2CG0A 4WYKB 1W00A 1SQBD 3JUNA 3TGUG 2E74C 3RK3E 1BE3J 2Q7CA 1LGHB 3L70J 4UB6H 1JKGB 2JEEA 1JO5A 2F98A 4OUQA 1SARA 5AW0B 1IV9A 3AE5C 1BE3G 5BVZA 2ZVOB 5AVVB 1LTIC 1KWIA 3F9SA 3L70G 1KV4A 2HOHA 4H13B 1YHQP 2KSJA 1D6UA 3HD7A 3SLUA 4BL3A 3HI7A 3DGOA 1S72P 2WSFJ 7STDA 1ZMEC 3F5HA
chains in the Genus database with same CATH topology
1STDA 1C7HA 1SQWA 3CC43 2D1WA 3OW22 1UUVB 5KP4A 4N6MA 3LTDA 8CHOA 1UW1A 4AEQA 3CD63 1OH0A 2JDIH 1O7HB 4L8OA 4FCJA 1JRQA 2HMMB 3JUOA 4LSOA 1VQM3 1E97A 5CXOA 3T8UA 1NB5I 2W56A 2WSSH 1W02A 1BSNA 3Q90A 3FG4A 2L4VA 1QALA 4HYZA 4LMIA 3USSA 5EQLA 2XFTA 4AKZA 4RNYA 1NJI4 5KP3A 3L0RA 1ULIB 2KXGA 4MMZB 1FGOA 2CFGA 4U13A 3KKGA 3BB9A 1IU7A 3MHEA 1CYVA 2W9PA 5CK6A 1EKMA 2Z76A 1W6YA 1FGQA 1IVVA 3CCS3 3BNBA 4ORLA 4TLFA 4L7KA 4XBYA 3Q2PA 4R80A 3DY5A 1VQ73 1AVKA 2ML6A 3FF2A 3OWYA 3LZAA 3T8NA 2CIUA 2E2VA 3LMLA 3FCSB 4FCMA 1JEKA 2GU1A 1OUNA 2WOHA 3NM7A 1W01A 2XGLA 4HM0B 4QMAA 1TP6A 2XRXB 1D6YA 4NREA 5IG4A 4EV5A 3BNCA 3DM8A 5LC7A 3MYTA 3U97A 1IQYA 5ELJA 3EB8A 3NQYA 1AV4A 3E99A 2P38A 2WO0A 1WNHA 1RRLA 3EQQB 3FF0A 4N6V0 2CWUA 4R4KA 2CC3A 2YX9A 3HZPA 1E3RA 3G8ZA 1VQ53 1VQL3 3K5TA 3MG1A 2W56B 4R9KA 1OGXA 2OTL3 1IK3A 3NBJA 4LGQA 2CK3H 1TUHA 2XR8B 2YFIB 5LC6A 3F7XA 1M1K4 3EE1A 3F8HA 3NUVA 4HZ9B 4N6UA 3OV4A 1TIJA 3TDGA 2WGQA 2CFDA 1VQP3 3WA3A 1N8QA 4BTWA 4MMXB 2CFKA 4G1MB 3S67A 1U5OA 2BMQB 4EC6A 3PS8A 3UJMA 1W4NA 2CHCA 3D3LA 5IF6A 1IVWA 5IG3A 1GD3A 3CC23 3F7SA 3LT9A 2XSOB 3GZYB 3VSYA 5AYSC 1VQK3 1LVNA 3G0KA 3MPHA 1TFOA 1ULJB 4GB5A 2XSHB 1YHQ3 1OACA 5ELUA 3DGMA 3ER7A 4J8TA 3LTCA 2RFRA 2RGQA 1DMMA 5I97A 1CYUA 4MEIA 1ASKA 3T0UA 1EG9B 5FGOA 4IPBA 4HM2B 2C10A 4EYCA 4K61A 1K9M4 4FCZA 4XDWA 3IPTA 3QRDA 4IT7A 3EJVA 1YGEA 1A67A 4HM3B 5CF1A 3CU3A 5D81A 1IVUA 1JN5A 1DYUA 2P09A 3V98A 1W5ZA 1LXEA 4YXWH 5AIHA 3NM2A 3NXJA 1K28A 2XEPA 3CCU3 5G2GA 3ALAA 1E79H 1DVCA 2LQVA 1GD4A 2Z7AA 3G4S3 3MSOA 2OWPA 1M9GA 4WWUC 3RGAA 1UI8A 3NBRA 1N9JA 3SEDA 3CCM3 1N5HA 1O7MB 2GBXB 1OCVA 1OPYA 2V1LA 1LOXA 3PCRA 4XBTA 3ROBA 3D9RA 2E2TA 1AVLA 3DXOA 3S5CA 1MOLA 3EN8A 1FGTA 3GZXB 3CNMA 3JUMA 4FMDA 4ZM8A 3KZTA 5D82A 3K9MC 4K1UA 5AEWB 3EFFK 3X3XA 3HIIA 3UL5A 1UI7A 3BNEA 3KN4A 4GL6A 2QA43 3KIIA 1CQSA 3PJSK 5AIFA 5D83A 4HM5B 5DRVA 1J2BA 3KSPA 1Q40A 3EN1B 4KFEA 4R9LA 3K0ZA 3G6E3 1ROAA 4XB5A 5AEUB 4WVZA 3GZBA 3NQZA 1JB4A 2Z77A 3QK9A 1KSIA 1IQXA 5IG0A 3X3ZA 4CCVA 5JPPA 5STDA 3FKAA 3HX8A 3DGLA 1IQ8A 3UNLA 1WQLB 3WOEB 1JN5B 2CFWA 1QAFA 3WODG 1IDPA 3F40A 3DMCA 3PZWA 3PXMA 3NX0A 3JVCA 3LYGA 1SIHA 4N6OB 4OK0A 4EXRA 3X3YA 3GZRA 1A90A 1QVG2 1RRHA 1YJN3 1BSHA 4H61A 2P0XA 4FMCA 1YIJ3 1D6ZA 2Y74A 1WMOA 2C11A 3JUQA 3NBBA 4CDLA 2Z6BA 2GXFA 1W7CA 2P05A 4RNZA 3PYJA 3LH4A 4I4KA 3G713 1OHOA 3CCQ3 5KP1A 2GU3A 3O8YA 3CCV3 2I9WA 1N5PA 1GS3A 1KD14 4XDVA 1FGRA 2UX0A 1JNQA 1WMPA 2FXTA 1YIT3 2SBLA 2O9UX 2QIYA 4BTYA 1O7WB 5IERA 2WGOA 1Y4KA 4R1KA 3V99A 2HMLB 4KFDA 2IUKA 2STDA 1US1A 3UL6A 1Q814 1Q40B 1V74A 2WOFA 1YJ93 2ZDJA 5IEOA 3X41A 2B24B 2YFJB 1K8A4 1ISKA 1W6GA 2CH9A 3VF1A 1FGMA 2Q07A 2GEYA 4J9AA 4EBGA 1S5AA 4N6LA 6STDA 3MG3A 1KQS2 4HKVB 1OF5A 3A76A 4X2OA 3H3HA 5FW5A 1N9EA 1O7GB 2E2UA 2V7QH 3CPOA 1Z1SA 2BNGA 3CCR3 3S28A 1MNLA 2CKFB 1IVXA 4KFFA 4O3VA 5BVBA 1Q7Y4 1VQ93 4HM6B 3BLZA 3CCJ3 1TFKA 3U1WA 3GRDA 5BXQA 2PZVA 1NO3A 1A2VA 3OX9A 1YVBI 1EA2A 4KZ1A 3SVAA 1HU9A 3OWSA 2PNCA 3EBYA 2IUJA 2MC8A 4L8PA 3EBTA 4HM4B 1STFI 2W04A 3B4OA 1T5YA 4X2HA 2W6JH 2OOVA 3S27A 4MMYB 3LT8A 4DJGA 4LEHA 4FMBA 5HGRA 1VQN3 2BT3A 3FG1A 3PGBA 3UB1A 3KSED 3H51A 4RZMA 2KCDA 1RJOA 2ML5A 3F8XA 4FR9A 1N8R4 1OGZA 2E5TA 3DGNA 3FSDA 3SOYA 3IJEB 1GY6A 2B1XB 2GEXA 3HIGA 4FMAA 5DREA 3FLJA 4IIAA 1JB2A 3N9HA 2QE7H 1IV7A 1SIIA 2HMNB 3G16A 4KVHA 4HM7B 3SXXA 3FH1A 1NWWA 3FG3A 2INXA 2CFLA 1WMNA 1AR0A 2FNQA 2CWVA 2M7OA 4N3VA 2MF7A 4K1VA 3B8LA 2W2CA 1L5GB 1OF5B 4H3UA 3M8CA 2CWTA 5CF2A 2CW9A 1VQO3 5EVHA 5CLKA 3SOAA 1ROVA 3LTAA 3Q1CA 2XF3A 4QWTA 3EC9A 5IENA 1BUQA 3RDEA 2W9QA 3ECFA 2BHMA 1OHSA 3CME3 5EEOA 3IMAB 5IG5A 3OXAA 3X40A 4N6TA 1DMNA 4BTXA 3MG2A 2O3OA 3BNDA 3FZWA 3AMOA 1JB5A 3PCSA 1Q824 2BMOB 2JQ5A 3CCL3 1KC84 1AQTA 3GAXA 4STDA 1F8NA 2FGTA 2OQEA 2P0MA 1A2KA 1SJWA 2XH9A 4RBNA 1QAKA 4HZBB 2XNDH 1NU3A 4EV2A 3S29A 4O8SA 3HK4A 1OHPA 1M1XB 1DMQA 3CXC2 1G96A 3CCE3 2BO9B 1QJGA 3SX1A 1YJW3 3WOFB 3OWUA 3MKIA 5A0OB 1Q864 1K734 5TGNA 4LZIA 1Q42A 2E5YA 5IEPA 4HJLB 2CG1A 3NV0A 4WYKA 1GYBA 5JBSA 1QMAA 1UUWB 2OOVC 1SPUA 1IFPA 1ZX2A 2QGUA 3EHCA 1RN7A 3X42A 1DVDA 3RGRA 3NHXA 5JPUA 2LYXA 4OVMA 2OCTA 3V92A 2RCDA 2D42A 1JKGA 1W2B2 2IA7A 2ZL8A 1IT7A 1NDOB 1VQ43 1W6CA 2QEX3 4HVNA 1NB3I 2YFLB 1IT8A 4PEJA 4HBRA 1VZZA 3CNXA 2BMRB 1R4CA 4HM8B 5AI1A 2W0QA 3AMOB 2KRTA 2XGNA 3FGYA 1FS0E 2GBWB 2F86B 2R4IA 1M904 2Y73A 3DUKA 3MWZA 1GY5A 2HMKB 3LOYA 3CMA3 3WMDA 2K0MA 3B7CA 4AKYA 4WP5A 1JJ22 3WA2X 4HM1B 2HMJB 1K41A 4JRFA 1U8CB 2HMOB 4XBXA 3JUPA 4Q53A 1QVF2 1ZO2A 5AYRB 1E3VA 1EQKA 1TU5A 1FUWA 1JV2B 4N6NB 4O2HA 4JF8A 3N8BA 1O7NB 4NHFA 3I553 3K7CA 1LNHA 4WHAA 3VGNA 3EF8A 3F14A 1VQ63 1HKXA 2CG0A 5AIIA 3K63A 3LXUX 4TX4A 3NV0B 1W00A 3EX9A 4WYKB 1O7PB 1PFPA 3JUNA 2A15A 1VQ83 3DZLA 4MJDA 2W03A 1FA3A 1RKYA 3KFQC 1W2ZA 1JKGB 2OTJ3 3N54B 2IMJA 2OQEC 1PU4A 1S723 3GWRA 1YI23 2F98A 4OUQA 3KE7A 3LTBA 2K54A 1IV9A 5IW9A 1GY7A 1KWIA 3WDGB 3F9SA 3CC73 1D6UA 4XM4A 2RSXA 3STDA 3SLUA 4WFOA 2XFSA 4K90B 5AIGA 3HI7A 1CEWI 1WTHA 3I563 3J7Yd 3DGOA 4O02B 3CPW2 2F99A 7STDA 3I0YA 3B4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XND H;  4QMA A;  3USS A;  2QE7 H;  4WVZ A;  2JDI H;  2W6J H;  4DJG A;  1FS0 E;  2E5Y A;  3EFF K;  4TLF A;  1AQT A;  2V7Q H;  1IFP A;  2E5T A;  2WSS H;  1BSN A;  4YXW H;  1BSH A;  2CK3 H;  3PJS K;  1E79 H;  1JEK A; 
#chains in the Genus database with same CATH topology
 1C7H A;  5CBN A;  2D1W A;  3O6Q A;  3OW2 2;  4N6M A;  1T8Z A;  4PD4 E;  1T2K D;  2FYN B;  2HMM B;  2O1J A;  4HKZ H;  3CCU P;  1OWA A;  2IYO A;  2QVA A;  2ZT9 B;  4H0L D;  4RES B;  4DOJ A;  2W56 A;  4DCK A;  1L0N D;  3H1L E;  1FU1 A;  1ZXG A;  3FG4 A;  4H13 C;  4N3Y B;  2CPB A;  1BNF A;  1U7J A;  1RCK A;  2XDJ A;  3AEC C;  4HYZ A;  1DEE G;  2IYJ A;  2H88 C;  1NJI 4;  3CX5 D;  4GSP A;  3L72 E;  4L74 A;  2W9P A;  2A06 E;  2Z76 A;  1SQX J;  1GZL A;  1AV1 A;  5RNT A;  4R80 A;  2FYN C;  1AVK A;  3FF2 A;  2ZT9 C;  5KAF H;  1PFI A;  2E2V A;  1DET A;  3LML A;  1NWQ A;  1JCD A;  1JY2 N;  1HTL C;  1KD1 Q;  2XGL A;  1TP6 A;  1SQX G;  1DH3 A;  1JBS A;  4AQR D;  3S1K A;  4RKU J;  3BNC A;  1SQV J;  1BCC E;  1LTB C;  1IQY A;  3NQY A;  4JYC A;  2P38 A;  1NTZ K;  3EQQ B;  4N6V 0;  2KNC A;  1RGF A;  1VQ5 3;  1E3R A;  3G8Z A;  1FJP A;  2Q3I A;  2GA1 A;  3N7N A;  1SQV G;  4R9K A;  3AE1 C;  4C7N B;  1OGX A;  1S4X A;  2ZYG A;  1I2G A;  4M3L A;  1LOV A;  2H43 A;  2CK3 H;  3CCQ P;  1VF5 D;  2XR8 B;  5LC6 A;  1M1K 4;  3EE1 A;  4Y99 B;  1W2B O;  3AE4 C;  3OV4 A;  3M0A A;  1TIJ A;  1ZN5 A;  1OZH A;  3TDG A;  5CJ4 A;  2WGQ A;  2CFD A;  3CWB D;  1KYO I;  1I2E A;  1AVO A;  1NTZ E;  2OTL P;  1BAN A;  4G1M B;  5GTH H;  1R5S A;  1BNR A;  1IVW A;  3F7S A;  2M3B A;  3RBZ A;  2XSO B;  3GZY B;  3ZFZ A;  3T97 A;  1LVN A;  1VQP P;  3MPH A;  1BSD A;  1ULJ B;  1YHQ 3;  3MHV A;  3ER7 A;  1QVF O;  3V6I A;  1CYU A;  2E43 A;  5FGO A;  4Y99 C;  4IPB A;  1BSB A;  2C10 A;  1UIX A;  4IT7 A;  1B2Z A;  2O1K A;  3L75 J;  4IFM A;  2CX1 A;  2IBZ I;  2P09 A;  1UCI A;  1W5Z A;  1IK9 A;  2QJY B;  5AIH A;  2O01 H;  3NM2 A;  1RF0 A;  3CCU 3;  5G2G A;  5CCH D;  1PPJ E;  3ALA A;  3G4S 3;  2P7J A;  4I1L A;  1PL5 A;  4R4M A;  1RGL A;  4WWU C;  1OX3 A;  3L75 G;  1UI8 A;  1FW7 A;  3CCM 3;  1T6A A;  2PRR A;  2GBX B;  1OCV A;  1OPY A;  1KYO H;  3PCR A;  1N2D C;  1CH0 A;  1UDI I;  1MOL A;  2XV5 A;  3CNM A;  4ZM8 A;  1MZ9 A;  1B2M A;  2KF6 A;  4K1U A;  1RE3 C;  3EFF K;  3HII A;  2E75 D;  3KPE A;  1OVV A;  1BE3 D;  2QA4 3;  1NVO A;  3V2N A;  1LP1 B;  5AIF A;  2WT7 A;  5APQ A;  3E7K A;  3KSP A;  2F5M A;  2QJY C;  4NPF X;  1LOY A;  4R9L A;  3K0Z A;  2H0G A;  2YKQ A;  3AEG C;  3GZB A;  2OYO A;  2Z77 A;  3QK9 A;  1YQ4 C;  5IG0 A;  3X3Z A;  5M18 A;  5JPP A;  1YBK A;  2HPC A;  4GHO A;  1YQ3 C;  4JPZ B;  1WQL B;  3WOD G;  2CFW A;  1TRP A;  1IDP A;  3MIW A;  3BCC J;  3PZW A;  3JVC A;  7GSP A;  4PD4 D;  4OK0 A;  1A90 A;  1A02 J;  5GTI H;  1RRH A;  4I5Q A;  1YJN 3;  1PGO A;  4H61 A;  1H0T B;  4FMC A;  3NBB A;  4CDL A;  1LTG C;  1SQQ G;  2K3D A;  2GXF A;  1W7C A;  5CCH A;  4K3A A;  5APX A;  2IDB A;  3CCQ 3;  1X1X A;  1S2E A;  3QH9 A;  3O8Y A;  3SSU A;  1N5P A;  3H1K J;  2R5D A;  1KD1 4;  4XDV A;  1FGR A;  2YKP A;  3KYQ A;  4ZMD A;  4HB1 A;  5K5G B;  2Q3E A;  1FZC A;  2QIY A;  3GW6 A;  2UUG C;  1O7W B;  2WGO A;  2H0I A;  2HML B;  2OYH A;  1MWU A;  3EQ2 A;  2A06 D;  3UL6 A;  3H1K G;  4BRY A;  3G71 P;  3M0D A;  1JZD A;  5AVW B;  1OMI A;  2BCC J;  2GEY A;  2P58 A;  1SQX D;  1YIT P;  2J59 M;  1EDK A;  3MG3 A;  1FDI A;  1MWR A;  5CBO A;  5KJ7 D;  4GKG A;  3A76 A;  3H3H A;  4X2O A;  3H32 A;  1FDO A;  1S5L E;  2V7Q H;  1R8E A;  3CPO A;  2BCC G;  3A0B E;  1BDC A;  4LLH A;  1AFO A;  4O3V A;  4KFF A;  3KQG A;  3IN6 A;  5BXQ A;  1A2V A;  4D6T E;  1EA2 A;  1YGW A;  1HJ0 A;  3G3Z A;  3BAS A;  1BRK A;  1FOS F;  4L8P A;  1RF1 A;  3CCR P;  1BRH A;  1STF I;  4HM4 B;  2W04 A;  2W6J H;  1HGV A;  3L35 A;  1MWS A;  4H44 B;  4LEH A;  1VQ9 P;  2UGI A;  3UIA A;  3KSE D;  2KCD A;  5KAI E;  3F8X A;  1N7S B;  4FR9 A;  1NTM K;  3KXD A;  1BNI A;  1BDD A;  3E1I A;  3FSD A;  1LT9 A;  4FMA A;  4EOT A;  1YTZ T;  2KLV A;  3I55 P;  4RJT A;  1NYH A;  2I1K A;  1NWW A;  3H1H D;  1WMN A;  2FNQ A;  1JMB A;  1LQG C;  2CWV A;  3L74 E;  1SFC D;  4GOD A;  1OF5 B;  1EZV D;  2KYV A;  5TJH A;  5CLK A;  1IZN B;  3D6Y A;  1NU1 J;  2WPV B;  5KJ7 A;  1NTM E;  4H44 C;  2XF3 A;  2NRG A;  3EC9 A;  1BUQ A;  1N7S C;  3RDE A;  1L0L D;  1JB0 J;  2KLU A;  5CCG D;  3CI9 A;  3ECF A;  3A5E A;  2IYP A;  1EDJ A;  1NU1 G;  3WU2 H;  1JBR A;  1VQO P;  1J2J B;  3Q5S A;  2QM8 A;  1HWT C;  4N6T A;  4HYT B;  3FZW A;  1JB5 A;  3PCS A;  2ZFC A;  1PP9 D;  1SP4 A;  2VRS A;  1BUJ A;  2P1J A;  2H0H A;  2FGT A;  1JY3 N;  2P0M A;  1A2K A;  3H6P A;  1LNQ A;  1MV8 A;  4HZB B;  3HUS A;  1VQM P;  3AE9 C;  2KSE A;  4WBA A;  2O01 J;  1AQZ A;  3WOF B;  5A0O B;  2HYN A;  4ASV A;  5TGN A;  4HJL B;  2N1T B;  2CG1 A;  1GK4 A;  1SFC A;  1GYB A;  1JBT A;  1QMA A;  1QVG O;  1IFP A;  5DJU B;  3X42 A;  1BU4 A;  1MFT A;  2E76 D;  3TF5 A;  2FXM A;  1KQG B;  1N86 A;  4IL6 E;  2PFX A;  1YJW P;  2NPS B;  1W2B 2;  2Q1K A;  4AUW A;  1SQP K;  1BNG A;  3RK2 B;  1SQQ D;  3MUD A;  1SQB E;  5CCG A;  4U7J A;  2BMR B;  2KRT A;  2XGN A;  1FS0 E;  2F86 B;  2J58 A;  3MWZ A;  2K0M A;  1VQ4 P;  4WP5 A;  3WA2 X;  2W83 C;  1I70 A;  3NXS A;  2N1T C;  4UB8 H;  4KHX A;  4JRF A;  2HMO B;  1QVF 2;  1E3V A;  3L73 D;  1J1D B;  3H1K D;  3B8E B;  1VQL P;  4B86 A;  5E79 E;  4O2H A;  2NPS C;  2HLO A;  1L0N K;  1L2P A;  3I55 3;  3V4Q A;  3RL0 B;  2IBZ G;  3RK2 C;  3VGN A;  1BRN L;  1VQ6 3;  2MKV A;  3V2R A;  2OQQ A;  4TX4 A;  3EX9 A;  4C46 A;  1O7P B;  2SPZ A;  1WRG A;  2AAE A;  3VMX A;  4XE5 B;  1RDS A;  1FA3 A;  1W2Z A;  2HOD A;  3KZI E;  1GW3 A;  3Q2Y A;  2IMJ A;  1PU4 A;  3EWK A;  2WSC H;  1L0N E;  2K54 A;  3SFD C;  2YO2 A;  1GY7 A;  1J1D C;  5IW9 A;  4I7Z B;  4D6T D;  2KB7 P;  4WY4 B;  2A45 I;  3WDG B;  1MKM A;  2JJL A;  1FUS A;  2B88 A;  2OGU A;  4XM4 A;  2RSX A;  3STD A;  4K90 B;  3RL0 C;  3FX0 A;  1FZG A;  3I56 3;  4EYY Q;  3C9I A;  3ZG5 A;  3EB8 A;  3CX5 E;  2M8R A;  3OJA B;  3M9Q A;  8CHO A;  2V7Q J;  1IJD B;  1UW1 A;  3RNT A;  2N9B A;  1M56 D;  1JRQ A;  4FCJ A;  3JUO A;  1IK7 A;  1M1J B;  5KLV J;  1E97 A;  1VQM 3;  2RBI A;  3BIR A;  1NB5 I;  2ZXX A;  5APW A;  1NJI Q;  4I2L C;  4I7Z C;  4WY4 C;  2BIR A;  3L74 D;  2L4V A;  1VPC A;  1QAL A;  1JNM A;  1ZR4 A;  3U1A A;  4ZKU A;  5KLV G;  5HOH A;  2AEF A;  1NTM D;  1S1C X;  3L0R A;  3O8Z A;  1ULI B;  4NPE A;  2KXG A;  2A45 H;  1IU7 A;  1NU1 D;  4EIJ A;  1EKM A;  2IX7 C;  3BNB A;  4TLF A;  3PRJ A;  2KK7 A;  3HD7 B;  1IFI A;  1M1J C;  2B9B A;  3T8N A;  1ZLL A;  2CIU A;  1KB9 D;  3FCS B;  1X1U A;  1M57 D;  2GU1 A;  3CWB E;  3NM7 A;  2GSP A;  1HGZ A;  4NRE A;  5IG4 A;  1D6Y A;  3O6Q B;  4EV5 A;  3E1R A;  3A0H H;  3H1J J;  1AV4 A;  3E99 A;  3H1I J;  2KAA A;  2WO0 A;  1RRL A;  1Q81 Q;  3FF0 A;  5B66 H;  2HFE D;  2CWU A;  2YNY A;  1VQL 3;  3HTK A;  2W56 B;  4J5G A;  1A2P A;  4OH8 B;  1BGY J;  3H1J G;  5CMZ A;  3VTP C;  4LGQ A;  3H1I G;  3WR2 A;  3HD7 C;  2B87 A;  4N78 D;  4HZ9 B;  1H8A A;  1VQ5 P;  3CXH I;  1RQU A;  1BGY G;  2CFK A;  1K05 A;  1Y9B A;  4EC6 A;  3WUU A;  3PS8 A;  1W4N A;  5IF6 A;  3P8C D;  5IG3 A;  3CC2 3;  1YVS A;  5AYS C;  1RGH A;  3G0K A;  4GB5 A;  2G8Y A;  1OAC A;  1N8R Q;  1GMP A;  1KMI Z;  4MEI A;  3T0U A;  2E74 D;  1EG9 B;  4HM2 B;  1K9M 4;  4RO0 A;  1BE3 E;  3TNU A;  4XDW A;  3IPT A;  3QRD A;  3EJV A;  2KNC B;  2K9J A;  3N4X A;  1UUG B;  2ZJS E;  1SQP D;  4W80 A;  1LXE A;  3GSP A;  4H0L B;  3NXJ A;  2XEP A;  2LQV A;  1T2I A;  2KOG A;  2Z7A A;  1DD3 A;  2FKW B;  3CXH H;  1URQ A;  1EDI A;  1O7M B;  1HZ1 A;  4XBT A;  1LOX A;  4IOI H;  1JMM A;  1AVL A;  1J1E B;  1K04 A;  1IFM A;  3GZX B;  3JUM A;  2KI7 B;  3K9M C;  1CI6 A;  3G4S P;  3X3X A;  1UI7 A;  1U57 A;  1QL1 A;  1ZR2 A;  3HE4 A;  3CCM P;  1FDM A;  1IC2 A;  2FY8 A;  1M7L A;  4JBZ A;  3T97 B;  2H7H A;  1T3U A;  3PJS K;  1T2K C;  1AJY A;  1SQX K;  4HM5 B;  1Q40 A;  1NKN A;  3G6E 3;  4H0L C;  4KT0 J;  1ROA A;  1KC8 Q;  4XB5 A;  2KIK A;  5AEU B;  1NTK J;  1FZB A;  1X22 A;  1JB4 A;  1KQF B;  2ITA A;  5AVR B;  1IQX A;  1KSI A;  4CCV A;  2QA4 P;  4DT0 A;  3GMA A;  3UNL A;  4OGQ D;  1SQV K;  1J1E C;  1BRI A;  1S5L H;  1RNB A;  3PXM A;  3NX0 A;  1NTK G;  4N6O B;  3X3Y A;  1QVG 2;  2WSC J;  2P0X A;  1YIJ 3;  1D6Z A;  1SQX E;  4LGD E;  1WMO A;  3MZW B;  2C11 A;  3L72 J;  5APV A;  1P84 I;  1VF5 B;  3LH4 A;  2KF4 A;  3CCL P;  2OTK E;  4I4K A;  2GU3 A;  1FAV A;  1YJN P;  1USD A;  3L72 G;  4MN4 C;  2UX0 A;  1UII A;  1SQV E;  3BRV B;  4YPC A;  1JZO A;  1WMP A;  5KAI H;  4BTY A;  1MGW A;  3RGU A;  2WTY A;  4KFD A;  2IUK A;  2WT7 B;  1Q81 4;  3WHO A;  1JY2 O;  4XFJ A;  3TYY A;  6GSP A;  1I0V A;  5IEO A;  1RF0 C;  1A02 F;  3L36 A;  2Y0D A;  1VF5 C;  2HPC B;  4HKV B;  5FW5 A;  1L0L K;  1Z1S A;  2BNG A;  5TIS E;  1MNL A;  1IVX A;  5BVB A;  1P84 H;  4HM6 B;  1NTZ J;  2I1J A;  3H1H E;  3BLZ A;  5M1A A;  3GRD A;  3H1J D;  3ITK A;  3OX9 A;  3H1I D;  4KZ1 A;  3IF4 A;  1RH5 B;  3SVA A;  5AW7 B;  1EZV E;  2BU4 A;  1HU9 A;  3OWS A;  4U3F J;  2PNC A;  3EBY A;  4LC1 A;  2MC8 A;  3CMA P;  2A45 G;  2W27 A;  1IFN A;  3S27 A;  1NTZ G;  1Z56 A;  4DJG A;  4FMB A;  1BGY D;  5HGR A;  3FG1 A;  3UB1 A;  3RK3 B;  1IFJ A;  4RZM A;  1L0L E;  1FZC B;  4WB4 A;  1LT1 A;  1N8R 4;  1I2F A;  4U3F G;  2SAR A;  1Q2N A;  1OGZ A;  2YO3 A;  2OYH B;  2H8P D;  4RNT A;  4N6J A;  5DRE A;  4BRY B;  1NH4 A;  3FLJ A;  1YNV X;  2QE7 H;  3G16 A;  1KOR A;  4PJ0 E;  3TGU D;  1V57 A;  2R41 A;  4IFD K;  3SXX A;  1PP9 E;  4ASW A;  4PV1 D;  5CCH C;  3GLM A;  3AE7 C;  4GDO A;  4H3U A;  1BVI A;  3M8C A;  1BNJ A;  5H2F H;  1BSE A;  3H32 B;  2GM4 A;  1FZU A;  3LTA A;  2POH A;  5APS A;  3AEA C;  3AE6 C;  1RE4 A;  3L70 D;  2KS1 A;  3RK3 C;  1SQQ K;  1OVU A;  1YI2 P;  1JY2 P;  1FZC C;  5IEN A;  4IL6 H;  3KDP B;  2OYH C;  3AE2 C;  2BHM A;  2FXO A;  3CME 3;  1HJB A;  3M0D C;  3X40 A;  4OVN F;  1RF1 B;  2XZR A;  1AY7 A;  2QJP B;  3AMO A;  3KCH A;  3PH0 A;  2JQ5 A;  3CCL 3;  1KC8 4;  3CC4 P;  1AQT A;  1JCC A;  1F8N A;  2OQE A;  1XTC C;  1LT9 B;  1NHL A;  1SQQ E;  4RBN A;  1T2H A;  3G9R A;  4UB6 E;  4Y28 J;  1NU3 A;  1RNT A;  1DX7 A;  3BCC G;  2KP8 A;  1DMQ A;  3CCE 3;  4L75 A;  1T3J A;  3SX1 A;  4K35 A;  3V2P A;  7RNT A;  2KF5 A;  3D5G A;  2CPS A;  1RF1 C;  3NV0 A;  1GU5 A;  5JBS A;  2QJP C;  1SPU A;  4HAA A;  1RN7 A;  3L73 E;  3H1K E;  3RGR A;  3NHX A;  5JPU A;  4OVM A;  2RCD A;  1RGE A;  2D42 A;  1W2E A;  1LT9 C;  2YKO A;  3NTN A;  2WPS A;  2YFL B;  1EXI A;  1VQ7 P;  1HVV A;  4W7Y A;  1GMJ A;  2W0Q A;  3GHG A;  1G2C A;  1EXJ A;  3CMA 3;  3WMD A;  1RGA A;  4AKY A;  1OXZ A;  2IPP A;  4HM1 B;  1G1I A;  2Q5U A;  3AEE C;  1SQV D;  3DGY A;  5KJ7 C;  1RQV A;  3JUP A;  3HUS B;  4Q53 A;  1EQK A;  4N6N B;  1CW5 A;  1GL2 D;  1X0T A;  1O7N B;  3CL3 D;  1KQS O;  3W68 A;  1BSC A;  2R44 A;  5AII A;  4Z1M H;  3LXU X;  1SFC B;  2ZVN B;  1PFP A;  5KAF E;  1EEJ A;  2A15 A;  1VQ8 3;  3DZL A;  4MJD A;  4BWN A;  2BEZ F;  2W03 A;  1JTH A;  3KFQ C;  2OTJ 3;  1NU1 K;  2FXP A;  1VQ6 P;  1I3F A;  1YI2 3;  1GD2 E;  3HUS C;  3KE7 A;  2V4H A;  1VQK P;  1NGM B;  1OVR A;  2WVR A;  1AQ5 A;  2W90 A;  3P7K A;  1HUC A;  1RGG A;  4WFO A;  2NZ2 A;  1WTH A;  4O02 B;  2F99 A;  3T8U A;  5AVY B;  3B4P A;  1SFC C;  4JQ0 D;  4U3F D;  1OIP A;  1SQW A;  3CC4 3;  1UUV B;  1NU1 E;  3B5N D;  1AVY A;  3FWL A;  3AHW A;  5KP4 A;  4H44 D;  4AEQ A;  3CD6 3;  1YTZ I;  2JDI H;  1O7H B;  3L75 D;  1V58 A;  3IR9 A;  2PP6 A;  4LSO A;  1KB9 E;  2XU6 A;  3I56 P;  1GL2 A;  2IZ0 A;  3MUD C;  3I5C A;  3V2Q A;  3VMA A;  1YYC A;  5CCG C;  3II6 A;  1IYY A;  2WSS H;  3Q90 A;  1BSN A;  1FE6 A;  3FGA D;  3R2P A;  3OW2 O;  1OW8 A;  2W6A A;  2KF3 A;  1S3J A;  3USS A;  1LWU A;  2HOD B;  5EQL A;  1Q7H A;  4RNY A;  4AKZ A;  3VMZ A;  3HE5 B;  1PYL A;  5KP3 A;  1N7L A;  4MMZ B;  1RHZ B;  2CFG A;  3KKG A;  2RH0 A;  1GSP A;  5CK6 A;  1X8Y A;  2Y9Z A;  2D2C D;  4PD4 I;  2P2U A;  5L8R J;  3Q2P A;  4N78 E;  1GMQ A;  3DY5 A;  3L71 J;  1VQ7 3;  3OWY A;  3LZA A;  3LW5 J;  1JEK A;  2AXT E;  1JY3 O;  1OUN A;  5BU5 A;  1W01 A;  1BNS A;  3K5B A;  3SFE C;  3JCU E;  1KYO E;  3SWK A;  3AEF C;  3DM8 A;  3L71 G;  5LC7 A;  3MYT A;  2F5W A;  3P8C E;  2I8D A;  1QX8 A;  2LXB A;  3B5N A;  2OYI A;  4AYC A;  1FOS E;  1QLE D;  1WNH A;  3BCC D;  2C0X A;  4R4K A;  2YX9 A;  3HZP A;  1DD4 A;  2C0W A;  1QEX A;  3NFQ A;  4GIF A;  1M8O B;  3K5T A;  4J5K A;  1PZQ A;  3NBJ A;  1SQB J;  1BIR A;  2YFI B;  3PP5 A;  3F8H A;  4N6U A;  1BOX A;  1SVF A;  5BU4 A;  1SQP E;  3WA3 A;  1N8Q A;  1EDL A;  1Q7Y Q;  2K9Y A;  4PD4 H;  4MMX B;  1SQB G;  4JF7 A;  3S67 A;  1U5O A;  5G1L A;  3UJM A;  2Y0E A;  3WUT A;  1GD3 A;  3TDK A;  1KIL D;  1X9V A;  2NPS D;  3LID A;  3VSY A;  1R4Y A;  3MP7 B;  1K9M Q;  1VQK 3;  1TFO A;  2BCC D;  2XSH B;  3DGM A;  4J8T A;  2YMK A;  3LTC A;  1D7M A;  1ASK A;  3S9O A;  3CC2 P;  1PGJ A;  1Y8A A;  4FCZ A;  1YGE A;  1N73 A;  5D81 A;  1JN5 A;  3SWY A;  3CCJ P;  2WZ7 A;  1UGH I;  4LYL B;  3V98 A;  4YXW H;  1Y47 A;  1PV3 A;  3JC2 2;  1FZE A;  1JY3 P;  3FXE A;  1E79 H;  1L0N J;  5KLV K;  1GD4 A;  2B87 B;  4EDF A;  2GUS A;  3NBR A;  1N5H A;  4L76 A;  1U7M A;  2V1L A;  1VQN P;  1RSN A;  3DXO A;  3S5C A;  1XTG B;  3EN8 A;  1EZV I;  1FGT A;  2RKL A;  1L4A D;  2G3A A;  2C4B A;  2O3J A;  3BNE A;  4GL6 A;  2DW3 A;  5AVQ B;  3CPW O;  1CQS A;  2P67 A;  1OW6 A;  3M9H A;  1KIL A;  5KLV E;  1J2B A;  1GW4 A;  3EN1 B;  4KFE A;  3AHS A;  2FYU J;  1ZP0 C;  3TNU B;  5AW5 B;  5APU A;  5STD A;  3FKA A;  1GDT A;  3DGL A;  3WOE B;  2K9J B;  4OWF A;  2FYU G;  1RLS A;  1SIH A;  3G6E P;  3Q3D A;  3F89 A;  1MFZ A;  3GZR A;  3L37 A;  2AEM A;  1TJD A;  2F4Y A;  1URQ B;  1NNV A;  4HJG H;  1P84 D;  2J5U A;  3GF3 A;  1OHO A;  5KP1 A;  2I9W A;  1GS3 A;  3CWB J;  4ILF A;  1HYF A;  1YIJ P;  1CI6 B;  2Y0C A;  2O9U X;  3H1J E;  3HE4 B;  1L4A A;  1S9K D;  3H1I E;  5IER A;  1Y4K A;  4R1K A;  1HBW A;  2W8Z A;  5BIR A;  2STD A;  1BGS A;  1Q40 B;  2WQY C;  2WOF A;  4YXD C;  2ZDJ A;  3X41 A;  3W67 A;  2B24 B;  2YFJ B;  1ISK A;  4PJ0 H;  1QL2 A;  3WU2 E;  1BGY E;  1FGM A;  4J9A A;  1PIX A;  1S5A A;  1URQ C;  5AVU B;  6STD A;  2P10 A;  1ZRT D;  3L71 D;  3WMM 0;  1KQS 2;  1KYO D;  1TU3 F;  3AE8 C;  1N9E A;  1NOH A;  1O7G B;  1LTJ A;  1GOV A;  1UCL A;  3TGU E;  2CKF B;  2QEX P;  2LXC B;  1Q7Y 4;  3CCJ 3;  3MTU E;  1YVB I;  2XKM A;  3VMY A;  3FXD A;  4DKI A;  3C8V A;  2IUJ A;  3HOH A;  1BAO A;  3URP A;  3L4F A;  1NAY A;  2ZYD A;  3B4O A;  3AGN A;  2OOV A;  4MMY B;  3L70 E;  3LT8 A;  1VL2 A;  3RL0 g;  2WMM A;  1VDF A;  3R4Y A;  4I6M C;  2FFD C;  1VQN 3;  3H51 A;  1FZF A;  1RJO A;  3GG2 A;  2M5A A;  2ML5 A;  1JOC A;  2K1A A;  2E5T A;  2IBZ D;  3RBX A;  3OA7 A;  2B1X B;  3NMD A;  4IIA A;  1JB2 A;  3N9H A;  3OAK A;  1IV7 A;  1SII A;  2HMN B;  1E5W A;  3FH1 A;  1Q9E A;  2B89 A;  4L73 A;  3FG3 A;  3S4R A;  2CFL A;  1AR0 A;  2M7O A;  5AW4 B;  4K1V A;  1L5G B;  3C1L A;  1I0X A;  1UCK A;  1NTK K;  2CW9 A;  1ROV A;  3Q1C A;  4OGQ B;  4UB8 E;  4QWT A;  1R5L A;  3IFM A;  1G1J A;  1G02 A;  3M06 A;  4W7Z A;  3CC7 P;  2WIT A;  1TTO A;  5EEO A;  2ZA4 A;  2Z5H A;  1B2X A;  1RCL A;  4H13 D;  2FFD A;  3H1L J;  1DMN A;  5BU8 B;  2BMO B;  1NTK E;  2XNX A;  3A0B H;  9RNT A;  3VN0 A;  3CME P;  4KJM A;  3H1L G;  1SJW A;  2XH9 A;  1QAK A;  4OGQ C;  4JYB A;  2AEJ A;  2N9Y B;  3S29 A;  1KFM A;  4O8S A;  3HK4 A;  2Q9I A;  3CXC 2;  1G96 A;  2WSE J;  2ZT9 D;  1QJG A;  2BO9 B;  5KLV D;  3OWU A;  2KXP B;  2QRX A;  1KN7 A;  4R4L A;  1Q42 A;  2E5Y A;  1H88 A;  4CJN A;  2A06 G;  3AGO A;  4WYK A;  1MGR A;  1KB9 I;  3M91 A;  1UUW B;  2QGU A;  3EHC A;  1BCC J;  2KS1 B;  4WWI A;  2LYX A;  3CCE P;  2FYU D;  1GU4 A;  2OCT A;  3V92 A;  1SLQ A;  2OAR A;  3EFG A;  1JKG A;  1I3I A;  1ZS7 A;  5AVZ B;  1W6C A;  3CCS P;  2QEX 3;  1UGI A;  4HVN A;  1BCC G;  4HBR A;  3AE3 C;  1R4C A;  4HM8 B;  1CSB A;  3AMO B;  3FGY A;  1AA0 A;  4YTP C;  2Y73 A;  1S5L X;  1GY5 A;  3B7C A;  1JJ2 2;  1GOU A;  2HMJ B;  1KQL A;  3A5T A;  2ZHX B;  1U8C B;  3VYI A;  1RE4 C;  1ZV8 A;  1ZO2 A;  5AYR B;  2R32 A;  3GF7 A;  1TU5 A;  1JV2 B;  5AW1 B;  2IFN A;  1HH0 A;  5B5E E;  3N8B A;  1EUI C;  1KB9 H;  1LNH A;  4WHA A;  3H1H J;  1IFD A;  4PV1 B;  3K63 A;  4U3F E;  4EW5 A;  3NV0 B;  1Q90 D;  5AW6 B;  3PLN A;  2E75 B;  1RKY A;  3L75 E;  3H1H G;  1B20 A;  3VP9 A;  3N54 B;  2OQE C;  2R3C A;  1LQM B;  3A0H E;  5KLI B;  1L0L J;  1UCJ A;  1S72 3;  1EZV G;  3GWR A;  1BRJ A;  3LW5 H;  3LTB A;  5B66 E;  1VQ8 P;  3GHG B;  3CC7 3;  2RN0 A;  3BAT A;  1G2C B;  1L0L G;  2OTJ P;  2XFS A;  5AIG A;  5G1K A;  1PP9 J;  1CEW I;  3J7Y d;  3CPW 2;  4PV1 C;  3A7O A;  2AXT H;  3I0Y A;  5AW8 B;  1STD A;  1PPJ G;  2PAJ A;  1GOY A;  3JCU H;  3LTD A;  3M9B A;  2E75 C;  3H25 A;  1OH0 A;  1DEB A;  3RK3 D;  1PP9 G;  2HR3 A;  3B71 A;  4L8O A;  5KLI C;  3HRN A;  1LOW A;  3D71 A;  3ZG0 A;  5CXO A;  2E42 A;  3SYU A;  4C7N A;  3D79 A;  3GHG C;  1W02 A;  2M3E A;  2R3S A;  1CZQ A;  3CD6 P;  1PY3 A;  1JTH B;  4LMI A;  2XFT A;  3BCC E;  1NO4 A;  2YMY A;  3CX5 I;  5E79 H;  1FGO A;  4U13 A;  1DIP A;  3BB9 A;  1SQQ J;  1CYV A;  3U1C A;  3MHE A;  2K37 A;  1W6Y A;  1FGQ A;  1IVV A;  3CCS 3;  4ORL A;  4XBY A;  4L7K A;  2Q6Q A;  5KKZ B;  6RNT A;  2ML6 A;  5CHX A;  3MGN A;  5AW3 B;  4FCM A;  2WOH A;  3CXH E;  4HM0 B;  1NTK D;  4QMA A;  2XRX B;  4IL6 X;  3H1L D;  3KZI H;  3U97 A;  1RE3 A;  5ELJ A;  2JWD A;  4NPD A;  1KIL E;  3L73 J;  3P32 A;  1H89 A;  2CC3 A;  1GL2 B;  2QJK B;  1RN4 A;  1K8A Q;  2BCC E;  3MG1 A;  1FZA A;  2OTL 3;  3L72 D;  1X1Y A;  1IK3 A;  3L73 G;  2YXR B;  3Q1M A;  1TUH A;  3F7X A;  3CCV P;  5KKZ C;  3CX5 H;  3QWO C;  3NUV A;  1LWU B;  1WT6 A;  3U59 A;  5KTB A;  2BAS A;  2IY2 A;  2JP3 A;  1VQP 3;  2RNT A;  4BTW A;  3SWF A;  1PGP A;  2YIU B;  2J8X B;  2YXQ B;  2BMQ B;  1BCC D;  2CHC A;  3D3L A;  5AVS B;  1YJ9 P;  4D6T J;  1ZW0 A;  5AW2 B;  3LT9 A;  1GL2 C;  2QJK C;  2HG5 D;  1B2U A;  1LP1 A;  2KUB A;  1USE A;  5ELU A;  2IFM A;  2RFR A;  1FC2 C;  4GOE A;  2RGQ A;  2W6B A;  1DMM A;  5I97 A;  4D6T G;  4C7R A;  2JKV A;  3Q5P A;  3VP8 A;  3B5N B;  1LWU C;  2OYI B;  4K61 A;  3ABV C;  4EYC A;  1A67 A;  4HM3 B;  5CF1 A;  3CU3 A;  1BSA A;  1IVU A;  1DYU A;  2YIU C;  3PHL A;  1NTZ D;  1K28 A;  1H0T A;  1DVC A;  2F56 A;  3BRT B;  3MSO A;  1B27 A;  2OWP A;  2RMZ A;  1M9G A;  1NAF A;  3RGA A;  1KZU B;  3L74 J;  1EQ7 A;  3SED A;  1N9J A;  1JM0 A;  1EC5 A;  1FJK A;  3V4W A;  3ROB A;  3D9R A;  2E2T A;  1NTM J;  1SS1 A;  4FMD A;  5GTH E;  1N7S D;  3KZT A;  5D82 A;  3AED C;  5AEW B;  3L74 G;  1KTM A;  4IFF A;  3B5N C;  3UL5 A;  2OYI C;  1B2S A;  3KN4 A;  2LKM A;  2GUV A;  2D2C B;  3KII A;  1LNI A;  3KHU A;  1NTM G;  1P84 E;  2FYZ A;  5D83 A;  5DRV A;  1RY3 A;  1Q82 Q;  1VQQ A;  1I8V A;  2E76 B;  1HF9 A;  4XA4 A;  5AW9 B;  4WVZ A;  2AXC A;  1PPJ D;  1QGK B;  3NQZ A;  1S9K E;  3VOP A;  1N73 B;  3HX8 A;  4CPK A;  1IQ8 A;  1JN5 B;  1QAF A;  2UWJ E;  3F40 A;  3DMC A;  3WUV A;  4HH2 A;  3LYG A;  2L91 A;  4EXR A;  1RHL A;  1W5C E;  1BSH A;  1Q86 Q;  2Y74 A;  1LRA A;  1GTW A;  2ZYA A;  1K73 Q;  3JUQ A;  2Z6B A;  2M0B A;  2D2C C;  1ZRT E;  3L71 E;  2P05 A;  4RNZ A;  3D4A A;  1T3B A;  3PYJ A;  1X79 B;  1SQB K;  3G71 3;  3CCV 3;  2AAD A;  2E76 C;  4EI2 A;  5H2F E;  1JNQ A;  3D70 A;  2FXT A;  2Y9Y A;  5APY A;  1LJ2 A;  2SBL A;  1OW7 A;  1YIT 3;  1N7S A;  1N73 C;  4BXL A;  1ZGX A;  3V99 A;  2QIW A;  1US1 A;  1KIL B;  1V74 A;  3BU4 A;  3A3Y B;  1YJ9 3;  1K8A 4;  4BIR A;  1M90 Q;  1BRG A;  1W6G A;  2CH9 A;  3VF1 A;  4EBG A;  4DZO A;  2Q07 A;  3BVH A;  3LIE A;  4N6L A;  2WSF H;  2N1T D;  3CXH D;  1PGQ A;  3MD0 A;  2IBZ E;  2JR8 A;  1OF5 A;  1WMK A;  4CPG A;  2E2U A;  3CCR 3;  3S28 A;  1SQP J;  5GTI E;  1VQ9 3;  3B4S A;  3RK2 D;  1TFK A;  2BEQ D;  4NPB A;  3U1W A;  1JUN A;  2PZV A;  1NO3 A;  5EFW B;  5C39 A;  1TRQ A;  1RTU A;  2CX0 A;  1KIL C;  4TT3 H;  2LR2 A;  1SQP G;  3EBT A;  2MJZ A;  4X2H A;  1T5Y A;  1MWT A;  4BL2 A;  2BT3 A;  3PGB A;  1LTT C;  3HTK B;  1L4A B;  1RN1 A;  3DGN A;  2WSE H;  3SOY A;  3IJE B;  2Z4E A;  1GY6 A;  2GEX A;  3HIG A;  1KFN A;  3JSV C;  5M1B A;  2Z5I A;  4BU4 A;  3HE5 A;  4ZKP A;  3TSI A;  4KVH A;  4HM7 B;  1ZOY C;  3RL0 D;  1GMR A;  2INX A;  2K88 A;  4N3V A;  3AEB C;  2MF7 A;  3PTZ A;  1IO4 A;  1L0N G;  1B3S A;  2W2C A;  3B8L A;  2FYU K;  2CWT A;  2N1T A;  4GT1 A;  5CF2 A;  1VQO 3;  5EVH A;  3SOA A;  1LTJ B;  1B21 A;  5M19 A;  2WPQ A;  3FWN A;  1L4A C;  2KZI A;  2L1S A;  2NPS A;  8RNT A;  4HOH A;  5DJT B;  4O9B A;  2W9Q A;  3A2A A;  2K3R A;  1GK6 A;  2O01 N;  1OHS A;  5APT A;  3IMA B;  5IG5 A;  4WY4 D;  3OXA A;  4GOF A;  4BTX A;  3MG2 A;  2O3O A;  1MUU A;  2C9N Y;  1RGK A;  4A7P A;  3BND A;  5GSP A;  1Q82 4;  2FYU E;  2R5B A;  2M5A B;  1FYS A;  3GAX A;  1DE3 A;  4STD A;  5TIS H;  1LTJ C;  2QG4 A;  2L5G B;  1BRS A;  2XND H;  3CLQ A;  3Q3F A;  4EV2 A;  1OHP A;  1M1X B;  5B5E H;  1YJW 3;  5AVT B;  3MKI A;  1Q86 4;  1G0T A;  1K73 4;  3P8M C;  1X1W A;  4LZI A;  5IEP A;  1LTS C;  2OOV C;  1ZX2 A;  2ZAE B;  1DVD A;  1C54 A;  1OFC X;  3V5B A;  3CWB G;  1BNE A;  2IA7 A;  2ZL8 A;  1IT7 A;  1NDO B;  1VQ4 3;  2QM7 A;  2FBW C;  3D6Z A;  2IZ1 A;  5CJ0 A;  2C9L Y;  1NB3 I;  2QSI A;  1IT8 A;  4PEJ A;  2PGD A;  2H89 C;  1VZZ A;  3CNX A;  2FFD B;  3HD7 D;  1LTA C;  2WPR A;  1RGC A;  1M1K Q;  5AI1 A;  2KZJ A;  3ZDM A;  4WY4 A;  3TK1 A;  2GBW B;  2E74 B;  1NKZ B;  2R4I A;  1M90 4;  3DUK A;  2HMK B;  3LOY A;  1URQ D;  1FUT A;  2WWW A;  1K41 A;  2JWA A;  3Q5R A;  3DH2 A;  4ZNC A;  4XBX A;  1RMS A;  1FBM A;  1FUW A;  4KT3 B;  2JO1 A;  4JF8 A;  3TGU J;  3D5I A;  4NHF A;  3K7C A;  3IAO A;  1M1J A;  3EF8 A;  3F14 A;  1HKX A;  2ZXE B;  5AVX B;  2CG0 A;  4WYK B;  1W00 A;  1SQB D;  3JUN A;  3TGU G;  2E74 C;  3RK3 E;  1BE3 J;  2Q7C A;  1LGH B;  3L70 J;  4UB6 H;  1JKG B;  2JEE A;  1JO5 A;  2F98 A;  4OUQ A;  1SAR A;  5AW0 B;  1IV9 A;  3AE5 C;  1BE3 G;  5BVZ A;  2ZVO B;  5AVV B;  1LTI C;  1KWI A;  3F9S A;  3L70 G;  1KV4 A;  2HOH A;  4H13 B;  1YHQ P;  2KSJ A;  1D6U A;  3HD7 A;  3SLU A;  4BL3 A;  3HI7 A;  3DGO A;  1S72 P;  2WSF J;  7STD A;  1ZME C;  3F5H A; 
#chains in the Genus database with same CATH homology
 1STD A;  1C7H A;  1SQW A;  3CC4 3;  2D1W A;  3OW2 2;  1UUV B;  5KP4 A;  4N6M A;  3LTD A;  8CHO A;  1UW1 A;  4AEQ A;  3CD6 3;  1OH0 A;  2JDI H;  1O7H B;  4L8O A;  4FCJ A;  1JRQ A;  2HMM B;  3JUO A;  4LSO A;  1VQM 3;  1E97 A;  5CXO A;  3T8U A;  1NB5 I;  2W56 A;  2WSS H;  1W02 A;  1BSN A;  3Q90 A;  3FG4 A;  2L4V A;  1QAL A;  4HYZ A;  4LMI A;  3USS A;  5EQL A;  2XFT A;  4AKZ A;  4RNY A;  1NJI 4;  5KP3 A;  3L0R A;  1ULI B;  2KXG A;  4MMZ B;  1FGO A;  2CFG A;  4U13 A;  3KKG A;  3BB9 A;  1IU7 A;  3MHE A;  1CYV A;  2W9P A;  5CK6 A;  1EKM A;  2Z76 A;  1W6Y A;  1FGQ A;  1IVV A;  3CCS 3;  3BNB A;  4ORL A;  4TLF A;  4L7K A;  4XBY A;  3Q2P A;  4R80 A;  3DY5 A;  1VQ7 3;  1AVK A;  2ML6 A;  3FF2 A;  3OWY A;  3LZA A;  3T8N A;  2CIU A;  2E2V A;  3LML A;  3FCS B;  4FCM A;  1JEK A;  2GU1 A;  1OUN A;  2WOH A;  3NM7 A;  1W01 A;  2XGL A;  4HM0 B;  4QMA A;  1TP6 A;  2XRX B;  1D6Y A;  4NRE A;  5IG4 A;  4EV5 A;  3BNC A;  3DM8 A;  5LC7 A;  3MYT A;  3U97 A;  1IQY A;  5ELJ A;  3EB8 A;  3NQY A;  1AV4 A;  3E99 A;  2P38 A;  2WO0 A;  1WNH A;  1RRL A;  3EQQ B;  3FF0 A;  4N6V 0;  2CWU A;  4R4K A;  2CC3 A;  2YX9 A;  3HZP A;  1E3R A;  3G8Z A;  1VQ5 3;  1VQL 3;  3K5T A;  3MG1 A;  2W56 B;  4R9K A;  1OGX A;  2OTL 3;  1IK3 A;  3NBJ A;  4LGQ A;  2CK3 H;  1TUH A;  2XR8 B;  2YFI B;  5LC6 A;  3F7X A;  1M1K 4;  3EE1 A;  3F8H A;  3NUV A;  4HZ9 B;  4N6U A;  3OV4 A;  1TIJ A;  3TDG A;  2WGQ A;  2CFD A;  1VQP 3;  3WA3 A;  1N8Q A;  4BTW A;  4MMX B;  2CFK A;  4G1M B;  3S67 A;  1U5O A;  2BMQ B;  4EC6 A;  3PS8 A;  3UJM A;  1W4N A;  2CHC A;  3D3L A;  5IF6 A;  1IVW A;  5IG3 A;  1GD3 A;  3CC2 3;  3F7S A;  3LT9 A;  2XSO B;  3GZY B;  3VSY A;  5AYS C;  1VQK 3;  1LVN A;  3G0K A;  3MPH A;  1TFO A;  1ULJ B;  4GB5 A;  2XSH B;  1YHQ 3;  1OAC A;  5ELU A;  3DGM A;  3ER7 A;  4J8T A;  3LTC A;  2RFR A;  2RGQ A;  1DMM A;  5I97 A;  1CYU A;  4MEI A;  1ASK A;  3T0U A;  1EG9 B;  5FGO A;  4IPB A;  4HM2 B;  2C10 A;  4EYC A;  4K61 A;  1K9M 4;  4FCZ A;  4XDW A;  3IPT A;  3QRD A;  4IT7 A;  3EJV A;  1YGE A;  1A67 A;  4HM3 B;  5CF1 A;  3CU3 A;  5D81 A;  1IVU A;  1JN5 A;  1DYU A;  2P09 A;  3V98 A;  1W5Z A;  1LXE A;  4YXW H;  5AIH A;  3NM2 A;  3NXJ A;  1K28 A;  2XEP A;  3CCU 3;  5G2G A;  3ALA A;  1E79 H;  1DVC A;  2LQV A;  1GD4 A;  2Z7A A;  3G4S 3;  3MSO A;  2OWP A;  1M9G A;  4WWU C;  3RGA A;  1UI8 A;  3NBR A;  1N9J A;  3SED A;  3CCM 3;  1N5H A;  1O7M B;  2GBX B;  1OCV A;  1OPY A;  2V1L A;  1LOX A;  3PCR A;  4XBT A;  3ROB A;  3D9R A;  2E2T A;  1AVL A;  3DXO A;  3S5C A;  1MOL A;  3EN8 A;  1FGT A;  3GZX B;  3CNM A;  3JUM A;  4FMD A;  4ZM8 A;  3KZT A;  5D82 A;  3K9M C;  4K1U A;  5AEW B;  3EFF K;  3X3X A;  3HII A;  3UL5 A;  1UI7 A;  3BNE A;  3KN4 A;  4GL6 A;  2QA4 3;  3KII A;  1CQS A;  3PJS K;  5AIF A;  5D83 A;  4HM5 B;  5DRV A;  1J2B A;  3KSP A;  1Q40 A;  3EN1 B;  4KFE A;  4R9L A;  3K0Z A;  3G6E 3;  1ROA A;  4XB5 A;  5AEU B;  4WVZ A;  3GZB A;  3NQZ A;  1JB4 A;  2Z77 A;  3QK9 A;  1KSI A;  1IQX A;  5IG0 A;  3X3Z A;  4CCV A;  5JPP A;  5STD A;  3FKA A;  3HX8 A;  3DGL A;  1IQ8 A;  3UNL A;  1WQL B;  3WOE B;  1JN5 B;  2CFW A;  1QAF A;  3WOD G;  1IDP A;  3F40 A;  3DMC A;  3PZW A;  3PXM A;  3NX0 A;  3JVC A;  3LYG A;  1SIH A;  4N6O B;  4OK0 A;  4EXR A;  3X3Y A;  3GZR A;  1A90 A;  1QVG 2;  1RRH A;  1YJN 3;  1BSH A;  4H61 A;  2P0X A;  4FMC A;  1YIJ 3;  1D6Z A;  2Y74 A;  1WMO A;  2C11 A;  3JUQ A;  3NBB A;  4CDL A;  2Z6B A;  2GXF A;  1W7C A;  2P05 A;  4RNZ A;  3PYJ A;  3LH4 A;  4I4K A;  3G71 3;  1OHO A;  3CCQ 3;  5KP1 A;  2GU3 A;  3O8Y A;  3CCV 3;  2I9W A;  1N5P A;  1GS3 A;  1KD1 4;  4XDV A;  1FGR A;  2UX0 A;  1JNQ A;  1WMP A;  2FXT A;  1YIT 3;  2SBL A;  2O9U X;  2QIY A;  4BTY A;  1O7W B;  5IER A;  2WGO A;  1Y4K A;  4R1K A;  3V99 A;  2HML B;  4KFD A;  2IUK A;  2STD A;  1US1 A;  3UL6 A;  1Q81 4;  1Q40 B;  1V74 A;  2WOF A;  1YJ9 3;  2ZDJ A;  5IEO A;  3X41 A;  2B24 B;  2YFJ B;  1K8A 4;  1ISK A;  1W6G A;  2CH9 A;  3VF1 A;  1FGM A;  2Q07 A;  2GEY A;  4J9A A;  4EBG A;  1S5A A;  4N6L A;  6STD A;  3MG3 A;  1KQS 2;  4HKV B;  1OF5 A;  3A76 A;  4X2O A;  3H3H A;  5FW5 A;  1N9E A;  1O7G B;  2E2U A;  2V7Q H;  3CPO A;  1Z1S A;  2BNG A;  3CCR 3;  3S28 A;  1MNL A;  2CKF B;  1IVX A;  4KFF A;  4O3V A;  5BVB A;  1Q7Y 4;  1VQ9 3;  4HM6 B;  3BLZ A;  3CCJ 3;  1TFK A;  3U1W A;  3GRD A;  5BXQ A;  2PZV A;  1NO3 A;  1A2V A;  3OX9 A;  1YVB I;  1EA2 A;  4KZ1 A;  3SVA A;  1HU9 A;  3OWS A;  2PNC A;  3EBY A;  2IUJ A;  2MC8 A;  4L8P A;  3EBT A;  4HM4 B;  1STF I;  2W04 A;  3B4O A;  1T5Y A;  4X2H A;  2W6J H;  2OOV A;  3S27 A;  4MMY B;  3LT8 A;  4DJG A;  4LEH A;  4FMB A;  5HGR A;  1VQN 3;  2BT3 A;  3FG1 A;  3PGB A;  3UB1 A;  3KSE D;  3H51 A;  4RZM A;  2KCD A;  1RJO A;  2ML5 A;  3F8X A;  4FR9 A;  1N8R 4;  1OGZ A;  2E5T A;  3DGN A;  3FSD A;  3SOY A;  3IJE B;  1GY6 A;  2B1X B;  2GEX A;  3HIG A;  4FMA A;  5DRE A;  3FLJ A;  4IIA A;  1JB2 A;  3N9H A;  2QE7 H;  1IV7 A;  1SII A;  2HMN B;  3G16 A;  4KVH A;  4HM7 B;  3SXX A;  3FH1 A;  1NWW A;  3FG3 A;  2INX A;  2CFL A;  1WMN A;  1AR0 A;  2FNQ A;  2CWV A;  2M7O A;  4N3V A;  2MF7 A;  4K1V A;  3B8L A;  2W2C A;  1L5G B;  1OF5 B;  4H3U A;  3M8C A;  2CWT A;  5CF2 A;  2CW9 A;  1VQO 3;  5EVH A;  5CLK A;  3SOA A;  1ROV A;  3LTA A;  3Q1C A;  2XF3 A;  4QWT A;  3EC9 A;  5IEN A;  1BUQ A;  3RDE A;  2W9Q A;  3ECF A;  2BHM A;  1OHS A;  3CME 3;  5EEO A;  3IMA B;  5IG5 A;  3OXA A;  3X40 A;  4N6T A;  1DMN A;  4BTX A;  3MG2 A;  2O3O A;  3BND A;  3FZW A;  3AMO A;  1JB5 A;  3PCS A;  1Q82 4;  2BMO B;  2JQ5 A;  3CCL 3;  1KC8 4;  1AQT A;  3GAX A;  4STD A;  1F8N A;  2FGT A;  2OQE A;  2P0M A;  1A2K A;  1SJW A;  2XH9 A;  4RBN A;  1QAK A;  4HZB B;  2XND H;  1NU3 A;  4EV2 A;  3S29 A;  4O8S A;  3HK4 A;  1OHP A;  1M1X B;  1DMQ A;  3CXC 2;  1G96 A;  3CCE 3;  2BO9 B;  1QJG A;  3SX1 A;  1YJW 3;  3WOF B;  3OWU A;  3MKI A;  5A0O B;  1Q86 4;  1K73 4;  5TGN A;  4LZI A;  1Q42 A;  2E5Y A;  5IEP A;  4HJL B;  2CG1 A;  3NV0 A;  4WYK A;  1GYB A;  5JBS A;  1QMA A;  1UUW B;  2OOV C;  1SPU A;  1IFP A;  1ZX2 A;  2QGU A;  3EHC A;  1RN7 A;  3X42 A;  1DVD A;  3RGR A;  3NHX A;  5JPU A;  2LYX A;  4OVM A;  2OCT A;  3V92 A;  2RCD A;  2D42 A;  1JKG A;  1W2B 2;  2IA7 A;  2ZL8 A;  1IT7 A;  1NDO B;  1VQ4 3;  1W6C A;  2QEX 3;  4HVN A;  1NB3 I;  2YFL B;  1IT8 A;  4PEJ A;  4HBR A;  1VZZ A;  3CNX A;  2BMR B;  1R4C A;  4HM8 B;  5AI1 A;  2W0Q A;  3AMO B;  2KRT A;  2XGN A;  3FGY A;  1FS0 E;  2GBW B;  2F86 B;  2R4I A;  1M90 4;  2Y73 A;  3DUK A;  3MWZ A;  1GY5 A;  2HMK B;  3LOY A;  3CMA 3;  3WMD A;  2K0M A;  3B7C A;  4AKY A;  4WP5 A;  1JJ2 2;  3WA2 X;  4HM1 B;  2HMJ B;  1K41 A;  4JRF A;  1U8C B;  2HMO B;  4XBX A;  3JUP A;  4Q53 A;  1QVF 2;  1ZO2 A;  5AYR B;  1E3V A;  1EQK A;  1TU5 A;  1FUW A;  1JV2 B;  4N6N B;  4O2H A;  4JF8 A;  3N8B A;  1O7N B;  4NHF A;  3I55 3;  3K7C A;  1LNH A;  4WHA A;  3VGN A;  3EF8 A;  3F14 A;  1VQ6 3;  1HKX A;  2CG0 A;  5AII A;  3K63 A;  3LXU X;  4TX4 A;  3NV0 B;  1W00 A;  3EX9 A;  4WYK B;  1O7P B;  1PFP A;  3JUN A;  2A15 A;  1VQ8 3;  3DZL A;  4MJD A;  2W03 A;  1FA3 A;  1RKY A;  3KFQ C;  1W2Z A;  1JKG B;  2OTJ 3;  3N54 B;  2IMJ A;  2OQE C;  1PU4 A;  1S72 3;  3GWR A;  1YI2 3;  2F98 A;  4OUQ A;  3KE7 A;  3LTB A;  2K54 A;  1IV9 A;  5IW9 A;  1GY7 A;  1KWI A;  3WDG B;  3F9S A;  3CC7 3;  1D6U A;  4XM4 A;  2RSX A;  3STD A;  3SLU A;  4WFO A;  2XFS A;  4K90 B;  5AIG A;  3HI7 A;  1CEW I;  1WTH A;  3I56 3;  3J7Y d;  3DGO A;  4O02 B;  3CPW 2;  2F99 A;  7STD A;  3I0Y A;  3B4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...