2JDIH

Ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
88
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ground State Structure of F1-ATPase from Bovine Heart Mitochondria at 1.9 A Resolution
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
total genus 11
structure length 88
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2jdiH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2jdiH01
2E5YA 2WSSH 1IFPA 2CK3H 2QE7H 1BSHA 4WVZA 3USSA 2XNDH 1BSNA 1JEKA 4YXWH 2E5TA 2JDIH 3EFFK 4QMAA 4TLFA 3PJSK 4DJGA 1E79H 2V7QH 1FS0E 1AQTA 2W6JH
chains in the Genus database with same CATH superfamily
2Q1KA 3IF4A 2OOVC 1SQXG 3B5NC 1RGKA 3S29A 2O1JA 2L5GB 2PAJA 1BNIA 4EIJA 3G713 5EVHA 2NPSC 1SIIA 1W5ZA 4HKZH 1X1UA 5AW0B 2B87B 5DREA 2E75B 3EFGA 5CCGC 1AR0A 1KB9H 4C7NA 3QWOC 2WOFA 3JUNA 2ZA4A 3NMDA 1YI23 1JY2O 2UUGC 1JBRA 5JPPA 1JN5A 1IVVA 1Z1SA 5LC7A 1QVF2 2YKPA 1RLSA 1YBKA 4O3VA 2ZFCA 1L0NE 4N78D 1JCCA 1KYOI 3W68A 3MG3A 1GY6A 3CCEP 4WB4A 1E3RA 1YJ93 1OVUA 2OTJP 3CMAP 3L71G 2W0QA 2J8XB 1T3JA 1GK6A 3QH9A 1DIPA 2K37A 3AE2C 3L70D 4AKYA 4WHAA 3KKGA 3NV0A 4XBXA 1MFZA 3VF1A 2JR8A 1OXZA 1Q2NA 2ZXEB 1JMMA 3P8CE 3KHUA 4X2HA 3G16A 1GTWA 1J2JB 4PD4H 1KB9I 1URQA 3RK2B 1CYUA 1KYOE 5E79E 3B4PA 4CJNA 5B66H 3CXC2 1JB2A 5AW3B 2GEXA 1W6CA 4GOEA 3U97A 4FCMA 1GW3A 1IT8A 1IK9A 2RCDA 1KORA 4FR9A 3MTUE 4XBYA 1G0TA 1PP9G 5IERA 3VYIA 3QK9A 5IG3A 1FBMA 3HK4A 2QJYB 3B4OA 2IFMA 5CCHA 1LOVA 1LTSC 1FOSE 2LXCB 1M90Q 1AVOA 1NO4A 4CPGA 4LLHA 3KIIA 3H1HJ 2IX7C 1GW4A 4OGQC 3RL0D 1QGKB 3B5ND 1LVNA 1UUWB 4RNTA 3CNMA 3DGMA 1FGMA 2BMOB 3RDEA 4BXLA 1L0LG 3BATA 1BSDA 1EDJA 1LWUA 1GL2B 4WVZA 1W4NA 4HM7B 1IC2A 2BCCD 1RHLA 3Q5RA 5KKZB 3D71A 1JKGB 4LGDE 2QIYA 3H51A 5G1KA 3RL0g 2J58A 2E42A 1RGCA 4XE5B 2CWVA 3U1CA 1BRGA 1D6YA 1HU9A 2WPSA 2Y9YA 2WMMA 2AAEA 1GYBA 2H0IA 4PEJA 3F14A 3OJAB 3S9OA 1X1YA 1ZX2A 3RK3C 3H1LG 3CWBJ 1QALA 3L74D 3AECC 1EZVD 1FGOA 1E5WA 4TX4A 3FH1A 3GWRA 2WT7A 4QMAA 1N9EA 3CCS3 1DETA 1YITP 4AUWA 3Q5SA 2E76B 1PGPA 1SQVG 2M3BA 1M1JA 1BANA 1TP6A 4JBZA 1RRLA 3CX5H 1TIJA 1L5GB 5IENA 3II6A 5GSPA 2E76C 3NBRA 3D6ZA 2XSOB 2KK7A 2OTJ3 4L75A 3NM2A 1WMPA 4HM0B 2HMOB 1U7JA 3L75D 3X3XA 3CX5I 3DM8A 5AVXB 2GXFA 1ULIB 2YIUC 1TU5A 2CX1A 4L8OA 2O01J 1JB0J 1BGYD 4N6JA 1STFI 4GB5A 5CLKA 4NPBA 4H13C 4C7NB 2PRRA 4LMIA 4J5GA 2LR2A 4IL6X 2ZAEB 1VQPP 1JEKA 1SQPE 4BRYB 1Q81Q 1DEBA 2CWUA 2V1LA 1NTKD 5AW6B 1DVDA 1X1XA 1LJ2A 4R4LA 1XTGB 4HAAA 2QJKC 3CD63 2B24B 3VGNA 3H1JE 2AADA 1NTZE 2KS1B 4N6V0 1PP9J 2K1AA 5AVQB 4HVNA 5AIIA 1BE3D 1KILD 1K73Q 4JYBA 1BCCD 1I2EA 5AW1B 1MKMA 3EN8A 3M91A 2IA7A 2YO3A 2PGDA 1PGOA 2M5AA 5AW8B 3U1WA 1IVUA 1EDKA 5KP4A 2ZVNB 1GD2E 3GW6A 4EYYQ 3FG4A 3Q1CA 2Y0EA 3HE4B 2OTKE 3F8HA 4XDWA 1GL2A 2Z4EA 2HMLB 2W04A 3KPEA 3IN6A 3PZWA 2E2VA 2L4VA 1VL2A 4BWNA 2E2TA 3D5IA 1O7HB 4YXWH 1O7GB 1NDOB 1K9MQ 2P58A 1DYUA 3MG1A 4H13D 3TDGA 1HGZA 3CCVP 2KSJA 1G1JA 3AGNA 3HRNA 2CPBA 1C7HA 3TF5A 2RH0A 3GMAA 3EX9A 2HMMB 2HR3A 3HX8A 1SQQD 5B5EH 2WITA 1FZEA 4R4KA 1YJNP 2Q5UA 1OF5B 1UUGB 2QM8A 1LOYA 5TISH 1I2FA 5FW5A 2H0HA 1OHOA 4I6MC 1KILA 1KD1Q 3OWUA 4EDFA 3LTAA 1QL2A 4N6UA 2R4IA 3B8LA 3GHGA 3TGUD 2WPRA 1NU1K 3HUSB 1E97A 3EF8A 2N9BA 1KYOH 2W9PA 1KC84 2W9QA 5AW9B 4K1UA 2C9LY 1SQQK 3T8NA 3NFQA 3WUVA 2G8YA 1DMQA 1B2UA 1KTMA 1KV4A 3NQYA 1RF1B 3PS8A 3V99A 1RE3A 1NU3A 1D7MA 3VP9A 5CJ4A 3P8CD 1BE3E 3BNBA 3KYQA 1GOYA 3GF3A 1M1XB 1YQ4C 2WTYA 1CYVA 5CMZA 1PU4A 4HM5B 5APYA 1KILB 3HE5B 1W6YA 1WMKA 1M1K4 3BLZA 3EHCA 2P1JA 4H44D 5APTA 4NPDA 5KLVJ 2Z6BA 3PHLA 1RF1A 2C11A 1IZNB 3HE4A 1M57D 1GOUA 5IG5A 2PNCA 2KLVA 4U3FD 4HM1B 3SYUA 1LWUB 1NTMG 3CCUP 2D2CD 2RKLA 1AV4A 1BCCJ 1YNVX 4IFFA 1X9VA 3L72D 2XFTA 3JUMA 1SLQA 4GHOA 3VMAA 3G8ZA 1SS1A 1M7LA 3NM7A 1IK7A 2N1TC 3HD7B 1FZUA 2G3AA 3MIWA 3N7NA 3BU4A 3WUTA 1SQVJ 1H0TA 1J1DC 2QJPC 1FGRA 2JEEA 1WQLB 4EXRA 3CCQP 1YGEA 4HJGH 2C0XA 2F5WA 3H3HA 5H2FE 2FXMA 2L1SA 2ZYGA 1B20A 1GY7A 4QWTA 1NTKJ 3JCUE 4BTWA 4J8TA 3SFDC 5KLVK 1GK4A 5D82A 2O1KA 3WA2X 3MG2A 2FYUG 2YNYA 3L0RA 4BIRA 3MPHA 1Q7YQ 2W8ZA 1D6ZA 1JCDA 3FWLA 5KLIC 4N6LA 1N8QA 1VPCA 2Q3IA 5M19A 4PV1D 5D81A 3AE3C 1TUHA 2XH9A 3X40A 5B5EE 1RE3C 3X3ZA 4Y99C 1UI8A 4PD4I 1G2CB 1B27A 1SPUA 4JQ0D 2O3OA 3CCQ3 3KN4A 4WY4C 2E75D 3RK3B 1W2BO 4K90B 1LT1A 3UB1A 2ZYDA 3HUSA 3A2AA 1I2GA 1S5LH 2KF3A 2BASA 5AW7B 1DH3A 2WPVB 3N4XA 5CHXA 2AEMA 2V4HA 3Q5PA 1RE4A 5AIHA 2OCTA 1K9M4 1URQD 1NU1J 1JM0A 2OGUA 3BASA 2Q07A 1GY5A 1NTZD 3JSVC 1H0TB 1LOXA 1MWUA 5AVVB 1BUJA 4H0LC 1USDA 1NAFA 1RQVA 3V2QA 3ZFZA 2FY8A 3C9IA 1VQ73 2FGTA 1LRAA 4STDA 3H1IJ 1KQS2 3AEAC 2BMQB 1K05A 1LGHB 5AI1A 2YXRB 1SQPD 1BNFA 4H3UA 4TT3H 2P10A 1MFTA 3AEGC 1O7MB 5M1AA 1OW8A 3V6IA 3DGOA 2CX0A 5GTIH 3A5EA 1NH4A 3EE1A 4PV1C 3JUOA 2ZYAA 3WUUA 1O7PB 1VQN3 1L0LK 3CPOA 5BVZA 2KB7P 4W7YA 1LTJB 2R32A 1ZR4A 3T97B 2IUKA 3AE4C 4H0LD 1BRIA 1ZV8A 2WQYC 5AW5B 1LNIA 4FCJA 1RNBA 2KNCB 1G96A 2W83C 3L36A 7RNTA 4Z1MH 2YFJB 1QVGO 2WSCJ 1W00A 2I1JA 3O8YA 1JKGA 1BNGA 2JWDA 1PFPA 1Q864 4EV2A 8CHOA 5B66E 1RGFA 2N1TA 3L70J 1RNTA 1KWIA 4RNYA 3CCL3 3AEFC 2YO2A 2F56A 1T2HA 3FKAA 5AVYB 3A5TA 2OQQA 2YFIB 1MGWA 3S27A 3B8EB 4ZMDA 2W56B 3MUDC 1AVKA 1OHPA 1E79H 1FS0E 1GL2D 1SQBD 1SQXJ 2J5UA 3KXDA 4JF8A 3L74E 1U7MA 4OGQB 3FWNA 1RF1C 4HJLB 1EA2A 3LH4A 1UCIA 3ITKA 2OYIA 3HIIA 2KUBA 3K0ZA 4HZBB 2SARA 3NTNA 2GBWB 3U1AA 1QMAA 2LXBA 2ZDJA 1GMJA 1K04A 3SVAA 3CME3 3PRJA 3D70A 2L91A 3ER7A 2CIUA 3PH0A 3VOPA 3UJMA 1RGAA 2MJZA 1EUIC 2JKVA 3AEDC 4L8PA 4R1KA 2KCDA 1SVFA 1YIJP 3TGUJ 1BGSA 1JY2P 1YTZI 3RBZA 1B21A 1OACA 3WDGB 2BIRA 1BNRA 3ABVC 4HH2A 1LTAC 3OW22 3P32A 1AFOA 2ZT9B 3DGNA 3MD0A 1BSNA 1UUVB 1B2SA 1NWQA 1FW7A 4D6TD 1CEWI 3DMCA 4HYZA 2Y74A 4BL3A 3BNEA 5KAFE 4L74A 1VQ43 1ZN5A 1N5HA 3GHGC 3AHWA 3K5TA 4AEQA 2HMNB 3PP5A 2WSSH 4L73A 5G2GA 2ML5A 1A67A 4DCKA 3H1IG 2WZ7A 2KXGA 3H1LE 2JQ5A 4AQRD 1YHQP 2NZ2A 3GF7A 3B71A 1FUSA 1NB5I 3NBJA 1LQGC 3VMYA 5TJHA 1ZMEC 2Z5HA 1KILE 3F7SA 1VQNP 1KQGB 1YI2P 1Q814 2OYHC 3HOHA 1BSEA 2N9YB 5AVWB 1X0TA 5DJUB 3A0BH 3L70E 4R4MA 1Q7HA 5KLIB 3H1LJ 1T5YA 2Y73A 3CWBD 1SQXE 2QEX3 1BRJA 1DX7A 1QEXA 1N7SC 1CQSA 1L2PA 1M8OB 1H89A 2P7JA 4N78E 1Y8AA 3H1HG 2KYVA 2W56A 1JO5A 3CCJP 1SQBE 3AMOA 1WMNA 4EC6A 4J9AA 1L0ND 1F8NA 4WYKA 1MWTA 1HVVA 5HGRA 1YJ9P 1S9KD 3A0BE 2FXTA 5KP1A 4R80A 5KJ7A 4N6TA 2CFKA 1A02J 4NPFX 3USSA 4BRYA 2AEFA 3I5CA 1KZUB 2C4BA 3LT9A 1N8R4 4Q53A 4DKIA 1S5LX 1VDFA 2WSEJ 1NYHA 1SQBJ 3CPWO 1ZRTD 1TFKA 5HOHA 3CPW2 2HPCA 2A45I 2CFGA 2RBIA 1BSHA 3WMDA 3H1KD 2FYNB 3H6PA 1FZAA 3L75J 5AVZB 2AEJA 3RK2C 2Z77A 7STDA 3DY5A 5IG4A 2YXQB 2XFSA 1RCKA 5IEPA 1A2VA 5E79H 1VQ9P 1ROAA 1VQ8P 1USEA 4WBAA 2W90A 3MYTA 3WHOA 1HBWA 2E74D 1YIJ3 3OAKA 3SXXA 1HUCA 3R4YA 3EJVA 2IMJA 2YMKA 1YYCA 1LT9C 2B89A 5AVUB 4N6NB 3I0YA 2V7QJ 1QVG2 5GTHH 3GSPA 2KXPB 3HI7A 3WU2E 4HKVB 2P38A 2OOVA 3LTCA 1R4YA 3G4S3 2AXTE 3SOAA 1Y47A 1SQBK 1YGWA 5APXA 1LQMB 4FMBA 4LC1A 1JOCA 2K0MA 1YTZT 2LKMA 4X2OA 3F89A 1BVIA 1NJIQ 2GUSA 2O01H 5JPUA 2FFDB 1OW6A 3S28A 2KNCA 1IFJA 1IVXA 1BE3J 4FCZA 1N86A 3BCCD 1FE6A 3BNDA 3E1RA 2D2CB 1MZ9A 2NPSA 1YJN3 1LP1A 3PJSK 3H25A 4HBRA 1IO4A 4NHFA 2W27A 2FFDC 3RGUA 3CX5D 4XA4A 1IYYA 1NWWA 3GRDA 4IFMA 2KOGA 1M1JC 4XDVA 4JYCA 1M1KQ 3LIEA 1R5SA 1G02A 4UB6H 1IFPA 1OW7A 3L35A 1I0XA 5AIFA 1BSCA 4WWIA 3BRTB 1WRGA 3TSIA 5CXOA 4OGQD 4EI2A 4K3AA 1AVLA 1IVWA 5DJTB 3FX0A 3JVCA 3OXAA 2D1WA 4EOTA 2ZHXB 3L37A 5APVA 2QM7A 1ZP0C 5CK6A 2K9YA 1N7SA 3VP8A 1AQZA 2K88A 4KT0J 2CFDA 1NO3A 3UL5A 2XNXA 3L75E 1VQ5P 3OA7A 1L0NJ 4I4KA 3L70G 1FA3A 3D5GA 1LXEA 2BT3A 3WR2A 2A06D 1WNHA 3A0HE 1SP4A 2JP3A 2HPCB 1H8AA 5AYSC 3M0DC 2FXOA 3G3ZA 4DJGA 2WO0A 3FSDA 1D6UA 1RMSA 2GU1A 4R9LA 3CMEP 2DW3A 4R9KA 6STDA 1KD14 1JN5B 1TU3F 1PGJA 2I9WA 1OCVA 3L72E 2J59M 2HFED 3RK3E 2N1TB 1RN4A 1PP9D 3A0HH 3HIGA 5GTIE 1JZDA 3VMXA 1RJOA 1KQLA 1PL5A 3EFFK 1HKXA 1BRNL 2ZL8A 2A06E 1DMMA 1OGXA 2IBZE 2IFNA 5AIGA 3CCRP 3LXUX 4U7JA 1L0LD 5JBSA 4GT1A 3D6YA 1JB5A 1LTJA 1ASKA 3PGBA 2I1KA 1OF5A 5KP3A 2WGOA 1BUQA 1JY3O 4FMAA 2NPSB 4KHXA 3MGNA 2GU3A 1C54A 2BCCG 2XGLA 3FF0A 5EEOA 1BSAA 2ZT9D 1T8ZA 3KCHA 5KJ7D 5KLVD 3UL6A 2IY2A 2WWWA 2XV5A 3F5HA 1EDIA 5AYRB 1OFCX 3ROBA 4KVHA 3OX9A 4GDOA 1LT9A 1FDMA 1AY7A 1ZXGA 4L7KA 3O6QA 1NNVA 4OUQA 2PZVA 3B7CA 2BHMA 2MKVA 3BCCE 3L74G 3RL0B 2M8RA 4TLFA 3MKIA 1GU5A 3SEDA 3K63A 3AE9C 3H32A 1T2KD 1FZFA 1YIT3 3KDPB 2LQVA 2Q3EA 2FYUJ 1SQVD 3X3YA 4PJ0E 2SPZA 4ILFA 4MEIA 1S2EA 5RNTA 2AXTH 2QEXP 1NTMK 4W7ZA 5TISE 3L75G 3F7XA 2IBZD 4IPBA 3FZWA 4HM3B 4H0LB 1IQYA 4HM8B 2XF3A 2B9BA 3S67A 4I5QA 2OWPA 1BOXA 2W6BA 6GSPA 3I56P 2R44A 1ZGXA 3ZDMA 3TDKA 4K61A 2IYJA 3PCSA 3IAOA 5CF2A 3TK1A 2CG0A 3T0UA 1T6AA 1VF5B 1BGYE 2HOHA 1RY3A 3FF2A 3EBTA 1E3VA 5D83A 3IMAB 2Q7CA 1QL1A 1JY2N 1VQKP 1M904 1L4AD 1NTKG 2UX0A 1A2KA 2H43A 3PYJA 1R5LA 1DMNA 4U3FJ 1VQ63 4NPEA 1IK3A 1ZRTE 3L74J 3CC23 3H1KJ 4RBNA 1SQPJ 1NU1G 1BCCG 2P67A 3H1JD 3L73D 1RN7A 1N7LA 2RNTA 1NTZK 3D4AA 1KFMA 3B4SA 3CNXA 1PPJG 2H88C 5CBNA 1O7WB 1WT6A 3LYGA 3RK3D 3IJEB 1RE4C 2MC8A 2FYNC 2GSPA 3LMLA 4N3VA 4WYKB 1SFCA 3AEEC 3RBXA 2WOHA 3NXSA 5DRVA 4WY4A 1URQC 2FBWC 1MV8A 3HUSC 3U59A 1NAYA 1VQMP 5EFWB 1CW5A 2P0MA 1W2B2 2JWAA 1AQ5A 3VTPC 3HD7C 5KAFH 2FNQA 1UCKA 1SQXD 1GL2C 1GU4A 5APUA 3CXHE 2BCCE 3VSYA 2FYUE 1LNHA 1JTHA 5LC6A 1L0NK 3RGAA 1L4AA 3R2PA 1SQQG 1ULJB 3E1IA 1NKZB 3G6E3 3DGLA 3W67A 3CCU3 1IDPA 2E2UA 1ZLLA 2IZ0A 1YVBI 3M0AA 4RZMA 4MMXB 1BRSA 1T2IA 3IPTA 1VQO3 4LZIA 1FU1A 2BO9B 4BTXA 4ZKPA 3HD7D 2XDJA 3TGUG 3KZIH 3GHGB 1UI7A 3AGOA 4O8SA 3CC43 1DD4A 1U5OA 1DEEG 1SQXK 2YFLB 3G4SP 4XFJA 1J1EB 3L71D 2YKQA 3NBBA 2Y0CA 4HM4B 3FXEA 1KQFB 5CCGA 4WP5A 5CJ0A 1V58A 4D6TJ 5K5GB 1M1JB 1VF5D 1G1IA 3C1LA 4OVMA 1W6GA 1BSBA 1V74A 3AE7C 1STDA 2QIWA 3LOYA 3SWYA 1B2XA 1J1EC 2B1XB 3VN0A 2H8PD 2XU6A 4RO0A 4GOFA 1TRPA 1I8VA 2IUJA 3P8MC 4U13A 1P84H 1X1WA 1CI6A 2HG5D 3CLQA 2XNDH 5H2FH 2RN0A 3D3LA 1ISKA 3FG3A 2R3SA 5IG0A 1LNQA 4FMCA 3RGRA 4MJDA 1NJI4 2IYPA 1TFOA 2C0WA 4ASVA 2BEQD 1NVOA 1VQ6P 4M3LA 3EQQB 5ELUA 2QA43 3H1IE 3CMA3 2GUVA 1Q7Y4 1NTMD 1OZHA 3L72G 1KB9E 2QJYC 1BRKA 4PV1B 1SFCC 1KSIA 2OTLP 1RH5B 1RQUA 4KZ1A 3Q1MA 1ZO2A 1LTJC 2XR8B 1EKMA 2GA1A 3MZWB 2PFXA 3GAXA 3LW5H 4WY4B 1MWSA 1T3BA 4OVNF 3JUQA 1SFCB 3BRVB 1I70A 3WOEB 3KE7A 2WSFJ 1KILC 1MOLA 4AYCA 2E5TA 2QGUA 3CXHD 4UB8E 1NGMB 3AE8C 2A45H 1IQXA 2Z5IA 1VQLP 5IEOA 1X22A 5KKZC 1JB4A 2R41A 1FDIA 1KMIZ 1LTIC 3AE6C 4HYTB 3N54B 3V2RA 3H1LD 1OUNA 5STDA 4H13B 5ELJA 3X41A 1EZVG 3ZG5A 4LYLB 2H0GA 3NQZA 3MHEA 2I8DA 5BU8B 2F99A 3SLUA 4NREA 4BU4A 4L76A 1YHQ3 1N2DC 4D6TE 1IV7A 1W01A 1RDSA 1FDOA 1S5LE 3Q2PA 4KJMA 1S4XA 3KSED 1IV9A 1L4AB 1GD4A 1Y9BA 1M56D 4DT0A 2B88A 2JJLA 1PFIA 4EBGA 1HJ0A 1DE3A 4N3YB 3LT8A 3WMM0 2CWTA 3KZIE 3L72J 1B3SA 1DD3A 3H32B 3V5BA 4MN4C 1IQ8A 2JO1A 4DZOA 1N9JA 1P84D 1GMQA 2IYOA 3I563 1RHZB 1GDTA 2FXPA 1BGYG 3DZLA 1W2ZA 2QRXA 2WVRA 1MGRA 2CG1A 3IFMA 1B2ZA 2PP6A 5I97A 2HYNA 3CCJ3 1RSNA 4J5KA 2F86B 1EZVE 1SQVK 3LTDA 3OWSA 2Y0DA 3WODG 2IBZI 2STDA 2FFDA 1SQPG 3F8XA 1CH0A 2W6AA 3CC2P 1EQ7A 4CCVA 3C8VA 1GOVA 1LTBC 4GL6A 4HM6B 4GKGA 4LSOA 1A02F 1PGQA 3PCRA 2R5BA 1UCLA 1US1A 2KS1A 1NU1E 1X8YA 1X79B 1N73C 2FYZA 4OK0A 2F5MA 2W2CA 3ZG0A 1BE3G 3LTBA 1Q824 1OWAA 3BB9A 2B87A 3BIRA 1OVRA 3I553 2Y9ZA 4XM4A 1JBSA 1FZBA 3L73J 1NKNA 2M5AB 1H88A 1RTUA 2H7HA 2VRSA 3CCE3 1ZS7A 2KZJA 2E74C 1Z56A 2Q6QA 2XSHB 2OYOA 3EBYA 1I3IA 1Q82Q 1SQPK 2QG4A 1ROVA 2K9JA 1QLED 1GS3A 1UIIA 2P0XA 1BDDA 3BCCJ 1VQK3 3RK2D 2E43A 1HGVA 3CC73 2ZVOB 4CPKA 4O9BA 7GSPA 2Z7AA 4A7PA 5BU5A 4LGQA 3STDA 2AXCA 3G6EP 4WWUC 4GODA 1HH0A 1URQB 3A3YB 3JUPA 5CCHD 2V7QH 4WY4D 1BNEA 2CHCA 4Y99B 3ECFA 1SQBG 1GSPA 1SFCD 3G9RA 1N73B 3TYYA 2P09A 3NXJA 4U3FE 3DXOA 3FGYA 3K9MC 1FAVA 1OMIA 1NB3I 1Q90D 3PLNA 3PTZA 5CF1A 2QVAA 2YMYA 1TRQA 2QSIA 3GZRA 4RJTA 2WSCH 3CCSP 5AEWB 1VZZA 2M0BA 3FLJA 3AMOB 3G0KA 5APWA 1AQTA 2ITAA 1ZOYC 1S1CX 3FG1A 4AKZA 4C46A 1FGQA 4BL2A 3ALAA 2GM4A 1NOHA 2E76D 2OYHB 4OWFA 1SQWA 3A7OA 1BNSA 1IT7A 4DOJA 1N5PA 2OQEC 9RNTA 4Y28J 4GIFA 1EG9B 4W80A 1FZCA 2FYUK 2RFRA 3M0DA 1Q40B 1HTLC 4D6TG 1FZGA 1HZ1A 1A90A 1EEJA 2IZ1A 3WU2H 1IFIA 1L0LJ 1J1DB 2QJPB 2QJKB 1OPYA 5BIRA 3L73E 3O6QB 5CCHC 1EQKA 2KIKA 1LT9B 4ZKUA 2HODA 4ORLA 1S723 1GZLA 1OVVA 1S72P 3O8ZA 2W03A 2HODB 2RGQA 1KN7A 1W5CE 1JY3N 2NPSD 3CXHH 3OW2O 1RGHA 2QA4P 2YX9A 1N8RQ 1W7CA 8RNTA 3HTKB 3TNUB 1VQQA 3TNUA 4U3FG 4JRFA 4MMYB 4O02B 1VQOP 3UNLA 1JTHB 2SBLA 4N6OB 1AV1A 3CWBG 3LIDA 3MHVA 2KF6A 3I55P 2R3CA 1YJWP 2BEZF 1QAKA 1OHSA 3PXMA 5AEUB 3CCR3 2UWJE 2BMRB 4IL6E 1WTHA 3Q90A 1JV2B 2LYXA 1VQ7P 1QJGA 2CKFB 3J7Yd 1EDLA 4UB6E 6RNTA 2UGIA 1L0NG 1IJDB 2QE7H 2XEPA 2KSEA 3JCUH 2A45G 1FUTA 1GD3A 3SOYA 1R4CA 3MUDA 1OGZA 4H44B 4KT3B 1VQM3 1FZCB 3V98A 1EXIA 5GTHE 1P84I 3GG2A 1YQ3C 2JDIH 1HYFA 1MUUA 2CFLA 1RGEA 1N73A 4B86A 2FYUD 1JY3P 3F9SA 3DH2A 1JNMA 2KLUA 2KF5A 3B5NA 3BNCA 2C10A 4XBTA 2ZXXA 3H1KG 1NTKE 2CPSA 3CCM3 1SARA 3MWZA 3V2NA 1KC8Q 1CZQA 2K54A 4O2HA 5BXQA 1PP9E 4KFDA 5KJ7C 1QAFA 1UGIA 2WGQA 1JJ22 1UIXA 1NTKK 4GSPA 1BU4A 3RL0C 1BGYJ 2FKWB 1M9GA 1W02A 4MMZB 1OH0A 4I1LA 2KRTA 2BNGA 3GZBA 1BAOA 1K8A4 1RF0A 4HM2B 3H1KE 3CCV3 3AE1C 3H1JJ 4H61A 3Q3FA 2KI7B 4I7ZB 4N6MA 5APSA 1NTZG 1T2KC 1VQ4P 2Z76A 2XKMA 1KQSO 4I2LC 1R8EA 2KP8A 1FGTA 1RCLA 1WMOA 1FOSF 1ZR2A 2RSXA 2KZIA 2CK3H 3AEBC 1VQL3 1XTCC 1VQP3 3JC22 3SWKA 1SQQE 1LWUC 4JPZB 1N7SD 2H89C 3L4FA 1RRHA 3UIAA 1ZW0A 2OQEA 3BCCG 1QX8A 4FMDA 4WFOA 3CD6P 1BIRA 1Q40A 2ML6A 2M7OA 3KZTA 1NTME 1BNJA 3FXDA 3HTKA 1GMPA 1PY3A 3AE5C 5FGOA 3N9HA 3HD7A 2E5YA 2HMJB 3A76A 1RKYA 3RNTA 2OTL3 4YXDC 3TGUE 2F98A 3Q3DA 1SQQJ 2OYHA 1DVCA 3GLMA 3K7CA 3CWBE 1YJW3 3M06A 1HJBA 3DGYA 3K5BA 2ZJSE 3EN1B 3D9RA 5L8RJ 2O01N 2W6JH 1GMRA 1G2CA 1LOWA 1IU7A 3DUKA 4UB8H 3CI9A 4IT7A 3HZPA 1B2MA 1CSBA 3D79A 5BU4A 2A06G 2YKOA 1SQVE 1AVYA 1JBTA 2WPQA 4IIAA 2INXA 5AW2B 2C9NY 3CL3D 2D2CC 4ZM8A 5AW4B 3EQ2A 4PJ0H 1J2BA 3GZYB 4JF7A 2OYIC 3VMZA 2OARA 2R5DA 1I0VA 1FYSA 3MSOA 1JMBA 4HB1A 2P2UA 1KFNA 4HZ9B 1S3JA 1BDCA 3H1HE 1UGHI 2OYIB 3SFEC 1AA0A 3CC4P 2HMKB 2WT7B 3L71J 5C39A 3SSUA 2D42A 1KYOD 1MWRA 1TJDA 2E75C 1VQ93 4CDLA 4IOIH 1L0LE 4IL6H 4OH8B 2GEYA 3NHXA 1PV3A 1T3UA 5M18A 1AJYA 5APQA 1VQ83 3QRDA 3NV0B 2N1TD 2CH9A 4ASWA 3E99A 2CW9A 4EV5A 3SWFA 5G1LA 1NTMJ 2K9JB 4PD4D 1RN1A 1O7NB 3M9HA 2IPPA 1N7SB 1UDII 4C7RA 2K3DA 4XB5A 2K3RA 1LTTC 2CC3A 1KB9D 2HLOA 5KLVG 4RKUJ 3X42A 1Q9EA 4YTPC 2P05A 2XZRA 1IFDA 1JNQA 1Q42A 1U8CB 3H1ID 3V2PA 5IW9A 5TGNA 5CBOA 3KSPA 1A2PA 3FGAD 3G71P 3T97A 5BVBA 3M9QA 1L4AC 4PD4E 3NUVA 1RGLA 5EQLA 4KFFA 1HWTC 1FJKA 1IFMA 1VF5C 2CFWA 1EC5A 4KFEA 2POHA 1JZOA 3S5CA 3F40A 2MF7A 3LZAA 5AVTB 1QVFO 1U57A 1OIPA 3FCSB 4K1VA 1W2EA 3V4QA 1BRHA 2XRXB 1S9KE 2KF4A 1CI6B 1LTGC 1Y4KA 2RMZA 5CCGD 3GZXB 1NHLA 3V4WA 1SIHA 4RESB 3H1HD 2IBZG 3CC7P 3AHSA 4YPCA 3CCLP 5IF6A 5KTBA 1VQ53 3L71E 3EWKA 4ZNCA 1RGGA 4G1MB 1EXJA 1HF9A 3P7KA 3M8CA 2KAAA 2O9UX 1V57A 1PPJE 3CX5E 3S1KA 1PZQA 1SJWA 3EB8A 2IDBA 1K41A 1P84E 2NRGA 1EZVI 1FZCC 1S5AA 5AVSB 3CU3A 3N8BA 1NTZJ 1JRQA 3LW5J 3OWYA 3E7KA 2XGNA 1MNLA 1BCCE 1UW1A 4H44C 1FC2C 1IFNA 1OX3A 3B5NB 3SX1A 2E74B 5M1BA 4IFDK 3CCMP 3NX0A 3KFQC 1I3FA 3S4RA 2M3EA 5KAIH 1LP1B 4EYCA 2ZT9C 3WA3A 2F4YA 1YVSA 1K8AQ 1NU1D 3H1JG 2O3JA 3L73G 3M9BA 1UCJA 2GBXB 2YIUB 2Q9IA 3T8UA 3KQGA 4HOHA 1PPJD 3CXHI 1FJPA 2A15A 2BU4A 3MP7B 3OV4A 3Q2YA 2WSEH 5A0OB 1RF0C 3EC9A 1K734 3WOFB 2BCCJ 4LEHA 3URPA 5KLVE 1PYLA 3IR9A 5KAIE 1FUWA 1JUNA 4EW5A 1K28A 3BVHA 4K35A 4RNZA 2WSFH 1Q86Q 3HE5A 1PIXA 3V92A 5AVRB 1TTOA 4BTYA 4I7ZC
chains in the Genus database with same CATH topology
2OOVC 4K90B 5AYRB 3UB1A 3S29A 3ROBA 3ALAA 4KVHA 3OX9A 3G713 1SQWA 5EVHA 1SIIA 1W5ZA 1IT7A 4L7KA 4OUQA 1N5PA 5DREA 2PZVA 3B7CA 1AR0A 2BHMA 2OQEC 2WOFA 3JUNA 5AIHA 1EG9B 2OCTA 1K9M4 4TLFA 2RFRA 3MKIA 1YI23 2Q07A 1Q40B 3SEDA 1GY5A 3K63A 1YIT3 5JPPA 1JN5A 1A90A 2LQVA 1LOXA 3X3YA 1IVVA 1Z1SA 5LC7A 1QVF2 1VQ73 2FGTA 4STDA 1OPYA 4O3VA 1KQS2 4MEIA 1EQKA 2BMQB 4ORLA 5AI1A 1S723 3MG3A 1GY6A 2W03A 4H3UA 2RGQA 1E3RA 1YJ93 2W0QA 3F7XA 2YX9A 4IPBA 3FZWA 4HM3B 1O7MB 1W7CA 1IQYA 4HM8B 2XF3A 3DGOA 3EE1A 3JUOA 1O7PB 3S67A 1VQN3 2OWPA 3CPOA 4AKYA 4JRFA 4MMYB 4O02B 4WHAA 3UNLA 3KKGA 3NV0A 4K61A 4XBXA 2IUKA 3VF1A 3PCSA 5CF2A 2CG0A 2SBLA 4FCJA 4N6OB 3T0UA 4X2HA 3G16A 1G96A 1QAKA 1OHSA 3FF2A 3PXMA 5AEUB 2YFJB 3CCR3 1CYUA 3EBTA 3B4PA 1W00A 1E3VA 3O8YA 5D83A 3IMAB 3CXC2 1JKGA 2BMRB 1M904 1JB2A 1PFPA 1WTHA 2GEXA 1Q864 1W6CA 3U97A 3Q90A 1JV2B 2LYXA 2UX0A 4FCMA 1A2KA 1IT8A 4EV2A 1QJGA 2CKFB 3PYJA 8CHOA 3J7Yd 2RCDA 3CCL3 1KWIA 4FR9A 4RNYA 4XBYA 5IERA 1DMNA 2QE7H 2XEPA 3QK9A 1VQ63 5IG3A 4AKZA 3HK4A 1GD3A 3B4OA 3SOYA 1IK3A 1R4CA 1OGZA 3FKAA 4RBNA 3CC23 1VQM3 3V98A 2YFIB 3S27A 3KIIA 1RN7A 2JDIH 2W56B 1AVKA 3CNXA 1OHPA 1E79H 2CFLA 1LVNA 1UUWB 1FS0E 4JF8A 3CNMA 1O7WB 3DGMA 1FGMA 2BMOB 3RDEA 3F9SA 3LYGA 4HJLB 1EA2A 3IJEB 3LH4A 2MC8A 3LMLA 4N3VA 4WYKB 3HIIA 4WVZA 2WOHA 3K0ZA 1W4NA 4HZBB 4HM7B 5DRVA 3BNCA 2C10A 2GBWB 4XBTA 1QMAA 3CCM3 2ZDJA 3MWZA 3SVAA 3CME3 1W2B2 1JKGB 2P0MA 2K54A 4O2HA 5BXQA 4KFDA 2QIYA 3H51A 3ER7A 1QAFA 2WGQA 2CIUA 2FNQA 2CWVA 1JJ22 1D6YA 1HU9A 3UJMA 4PEJA 1GYBA 4L8PA 4R1KA 3F14A 2KCDA 3VSYA 1LNHA 5LC6A 1M9GA 3RGAA 1ZX2A 1W02A 4MMZB 1OACA 1OH0A 2KRTA 2BNGA 3GZBA 1ULJB 1K8A4 4HM2B 3WDGB 3G6E3 1QALA 3DGLA 3CCU3 1IDPA 2E2UA 3CCV3 3OW22 1FGOA 3DGNA 4H61A 4TX4A 1BSNA 1UUVB 3FH1A 1YVBI 3GWRA 4N6MA 4QMAA 1N9EA 4RZMA 1CEWI 3CCS3 3DMCA 2Z76A 2Y74A 4HYZA 4MMXB 3BNEA 1VQ43 3IPTA 1VQO3 1N5HA 4LZIA 2BO9B 3K5TA 4AEQA 1TP6A 1FGTA 4BTXA 2HMNB 2WSSH 1WMOA 2RSXA 1RRLA 5G2GA 2CK3H 1VQL3 1TIJA 1L5GB 1VQP3 1UI7A 5IENA 2ML5A 1A67A 2KXGA 4O8SA 3CC43 2JQ5A 1U5OA 3NBRA 2XSOB 2OTJ3 2YFLB 3NM2A 1WMPA 4HM0B 1RRHA 2HMOB 3X3XA 4HM4B 3NBBA 2OQEA 4WP5A 3DM8A 1NB5I 4FMDA 3NBJA 4WFOA 2GXFA 1ULIB 1TU5A 1Q40A 2ML6A 2M7OA 3F7SA 3KZTA 4L8OA 4OVMA 1W6GA 1V74A 1Q814 3LOYA 1STDA 5FGOA 3N9HA 2E5YA 2B1XB 2HMJB 3A76A 1STFI 1RKYA 4GB5A 2OTL3 5CLKA 2F98A 1T5YA 2Y73A 4LMIA 1DVCA 2IUJA 4U13A 3K7CA 2QEX3 1YJW3 2XNDH 1JEKA 1CQSA 3D3LA 1ISKA 2CWUA 3FG3A 3EN1B 2W56A 3D9RA 5IG0A 2V1LA 1DVDA 2W6JH 4FMCA 3RGRA 3AMOA 1WMNA 1IU7A 3DUKA 4EC6A 4J9AA 4MJDA 1NJI4 3CD63 4IT7A 1F8NA 4WYKA 3HZPA 2B24B 3VGNA 1TFOA 4N6V0 5HGRA 3CCQ3 3EQQB 5ELUA 2FXTA 5KP1A 4HVNA 4R80A 2QA43 4N6TA 5AIIA 3CMA3 2CFKA 3USSA 4IIAA 1Q7Y4 2INXA 3LT9A 4ZM8A 3EN8A 1N8R4 2IA7A 4Q53A 1J2BA 3U1WA 3GZYB 1IVUA 1KSIA 5KP4A 4KZ1A 3MSOA 1TFKA 1ZO2A 2XR8B 3CPW2 1EKMA 4HZ9B 3FG4A 3Q1CA 3GAXA 2CFGA 1BSHA 3WMDA 3F8HA 3JUQA 4XDWA 2HMLB 2W04A 3WOEB 3KE7A 2HMKB 3PZWA 2E2VA 2L4VA 2E2TA 1O7HB 4YXWH 1MOLA 2E5TA 2Z77A 2D42A 2QGUA 7STDA 1O7GB 1NDOB 1DYUA 3DY5A 3MG1A 5IG4A 3TDGA 2XFSA 1IQXA 5IEPA 1A2VA 4CDLA 1VQ93 2GEYA 3NHXA 5IEOA 1ROAA 1C7HA 1JB4A 3MYTA 1VQ83 3QRDA 3NV0B 2CH9A 3EX9A 1YIJ3 2HMMB 3N54B 3E99A 3HX8A 1OUNA 3SXXA 2CW9A 5STDA 4EV5A 5ELJA 3EJVA 2IMJA 3X41A 4R4KA 4N6NB 3I0YA 1OF5B 1QVG2 1O7NB 3NQZA 3MHEA 3HI7A 4HKVB 5FW5A 2F99A 2P38A 1OHOA 2OOVA 3SLUA 4XB5A 4NREA 3LTCA 2CC3A 3G4S3 1YHQ3 3OWUA 3SOAA 1IV7A 1W01A 3LTAA 4FMBA 4N6UA 3X42A 2K0MA 3Q2PA 4X2OA 2R4IA 2P05A 3B8LA 3KSED 1IV9A 1JNQA 1GD4A 1Q42A 1U8CB 5IW9A 5TGNA 5JPUA 3KSPA 3S28A 1IVXA 1E97A 3EF8A 4EBGA 5BVBA 3LT8A 4FCZA 2CWTA 2W9PA 1KC84 3NUVA 2W9QA 3BNDA 4K1UA 1YJN3 5EQLA 4KFFA 3PJSK 4HBRA 4NHFA 1IQ8A 1N9JA 3T8NA 2CFWA 3I563 1DMQA 4KFEA 1NWWA 3GRDA 3DZLA 3NQYA 1W2ZA 4XDVA 3S5CA 2CG1A 3F40A 2MF7A 3LZAA 3PS8A 1IFPA 5I97A 5AIFA 3V99A 3CCJ3 1NU3A 2F86B 3LTDA 5CXOA 3OWSA 3BNBA 3WODG 3FCSB 1M1XB 2STDA 1AVLA 4K1VA 1IVWA 1CYVA 3JVCA 1PU4A 2XRXB 3OXAA 4HM5B 2D1WA 1Y4KA 3F8XA 3GZXB 1SIHA 1W6YA 5CK6A 1M1K4 3BLZA 3EHCA 4CCVA 2CFDA 1NO3A 4GL6A 3UL5A 4HM6B 2Z6BA 4LSOA 5IF6A 3PCRA 2C11A 1VQ53 4G1MB 1US1A 5IG5A 2PNCA 4I4KA 3M8CA 1FA3A 1LXEA 2BT3A 2W2CA 4HM1B 1WNHA 4OK0A 2O9UX 3LTBA 1Q824 3BB9A 5AYSC 1AV4A 1SJWA 3I553 4XM4A 2XFTA 3EB8A 3JUMA 3G8ZA 1K41A 4DJGA 2WO0A 1S5AA 3CCE3 3CU3A 3FSDA 3N8BA 1D6UA 3NM7A 2GU1A 4R9LA 1JRQA 3OWYA 6STDA 4R9KA 2XSHB 1KD14 2XGNA 1JN5B 1MNLA 1WQLB 1FGRA 3EBYA 4EXRA 2I9WA 1OCVA 1UW1A 3SX1A 1ROVA 1YGEA 3HIGA 1GS3A 3NX0A 3KFQC 2P0XA 1VQK3 3H3HA 3CC73 4EYCA 2Z7AA 3WA3A 1RJOA 3EFFK 4LGQA 1HKXA 3STDA 2GBXB 4WWUC 2ZL8A 3JUPA 1GY7A 2V7QH 4QWTA 1DMMA 1OGXA 4BTWA 3T8UA 2CHCA 4J8TA 5AIGA 3ECFA 5D82A 3WA2X 3MG2A 3LXUX 3L0RA 2A15A 2P09A 3NXJA 3OV4A 3MPHA 3DXOA 3FGYA 5JBSA 3K9MC 5A0OB 1JB5A 1NB3I 1D6ZA 1ASKA 3PGBA 3EC9A 4N6LA 1N8QA 5CF1A 1K734 1OF5A 5KP3A 2WGOA 5D81A 3WOFB 1BUQA 3GZRA 4FMAA 4LEHA 1TUHA 2XH9A 3X40A 2GU3A 2XGLA 1FUWA 5AEWB 3FF0A 1K28A 5EEOA 3X3ZA 1VZZA 4RNZA 3FLJA 1UI8A 3AMOB 3UL6A 3V92A 3G0KA 1AQTA 1SPUA 4BTYA 2O3OA 3FG1A 3KN4A 1FGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5Y A;  2WSS H;  1IFP A;  2CK3 H;  2QE7 H;  1BSH A;  4WVZ A;  3USS A;  2XND H;  1BSN A;  1JEK A;  4YXW H;  2E5T A;  2JDI H;  3EFF K;  4QMA A;  4TLF A;  3PJS K;  4DJG A;  1E79 H;  2V7Q H;  1FS0 E;  1AQT A;  2W6J H; 
#chains in the Genus database with same CATH topology
 2Q1K A;  3IF4 A;  2OOV C;  1SQX G;  3B5N C;  1RGK A;  3S29 A;  2O1J A;  2L5G B;  2PAJ A;  1BNI A;  4EIJ A;  3G71 3;  5EVH A;  2NPS C;  1SII A;  1W5Z A;  4HKZ H;  1X1U A;  5AW0 B;  2B87 B;  5DRE A;  2E75 B;  3EFG A;  5CCG C;  1AR0 A;  1KB9 H;  4C7N A;  3QWO C;  2WOF A;  3JUN A;  2ZA4 A;  3NMD A;  1YI2 3;  1JY2 O;  2UUG C;  1JBR A;  5JPP A;  1JN5 A;  1IVV A;  1Z1S A;  5LC7 A;  1QVF 2;  2YKP A;  1RLS A;  1YBK A;  4O3V A;  2ZFC A;  1L0N E;  4N78 D;  1JCC A;  1KYO I;  3W68 A;  3MG3 A;  1GY6 A;  3CCE P;  4WB4 A;  1E3R A;  1YJ9 3;  1OVU A;  2OTJ P;  3CMA P;  3L71 G;  2W0Q A;  2J8X B;  1T3J A;  1GK6 A;  3QH9 A;  1DIP A;  2K37 A;  3AE2 C;  3L70 D;  4AKY A;  4WHA A;  3KKG A;  3NV0 A;  4XBX A;  1MFZ A;  3VF1 A;  2JR8 A;  1OXZ A;  1Q2N A;  2ZXE B;  1JMM A;  3P8C E;  3KHU A;  4X2H A;  3G16 A;  1GTW A;  1J2J B;  4PD4 H;  1KB9 I;  1URQ A;  3RK2 B;  1CYU A;  1KYO E;  5E79 E;  3B4P A;  4CJN A;  5B66 H;  3CXC 2;  1JB2 A;  5AW3 B;  2GEX A;  1W6C A;  4GOE A;  3U97 A;  4FCM A;  1GW3 A;  1IT8 A;  1IK9 A;  2RCD A;  1KOR A;  4FR9 A;  3MTU E;  4XBY A;  1G0T A;  1PP9 G;  5IER A;  3VYI A;  3QK9 A;  5IG3 A;  1FBM A;  3HK4 A;  2QJY B;  3B4O A;  2IFM A;  5CCH A;  1LOV A;  1LTS C;  1FOS E;  2LXC B;  1M90 Q;  1AVO A;  1NO4 A;  4CPG A;  4LLH A;  3KII A;  3H1H J;  2IX7 C;  1GW4 A;  4OGQ C;  3RL0 D;  1QGK B;  3B5N D;  1LVN A;  1UUW B;  4RNT A;  3CNM A;  3DGM A;  1FGM A;  2BMO B;  3RDE A;  4BXL A;  1L0L G;  3BAT A;  1BSD A;  1EDJ A;  1LWU A;  1GL2 B;  4WVZ A;  1W4N A;  4HM7 B;  1IC2 A;  2BCC D;  1RHL A;  3Q5R A;  5KKZ B;  3D71 A;  1JKG B;  4LGD E;  2QIY A;  3H51 A;  5G1K A;  3RL0 g;  2J58 A;  2E42 A;  1RGC A;  4XE5 B;  2CWV A;  3U1C A;  1BRG A;  1D6Y A;  1HU9 A;  2WPS A;  2Y9Y A;  2WMM A;  2AAE A;  1GYB A;  2H0I A;  4PEJ A;  3F14 A;  3OJA B;  3S9O A;  1X1Y A;  1ZX2 A;  3RK3 C;  3H1L G;  3CWB J;  1QAL A;  3L74 D;  3AEC C;  1EZV D;  1FGO A;  1E5W A;  4TX4 A;  3FH1 A;  3GWR A;  2WT7 A;  4QMA A;  1N9E A;  3CCS 3;  1DET A;  1YIT P;  4AUW A;  3Q5S A;  2E76 B;  1PGP A;  1SQV G;  2M3B A;  1M1J A;  1BAN A;  1TP6 A;  4JBZ A;  1RRL A;  3CX5 H;  1TIJ A;  1L5G B;  5IEN A;  3II6 A;  5GSP A;  2E76 C;  3NBR A;  3D6Z A;  2XSO B;  2KK7 A;  2OTJ 3;  4L75 A;  3NM2 A;  1WMP A;  4HM0 B;  2HMO B;  1U7J A;  3L75 D;  3X3X A;  3CX5 I;  3DM8 A;  5AVX B;  2GXF A;  1ULI B;  2YIU C;  1TU5 A;  2CX1 A;  4L8O A;  2O01 J;  1JB0 J;  1BGY D;  4N6J A;  1STF I;  4GB5 A;  5CLK A;  4NPB A;  4H13 C;  4C7N B;  2PRR A;  4LMI A;  4J5G A;  2LR2 A;  4IL6 X;  2ZAE B;  1VQP P;  1JEK A;  1SQP E;  4BRY B;  1Q81 Q;  1DEB A;  2CWU A;  2V1L A;  1NTK D;  5AW6 B;  1DVD A;  1X1X A;  1LJ2 A;  4R4L A;  1XTG B;  4HAA A;  2QJK C;  3CD6 3;  2B24 B;  3VGN A;  3H1J E;  2AAD A;  1NTZ E;  2KS1 B;  4N6V 0;  1PP9 J;  2K1A A;  5AVQ B;  4HVN A;  5AII A;  1BE3 D;  1KIL D;  1K73 Q;  4JYB A;  1BCC D;  1I2E A;  5AW1 B;  1MKM A;  3EN8 A;  3M91 A;  2IA7 A;  2YO3 A;  2PGD A;  1PGO A;  2M5A A;  5AW8 B;  3U1W A;  1IVU A;  1EDK A;  5KP4 A;  2ZVN B;  1GD2 E;  3GW6 A;  4EYY Q;  3FG4 A;  3Q1C A;  2Y0E A;  3HE4 B;  2OTK E;  3F8H A;  4XDW A;  1GL2 A;  2Z4E A;  2HML B;  2W04 A;  3KPE A;  3IN6 A;  3PZW A;  2E2V A;  2L4V A;  1VL2 A;  4BWN A;  2E2T A;  3D5I A;  1O7H B;  4YXW H;  1O7G B;  1NDO B;  1K9M Q;  2P58 A;  1DYU A;  3MG1 A;  4H13 D;  3TDG A;  1HGZ A;  3CCV P;  2KSJ A;  1G1J A;  3AGN A;  3HRN A;  2CPB A;  1C7H A;  3TF5 A;  2RH0 A;  3GMA A;  3EX9 A;  2HMM B;  2HR3 A;  3HX8 A;  1SQQ D;  5B5E H;  2WIT A;  1FZE A;  4R4K A;  1YJN P;  2Q5U A;  1OF5 B;  1UUG B;  2QM8 A;  1LOY A;  5TIS H;  1I2F A;  5FW5 A;  2H0H A;  1OHO A;  4I6M C;  1KIL A;  1KD1 Q;  3OWU A;  4EDF A;  3LTA A;  1QL2 A;  4N6U A;  2R4I A;  3B8L A;  3GHG A;  3TGU D;  2WPR A;  1NU1 K;  3HUS B;  1E97 A;  3EF8 A;  2N9B A;  1KYO H;  2W9P A;  1KC8 4;  2W9Q A;  5AW9 B;  4K1U A;  2C9L Y;  1SQQ K;  3T8N A;  3NFQ A;  3WUV A;  2G8Y A;  1DMQ A;  1B2U A;  1KTM A;  1KV4 A;  3NQY A;  1RF1 B;  3PS8 A;  3V99 A;  1RE3 A;  1NU3 A;  1D7M A;  3VP9 A;  5CJ4 A;  3P8C D;  1BE3 E;  3BNB A;  3KYQ A;  1GOY A;  3GF3 A;  1M1X B;  1YQ4 C;  2WTY A;  1CYV A;  5CMZ A;  1PU4 A;  4HM5 B;  5APY A;  1KIL B;  3HE5 B;  1W6Y A;  1WMK A;  1M1K 4;  3BLZ A;  3EHC A;  2P1J A;  4H44 D;  5APT A;  4NPD A;  5KLV J;  2Z6B A;  3PHL A;  1RF1 A;  2C11 A;  1IZN B;  3HE4 A;  1M57 D;  1GOU A;  5IG5 A;  2PNC A;  2KLV A;  4U3F D;  4HM1 B;  3SYU A;  1LWU B;  1NTM G;  3CCU P;  2D2C D;  2RKL A;  1AV4 A;  1BCC J;  1YNV X;  4IFF A;  1X9V A;  3L72 D;  2XFT A;  3JUM A;  1SLQ A;  4GHO A;  3VMA A;  3G8Z A;  1SS1 A;  1M7L A;  3NM7 A;  1IK7 A;  2N1T C;  3HD7 B;  1FZU A;  2G3A A;  3MIW A;  3N7N A;  3BU4 A;  3WUT A;  1SQV J;  1H0T A;  1J1D C;  2QJP C;  1FGR A;  2JEE A;  1WQL B;  4EXR A;  3CCQ P;  1YGE A;  4HJG H;  2C0X A;  2F5W A;  3H3H A;  5H2F E;  2FXM A;  2L1S A;  2ZYG A;  1B20 A;  1GY7 A;  4QWT A;  1NTK J;  3JCU E;  4BTW A;  4J8T A;  3SFD C;  5KLV K;  1GK4 A;  5D82 A;  2O1K A;  3WA2 X;  3MG2 A;  2FYU G;  2YNY A;  3L0R A;  4BIR A;  3MPH A;  1Q7Y Q;  2W8Z A;  1D6Z A;  1JCD A;  3FWL A;  5KLI C;  4N6L A;  1N8Q A;  1VPC A;  2Q3I A;  5M19 A;  4PV1 D;  5D81 A;  3AE3 C;  1TUH A;  2XH9 A;  3X40 A;  5B5E E;  1RE3 C;  3X3Z A;  4Y99 C;  1UI8 A;  4PD4 I;  1G2C B;  1B27 A;  1SPU A;  4JQ0 D;  2O3O A;  3CCQ 3;  3KN4 A;  4WY4 C;  2E75 D;  3RK3 B;  1W2B O;  4K90 B;  1LT1 A;  3UB1 A;  2ZYD A;  3HUS A;  3A2A A;  1I2G A;  1S5L H;  2KF3 A;  2BAS A;  5AW7 B;  1DH3 A;  2WPV B;  3N4X A;  5CHX A;  2AEM A;  2V4H A;  3Q5P A;  1RE4 A;  5AIH A;  2OCT A;  1K9M 4;  1URQ D;  1NU1 J;  1JM0 A;  2OGU A;  3BAS A;  2Q07 A;  1GY5 A;  1NTZ D;  3JSV C;  1H0T B;  1LOX A;  1MWU A;  5AVV B;  1BUJ A;  4H0L C;  1USD A;  1NAF A;  1RQV A;  3V2Q A;  3ZFZ A;  2FY8 A;  3C9I A;  1VQ7 3;  2FGT A;  1LRA A;  4STD A;  3H1I J;  1KQS 2;  3AEA C;  2BMQ B;  1K05 A;  1LGH B;  5AI1 A;  2YXR B;  1SQP D;  1BNF A;  4H3U A;  4TT3 H;  2P10 A;  1MFT A;  3AEG C;  1O7M B;  5M1A A;  1OW8 A;  3V6I A;  3DGO A;  2CX0 A;  5GTI H;  3A5E A;  1NH4 A;  3EE1 A;  4PV1 C;  3JUO A;  2ZYA A;  3WUU A;  1O7P B;  1VQN 3;  1L0L K;  3CPO A;  5BVZ A;  2KB7 P;  4W7Y A;  1LTJ B;  2R32 A;  1ZR4 A;  3T97 B;  2IUK A;  3AE4 C;  4H0L D;  1BRI A;  1ZV8 A;  2WQY C;  5AW5 B;  1LNI A;  4FCJ A;  1RNB A;  2KNC B;  1G96 A;  2W83 C;  3L36 A;  7RNT A;  4Z1M H;  2YFJ B;  1QVG O;  2WSC J;  1W00 A;  2I1J A;  3O8Y A;  1JKG A;  1BNG A;  2JWD A;  1PFP A;  1Q86 4;  4EV2 A;  8CHO A;  5B66 E;  1RGF A;  2N1T A;  3L70 J;  1RNT A;  1KWI A;  4RNY A;  3CCL 3;  3AEF C;  2YO2 A;  2F56 A;  1T2H A;  3FKA A;  5AVY B;  3A5T A;  2OQQ A;  2YFI B;  1MGW A;  3S27 A;  3B8E B;  4ZMD A;  2W56 B;  3MUD C;  1AVK A;  1OHP A;  1E79 H;  1FS0 E;  1GL2 D;  1SQB D;  1SQX J;  2J5U A;  3KXD A;  4JF8 A;  3L74 E;  1U7M A;  4OGQ B;  3FWN A;  1RF1 C;  4HJL B;  1EA2 A;  3LH4 A;  1UCI A;  3ITK A;  2OYI A;  3HII A;  2KUB A;  3K0Z A;  4HZB B;  2SAR A;  3NTN A;  2GBW B;  3U1A A;  1QMA A;  2LXB A;  2ZDJ A;  1GMJ A;  1K04 A;  3SVA A;  3CME 3;  3PRJ A;  3D70 A;  2L91 A;  3ER7 A;  2CIU A;  3PH0 A;  3VOP A;  3UJM A;  1RGA A;  2MJZ A;  1EUI C;  2JKV A;  3AED C;  4L8P A;  4R1K A;  2KCD A;  1SVF A;  1YIJ P;  3TGU J;  1BGS A;  1JY2 P;  1YTZ I;  3RBZ A;  1B21 A;  1OAC A;  3WDG B;  2BIR A;  1BNR A;  3ABV C;  4HH2 A;  1LTA C;  3OW2 2;  3P32 A;  1AFO A;  2ZT9 B;  3DGN A;  3MD0 A;  1BSN A;  1UUV B;  1B2S A;  1NWQ A;  1FW7 A;  4D6T D;  1CEW I;  3DMC A;  4HYZ A;  2Y74 A;  4BL3 A;  3BNE A;  5KAF E;  4L74 A;  1VQ4 3;  1ZN5 A;  1N5H A;  3GHG C;  3AHW A;  3K5T A;  4AEQ A;  2HMN B;  3PP5 A;  2WSS H;  4L73 A;  5G2G A;  2ML5 A;  1A67 A;  4DCK A;  3H1I G;  2WZ7 A;  2KXG A;  3H1L E;  2JQ5 A;  4AQR D;  1YHQ P;  2NZ2 A;  3GF7 A;  3B71 A;  1FUS A;  1NB5 I;  3NBJ A;  1LQG C;  3VMY A;  5TJH A;  1ZME C;  2Z5H A;  1KIL E;  3F7S A;  1VQN P;  1KQG B;  1YI2 P;  1Q81 4;  2OYH C;  3HOH A;  1BSE A;  2N9Y B;  5AVW B;  1X0T A;  5DJU B;  3A0B H;  3L70 E;  4R4M A;  1Q7H A;  5KLI B;  3H1L J;  1T5Y A;  2Y73 A;  3CWB D;  1SQX E;  2QEX 3;  1BRJ A;  1DX7 A;  1QEX A;  1N7S C;  1CQS A;  1L2P A;  1M8O B;  1H89 A;  2P7J A;  4N78 E;  1Y8A A;  3H1H G;  2KYV A;  2W56 A;  1JO5 A;  3CCJ P;  1SQB E;  3AMO A;  1WMN A;  4EC6 A;  4J9A A;  1L0N D;  1F8N A;  4WYK A;  1MWT A;  1HVV A;  5HGR A;  1YJ9 P;  1S9K D;  3A0B E;  2FXT A;  5KP1 A;  4R80 A;  5KJ7 A;  4N6T A;  2CFK A;  1A02 J;  4NPF X;  3USS A;  4BRY A;  2AEF A;  3I5C A;  1KZU B;  2C4B A;  3LT9 A;  1N8R 4;  4Q53 A;  4DKI A;  1S5L X;  1VDF A;  2WSE J;  1NYH A;  1SQB J;  3CPW O;  1ZRT D;  1TFK A;  5HOH A;  3CPW 2;  2HPC A;  2A45 I;  2CFG A;  2RBI A;  1BSH A;  3WMD A;  3H1K D;  2FYN B;  3H6P A;  1FZA A;  3L75 J;  5AVZ B;  2AEJ A;  3RK2 C;  2Z77 A;  7STD A;  3DY5 A;  5IG4 A;  2YXQ B;  2XFS A;  1RCK A;  5IEP A;  1A2V A;  5E79 H;  1VQ9 P;  1ROA A;  1VQ8 P;  1USE A;  4WBA A;  2W90 A;  3MYT A;  3WHO A;  1HBW A;  2E74 D;  1YIJ 3;  3OAK A;  3SXX A;  1HUC A;  3R4Y A;  3EJV A;  2IMJ A;  2YMK A;  1YYC A;  1LT9 C;  2B89 A;  5AVU B;  4N6N B;  3I0Y A;  2V7Q J;  1QVG 2;  5GTH H;  3GSP A;  2KXP B;  3HI7 A;  3WU2 E;  4HKV B;  2P38 A;  2OOV A;  3LTC A;  1R4Y A;  3G4S 3;  2AXT E;  3SOA A;  1Y47 A;  1SQB K;  1YGW A;  5APX A;  1LQM B;  4FMB A;  4LC1 A;  1JOC A;  2K0M A;  1YTZ T;  2LKM A;  4X2O A;  3F89 A;  1BVI A;  1NJI Q;  2GUS A;  2O01 H;  5JPU A;  2FFD B;  1OW6 A;  3S28 A;  2KNC A;  1IFJ A;  1IVX A;  1BE3 J;  4FCZ A;  1N86 A;  3BCC D;  1FE6 A;  3BND A;  3E1R A;  2D2C B;  1MZ9 A;  2NPS A;  1YJN 3;  1LP1 A;  3PJS K;  3H25 A;  4HBR A;  1IO4 A;  4NHF A;  2W27 A;  2FFD C;  3RGU A;  3CX5 D;  4XA4 A;  1IYY A;  1NWW A;  3GRD A;  4IFM A;  2KOG A;  1M1J C;  4XDV A;  4JYC A;  1M1K Q;  3LIE A;  1R5S A;  1G02 A;  4UB6 H;  1IFP A;  1OW7 A;  3L35 A;  1I0X A;  5AIF A;  1BSC A;  4WWI A;  3BRT B;  1WRG A;  3TSI A;  5CXO A;  4OGQ D;  4EI2 A;  4K3A A;  1AVL A;  1IVW A;  5DJT B;  3FX0 A;  3JVC A;  3OXA A;  2D1W A;  4EOT A;  2ZHX B;  3L37 A;  5APV A;  2QM7 A;  1ZP0 C;  5CK6 A;  2K9Y A;  1N7S A;  3VP8 A;  1AQZ A;  2K88 A;  4KT0 J;  2CFD A;  1NO3 A;  3UL5 A;  2XNX A;  3L75 E;  1VQ5 P;  3OA7 A;  1L0N J;  4I4K A;  3L70 G;  1FA3 A;  3D5G A;  1LXE A;  2BT3 A;  3WR2 A;  2A06 D;  1WNH A;  3A0H E;  1SP4 A;  2JP3 A;  2HPC B;  1H8A A;  5AYS C;  3M0D C;  2FXO A;  3G3Z A;  4DJG A;  2WO0 A;  3FSD A;  1D6U A;  1RMS A;  2GU1 A;  4R9L A;  3CME P;  2DW3 A;  4R9K A;  6STD A;  1KD1 4;  1JN5 B;  1TU3 F;  1PGJ A;  2I9W A;  1OCV A;  3L72 E;  2J59 M;  2HFE D;  3RK3 E;  2N1T B;  1RN4 A;  1PP9 D;  3A0H H;  3HIG A;  5GTI E;  1JZD A;  3VMX A;  1RJO A;  1KQL A;  1PL5 A;  3EFF K;  1HKX A;  1BRN L;  2ZL8 A;  2A06 E;  1DMM A;  1OGX A;  2IBZ E;  2IFN A;  5AIG A;  3CCR P;  3LXU X;  4U7J A;  1L0L D;  5JBS A;  4GT1 A;  3D6Y A;  1JB5 A;  1LTJ A;  1ASK A;  3PGB A;  2I1K A;  1OF5 A;  5KP3 A;  2WGO A;  1BUQ A;  1JY3 O;  4FMA A;  2NPS B;  4KHX A;  3MGN A;  2GU3 A;  1C54 A;  2BCC G;  2XGL A;  3FF0 A;  5EEO A;  1BSA A;  2ZT9 D;  1T8Z A;  3KCH A;  5KJ7 D;  5KLV D;  3UL6 A;  2IY2 A;  2WWW A;  2XV5 A;  3F5H A;  1EDI A;  5AYR B;  1OFC X;  3ROB A;  4KVH A;  3OX9 A;  4GDO A;  1LT9 A;  1FDM A;  1AY7 A;  1ZXG A;  4L7K A;  3O6Q A;  1NNV A;  4OUQ A;  2PZV A;  3B7C A;  2BHM A;  2MKV A;  3BCC E;  3L74 G;  3RL0 B;  2M8R A;  4TLF A;  3MKI A;  1GU5 A;  3SED A;  3K63 A;  3AE9 C;  3H32 A;  1T2K D;  1FZF A;  1YIT 3;  3KDP B;  2LQV A;  2Q3E A;  2FYU J;  1SQV D;  3X3Y A;  4PJ0 E;  2SPZ A;  4ILF A;  4MEI A;  1S2E A;  5RNT A;  2AXT H;  2QEX P;  1NTM K;  4W7Z A;  5TIS E;  3L75 G;  3F7X A;  2IBZ D;  4IPB A;  3FZW A;  4HM3 B;  4H0L B;  1IQY A;  4HM8 B;  2XF3 A;  2B9B A;  3S67 A;  4I5Q A;  2OWP A;  1BOX A;  2W6B A;  6GSP A;  3I56 P;  2R44 A;  1ZGX A;  3ZDM A;  3TDK A;  4K61 A;  2IYJ A;  3PCS A;  3IAO A;  5CF2 A;  3TK1 A;  2CG0 A;  3T0U A;  1T6A A;  1VF5 B;  1BGY E;  2HOH A;  1RY3 A;  3FF2 A;  3EBT A;  1E3V A;  5D83 A;  3IMA B;  2Q7C A;  1QL1 A;  1JY2 N;  1VQK P;  1M90 4;  1L4A D;  1NTK G;  2UX0 A;  1A2K A;  2H43 A;  3PYJ A;  1R5L A;  1DMN A;  4U3F J;  1VQ6 3;  4NPE A;  1IK3 A;  1ZRT E;  3L74 J;  3CC2 3;  3H1K J;  4RBN A;  1SQP J;  1NU1 G;  1BCC G;  2P67 A;  3H1J D;  3L73 D;  1RN7 A;  1N7L A;  2RNT A;  1NTZ K;  3D4A A;  1KFM A;  3B4S A;  3CNX A;  1PPJ G;  2H88 C;  5CBN A;  1O7W B;  1WT6 A;  3LYG A;  3RK3 D;  3IJE B;  1RE4 C;  2MC8 A;  2FYN C;  2GSP A;  3LML A;  4N3V A;  4WYK B;  1SFC A;  3AEE C;  3RBX A;  2WOH A;  3NXS A;  5DRV A;  4WY4 A;  1URQ C;  2FBW C;  1MV8 A;  3HUS C;  3U59 A;  1NAY A;  1VQM P;  5EFW B;  1CW5 A;  2P0M A;  1W2B 2;  2JWA A;  1AQ5 A;  3VTP C;  3HD7 C;  5KAF H;  2FNQ A;  1UCK A;  1SQX D;  1GL2 C;  1GU4 A;  5APU A;  3CXH E;  2BCC E;  3VSY A;  2FYU E;  1LNH A;  1JTH A;  5LC6 A;  1L0N K;  3RGA A;  1L4A A;  3R2P A;  1SQQ G;  1ULJ B;  3E1I A;  1NKZ B;  3G6E 3;  3DGL A;  3W67 A;  3CCU 3;  1IDP A;  2E2U A;  1ZLL A;  2IZ0 A;  1YVB I;  3M0A A;  4RZM A;  4MMX B;  1BRS A;  1T2I A;  3IPT A;  1VQO 3;  4LZI A;  1FU1 A;  2BO9 B;  4BTX A;  4ZKP A;  3HD7 D;  2XDJ A;  3TGU G;  3KZI H;  3GHG B;  1UI7 A;  3AGO A;  4O8S A;  3CC4 3;  1DD4 A;  1U5O A;  1DEE G;  1SQX K;  2YFL B;  3G4S P;  4XFJ A;  1J1E B;  3L71 D;  2YKQ A;  3NBB A;  2Y0C A;  4HM4 B;  3FXE A;  1KQF B;  5CCG A;  4WP5 A;  5CJ0 A;  1V58 A;  4D6T J;  5K5G B;  1M1J B;  1VF5 D;  1G1I A;  3C1L A;  4OVM A;  1W6G A;  1BSB A;  1V74 A;  3AE7 C;  1STD A;  2QIW A;  3LOY A;  3SWY A;  1B2X A;  1J1E C;  2B1X B;  3VN0 A;  2H8P D;  2XU6 A;  4RO0 A;  4GOF A;  1TRP A;  1I8V A;  2IUJ A;  3P8M C;  4U13 A;  1P84 H;  1X1W A;  1CI6 A;  2HG5 D;  3CLQ A;  2XND H;  5H2F H;  2RN0 A;  3D3L A;  1ISK A;  3FG3 A;  2R3S A;  5IG0 A;  1LNQ A;  4FMC A;  3RGR A;  4MJD A;  1NJI 4;  2IYP A;  1TFO A;  2C0W A;  4ASV A;  2BEQ D;  1NVO A;  1VQ6 P;  4M3L A;  3EQQ B;  5ELU A;  2QA4 3;  3H1I E;  3CMA 3;  2GUV A;  1Q7Y 4;  1NTM D;  1OZH A;  3L72 G;  1KB9 E;  2QJY C;  1BRK A;  4PV1 B;  1SFC C;  1KSI A;  2OTL P;  1RH5 B;  1RQU A;  4KZ1 A;  3Q1M A;  1ZO2 A;  1LTJ C;  2XR8 B;  1EKM A;  2GA1 A;  3MZW B;  2PFX A;  3GAX A;  3LW5 H;  4WY4 B;  1MWS A;  1T3B A;  4OVN F;  3JUQ A;  1SFC B;  3BRV B;  1I70 A;  3WOE B;  3KE7 A;  2WSF J;  1KIL C;  1MOL A;  4AYC A;  2E5T A;  2QGU A;  3CXH D;  4UB8 E;  1NGM B;  3AE8 C;  2A45 H;  1IQX A;  2Z5I A;  1VQL P;  5IEO A;  1X22 A;  5KKZ C;  1JB4 A;  2R41 A;  1FDI A;  1KMI Z;  1LTI C;  3AE6 C;  4HYT B;  3N54 B;  3V2R A;  3H1L D;  1OUN A;  5STD A;  4H13 B;  5ELJ A;  3X41 A;  1EZV G;  3ZG5 A;  4LYL B;  2H0G A;  3NQZ A;  3MHE A;  2I8D A;  5BU8 B;  2F99 A;  3SLU A;  4NRE A;  4BU4 A;  4L76 A;  1YHQ 3;  1N2D C;  4D6T E;  1IV7 A;  1W01 A;  1RDS A;  1FDO A;  1S5L E;  3Q2P A;  4KJM A;  1S4X A;  3KSE D;  1IV9 A;  1L4A B;  1GD4 A;  1Y9B A;  1M56 D;  4DT0 A;  2B88 A;  2JJL A;  1PFI A;  4EBG A;  1HJ0 A;  1DE3 A;  4N3Y B;  3LT8 A;  3WMM 0;  2CWT A;  3KZI E;  3L72 J;  1B3S A;  1DD3 A;  3H32 B;  3V5B A;  4MN4 C;  1IQ8 A;  2JO1 A;  4DZO A;  1N9J A;  1P84 D;  1GMQ A;  2IYO A;  3I56 3;  1RHZ B;  1GDT A;  2FXP A;  1BGY G;  3DZL A;  1W2Z A;  2QRX A;  2WVR A;  1MGR A;  2CG1 A;  3IFM A;  1B2Z A;  2PP6 A;  5I97 A;  2HYN A;  3CCJ 3;  1RSN A;  4J5K A;  2F86 B;  1EZV E;  1SQV K;  3LTD A;  3OWS A;  2Y0D A;  3WOD G;  2IBZ I;  2STD A;  2FFD A;  1SQP G;  3F8X A;  1CH0 A;  2W6A A;  3CC2 P;  1EQ7 A;  4CCV A;  3C8V A;  1GOV A;  1LTB C;  4GL6 A;  4HM6 B;  4GKG A;  4LSO A;  1A02 F;  1PGQ A;  3PCR A;  2R5B A;  1UCL A;  1US1 A;  2KS1 A;  1NU1 E;  1X8Y A;  1X79 B;  1N73 C;  2FYZ A;  4OK0 A;  2F5M A;  2W2C A;  3ZG0 A;  1BE3 G;  3LTB A;  1Q82 4;  1OWA A;  3BB9 A;  2B87 A;  3BIR A;  1OVR A;  3I55 3;  2Y9Z A;  4XM4 A;  1JBS A;  1FZB A;  3L73 J;  1NKN A;  2M5A B;  1H88 A;  1RTU A;  2H7H A;  2VRS A;  3CCE 3;  1ZS7 A;  2KZJ A;  2E74 C;  1Z56 A;  2Q6Q A;  2XSH B;  2OYO A;  3EBY A;  1I3I A;  1Q82 Q;  1SQP K;  2QG4 A;  1ROV A;  2K9J A;  1QLE D;  1GS3 A;  1UII A;  2P0X A;  1BDD A;  3BCC J;  1VQK 3;  3RK2 D;  2E43 A;  1HGV A;  3CC7 3;  2ZVO B;  4CPK A;  4O9B A;  7GSP A;  2Z7A A;  4A7P A;  5BU5 A;  4LGQ A;  3STD A;  2AXC A;  3G6E P;  4WWU C;  4GOD A;  1HH0 A;  1URQ B;  3A3Y B;  3JUP A;  5CCH D;  2V7Q H;  4WY4 D;  1BNE A;  2CHC A;  4Y99 B;  3ECF A;  1SQB G;  1GSP A;  1SFC D;  3G9R A;  1N73 B;  3TYY A;  2P09 A;  3NXJ A;  4U3F E;  3DXO A;  3FGY A;  3K9M C;  1FAV A;  1OMI A;  1NB3 I;  1Q90 D;  3PLN A;  3PTZ A;  5CF1 A;  2QVA A;  2YMY A;  1TRQ A;  2QSI A;  3GZR A;  4RJT A;  2WSC H;  3CCS P;  5AEW B;  1VZZ A;  2M0B A;  3FLJ A;  3AMO B;  3G0K A;  5APW A;  1AQT A;  2ITA A;  1ZOY C;  1S1C X;  3FG1 A;  4AKZ A;  4C46 A;  1FGQ A;  4BL2 A;  3ALA A;  2GM4 A;  1NOH A;  2E76 D;  2OYH B;  4OWF A;  1SQW A;  3A7O A;  1BNS A;  1IT7 A;  4DOJ A;  1N5P A;  2OQE C;  9RNT A;  4Y28 J;  4GIF A;  1EG9 B;  4W80 A;  1FZC A;  2FYU K;  2RFR A;  3M0D A;  1Q40 B;  1HTL C;  4D6T G;  1FZG A;  1HZ1 A;  1A90 A;  1EEJ A;  2IZ1 A;  3WU2 H;  1IFI A;  1L0L J;  1J1D B;  2QJP B;  2QJK B;  1OPY A;  5BIR A;  3L73 E;  3O6Q B;  5CCH C;  1EQK A;  2KIK A;  1LT9 B;  4ZKU A;  2HOD A;  4ORL A;  1S72 3;  1GZL A;  1OVV A;  1S72 P;  3O8Z A;  2W03 A;  2HOD B;  2RGQ A;  1KN7 A;  1W5C E;  1JY3 N;  2NPS D;  3CXH H;  3OW2 O;  1RGH A;  2QA4 P;  2YX9 A;  1N8R Q;  1W7C A;  8RNT A;  3HTK B;  3TNU B;  1VQQ A;  3TNU A;  4U3F G;  4JRF A;  4MMY B;  4O02 B;  1VQO P;  3UNL A;  1JTH B;  2SBL A;  4N6O B;  1AV1 A;  3CWB G;  3LID A;  3MHV A;  2KF6 A;  3I55 P;  2R3C A;  1YJW P;  2BEZ F;  1QAK A;  1OHS A;  3PXM A;  5AEU B;  3CCR 3;  2UWJ E;  2BMR B;  4IL6 E;  1WTH A;  3Q90 A;  1JV2 B;  2LYX A;  1VQ7 P;  1QJG A;  2CKF B;  3J7Y d;  1EDL A;  4UB6 E;  6RNT A;  2UGI A;  1L0N G;  1IJD B;  2QE7 H;  2XEP A;  2KSE A;  3JCU H;  2A45 G;  1FUT A;  1GD3 A;  3SOY A;  1R4C A;  3MUD A;  1OGZ A;  4H44 B;  4KT3 B;  1VQM 3;  1FZC B;  3V98 A;  1EXI A;  5GTH E;  1P84 I;  3GG2 A;  1YQ3 C;  2JDI H;  1HYF A;  1MUU A;  2CFL A;  1RGE A;  1N73 A;  4B86 A;  2FYU D;  1JY3 P;  3F9S A;  3DH2 A;  1JNM A;  2KLU A;  2KF5 A;  3B5N A;  3BNC A;  2C10 A;  4XBT A;  2ZXX A;  3H1K G;  1NTK E;  2CPS A;  3CCM 3;  1SAR A;  3MWZ A;  3V2N A;  1KC8 Q;  1CZQ A;  2K54 A;  4O2H A;  5BXQ A;  1PP9 E;  4KFD A;  5KJ7 C;  1QAF A;  1UGI A;  2WGQ A;  1JJ2 2;  1UIX A;  1NTK K;  4GSP A;  1BU4 A;  3RL0 C;  1BGY J;  2FKW B;  1M9G A;  1W02 A;  4MMZ B;  1OH0 A;  4I1L A;  2KRT A;  2BNG A;  3GZB A;  1BAO A;  1K8A 4;  1RF0 A;  4HM2 B;  3H1K E;  3CCV 3;  3AE1 C;  3H1J J;  4H61 A;  3Q3F A;  2KI7 B;  4I7Z B;  4N6M A;  5APS A;  1NTZ G;  1T2K C;  1VQ4 P;  2Z76 A;  2XKM A;  1KQS O;  4I2L C;  1R8E A;  2KP8 A;  1FGT A;  1RCL A;  1WMO A;  1FOS F;  1ZR2 A;  2RSX A;  2KZI A;  2CK3 H;  3AEB C;  1VQL 3;  1XTC C;  1VQP 3;  3JC2 2;  3SWK A;  1SQQ E;  1LWU C;  4JPZ B;  1N7S D;  2H89 C;  3L4F A;  1RRH A;  3UIA A;  1ZW0 A;  2OQE A;  3BCC G;  1QX8 A;  4FMD A;  4WFO A;  3CD6 P;  1BIR A;  1Q40 A;  2ML6 A;  2M7O A;  3KZT A;  1NTM E;  1BNJ A;  3FXD A;  3HTK A;  1GMP A;  1PY3 A;  3AE5 C;  5FGO A;  3N9H A;  3HD7 A;  2E5Y A;  2HMJ B;  3A76 A;  1RKY A;  3RNT A;  2OTL 3;  4YXD C;  3TGU E;  2F98 A;  3Q3D A;  1SQQ J;  2OYH A;  1DVC A;  3GLM A;  3K7C A;  3CWB E;  1YJW 3;  3M06 A;  1HJB A;  3DGY A;  3K5B A;  2ZJS E;  3EN1 B;  3D9R A;  5L8R J;  2O01 N;  2W6J H;  1GMR A;  1G2C A;  1LOW A;  1IU7 A;  3DUK A;  4UB8 H;  3CI9 A;  4IT7 A;  3HZP A;  1B2M A;  1CSB A;  3D79 A;  5BU4 A;  2A06 G;  2YKO A;  1SQV E;  1AVY A;  1JBT A;  2WPQ A;  4IIA A;  2INX A;  5AW2 B;  2C9N Y;  3CL3 D;  2D2C C;  4ZM8 A;  5AW4 B;  3EQ2 A;  4PJ0 H;  1J2B A;  3GZY B;  4JF7 A;  2OYI C;  3VMZ A;  2OAR A;  2R5D A;  1I0V A;  1FYS A;  3MSO A;  1JMB A;  4HB1 A;  2P2U A;  1KFN A;  4HZ9 B;  1S3J A;  1BDC A;  3H1H E;  1UGH I;  2OYI B;  3SFE C;  1AA0 A;  3CC4 P;  2HMK B;  2WT7 B;  3L71 J;  5C39 A;  3SSU A;  2D42 A;  1KYO D;  1MWR A;  1TJD A;  2E75 C;  1VQ9 3;  4CDL A;  4IOI H;  1L0L E;  4IL6 H;  4OH8 B;  2GEY A;  3NHX A;  1PV3 A;  1T3U A;  5M18 A;  1AJY A;  5APQ A;  1VQ8 3;  3QRD A;  3NV0 B;  2N1T D;  2CH9 A;  4ASW A;  3E99 A;  2CW9 A;  4EV5 A;  3SWF A;  5G1L A;  1NTM J;  2K9J B;  4PD4 D;  1RN1 A;  1O7N B;  3M9H A;  2IPP A;  1N7S B;  1UDI I;  4C7R A;  2K3D A;  4XB5 A;  2K3R A;  1LTT C;  2CC3 A;  1KB9 D;  2HLO A;  5KLV G;  4RKU J;  3X42 A;  1Q9E A;  4YTP C;  2P05 A;  2XZR A;  1IFD A;  1JNQ A;  1Q42 A;  1U8C B;  3H1I D;  3V2P A;  5IW9 A;  5TGN A;  5CBO A;  3KSP A;  1A2P A;  3FGA D;  3G71 P;  3T97 A;  5BVB A;  3M9Q A;  1L4A C;  4PD4 E;  3NUV A;  1RGL A;  5EQL A;  4KFF A;  1HWT C;  1FJK A;  1IFM A;  1VF5 C;  2CFW A;  1EC5 A;  4KFE A;  2POH A;  1JZO A;  3S5C A;  3F40 A;  2MF7 A;  3LZA A;  5AVT B;  1QVF O;  1U57 A;  1OIP A;  3FCS B;  4K1V A;  1W2E A;  3V4Q A;  1BRH A;  2XRX B;  1S9K E;  2KF4 A;  1CI6 B;  1LTG C;  1Y4K A;  2RMZ A;  5CCG D;  3GZX B;  1NHL A;  3V4W A;  1SIH A;  4RES B;  3H1H D;  2IBZ G;  3CC7 P;  3AHS A;  4YPC A;  3CCL P;  5IF6 A;  5KTB A;  1VQ5 3;  3L71 E;  3EWK A;  4ZNC A;  1RGG A;  4G1M B;  1EXJ A;  1HF9 A;  3P7K A;  3M8C A;  2KAA A;  2O9U X;  1V57 A;  1PPJ E;  3CX5 E;  3S1K A;  1PZQ A;  1SJW A;  3EB8 A;  2IDB A;  1K41 A;  1P84 E;  2NRG A;  1EZV I;  1FZC C;  1S5A A;  5AVS B;  3CU3 A;  3N8B A;  1NTZ J;  1JRQ A;  3LW5 J;  3OWY A;  3E7K A;  2XGN A;  1MNL A;  1BCC E;  1UW1 A;  4H44 C;  1FC2 C;  1IFN A;  1OX3 A;  3B5N B;  3SX1 A;  2E74 B;  5M1B A;  4IFD K;  3CCM P;  3NX0 A;  3KFQ C;  1I3F A;  3S4R A;  2M3E A;  5KAI H;  1LP1 B;  4EYC A;  2ZT9 C;  3WA3 A;  2F4Y A;  1YVS A;  1K8A Q;  1NU1 D;  3H1J G;  2O3J A;  3L73 G;  3M9B A;  1UCJ A;  2GBX B;  2YIU B;  2Q9I A;  3T8U A;  3KQG A;  4HOH A;  1PPJ D;  3CXH I;  1FJP A;  2A15 A;  2BU4 A;  3MP7 B;  3OV4 A;  3Q2Y A;  2WSE H;  5A0O B;  1RF0 C;  3EC9 A;  1K73 4;  3WOF B;  2BCC J;  4LEH A;  3URP A;  5KLV E;  1PYL A;  3IR9 A;  5KAI E;  1FUW A;  1JUN A;  4EW5 A;  1K28 A;  3BVH A;  4K35 A;  4RNZ A;  2WSF H;  1Q86 Q;  3HE5 A;  1PIX A;  3V92 A;  5AVR B;  1TTO A;  4BTY A;  4I7Z C; 
#chains in the Genus database with same CATH homology
 2OOV C;  4K90 B;  5AYR B;  3UB1 A;  3S29 A;  3ROB A;  3ALA A;  4KVH A;  3OX9 A;  3G71 3;  1SQW A;  5EVH A;  1SII A;  1W5Z A;  1IT7 A;  4L7K A;  4OUQ A;  1N5P A;  5DRE A;  2PZV A;  3B7C A;  1AR0 A;  2BHM A;  2OQE C;  2WOF A;  3JUN A;  5AIH A;  1EG9 B;  2OCT A;  1K9M 4;  4TLF A;  2RFR A;  3MKI A;  1YI2 3;  2Q07 A;  1Q40 B;  3SED A;  1GY5 A;  3K63 A;  1YIT 3;  5JPP A;  1JN5 A;  1A90 A;  2LQV A;  1LOX A;  3X3Y A;  1IVV A;  1Z1S A;  5LC7 A;  1QVF 2;  1VQ7 3;  2FGT A;  4STD A;  1OPY A;  4O3V A;  1KQS 2;  4MEI A;  1EQK A;  2BMQ B;  4ORL A;  5AI1 A;  1S72 3;  3MG3 A;  1GY6 A;  2W03 A;  4H3U A;  2RGQ A;  1E3R A;  1YJ9 3;  2W0Q A;  3F7X A;  2YX9 A;  4IPB A;  3FZW A;  4HM3 B;  1O7M B;  1W7C A;  1IQY A;  4HM8 B;  2XF3 A;  3DGO A;  3EE1 A;  3JUO A;  1O7P B;  3S67 A;  1VQN 3;  2OWP A;  3CPO A;  4AKY A;  4JRF A;  4MMY B;  4O02 B;  4WHA A;  3UNL A;  3KKG A;  3NV0 A;  4K61 A;  4XBX A;  2IUK A;  3VF1 A;  3PCS A;  5CF2 A;  2CG0 A;  2SBL A;  4FCJ A;  4N6O B;  3T0U A;  4X2H A;  3G16 A;  1G96 A;  1QAK A;  1OHS A;  3FF2 A;  3PXM A;  5AEU B;  2YFJ B;  3CCR 3;  1CYU A;  3EBT A;  3B4P A;  1W00 A;  1E3V A;  3O8Y A;  5D83 A;  3IMA B;  3CXC 2;  1JKG A;  2BMR B;  1M90 4;  1JB2 A;  1PFP A;  1WTH A;  2GEX A;  1Q86 4;  1W6C A;  3U97 A;  3Q90 A;  1JV2 B;  2LYX A;  2UX0 A;  4FCM A;  1A2K A;  1IT8 A;  4EV2 A;  1QJG A;  2CKF B;  3PYJ A;  8CHO A;  3J7Y d;  2RCD A;  3CCL 3;  1KWI A;  4FR9 A;  4RNY A;  4XBY A;  5IER A;  1DMN A;  2QE7 H;  2XEP A;  3QK9 A;  1VQ6 3;  5IG3 A;  4AKZ A;  3HK4 A;  1GD3 A;  3B4O A;  3SOY A;  1IK3 A;  1R4C A;  1OGZ A;  3FKA A;  4RBN A;  3CC2 3;  1VQM 3;  3V98 A;  2YFI B;  3S27 A;  3KII A;  1RN7 A;  2JDI H;  2W56 B;  1AVK A;  3CNX A;  1OHP A;  1E79 H;  2CFL A;  1LVN A;  1UUW B;  1FS0 E;  4JF8 A;  3CNM A;  1O7W B;  3DGM A;  1FGM A;  2BMO B;  3RDE A;  3F9S A;  3LYG A;  4HJL B;  1EA2 A;  3IJE B;  3LH4 A;  2MC8 A;  3LML A;  4N3V A;  4WYK B;  3HII A;  4WVZ A;  2WOH A;  3K0Z A;  1W4N A;  4HZB B;  4HM7 B;  5DRV A;  3BNC A;  2C10 A;  2GBW B;  4XBT A;  1QMA A;  3CCM 3;  2ZDJ A;  3MWZ A;  3SVA A;  3CME 3;  1W2B 2;  1JKG B;  2P0M A;  2K54 A;  4O2H A;  5BXQ A;  4KFD A;  2QIY A;  3H51 A;  3ER7 A;  1QAF A;  2WGQ A;  2CIU A;  2FNQ A;  2CWV A;  1JJ2 2;  1D6Y A;  1HU9 A;  3UJM A;  4PEJ A;  1GYB A;  4L8P A;  4R1K A;  3F14 A;  2KCD A;  3VSY A;  1LNH A;  5LC6 A;  1M9G A;  3RGA A;  1ZX2 A;  1W02 A;  4MMZ B;  1OAC A;  1OH0 A;  2KRT A;  2BNG A;  3GZB A;  1ULJ B;  1K8A 4;  4HM2 B;  3WDG B;  3G6E 3;  1QAL A;  3DGL A;  3CCU 3;  1IDP A;  2E2U A;  3CCV 3;  3OW2 2;  1FGO A;  3DGN A;  4H61 A;  4TX4 A;  1BSN A;  1UUV B;  3FH1 A;  1YVB I;  3GWR A;  4N6M A;  4QMA A;  1N9E A;  4RZM A;  1CEW I;  3CCS 3;  3DMC A;  2Z76 A;  2Y74 A;  4HYZ A;  4MMX B;  3BNE A;  1VQ4 3;  3IPT A;  1VQO 3;  1N5H A;  4LZI A;  2BO9 B;  3K5T A;  4AEQ A;  1TP6 A;  1FGT A;  4BTX A;  2HMN B;  2WSS H;  1WMO A;  2RSX A;  1RRL A;  5G2G A;  2CK3 H;  1VQL 3;  1TIJ A;  1L5G B;  1VQP 3;  1UI7 A;  5IEN A;  2ML5 A;  1A67 A;  2KXG A;  4O8S A;  3CC4 3;  2JQ5 A;  1U5O A;  3NBR A;  2XSO B;  2OTJ 3;  2YFL B;  3NM2 A;  1WMP A;  4HM0 B;  1RRH A;  2HMO B;  3X3X A;  4HM4 B;  3NBB A;  2OQE A;  4WP5 A;  3DM8 A;  1NB5 I;  4FMD A;  3NBJ A;  4WFO A;  2GXF A;  1ULI B;  1TU5 A;  1Q40 A;  2ML6 A;  2M7O A;  3F7S A;  3KZT A;  4L8O A;  4OVM A;  1W6G A;  1V74 A;  1Q81 4;  3LOY A;  1STD A;  5FGO A;  3N9H A;  2E5Y A;  2B1X B;  2HMJ B;  3A76 A;  1STF I;  1RKY A;  4GB5 A;  2OTL 3;  5CLK A;  2F98 A;  1T5Y A;  2Y73 A;  4LMI A;  1DVC A;  2IUJ A;  4U13 A;  3K7C A;  2QEX 3;  1YJW 3;  2XND H;  1JEK A;  1CQS A;  3D3L A;  1ISK A;  2CWU A;  3FG3 A;  3EN1 B;  2W56 A;  3D9R A;  5IG0 A;  2V1L A;  1DVD A;  2W6J H;  4FMC A;  3RGR A;  3AMO A;  1WMN A;  1IU7 A;  3DUK A;  4EC6 A;  4J9A A;  4MJD A;  1NJI 4;  3CD6 3;  4IT7 A;  1F8N A;  4WYK A;  3HZP A;  2B24 B;  3VGN A;  1TFO A;  4N6V 0;  5HGR A;  3CCQ 3;  3EQQ B;  5ELU A;  2FXT A;  5KP1 A;  4HVN A;  4R80 A;  2QA4 3;  4N6T A;  5AII A;  3CMA 3;  2CFK A;  3USS A;  4IIA A;  1Q7Y 4;  2INX A;  3LT9 A;  4ZM8 A;  3EN8 A;  1N8R 4;  2IA7 A;  4Q53 A;  1J2B A;  3U1W A;  3GZY B;  1IVU A;  1KSI A;  5KP4 A;  4KZ1 A;  3MSO A;  1TFK A;  1ZO2 A;  2XR8 B;  3CPW 2;  1EKM A;  4HZ9 B;  3FG4 A;  3Q1C A;  3GAX A;  2CFG A;  1BSH A;  3WMD A;  3F8H A;  3JUQ A;  4XDW A;  2HML B;  2W04 A;  3WOE B;  3KE7 A;  2HMK B;  3PZW A;  2E2V A;  2L4V A;  2E2T A;  1O7H B;  4YXW H;  1MOL A;  2E5T A;  2Z77 A;  2D42 A;  2QGU A;  7STD A;  1O7G B;  1NDO B;  1DYU A;  3DY5 A;  3MG1 A;  5IG4 A;  3TDG A;  2XFS A;  1IQX A;  5IEP A;  1A2V A;  4CDL A;  1VQ9 3;  2GEY A;  3NHX A;  5IEO A;  1ROA A;  1C7H A;  1JB4 A;  3MYT A;  1VQ8 3;  3QRD A;  3NV0 B;  2CH9 A;  3EX9 A;  1YIJ 3;  2HMM B;  3N54 B;  3E99 A;  3HX8 A;  1OUN A;  3SXX A;  2CW9 A;  5STD A;  4EV5 A;  5ELJ A;  3EJV A;  2IMJ A;  3X41 A;  4R4K A;  4N6N B;  3I0Y A;  1OF5 B;  1QVG 2;  1O7N B;  3NQZ A;  3MHE A;  3HI7 A;  4HKV B;  5FW5 A;  2F99 A;  2P38 A;  1OHO A;  2OOV A;  3SLU A;  4XB5 A;  4NRE A;  3LTC A;  2CC3 A;  3G4S 3;  1YHQ 3;  3OWU A;  3SOA A;  1IV7 A;  1W01 A;  3LTA A;  4FMB A;  4N6U A;  3X42 A;  2K0M A;  3Q2P A;  4X2O A;  2R4I A;  2P05 A;  3B8L A;  3KSE D;  1IV9 A;  1JNQ A;  1GD4 A;  1Q42 A;  1U8C B;  5IW9 A;  5TGN A;  5JPU A;  3KSP A;  3S28 A;  1IVX A;  1E97 A;  3EF8 A;  4EBG A;  5BVB A;  3LT8 A;  4FCZ A;  2CWT A;  2W9P A;  1KC8 4;  3NUV A;  2W9Q A;  3BND A;  4K1U A;  1YJN 3;  5EQL A;  4KFF A;  3PJS K;  4HBR A;  4NHF A;  1IQ8 A;  1N9J A;  3T8N A;  2CFW A;  3I56 3;  1DMQ A;  4KFE A;  1NWW A;  3GRD A;  3DZL A;  3NQY A;  1W2Z A;  4XDV A;  3S5C A;  2CG1 A;  3F40 A;  2MF7 A;  3LZA A;  3PS8 A;  1IFP A;  5I97 A;  5AIF A;  3V99 A;  3CCJ 3;  1NU3 A;  2F86 B;  3LTD A;  5CXO A;  3OWS A;  3BNB A;  3WOD G;  3FCS B;  1M1X B;  2STD A;  1AVL A;  4K1V A;  1IVW A;  1CYV A;  3JVC A;  1PU4 A;  2XRX B;  3OXA A;  4HM5 B;  2D1W A;  1Y4K A;  3F8X A;  3GZX B;  1SIH A;  1W6Y A;  5CK6 A;  1M1K 4;  3BLZ A;  3EHC A;  4CCV A;  2CFD A;  1NO3 A;  4GL6 A;  3UL5 A;  4HM6 B;  2Z6B A;  4LSO A;  5IF6 A;  3PCR A;  2C11 A;  1VQ5 3;  4G1M B;  1US1 A;  5IG5 A;  2PNC A;  4I4K A;  3M8C A;  1FA3 A;  1LXE A;  2BT3 A;  2W2C A;  4HM1 B;  1WNH A;  4OK0 A;  2O9U X;  3LTB A;  1Q82 4;  3BB9 A;  5AYS C;  1AV4 A;  1SJW A;  3I55 3;  4XM4 A;  2XFT A;  3EB8 A;  3JUM A;  3G8Z A;  1K41 A;  4DJG A;  2WO0 A;  1S5A A;  3CCE 3;  3CU3 A;  3FSD A;  3N8B A;  1D6U A;  3NM7 A;  2GU1 A;  4R9L A;  1JRQ A;  3OWY A;  6STD A;  4R9K A;  2XSH B;  1KD1 4;  2XGN A;  1JN5 B;  1MNL A;  1WQL B;  1FGR A;  3EBY A;  4EXR A;  2I9W A;  1OCV A;  1UW1 A;  3SX1 A;  1ROV A;  1YGE A;  3HIG A;  1GS3 A;  3NX0 A;  3KFQ C;  2P0X A;  1VQK 3;  3H3H A;  3CC7 3;  4EYC A;  2Z7A A;  3WA3 A;  1RJO A;  3EFF K;  4LGQ A;  1HKX A;  3STD A;  2GBX B;  4WWU C;  2ZL8 A;  3JUP A;  1GY7 A;  2V7Q H;  4QWT A;  1DMM A;  1OGX A;  4BTW A;  3T8U A;  2CHC A;  4J8T A;  5AIG A;  3ECF A;  5D82 A;  3WA2 X;  3MG2 A;  3LXU X;  3L0R A;  2A15 A;  2P09 A;  3NXJ A;  3OV4 A;  3MPH A;  3DXO A;  3FGY A;  5JBS A;  3K9M C;  5A0O B;  1JB5 A;  1NB3 I;  1D6Z A;  1ASK A;  3PGB A;  3EC9 A;  4N6L A;  1N8Q A;  5CF1 A;  1K73 4;  1OF5 A;  5KP3 A;  2WGO A;  5D81 A;  3WOF B;  1BUQ A;  3GZR A;  4FMA A;  4LEH A;  1TUH A;  2XH9 A;  3X40 A;  2GU3 A;  2XGL A;  1FUW A;  5AEW B;  3FF0 A;  1K28 A;  5EEO A;  3X3Z A;  1VZZ A;  4RNZ A;  3FLJ A;  1UI8 A;  3AMO B;  3UL6 A;  3V92 A;  3G0K A;  1AQT A;  1SPU A;  4BTY A;  2O3O A;  3FG1 A;  3KN4 A;  1FGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...