2JDIH

Ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
88
Chain Sequence
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
publication title Ground State Structure of F1-ATPase from Bovine Heart Mitochondria at 1.9 A Resolution
pubmed doi rcsb
molecule tags Hydrolase
total genus 11
structure length 88
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2jdiH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2jdiH01
1E79H 1IFPA 1BSNA 4DJGA 1JEKA 2JDIH 3EFFK 4QMAA 2CK3H 2E5TA 2E5YA 2WSSH 4YXWH 2V7QH 4WVZA 1AQTA 1BSHA 3USSA 3PJSK 2W6JH 2QE7H 1FS0E 4TLFA 2XNDH
chains in the Genus database with same CATH superfamily
5G2GA 1L4AB 1YHQ3 3H25A 3HUSC 1K8AQ 2MC8A 1A02F 2XNXA 4RBNA 4HBRA 3DGNA 3CC43 1Q82Q 1SQVD 3JCUH 1JCCA 3NM2A 4ZKUA 1V58A 3A3YB 2ZXEB 1OVUA 4KFDA 3TSIA 3NBRA 1VQ53 3HD7B 2L91A 2PRRA 3CCR3 1MWSA 1RGLA 2AXCA 5CCHC 1IYYA 2W8ZA 4RNZA 1OW6A 4H13D 2R32A 3MGNA 3NFQA 2IYOA 2C11A 1DYUA 3B71A 5TISH 1GSPA 3U1CA 3RL0g 1BDDA 3FWNA 3OV4A 2K9JA 2IZ0A 2CG0A 1JZOA 2M7OA 3L74D 1A90A 1RSNA 3NBJA 4FMDA 1IU7A 5AIGA 3M9QA 2YIUC 5DREA 5KLVE 2R41A 2BMOB 3AEEC 1FZFA 2ZL8A 3CCJP 2H0GA 1M1KQ 2IMJA 1NH4A 2AXTE 3USSA 3X3XA 1SQBE 1P84H 3CL3D 3O8YA 2HODB 4N6JA 1U7JA 1BSDA 5HOHA 2H8PD 4DCKA 3SOAA 3H51A 1PP9D 2Z7AA 1ULIB 3F9SA 3D70A 2BMQB 1VQM3 1IO4A 1DMQA 5DJUB 1GOUA 3JUMA 3H1HJ 4U3FD 1B2UA 3CCJ3 1PZQA 5AW9B 1K9MQ 2J58A 3C9IA 3CWBE 3CX5E 3GMAA 3DH2A 1JOCA 4CDLA 3HE4A 1J1EB 1U57A 4IT7A 2OQEC 2WT7B 2WPRA 1BRKA 5AW6B 4N78D 4NPBA 2PGDA 1L0NK 2GA1A 1LOXA 1LOYA 1KFMA 1PGJA 1I70A 2BIRA 3CCEP 2QJYC 4O9BA 1I0XA 3V92A 3H1KJ 4OH8B 1Q90D 1STFI 1SIIA 2P38A 3V2QA 2QJKC 3LT8A 4MEIA 1H0TA 3AMOB 1R5SA 2J8XB 1SQPJ 1S5AA 1GK4A 3CXHH 1IFIA 2WSFH 1L0ND 1X1UA 4GL6A 1QMAA 2BCCD 2KSJA 1T6AA 1EZVG 2OTKE 1BCCE 1E3VA 3QK9A 1HTLC 1SLQA 4PV1D 1KFNA 1JTHA 4EBGA 1ZW0A 1KSIA 4D6TD 3TK1A 1L0LE 1EDJA 2D42A 2XR8B 2HFED 1A2VA 1QL2A 4KVHA 1JBSA 2CWVA 1PPJG 2FGTA 1YJ93 1CSBA 2E75B 1OIPA 1FZCC 4FCZA 1W02A 2CFDA 1KILC 2V7QJ 1RF0C 1LTIC 2WWWA 1S9KE 1T3BA 2WZ7A 4YXWH 5BXQA 3I56P 3MG2A 4N6OB 1VF5D 1BRGA 2JEEA 3JSVC 2ZDJA 1KB9E 3DZLA 1DVDA 3BCCD 3I553 3NXSA 1JO5A 5TGNA 4HM8B 1N8RQ 1GMPA 1S723 1EXJA 1BSNA 1VQ4P 1QVFO 4JRFA 3B4SA 4HYTB 1EQ7A 4MMXB 1M1JA 1NVOA 4GOFA 3DM8A 4I5QA 5B5EE 5KAIH 3GZBA 4WYKA 3LYGA 5CF1A 1J1DB 2KCDA 2OOVA 1LTJC 1JV2B 1R4YA 3D6YA 1ZXGA 2SPZA 1NHLA 2Z5HA 3O6QB 5DRVA 1VQ43 4U7JA 3L73J 2IPPA 3K7CA 3FF2A 1BDCA 1BSEA 1W7CA 1RF1B 2B89A 5CJ0A 2M0BA 3H1ID 1L4AC 1PIXA 4KJMA 4OGQB 5AVTB 3Q2YA 5M1BA 3NHXA 5G1LA 4DKIA 1Q42A 4XDWA 1JMMA 3GF7A 3CNXA 3WODG 3Q3FA 2HMLB 4AEQA 4TLFA 3H1HG 3SXXA 3ZFZA 1FZAA 1FC2C 2YKOA 1YQ3C 1BNSA 3OWYA 2IBZI 1YVBI 2BU4A 2HMKB 2K1AA 1X1XA 1MUUA 1JZDA 2NPSD 1NTMJ 5KJ7A 1BSBA 3M9HA 1BRJA 4U3FE 1RTUA 3RL0D 4HM7B 2M5AB 3RNTA 4WHAA 3H1KG 2K88A 3BNBA 1JEKA 3K0ZA 2ZT9D 3PXMA 1LTAC 5AVXB 1SQWA 2QSIA 3VMYA 1SQPG 1FGQA 1S3JA 1RE4A 1AQTA 1IVXA 1FZEA 3CCSP 1NYHA 2R5BA 2FKWB 1MNLA 3NQZA 3B5NA 2H7HA 4IFDK 2AEJA 2CHCA 3AHSA 4CPKA 5IG3A 4X2OA 4IFFA 4I6MC 3CC2P 3TYYA 1LQMB 2E2TA 3L73E 1SJWA 5E79E 4NREA 2BEZF 2N9YB 3CCVP 2XFSA 3CCS3 2INXA 1KQLA 1S5LX 1EXIA 1URQC 2HG5D 4O8SA 7GSPA 1RRLA 4L73A 4K35A 1GY5A 3A0HE 1KB9I 1FW7A 1JY2O 1ZOYC 4D6TE 1DIPA 3FLJA 1J1EC 1QX8A 1HVVA 3HIIA 2MJZA 1FUSA 1HGZA 3KE7A 1XTGB 3H1JD 3CMEP 4L75A 3T8NA 2R44A 3DXOA 2HPCA 3DUKA 2XFTA 3FG4A 5AVSB 2E74C 1JUNA 5ELUA 4HM5B 2KZIA 4RESB 1OHPA 1HH0A 1M9GA 4EIJA 2WPSA 3HUSB 2OYHB 2F4YA 1NTKJ 4JF7A 3CC73 1K28A 1SFCD 4BRYA 1IZNB 3BCCE 4BTWA 3ITKA 2ZYDA 5EVHA 2GEYA 4IPBA 1SQXJ 2KK7A 3CD6P 4EYYQ 1Y4KA 2JR8A 1BRSA 2R3SA 3FXEA 2FYUJ 1Q7Y4 3FCSB 1TP6A 5CCGC 2KXGA 4GIFA 2GU1A 2CWUA 2XKMA 1NTZD 4LZIA 1USEA 1ROAA 4N3YB 2Y9YA 2K3DA 1FAVA 2W04A 3D4AA 1GZLA 1LGHB 1RCLA 2E75C 2XU6A 5KKZC 1KQS2 3CD63 3KXDA 3GRDA 2OTL3 4HKVB 1S1CX 1JY3O 4AQRD 2J59M 3VMXA 2N1TB 4N6MA 1BGYG 1GL2A 3JCUE 4HH2A 1NKZB 1TU3F 4AYCA 1PV3A 5AW3B 4I7ZB 2FXOA 2UWJE 2CPBA 4N6V0 2CKFB 5KP3A 3AEDC 1HGVA 5BIRA 2RNTA 2J5UA 2Z4EA 1NTMG 1S2EA 2KS1A 2ZHXB 3B8EB 2YIUB 3KFQC 2IZ1A 1LWUA 2WPQA 1DMNA 1Z1SA 3BNCA 2JJLA 4RNTA 1DEBA 3K9MC 4XDVA 4BIRA 2FFDC 1T5YA 1K8A4 1JN5A 3RK3B 2YFJB 1J1DC 2P67A 1ZV8A 1OMIA 1OACA 1PFIA 1TRPA 3H32B 1RE3A 3CI9A 3TNUB 1VQLP 3H3HA 5KLVK 4EC6A 3E99A 1T2KC 1VQK3 3EHCA 3NV0A 3TGUJ 1RF1C 1SQXE 1SQBK 1RGGA 2BNGA 1P84E 2H88C 3EC9A 8RNTA 1OZHA 1LTGC 6GSPA 3V2RA 4OGQC 1ZMEC 1DVCA 1RGFA 1VDFA 5JPPA 1DMMA 5AIIA 2QIWA 3VP8A 3BRVB 5KLVD 3B4OA 2G3AA 4HM0B 1SP4A 1RNBA 3HRNA 3RK2B 2QJYB 2NPSA 5GTHE 1O7NB 1SQBD 1UUVB 2WQYC 2W9PA 2RFRA 1NDOB 1TUHA 1OVRA 2CFWA 4MMZB 2YXQB 2A06E 3B8LA 2AEFA 5EEOA 1RLSA 3FZWA 3N7NA 4C46A 1RKYA 2CFKA 3EBTA 3WUTA 2KXPB 3L72J 4N6LA 2E2VA 2QRXA 3PRJA 4GODA 1PY3A 4XBYA 5AIFA 2CG1A 5LC7A 3O8ZA 5AW1B 5BVZA 2QA4P 4PD4H 1VZZA 2D1WA 3OX9A 1WMKA 1VQ63 3LTDA 2E76B 1LTSC 4H13C 4FR9A 1IJDB 2FXPA 2IBZD 3H1LG 3UB1A 3FG3A 3CXHE 2RH0A 7STDA 3AEGC 1KILB 1NKNA 1RF0A 2ITAA 3SSUA 3OA7A 5K5GB 2WGOA 1OHOA 5JBSA 2FYUG 3EJVA 3LTAA 4O3VA 1C7HA 1SPUA 2YXRB 2OYIA 3WA3A 2WMMA 1RGEA 2P0XA 2YO2A 3KSPA 1GU4A 1K734 2JO1A 5CBNA 4CJNA 1U5OA 4L74A 4W80A 3LXUX 3S67A 2H0HA 3AE6C 1PU4A 4LYLB 4ORLA 3FWLA 1VQPP 2ZJSE 4L8PA 4C7RA 2FXMA 4GSPA 4RKUJ 1OGZA 3HE5A 1VQNP 1L0LD 1IT7A 1YJN3 1MKMA 1ISKA 1LTJB 1NJIQ 5I97A 3RGUA 1CYVA 4NPFX 4WY4D 4BTYA 3GHGA 1S5LE 3H6PA 1R8EA 1VQO3 1UIIA 2W0QA 1Q7HA 3L75G 2KI7B 3KDPB 5APWA 1W2B2 3NQYA 1L4AA 1GY7A 3L71G 3EF8A 1LT9A 2OYHC 5KAIE 1KB9D 1TJDA 2AAEA 1KMIZ 1CQSA 4EI2A 1JKGA 1KQSO 3UL6A 3P8CE 2QIYA 3MTUE 5GTIH 4GHOA 3Q1MA 2YNYA 1P84I 1SQPK 2OYOA 1W6YA 1PGPA 2IX7C 3TGUG 4I1LA 1IFNA 3VP9A 3HD7A 1QAFA 2LQVA 1IVVA 1YBKA 4EV2A 5CXOA 2BHMA 2JWAA 1N8R4 1LT1A 1E97A 1BRNL 1JY3P 3U1WA 1T8ZA 2K37A 3A5EA 2GUVA 5KJ7D 4L76A 2R4IA 1I3IA 1R5LA 1K05A 2AADA 2N1TC 4KFEA 4R1KA 4I7ZC 1LNIA 1AJYA 3M0DC 3M06A 2LXCB 4OK0A 1UUWB 3DMCA 1SVFA 3AEAC 2IUJA 3SWFA 1B3SA 1KYOI 1LP1B 3L72G 1W2ZA 3CPW2 1VF5C 5AEWB 3IMAB 2WSEJ 1TRQA 1JY2N 2ZFCA 1LOWA 2HODA 1WMPA 3B5ND 2YMKA 3CXHI 2YFIB 3RK3C 1PGOA 3EFGA 1JB2A 1AFOA 4RNYA 1OX3A 3MG1A 3R2PA 1MGWA 1URQB 1G1IA 4K90B 1FZBA 1GMJA 3S28A 5GTHH 1FOSE 4EW5A 5AW8B 4C7NB 5IENA 4PJ0H 5KP1A 3ABVC 4Z1MH 4K61A 1W01A 4BWNA 3AGNA 1NU1G 4YPCA 5AVUB 1UI8A 5BVBA 1JB0J 2WT7A 1V74A 4HM3B 2W2CA 2IBZE 3RBZA 1I0VA 4H44B 1FJKA 3KZIH 4TT3H 3MUDA 2GBWB 1K73Q 1FDIA 4KHXA 5LC6A 1KYOH 3KQGA 2E74B 2KYVA 3RK2C 2A45G 4KZ1A 3JUOA 3GG2A 3KPEA 1JCDA 5A0OB 1GU5A 3AECC 1B2XA 1STDA 4JYBA 3LW5H 1BNJA 3L73D 3X3YA 1JBTA 1QJGA 3AMOA 5APUA 1M56D 3HI7A 1OF5B 1N7SD 2XEPA 1EG9B 5AVQB 3CMAP 1SQVJ 1K41A 5FW5A 1RHLA 1JY3N 3IR9A 5DJTB 1KD1Q 1VQ9P 3CCE3 1MWUA 1VQQA 2KRTA 1NTMK 5CCGA 1G96A 3JVCA 2I8DA 1IVUA 5C39A 4H0LB 4OUQA 2E76C 1FS0E 3EWKA 4HZ9B 3V99A 1ZP0C 2QEXP 2Q7CA 1QLED 1Y47A 3AHWA 1D6YA 3GZXB 5KKZB 7RNTA 2D2CB 3AGOA 5TJHA 3PCSA 3TDKA 2OQQA 2KF5A 2W83C 2R5DA 2YKQA 1BE3G 3L70G 3ZG0A 4DT0A 1D6ZA 4AUWA 2Y74A 3H1HE 3CCQP 1QAKA 1JRQA 1MWRA 2CFLA 2OGUA 4LGQA 5IF6A 1L5GB 1IQYA 3CWBG 3ZG5A 2Y0CA 4ZMDA 1S5LH 1GL2D 3WU2H 3B7CA 3AE4C 4ZKPA 1PP9J 3P7KA 1YITP 1FUTA 3BNEA 4HM2B 1W2BO 3BIRA 1A67A 3I563 2FFDB 1FGRA 2FYZA 4WY4A 3TDGA 2SARA 1N73C 2CC3A 2YX9A 3OWUA 1OPYA 1ZLLA 3C8VA 3H1KE 3L4FA 2Z77A 1WMOA 3Q3DA 3BLZA 3IF4A 3M91A 3DY5A 1W5CE 4IL6X 3O6QA 2GEXA 3AE8C 2CX0A 2HMMB 5AVRB 4N3VA 1SQPE 1PL5A 1SQQG 1EZVI 3BATA 3G9RA 2XF3A 1M7LA 1TFKA 2RCDA 1RF1A 3MIWA 2B87A 1FJPA 3HZPA 3FSDA 1BOXA 1RQUA 2QGUA 3V98A 1BCCG 2G8YA 1V57A 1W4NA 4IFMA 3D6ZA 3CLQA 4LSOA 2XZRA 1NTKK 4HKZH 1D6UA 4WP5A 4XFJA 4EYCA 5AW7B 1G2CB 1EA2A 1KWIA 5ELJA 1BGYJ 4CPGA 1NB3I 5EQLA 2A45H 1SQXK 1IV9A 5B66H 2FYUK 4R80A 1UIXA 1YI2P 4EV5A 5L8RJ 3CPWO 1NTKD 2M5AA 4ASWA 2P2UA 1JNMA 1S4XA 1ZRTE 2Z5IA 1IC2A 1NO3A 2CFGA 5HGRA 1SQXD 4XBXA 1GMQA 1P84D 2B88A 4LLHA 2QM7A 3GF3A 1FYSA 4H13B 2PZVA 4HVNA 1KTMA 1LVNA 1FGOA 1YI23 1FE6A 1SQVG 3M9BA 1UGIA 1N8QA 1MGRA 3LMLA 2DW3A 3GZRA 3JUPA 3KCHA 2QVAA 3VN0A 3BRTB 1BNEA 5AVVB 3RGAA 3FKAA 9RNTA 4IOIH 1KILD 4NPEA 4PD4E 3UNLA 3URPA 2A06D 3S9OA 1DETA 1HZ1A 1RCKA 1T2IA 1ZR4A 1AR0A 4STDA 1GMRA 3W67A 5CBOA 1WTHA 4JBZA 3BVHA 1VQ8P 1IK9A 3L74G 1RRHA 5KLIC 1KYOD 3CC23 1NAFA 2LR2A 4MJDA 1OW7A 5AVYB 1DX7A 3FG1A 2JWDA 3KKGA 2L1SA 4UB8H 3GZYB 3CCV3 3WOEB 3GAXA 1BGYE 3WUUA 3CXHD 4H44C 1I2EA 2RSXA 1EDIA 3EQ2A 1UDII 5IERA 3NBBA 1NTME 3LT9A 2M8RA 2P09A 1PP9G 1IFDA 1HJBA 1FOSF 4N6UA 1OW8A 2ZA4A 1RN1A 1N7SA 2Y9ZA 2WSEH 3RBXA 1O7WB 3HUSA 3GW6A 4U3FG 1CH0A 2Q6QA 2O01H 1H89A 3AE2C 3H1LJ 1ULJB 3CME3 1JM0A 1L4AD 1O7MB 3P32A 5EFWB 3VTPC 2GXFA 1JBRA 2BEQD 1UW1A 4ILFA 3PZWA 3QH9A 1TTOA 2AEMA 3FGAD 1IFMA 1YVSA 5KTBA 2WO0A 5M19A 1EEJA 4ZNCA 1UGHI 3V5BA 3GLMA 4H0LC 1IDPA 1GTWA 3WUVA 5AVWB 4G1MB 5CCHA 1EDKA 4PV1B 4HAAA 3WMM0 2W56B 4AKYA 5IEPA 2P10A 3V4QA 4XE5B 3QWOC 5KAFH 1OGXA 4I2LC 3HD7D 2D2CC 5GTIE 3CCMP 4R4MA 3KN4A 4WB4A 2F99A 1O7HB 3B4PA 1KZUB 3N8BA 1L0NG 1M57D 1GS3A 2P0MA 1NJI4 2BCCG 3GWRA 1MOLA 1Y9BA 1FU1A 2JKVA 3AE9C 3P8CD 5FGOA 4Y99B 4J9AA 1VF5B 2W6AA 3CCM3 2HYNA 1IQ8A 3PLNA 1LQGC 3LW5J 3WMDA 2RGQA 3G71P 3L75J 1EDLA 3A5TA 2V4HA 3HTKB 1GD4A 4UB6H 3L71J 1R4CA 1JB5A 1GYBA 2QE7H 3DGLA 1HU9A 3K5BA 4MMYB 1SARA 1GK6A 1MZ9A 1UCIA 3H32A 1ZX2A 5AI1A 3TNUA 1NTKE 1C54A 3G6EP 1EC5A 1YGWA 4PD4I 3PYJA 3H1JJ 3BCCG 3N4XA 1A2KA 1RH5B 1BNFA 3UJMA 4Q53A 1CI6B 2KNCB 2K3RA 2OQEA 5IG5A 3R4YA 2FYUE 3V4WA 4W7ZA 3VF1A 3FF0A 1IK7A 3U1AA 1UCJA 3CCLP 3PTZA 4HJLB 2YO3A 3Q1CA 1FUWA 1VQL3 1U7MA 5GSPA 1BGSA 2CK3H 3UL5A 4BU4A 3DGMA 2KIKA 2XDJA 3RDEA 3MSOA 4OVMA 2V1LA 2XSOB 1DD4A 3T97B 1KILE 2W90A 5APXA 2ZVNB 1EZVD 4PJ0E 1AV4A 3SWYA 3F5HA 2E74D 2RKLA 3PCRA 3AEFC 1I8VA 3OAKA 5BU4A 3PP5A 2XNDH 3F40A 1JMBA 2PNCA 1NTZJ 3H1IG 3KZIE 1PPJD 1YIJP 2B24B 1RGAA 2E2UA 2QJPC 3L0RA 4LC1A 1KYOE 2NPSB 1X8YA 2ZAEB 1FA3A 1DD3A 1OVVA 5CCGD 3L75E 3MZWB 2K9YA 4GDOA 4LGDE 2W6JH 2CPSA 5KJ7C 5JPUA 3L71E 1FZCA 1KORA 3I5CA 2JP3A 3ZDMA 1KILA 1L2PA 1F8NA 1YIJ3 1T3UA 2H43A 2W03A 1IVWA 1YJWP 1G02A 2QA43 4BXLA 4MN4C 2E75D 1N86A 1EQKA 4EXRA 4WFOA 2F86B 2IUKA 1NU1J 2XGLA 1OXZA 1G0TA 1GY6A 2Y73A 5H2FH 3TGUE 1QALA 1LNQA 1Q40B 4J5GA 2KUBA 3X42A 2VRSA 3B5NC 1XTCC 1Q86Q 5AW0B 3ALAA 1VQ7P 3OJAB 2K0MA 2UGIA 2FBWC 5CLKA 2KF4A 2P7JA 2UUGC 5APSA 1BU4A 3V6IA 1M1XB 1N73B 3L36A 4H61A 1Q814 3K63A 1LTJA 2MKVA 1HKXA 5CK6A 1O7PB 3NTNA 1IT8A 3AE1C 1KD14 4JQ0D 3WU2E 3K5TA 2W27A 1VQ73 2WSCH 4H3UA 1VQP3 1N7LA 4XB5A 3L72E 1AVYA 3PHLA 1RNTA 1AY7A 2C10A 2BO9B 3H1HD 1YHQP 1VQN3 2KB7P 4HM4B 3EE1A 3LZAA 3OW22 4B86A 1PYLA 3WOFB 3F89A 2WSSH 3G0KA 1E3RA 2IDBA 1H8AA 1VL2A 1X22A 5M1AA 3G8ZA 1ZS7A 2I1JA 2HR3A 4YTPC 4OGQD 3CC4P 3SEDA 3G4SP 1SFCB 1BE3J 3L70J 5D82A 1SQVK 3H1JG 4GOEA 1LT9B 3VMZA 4GKGA 2CX1A 1VQ5P 1HYFA 1FBMA 1N9JA 3CWBJ 1ROVA 3H1KD 3CCRP 1JKGB 2Y0EA 4RZMA 1LTTC 2NZ2A 4PV1C 1J2BA 1FZGA 1TFOA 1NU1E 1N9EA 4L7KA 1M8OB 3Q5PA 3G4S3 2GUSA 1SQPD 4EDFA 3VYIA 1BSAA 1YQ4C 1I2FA 1D7MA 2C4BA 3MP7B 2QM8A 5AIHA 1IFPA 1H88A 2W9QA 5B66E 1KV4A 1QGKB 2E5YA 1B2ZA 2RMZA 3FXDA 1AA0A 2O9UX 3KIIA 3WDGB 1LP1A 1LXEA 4Y99C 1NTZG 1SQQJ 2FYNB 1RMSA 2KAAA 2C0XA 4R4KA 1USDA 1OH0A 2O01J 1GL2C 3M0AA 1X1WA 2K9JB 1EZVE 3W68A 3NM7A 2CH9A 3ROBA 1E79H 1FDOA 1BCCJ 1W6GA 2IY2A 1VQMP 4IL6H 1LWUC 1URQA 3X40A 5AW5B 3X41A 1UCKA 4OVNF 1PPJE 1L0LJ 3DGYA 4W7YA 1LTBC 5KLIB 3VGNA 3PJSK 4C7NA 1ZRTD 1CEWI 1AVOA 1BVIA 6STDA 1BUQA 1O7GB 1IQXA 2XSHB 1BE3E 3L70E 1X0TA 4DJGA 1OUNA 2HLOA 3A7OA 3EN1B 1RE3C 3D3LA 3AE3C 2Q07A 2M3EA 3HE4B 1I3FA 1BAOA 1UI7A 4O02B 3CXC2 4PD4D 1FGTA 2XRXB 1OF5A 4UB8E 1Q81Q 4JYCA 3EB8A 2WTYA 2IYPA 4GT1A 1MFZA 3DGOA 1AQZA 3E1RA 2NPSC 4AKZA 1QL1A 1NWWA 1PFPA 3KYQA 1SQQE 2P58A 1YNVX 3ECFA 3IJEB 5KLVG 1H0TB 1RY3A 3RL0C 2JQ5A 1NO4A 3CMA3 1YYCA 1BGYD 3PGBA 1YJ9P 4FMAA 5IEOA 1SQBG 2WOFA 1ASKA 2ZT9C 4RO0A 4IIAA 3EN8A 1VQ93 2O1JA 3E7KA 3L74J 1NTMD 5CCHD 3I0YA 1BSCA 1JTHB 4BL2A 1MV8A 3IFMA 5APQA 1JB4A 3L37A 3F8HA 4HB1A 5D81A 2QEX3 4U13A 2N1TD 3I55P 3MG3A 1BUJA 4BL3A 5KAFE 1S72P 2H0IA 1WRGA 3WR2A 4QMAA 3LIEA 1KQGB 2P05A 5G1KA 1KC84 2A45I 3NMDA 3MPHA 2IBZG 3BNDA 2FFDA 3CCQ3 2OYIC 3OW2O 4U3FJ 2W6BA 2IYJA 1QEXA 5CMZA 4K1UA 3HK4A 3N9HA 4FCMA 3STDA 2KSEA 2FNQA 3F7SA 3EQQB 4PEJA 2WITA 4HM6B 3RK3D 3BB9A 3A0BH 4BTXA 1YIT3 1EUIC 3S29A 3SVAA 3S4RA 1SQVE 1M1JB 1NOHA 4Y28J 3HX8A 1GOVA 1A2PA 4WY4B 3V2NA 4UB6E 1OWAA 3M8CA 4WYKB 1WT6A 5STDA 3T8UA 2IFMA 3EX9A 2K54A 3RGRA 2CW9A 4O2HA 3J7Yd 1FGMA 3GHGC 1WNHA 1CW5A 3D5IA 1DEEG 1L0LG 2XGNA 2F98A 3BU4A 1G2CA 1SFCC 3KHUA 1UUGB 1LJ2A 1NWQA 3AE5C 1L0NJ 2STDA 3F8XA 1BANA 2B87B 2IA7A 1LOVA 1LT9C 2BCCJ 3L74E 1JNQA 3RK2D 3MD0A 2MF7A 1Z56A 2Q1KA 3JUQA 3CX5I 1B2MA 3SWKA 4JF8A 4DOJA 2KF3A 4D6TJ 2QJPB 3GSPA 3A76A 3H1LD 2P1JA 1A02J 2GSPA 3VSYA 1K04A 2BMRB 4X2HA 5BU8B 1PP9E 3G16A 2KOGA 3HD7C 2FYUD 2ZYGA 1HF9A 1NB5I 2WSCJ 1GW4A 1LRAA 4K3AA 2E76D 2L5GB 2ML6A 2BT3A 1Q9EA 4KT3B 1GOYA 1OHSA 1T3JA 1SIHA 2AXTH 2FYNC 3BASA 1RJOA 4YXDC 3BCCJ 2I1KA 3Q90A 2KF6A 3SFDC 2JDIH 1UCLA 2KLVA 1TU5A 3WA2X 4M3LA 1KQFB 4N78E 1N2DC 2Q9IA 1E5WA 3KZTA 5D83A 2OWPA 3B5NB 3CX5H 2E42A 1RDSA 1RHZB 2KLUA 3AE7C 5AW4B 2HMOB 1QVG2 1WQLB 2CIUA 1CZQA 2LXBA 5BU5A 4QWTA 4WWUC 1X9VA 2L4VA 2I9WA 2O1KA 2KZJA 2WPVB 1W00A 3L75D 1L0NE 5H2FE 5APTA 2B1XB 3L71D 4WVZA 2BCCE 3H1IJ 4XA4A 2CWTA 3II6A 4HOHA 2ZXXA 2M3BA 1VQ83 2C0WA 1N5HA 3E1IA 3FGYA 3QRDA 5RNTA 3P8MC 2PAJA 1GW3A 1KC8Q 2OYHA 3V2PA 3C1LA 4OWFA 3CC7P 3EFFK 3TGUD 2XV5A 5APVA 1GDTA 4N6TA 2YMYA 3SYUA 3MUDC 3FH1A 2HPCB 1BNRA 3UIAA 3JUNA 3MYTA 1RGCA 3S1KA 1N7SB 1JJ22 3LTCA 1HBWA 1MFTA 6RNTA 1NTZK 3S5CA 1W2EA 4DZOA 1J2JB 4FMCA 4WWIA 4BRYB 1AVLA 2Z6BA 2NRGA 2W56A 1SS1A 4RJTA 1Q864 1TIJA 3JC22 1FDMA 4XBTA 3IAOA 3RK3E 1GD2E 3OXAA 1BNIA 3L73G 2OTLP 1G1JA 4R9KA 2N1TA 3L72D 1ZN5A 3SOYA 2GU3A 4ASVA 1NNVA 4J8TA 1HUCA 2OARA 1KB9H 2Q5UA 4HJGH 2GBXB 1PGQA 3M0DA 5APYA 1LNHA 1EKMA 1NGMB 2ZVOB 3IPTA 1VPCA 3MHVA 1NU1K 3LIDA 1OCVA 2B9BA 5IW9A 4D6TG 4LEHA 5AYRB 2RN0A 1U8CB 5B5EH 1T2HA 4ZM8A 1X1YA 3HTKA 3H1IE 1M904 1GL2B 1HJ0A 4CCVA 3CU3A 1NU3A 5AW2B 4NHFA 3MWZA 1IK3A 3SFEC 2KS1B 1BIRA 3CPOA 1LWUB 1NU1D 5AEUB 4HZBB 1AV1A 2YFLB 3H1LE 1VQKP 3G713 2Y0DA 4FCJA 4K1VA 2PP6A 1B27A 2C9LY 1M1JC 1YTZI 2BASA 1RN4A 1URQD 2LKMA 5TISE 2A15A 1YTZT 1CI6A 2KNCA 4WY4C 2WSFJ 1JN5B 4A7PA 2WVRA 1AQ5A 1IV7A 3A2AA 2XH9A 2OOVC 1ZO2A 2QG4A 3NUVA 1Q824 1Q2NA 1OFCX 1W5ZA 1KN7A 2YKPA 4N6NB 3G6E3 4IL6E 2RBIA 1X79B 2F56A 2OCTA 2Q3EA 4KT0J 3NV0B 2V7QH 1RGHA 2N9BA 4H44D 3SX1A 3T97A 1N5PA 3S27A 3OWSA 5KP4A 2ML5A 3CCL3 3F7XA 3F14A 1I2GA 2HMJB 3T0UA 3D5GA 3CNMA 2E5TA 1BRIA 4EOTA 2R3CA 2QJKB 3PS8A 3TF5A 2OTJP 5AVZB 1VQ6P 4GB5A 4XM4A 1FZUA 4HYZA 3RL0B 4TX4A 1BRHA 4R9LA 2E43A 1BE3D 3L70D 1B2SA 4J5KA 1B20A 1M1K4 4H0LD 2ZT9B 4R4LA 4FMBA 2O3OA 3Q5SA 3HOHA 5CF2A 3CX5D 3CWBD 1RN7A 1QVGO 2FY8A 3Q5RA 2OTJ3 5M18A 2D2CD 5E79H 2SBLA 1BNGA 1ZGXA 4JPZB 1SQQK 1NTKG 2O01N 5CHXA 3LH4A 3VOPA 3NXJA 4I4KA 3H1JE 3EBYA 4HM1B 4NPDA 1MWTA 2HOHA 1FZCB 1Q40A 1DE3A 1RE4C 3FX0A 1K9M4 1DH3A 3MKIA 1SQXG 2O3JA 3CCUP 1RGKA 1YJW3 1Y8AA 1W6CA 2C9NY 3A0HH 2F5MA 3Q2PA 4LMIA 5IG0A 3ER7A 3U59A 1GD3A 3WHOA 2WOHA 5IG4A 1Q7YQ 2GM4A 2HMNB 2ZYAA 2IFNA 2OYIB 1SQQD 2Q3IA 2F5WA 1L0LK 1N73A 3LTBA 1YJNP 2KP8A 3LOYA 8CHOA 3KSED 1BSHA 1IFJA 2H89C 3MHEA 3PH0A 3AEBC 3IN6A 3NX0A 3CCU3 3D79A 3D9RA 1VQOP 2FXTA 2LYXA 3D71A 1ZR2A 1BCCD 2PFXA 2A06G 3G3ZA 1JY2P 1HWTC 1NAYA 1B21A 5AYSC 1AVKA 4L8OA 1YGEA 1CYUA 3SLUA 1NTZE 4WBAA 1US1A 3HE5B 5KLVJ 1T2KD 2UX0A 1M90Q 2POHA 3U97A 3HIGA 2WGQA 1SQBJ 3GHGB 3VMAA 4KFFA 1RQVA 3N54B 1S9KD 1SFCA 5CJ4A 3A0BE 2Z76A 1QVF2 1WMNA 3L35A 1N7SC 3X3ZA
chains in the Genus database with same CATH topology
5G2GA 4FMAA 5IEOA 1YHQ3 3H3HA 3UNLA 2WOFA 1ASKA 4EC6A 3E99A 4IIAA 3EN8A 1VQ93 1VQK3 3EHCA 3I0YA 2MC8A 3NV0A 1AR0A 4RBNA 4HBRA 4STDA 3DGNA 2BNGA 1WTHA 3EC9A 3CC43 1JB4A 3F8HA 5D81A 1DVCA 2QEX3 1RRHA 4U13A 5JPPA 1DMMA 3CC23 5AIIA 3MG3A 3NM2A 4MJDA 3FG1A 3B4OA 4HM0B 4KFDA 3NBRA 1VQ53 3KKGA 3GZYB 4QMAA 3CCV3 3CCR3 3WOEB 3GAXA 1KC84 2P05A 3MPHA 1O7NB 1UUVB 4RNZA 3BNDA 2W9PA 2RFRA 1NDOB 2RSXA 3CCQ3 1TUHA 2CFWA 4MMZB 5IERA 3NBBA 3B8LA 4K1UA 2C11A 3LT9A 5EEOA 3FZWA 2P09A 4N6UA 3HK4A 3N9HA 4FCMA 1DYUA 1RKYA 2CFKA 3EBTA 3STDA 2FNQA 3F7SA 4N6LA 3EQQB 4PEJA 3OV4A 1O7WB 2CG0A 4HM6B 2E2VA 3BB9A 4XBYA 2M7OA 4BTXA 5AIFA 1A90A 2CG1A 1YIT3 3NBJA 5LC7A 3S29A 4FMDA 1IU7A 5AIGA 3SVAA 3CME3 1ULJB 1VZZA 2D1WA 1O7MB 3OX9A 3HX8A 5DREA 1VQ63 3LTDA 2BMOB 2GXFA 1UW1A 3M8CA 4WYKB 2ZL8A 4FR9A 3PZWA 5STDA 2IMJA 3T8UA 3EX9A 3USSA 2K54A 2WO0A 3X3XA 3RGRA 2CW9A 3UB1A 3O8YA 3FG3A 4O2HA 7STDA 3J7Yd 1FGMA 3SOAA 1WNHA 1IDPA 2WGOA 3H51A 2Z7AA 3F9SA 1ULIB 2XGNA 1OHOA 5JBSA 2F98A 4G1MB 3EJVA 2BMQB 4AKYA 2W56B 1VQM3 5IEPA 3LTAA 1DMQA 2STDA 1C7HA 4O3VA 1SPUA 3F8XA 3JUMA 2IA7A 3WA3A 1OGXA 3CCJ3 1JNQA 2P0XA 2MF7A 3KSPA 4CDLA 3KN4A 1K734 3JUQA 2F99A 1O7HB 3B4PA 4JF8A 1U5OA 3N8BA 1GS3A 2P0MA 3LXUX 2OQEC 4IT7A 3GWRA 3S67A 1PU4A 1NJI4 1MOLA 3A76A 4ORLA 4L8PA 3VSYA 1OGZA 2BMRB 1LOXA 5FGOA 4X2HA 4J9AA 1IT7A 3G16A 1YJN3 3CCM3 1IQ8A 1ISKA 5I97A 3WMDA 2RGQA 3V92A 1CYVA 1STFI 1SIIA 1GD4A 2P38A 1NB5I 1R4CA 4BTYA 1JB5A 3LT8A 1VQO3 1GYBA 2QE7H 3DGLA 2ML6A 2BT3A 4MEIA 3AMOB 1OHSA 1SIHA 1HU9A 1RJOA 1S5AA 2W0QA 4MMYB 3Q90A 1W2B2 4GL6A 3NQYA 1QMAA 1ZX2A 5AI1A 1GY7A 2JDIH 3EF8A 1TU5A 3WA2X 1E3VA 3QK9A 3PYJA 1CQSA 1JKGA 1A2KA 3KZTA 5D83A 2OWPA 4EBGA 3UL6A 3UJMA 1KSIA 4Q53A 2QIYA 2D42A 2XR8B 2OQEA 5IG5A 1A2VA 4KVHA 3VF1A 3FF0A 2CWVA 2FGTA 1W6YA 1YJ93 4HJLB 2HMOB 3Q1CA 1QVG2 1FUWA 1WQLB 2CIUA 4FCZA 1W02A 4QWTA 4WWUC 1VQL3 2CFDA 2L4VA 2I9WA 1QAFA 2LQVA 1IVVA 2CK3H 1W00A 3UL5A 4EV2A 3DGMA 5CXOA 3RDEA 2BHMA 3MSOA 4YXWH 5BXQA 1N8R4 4OVMA 2V1LA 2B1XB 1E97A 4WVZA 2XSOB 3MG2A 4N6OB 2CWTA 3U1WA 1AV4A 1VQ83 3PCRA 2ZDJA 3DZLA 1DVDA 1N5HA 3FGYA 3QRDA 3I553 2R4IA 4KFEA 2XNDH 5TGNA 3F40A 4HM8B 4R1KA 2PNCA 1S723 1BSNA 2B24B 2E2UA 3L0RA 4JRFA 4OK0A 1UUWB 3EFFK 3DMCA 1FA3A 4MMXB 2IUJA 3DM8A 4N6TA 1W2ZA 3FH1A 3CPW2 3GZBA 4WYKA 5AEWB 3IMAB 3JUNA 3LYGA 5CF1A 3MYTA 2KCDA 2OOVA 1JV2B 2W6JH 1JJ22 5JPUA 3LTCA 1WMPA 1F8NA 5DRVA 1VQ43 3S5CA 1YIJ3 4FMCA 2YFIB 2W03A 1IVWA 3K7CA 3FF2A 1AVLA 2QA43 1JB2A 2Z6BA 1W7CA 2W56A 4RNYA 1EQKA 3MG1A 4EXRA 1Q864 1TIJA 4WFOA 2F86B 2IUKA 4XBTA 3OXAA 4K90B 2XGLA 1GY6A 3S28A 2Y73A 1QALA 3NHXA 4R9KA 1Q42A 4XDWA 1Q40B 3CNXA 5IENA 3SOYA 2GU3A 5KP1A 3WODG 4K61A 1W01A 4J8TA 3X42A 2HMLB 4AEQA 4TLFA 5BVBA 3SXXA 1UI8A 1V74A 2GBXB 4HM3B 3ALAA 2K0MA 1LNHA 2W2CA 1EKMA 5CLKA 3IPTA 2GBWB 3OWYA 1YVBI 2HMKB 1OCVA 5LC6A 1M1XB 5IW9A 4H61A 4LEHA 5AYRB 1Q814 3K63A 1HKXA 5CK6A 4KZ1A 1O7PB 3JUOA 1IT8A 1U8CB 4ZM8A 5A0OB 1M904 1KD14 1STDA 4CCVA 3CU3A 3K5TA 1NU3A 3X3YA 1QJGA 3AMOA 4HM7B 1VQ73 4NHFA 3HI7A 1OF5B 3MWZA 4H3UA 1VQP3 1IK3A 2XEPA 4XB5A 4WHAA 3X3ZA 1EG9B 1K41A 3BNBA 1JEKA 3CPOA 2C10A 2BO9B 3K0ZA 5FW5A 1VQN3 3PXMA 5AEUB 4HM4B 4HZBB 3EE1A 3LZAA 3OW22 3WOFB 2YFLB 2WSSH 3CCE3 2KRTA 1SQWA 3G713 3G0KA 1E3RA 1G96A 4FCJA 3JVCA 4K1VA 1FGQA 1IVUA 1AQTA 1IVXA 2A15A 1MNLA 3G8ZA 3NQZA 4OUQA 2CHCA 1JN5B 1FS0E 5IG3A 1IV7A 4HZ9B 3SEDA 3V99A 2XH9A 4X2OA 2OOVC 1ZO2A 5D82A 3NUVA 1Q824 1D6YA 3GZXB 1W5ZA 2E2TA 1SJWA 4N6NB 3G6E3 4NREA 3PCSA 2OCTA 1N9JA 1ROVA 3NV0B 1JKGB 2V7QH 2XFSA 3CCS3 4RZMA 2INXA 1J2BA 3SX1A 1TFOA 1D6ZA 1N9EA 1N5PA 2Y74A 4L7KA 1QAKA 3S27A 3OWSA 1JRQA 2CFLA 3G4S3 5KP4A 4LGQA 4O8SA 1RRLA 5IF6A 1L5GB 2ML5A 1IQYA 1GY5A 3CCL3 3F7XA 3F14A 3B7CA 3HIIA 3FLJA 5AIHA 1IFPA 2HMJB 3KE7A 3T0UA 2W9QA 3BNEA 3CNMA 2E5TA 2E5YA 4HM2B 1A67A 2O9UX 3I563 3T8NA 3KIIA 3WDGB 1FGRA 1LXEA 3PS8A 3DXOA 3TDGA 3DUKA 2XFTA 4GB5A 4XM4A 4HYZA 3FG4A 2CC3A 2YX9A 4R9LA 3OWUA 4TX4A 1OPYA 2Z77A 1WMOA 5ELUA 4R4KA 4HM5B 1OHPA 3BLZA 1OH0A 3DY5A 1M9GA 1M1K4 2GEXA 2CH9A 3NM7A 3ROBA 2HMMB 4FMBA 2O3OA 1E79H 4N3VA 5CF2A 1K28A 3CC73 2XF3A 4BTWA 1TFKA 1RN7A 1W6GA 2RCDA 5EVHA 2OTJ3 2GEYA 4IPBA 3X40A 3X41A 1Y4KA 2SBLA 3HZPA 3FSDA 1Q7Y4 3LH4A 3FCSB 3NXJA 4I4KA 1TP6A 2QGUA 3EBYA 3VGNA 3V98A 2KXGA 4HM1B 3PJSK 1W4NA 1Q40A 2GU1A 1CEWI 2CWUA 1K9M4 3MKIA 4LZIA 4LSOA 1ROAA 6STDA 1BUQA 1O7GB 1YJW3 1IQXA 1W6CA 3Q2PA 2XSHB 1D6UA 4LMIA 4WP5A 5IG0A 4EYCA 3ER7A 1GD3A 2W04A 1OUNA 4DJGA 2WOHA 1EA2A 1KWIA 5IG4A 5ELJA 2HMNB 1NB3I 3EN1B 1KQS2 5EQLA 3CD63 1IV9A 3GRDA 3D3LA 2OTL3 4HKVB 3LTBA 2Q07A 3LOYA 8CHOA 3KSED 1BSHA 3MHEA 4R80A 4N6MA 1UI7A 4O02B 4EV5A 3NX0A 3CCU3 3CXC2 3D9RA 2FXTA 2LYXA 4N6V0 2CKFB 5KP3A 1FGTA 2XRXB 1OF5A 5AYSC 1AVKA 2CFGA 1NO3A 3EB8A 1YGEA 3KFQC 4L8OA 1US1A 4XBXA 5HGRA 3SLUA 1CYUA 2UX0A 1DMNA 1Z1SA 3DGOA 3BNCA 3U97A 2PZVA 4HVNA 4AKZA 1LVNA 1FGOA 1NWWA 1PFPA 2WGQA 3HIGA 3K9MC 4XDVA 1YI23 1T5YA 1N8QA 1K8A4 3LMLA 3ECFA 1JN5A 3IJEB 2YFJB 3GZRA 3JUPA 4KFFA 2JQ5A 3N54B 1QVF2 2Z76A 3CMA3 1WMNA 3PGBA 1OACA 3RGAA 3FKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E79 H;  1IFP A;  1BSN A;  4DJG A;  1JEK A;  2JDI H;  3EFF K;  4QMA A;  2CK3 H;  2E5T A;  2E5Y A;  2WSS H;  4YXW H;  2V7Q H;  4WVZ A;  1AQT A;  1BSH A;  3USS A;  3PJS K;  2W6J H;  2QE7 H;  1FS0 E;  4TLF A;  2XND H; 
#chains in the Genus database with same CATH topology
 5G2G A;  1L4A B;  1YHQ 3;  3H25 A;  3HUS C;  1K8A Q;  2MC8 A;  1A02 F;  2XNX A;  4RBN A;  4HBR A;  3DGN A;  3CC4 3;  1Q82 Q;  1SQV D;  3JCU H;  1JCC A;  3NM2 A;  4ZKU A;  1V58 A;  3A3Y B;  2ZXE B;  1OVU A;  4KFD A;  3TSI A;  3NBR A;  1VQ5 3;  3HD7 B;  2L91 A;  2PRR A;  3CCR 3;  1MWS A;  1RGL A;  2AXC A;  5CCH C;  1IYY A;  2W8Z A;  4RNZ A;  1OW6 A;  4H13 D;  2R32 A;  3MGN A;  3NFQ A;  2IYO A;  2C11 A;  1DYU A;  3B71 A;  5TIS H;  1GSP A;  3U1C A;  3RL0 g;  1BDD A;  3FWN A;  3OV4 A;  2K9J A;  2IZ0 A;  2CG0 A;  1JZO A;  2M7O A;  3L74 D;  1A90 A;  1RSN A;  3NBJ A;  4FMD A;  1IU7 A;  5AIG A;  3M9Q A;  2YIU C;  5DRE A;  5KLV E;  2R41 A;  2BMO B;  3AEE C;  1FZF A;  2ZL8 A;  3CCJ P;  2H0G A;  1M1K Q;  2IMJ A;  1NH4 A;  2AXT E;  3USS A;  3X3X A;  1SQB E;  1P84 H;  3CL3 D;  3O8Y A;  2HOD B;  4N6J A;  1U7J A;  1BSD A;  5HOH A;  2H8P D;  4DCK A;  3SOA A;  3H51 A;  1PP9 D;  2Z7A A;  1ULI B;  3F9S A;  3D70 A;  2BMQ B;  1VQM 3;  1IO4 A;  1DMQ A;  5DJU B;  1GOU A;  3JUM A;  3H1H J;  4U3F D;  1B2U A;  3CCJ 3;  1PZQ A;  5AW9 B;  1K9M Q;  2J58 A;  3C9I A;  3CWB E;  3CX5 E;  3GMA A;  3DH2 A;  1JOC A;  4CDL A;  3HE4 A;  1J1E B;  1U57 A;  4IT7 A;  2OQE C;  2WT7 B;  2WPR A;  1BRK A;  5AW6 B;  4N78 D;  4NPB A;  2PGD A;  1L0N K;  2GA1 A;  1LOX A;  1LOY A;  1KFM A;  1PGJ A;  1I70 A;  2BIR A;  3CCE P;  2QJY C;  4O9B A;  1I0X A;  3V92 A;  3H1K J;  4OH8 B;  1Q90 D;  1STF I;  1SII A;  2P38 A;  3V2Q A;  2QJK C;  3LT8 A;  4MEI A;  1H0T A;  3AMO B;  1R5S A;  2J8X B;  1SQP J;  1S5A A;  1GK4 A;  3CXH H;  1IFI A;  2WSF H;  1L0N D;  1X1U A;  4GL6 A;  1QMA A;  2BCC D;  2KSJ A;  1T6A A;  1EZV G;  2OTK E;  1BCC E;  1E3V A;  3QK9 A;  1HTL C;  1SLQ A;  4PV1 D;  1KFN A;  1JTH A;  4EBG A;  1ZW0 A;  1KSI A;  4D6T D;  3TK1 A;  1L0L E;  1EDJ A;  2D42 A;  2XR8 B;  2HFE D;  1A2V A;  1QL2 A;  4KVH A;  1JBS A;  2CWV A;  1PPJ G;  2FGT A;  1YJ9 3;  1CSB A;  2E75 B;  1OIP A;  1FZC C;  4FCZ A;  1W02 A;  2CFD A;  1KIL C;  2V7Q J;  1RF0 C;  1LTI C;  2WWW A;  1S9K E;  1T3B A;  2WZ7 A;  4YXW H;  5BXQ A;  3I56 P;  3MG2 A;  4N6O B;  1VF5 D;  1BRG A;  2JEE A;  3JSV C;  2ZDJ A;  1KB9 E;  3DZL A;  1DVD A;  3BCC D;  3I55 3;  3NXS A;  1JO5 A;  5TGN A;  4HM8 B;  1N8R Q;  1GMP A;  1S72 3;  1EXJ A;  1BSN A;  1VQ4 P;  1QVF O;  4JRF A;  3B4S A;  4HYT B;  1EQ7 A;  4MMX B;  1M1J A;  1NVO A;  4GOF A;  3DM8 A;  4I5Q A;  5B5E E;  5KAI H;  3GZB A;  4WYK A;  3LYG A;  5CF1 A;  1J1D B;  2KCD A;  2OOV A;  1LTJ C;  1JV2 B;  1R4Y A;  3D6Y A;  1ZXG A;  2SPZ A;  1NHL A;  2Z5H A;  3O6Q B;  5DRV A;  1VQ4 3;  4U7J A;  3L73 J;  2IPP A;  3K7C A;  3FF2 A;  1BDC A;  1BSE A;  1W7C A;  1RF1 B;  2B89 A;  5CJ0 A;  2M0B A;  3H1I D;  1L4A C;  1PIX A;  4KJM A;  4OGQ B;  5AVT B;  3Q2Y A;  5M1B A;  3NHX A;  5G1L A;  4DKI A;  1Q42 A;  4XDW A;  1JMM A;  3GF7 A;  3CNX A;  3WOD G;  3Q3F A;  2HML B;  4AEQ A;  4TLF A;  3H1H G;  3SXX A;  3ZFZ A;  1FZA A;  1FC2 C;  2YKO A;  1YQ3 C;  1BNS A;  3OWY A;  2IBZ I;  1YVB I;  2BU4 A;  2HMK B;  2K1A A;  1X1X A;  1MUU A;  1JZD A;  2NPS D;  1NTM J;  5KJ7 A;  1BSB A;  3M9H A;  1BRJ A;  4U3F E;  1RTU A;  3RL0 D;  4HM7 B;  2M5A B;  3RNT A;  4WHA A;  3H1K G;  2K88 A;  3BNB A;  1JEK A;  3K0Z A;  2ZT9 D;  3PXM A;  1LTA C;  5AVX B;  1SQW A;  2QSI A;  3VMY A;  1SQP G;  1FGQ A;  1S3J A;  1RE4 A;  1AQT A;  1IVX A;  1FZE A;  3CCS P;  1NYH A;  2R5B A;  2FKW B;  1MNL A;  3NQZ A;  3B5N A;  2H7H A;  4IFD K;  2AEJ A;  2CHC A;  3AHS A;  4CPK A;  5IG3 A;  4X2O A;  4IFF A;  4I6M C;  3CC2 P;  3TYY A;  1LQM B;  2E2T A;  3L73 E;  1SJW A;  5E79 E;  4NRE A;  2BEZ F;  2N9Y B;  3CCV P;  2XFS A;  3CCS 3;  2INX A;  1KQL A;  1S5L X;  1EXI A;  1URQ C;  2HG5 D;  4O8S A;  7GSP A;  1RRL A;  4L73 A;  4K35 A;  1GY5 A;  3A0H E;  1KB9 I;  1FW7 A;  1JY2 O;  1ZOY C;  4D6T E;  1DIP A;  3FLJ A;  1J1E C;  1QX8 A;  1HVV A;  3HII A;  2MJZ A;  1FUS A;  1HGZ A;  3KE7 A;  1XTG B;  3H1J D;  3CME P;  4L75 A;  3T8N A;  2R44 A;  3DXO A;  2HPC A;  3DUK A;  2XFT A;  3FG4 A;  5AVS B;  2E74 C;  1JUN A;  5ELU A;  4HM5 B;  2KZI A;  4RES B;  1OHP A;  1HH0 A;  1M9G A;  4EIJ A;  2WPS A;  3HUS B;  2OYH B;  2F4Y A;  1NTK J;  4JF7 A;  3CC7 3;  1K28 A;  1SFC D;  4BRY A;  1IZN B;  3BCC E;  4BTW A;  3ITK A;  2ZYD A;  5EVH A;  2GEY A;  4IPB A;  1SQX J;  2KK7 A;  3CD6 P;  4EYY Q;  1Y4K A;  2JR8 A;  1BRS A;  2R3S A;  3FXE A;  2FYU J;  1Q7Y 4;  3FCS B;  1TP6 A;  5CCG C;  2KXG A;  4GIF A;  2GU1 A;  2CWU A;  2XKM A;  1NTZ D;  4LZI A;  1USE A;  1ROA A;  4N3Y B;  2Y9Y A;  2K3D A;  1FAV A;  2W04 A;  3D4A A;  1GZL A;  1LGH B;  1RCL A;  2E75 C;  2XU6 A;  5KKZ C;  1KQS 2;  3CD6 3;  3KXD A;  3GRD A;  2OTL 3;  4HKV B;  1S1C X;  1JY3 O;  4AQR D;  2J59 M;  3VMX A;  2N1T B;  4N6M A;  1BGY G;  1GL2 A;  3JCU E;  4HH2 A;  1NKZ B;  1TU3 F;  4AYC A;  1PV3 A;  5AW3 B;  4I7Z B;  2FXO A;  2UWJ E;  2CPB A;  4N6V 0;  2CKF B;  5KP3 A;  3AED C;  1HGV A;  5BIR A;  2RNT A;  2J5U A;  2Z4E A;  1NTM G;  1S2E A;  2KS1 A;  2ZHX B;  3B8E B;  2YIU B;  3KFQ C;  2IZ1 A;  1LWU A;  2WPQ A;  1DMN A;  1Z1S A;  3BNC A;  2JJL A;  4RNT A;  1DEB A;  3K9M C;  4XDV A;  4BIR A;  2FFD C;  1T5Y A;  1K8A 4;  1JN5 A;  3RK3 B;  2YFJ B;  1J1D C;  2P67 A;  1ZV8 A;  1OMI A;  1OAC A;  1PFI A;  1TRP A;  3H32 B;  1RE3 A;  3CI9 A;  3TNU B;  1VQL P;  3H3H A;  5KLV K;  4EC6 A;  3E99 A;  1T2K C;  1VQK 3;  3EHC A;  3NV0 A;  3TGU J;  1RF1 C;  1SQX E;  1SQB K;  1RGG A;  2BNG A;  1P84 E;  2H88 C;  3EC9 A;  8RNT A;  1OZH A;  1LTG C;  6GSP A;  3V2R A;  4OGQ C;  1ZME C;  1DVC A;  1RGF A;  1VDF A;  5JPP A;  1DMM A;  5AII A;  2QIW A;  3VP8 A;  3BRV B;  5KLV D;  3B4O A;  2G3A A;  4HM0 B;  1SP4 A;  1RNB A;  3HRN A;  3RK2 B;  2QJY B;  2NPS A;  5GTH E;  1O7N B;  1SQB D;  1UUV B;  2WQY C;  2W9P A;  2RFR A;  1NDO B;  1TUH A;  1OVR A;  2CFW A;  4MMZ B;  2YXQ B;  2A06 E;  3B8L A;  2AEF A;  5EEO A;  1RLS A;  3FZW A;  3N7N A;  4C46 A;  1RKY A;  2CFK A;  3EBT A;  3WUT A;  2KXP B;  3L72 J;  4N6L A;  2E2V A;  2QRX A;  3PRJ A;  4GOD A;  1PY3 A;  4XBY A;  5AIF A;  2CG1 A;  5LC7 A;  3O8Z A;  5AW1 B;  5BVZ A;  2QA4 P;  4PD4 H;  1VZZ A;  2D1W A;  3OX9 A;  1WMK A;  1VQ6 3;  3LTD A;  2E76 B;  1LTS C;  4H13 C;  4FR9 A;  1IJD B;  2FXP A;  2IBZ D;  3H1L G;  3UB1 A;  3FG3 A;  3CXH E;  2RH0 A;  7STD A;  3AEG C;  1KIL B;  1NKN A;  1RF0 A;  2ITA A;  3SSU A;  3OA7 A;  5K5G B;  2WGO A;  1OHO A;  5JBS A;  2FYU G;  3EJV A;  3LTA A;  4O3V A;  1C7H A;  1SPU A;  2YXR B;  2OYI A;  3WA3 A;  2WMM A;  1RGE A;  2P0X A;  2YO2 A;  3KSP A;  1GU4 A;  1K73 4;  2JO1 A;  5CBN A;  4CJN A;  1U5O A;  4L74 A;  4W80 A;  3LXU X;  3S67 A;  2H0H A;  3AE6 C;  1PU4 A;  4LYL B;  4ORL A;  3FWL A;  1VQP P;  2ZJS E;  4L8P A;  4C7R A;  2FXM A;  4GSP A;  4RKU J;  1OGZ A;  3HE5 A;  1VQN P;  1L0L D;  1IT7 A;  1YJN 3;  1MKM A;  1ISK A;  1LTJ B;  1NJI Q;  5I97 A;  3RGU A;  1CYV A;  4NPF X;  4WY4 D;  4BTY A;  3GHG A;  1S5L E;  3H6P A;  1R8E A;  1VQO 3;  1UII A;  2W0Q A;  1Q7H A;  3L75 G;  2KI7 B;  3KDP B;  5APW A;  1W2B 2;  3NQY A;  1L4A A;  1GY7 A;  3L71 G;  3EF8 A;  1LT9 A;  2OYH C;  5KAI E;  1KB9 D;  1TJD A;  2AAE A;  1KMI Z;  1CQS A;  4EI2 A;  1JKG A;  1KQS O;  3UL6 A;  3P8C E;  2QIY A;  3MTU E;  5GTI H;  4GHO A;  3Q1M A;  2YNY A;  1P84 I;  1SQP K;  2OYO A;  1W6Y A;  1PGP A;  2IX7 C;  3TGU G;  4I1L A;  1IFN A;  3VP9 A;  3HD7 A;  1QAF A;  2LQV A;  1IVV A;  1YBK A;  4EV2 A;  5CXO A;  2BHM A;  2JWA A;  1N8R 4;  1LT1 A;  1E97 A;  1BRN L;  1JY3 P;  3U1W A;  1T8Z A;  2K37 A;  3A5E A;  2GUV A;  5KJ7 D;  4L76 A;  2R4I A;  1I3I A;  1R5L A;  1K05 A;  2AAD A;  2N1T C;  4KFE A;  4R1K A;  4I7Z C;  1LNI A;  1AJY A;  3M0D C;  3M06 A;  2LXC B;  4OK0 A;  1UUW B;  3DMC A;  1SVF A;  3AEA C;  2IUJ A;  3SWF A;  1B3S A;  1KYO I;  1LP1 B;  3L72 G;  1W2Z A;  3CPW 2;  1VF5 C;  5AEW B;  3IMA B;  2WSE J;  1TRQ A;  1JY2 N;  2ZFC A;  1LOW A;  2HOD A;  1WMP A;  3B5N D;  2YMK A;  3CXH I;  2YFI B;  3RK3 C;  1PGO A;  3EFG A;  1JB2 A;  1AFO A;  4RNY A;  1OX3 A;  3MG1 A;  3R2P A;  1MGW A;  1URQ B;  1G1I A;  4K90 B;  1FZB A;  1GMJ A;  3S28 A;  5GTH H;  1FOS E;  4EW5 A;  5AW8 B;  4C7N B;  5IEN A;  4PJ0 H;  5KP1 A;  3ABV C;  4Z1M H;  4K61 A;  1W01 A;  4BWN A;  3AGN A;  1NU1 G;  4YPC A;  5AVU B;  1UI8 A;  5BVB A;  1JB0 J;  2WT7 A;  1V74 A;  4HM3 B;  2W2C A;  2IBZ E;  3RBZ A;  1I0V A;  4H44 B;  1FJK A;  3KZI H;  4TT3 H;  3MUD A;  2GBW B;  1K73 Q;  1FDI A;  4KHX A;  5LC6 A;  1KYO H;  3KQG A;  2E74 B;  2KYV A;  3RK2 C;  2A45 G;  4KZ1 A;  3JUO A;  3GG2 A;  3KPE A;  1JCD A;  5A0O B;  1GU5 A;  3AEC C;  1B2X A;  1STD A;  4JYB A;  3LW5 H;  1BNJ A;  3L73 D;  3X3Y A;  1JBT A;  1QJG A;  3AMO A;  5APU A;  1M56 D;  3HI7 A;  1OF5 B;  1N7S D;  2XEP A;  1EG9 B;  5AVQ B;  3CMA P;  1SQV J;  1K41 A;  5FW5 A;  1RHL A;  1JY3 N;  3IR9 A;  5DJT B;  1KD1 Q;  1VQ9 P;  3CCE 3;  1MWU A;  1VQQ A;  2KRT A;  1NTM K;  5CCG A;  1G96 A;  3JVC A;  2I8D A;  1IVU A;  5C39 A;  4H0L B;  4OUQ A;  2E76 C;  1FS0 E;  3EWK A;  4HZ9 B;  3V99 A;  1ZP0 C;  2QEX P;  2Q7C A;  1QLE D;  1Y47 A;  3AHW A;  1D6Y A;  3GZX B;  5KKZ B;  7RNT A;  2D2C B;  3AGO A;  5TJH A;  3PCS A;  3TDK A;  2OQQ A;  2KF5 A;  2W83 C;  2R5D A;  2YKQ A;  1BE3 G;  3L70 G;  3ZG0 A;  4DT0 A;  1D6Z A;  4AUW A;  2Y74 A;  3H1H E;  3CCQ P;  1QAK A;  1JRQ A;  1MWR A;  2CFL A;  2OGU A;  4LGQ A;  5IF6 A;  1L5G B;  1IQY A;  3CWB G;  3ZG5 A;  2Y0C A;  4ZMD A;  1S5L H;  1GL2 D;  3WU2 H;  3B7C A;  3AE4 C;  4ZKP A;  1PP9 J;  3P7K A;  1YIT P;  1FUT A;  3BNE A;  4HM2 B;  1W2B O;  3BIR A;  1A67 A;  3I56 3;  2FFD B;  1FGR A;  2FYZ A;  4WY4 A;  3TDG A;  2SAR A;  1N73 C;  2CC3 A;  2YX9 A;  3OWU A;  1OPY A;  1ZLL A;  3C8V A;  3H1K E;  3L4F A;  2Z77 A;  1WMO A;  3Q3D A;  3BLZ A;  3IF4 A;  3M91 A;  3DY5 A;  1W5C E;  4IL6 X;  3O6Q A;  2GEX A;  3AE8 C;  2CX0 A;  2HMM B;  5AVR B;  4N3V A;  1SQP E;  1PL5 A;  1SQQ G;  1EZV I;  3BAT A;  3G9R A;  2XF3 A;  1M7L A;  1TFK A;  2RCD A;  1RF1 A;  3MIW A;  2B87 A;  1FJP A;  3HZP A;  3FSD A;  1BOX A;  1RQU A;  2QGU A;  3V98 A;  1BCC G;  2G8Y A;  1V57 A;  1W4N A;  4IFM A;  3D6Z A;  3CLQ A;  4LSO A;  2XZR A;  1NTK K;  4HKZ H;  1D6U A;  4WP5 A;  4XFJ A;  4EYC A;  5AW7 B;  1G2C B;  1EA2 A;  1KWI A;  5ELJ A;  1BGY J;  4CPG A;  1NB3 I;  5EQL A;  2A45 H;  1SQX K;  1IV9 A;  5B66 H;  2FYU K;  4R80 A;  1UIX A;  1YI2 P;  4EV5 A;  5L8R J;  3CPW O;  1NTK D;  2M5A A;  4ASW A;  2P2U A;  1JNM A;  1S4X A;  1ZRT E;  2Z5I A;  1IC2 A;  1NO3 A;  2CFG A;  5HGR A;  1SQX D;  4XBX A;  1GMQ A;  1P84 D;  2B88 A;  4LLH A;  2QM7 A;  3GF3 A;  1FYS A;  4H13 B;  2PZV A;  4HVN A;  1KTM A;  1LVN A;  1FGO A;  1YI2 3;  1FE6 A;  1SQV G;  3M9B A;  1UGI A;  1N8Q A;  1MGR A;  3LML A;  2DW3 A;  3GZR A;  3JUP A;  3KCH A;  2QVA A;  3VN0 A;  3BRT B;  1BNE A;  5AVV B;  3RGA A;  3FKA A;  9RNT A;  4IOI H;  1KIL D;  4NPE A;  4PD4 E;  3UNL A;  3URP A;  2A06 D;  3S9O A;  1DET A;  1HZ1 A;  1RCK A;  1T2I A;  1ZR4 A;  1AR0 A;  4STD A;  1GMR A;  3W67 A;  5CBO A;  1WTH A;  4JBZ A;  3BVH A;  1VQ8 P;  1IK9 A;  3L74 G;  1RRH A;  5KLI C;  1KYO D;  3CC2 3;  1NAF A;  2LR2 A;  4MJD A;  1OW7 A;  5AVY B;  1DX7 A;  3FG1 A;  2JWD A;  3KKG A;  2L1S A;  4UB8 H;  3GZY B;  3CCV 3;  3WOE B;  3GAX A;  1BGY E;  3WUU A;  3CXH D;  4H44 C;  1I2E A;  2RSX A;  1EDI A;  3EQ2 A;  1UDI I;  5IER A;  3NBB A;  1NTM E;  3LT9 A;  2M8R A;  2P09 A;  1PP9 G;  1IFD A;  1HJB A;  1FOS F;  4N6U A;  1OW8 A;  2ZA4 A;  1RN1 A;  1N7S A;  2Y9Z A;  2WSE H;  3RBX A;  1O7W B;  3HUS A;  3GW6 A;  4U3F G;  1CH0 A;  2Q6Q A;  2O01 H;  1H89 A;  3AE2 C;  3H1L J;  1ULJ B;  3CME 3;  1JM0 A;  1L4A D;  1O7M B;  3P32 A;  5EFW B;  3VTP C;  2GXF A;  1JBR A;  2BEQ D;  1UW1 A;  4ILF A;  3PZW A;  3QH9 A;  1TTO A;  2AEM A;  3FGA D;  1IFM A;  1YVS A;  5KTB A;  2WO0 A;  5M19 A;  1EEJ A;  4ZNC A;  1UGH I;  3V5B A;  3GLM A;  4H0L C;  1IDP A;  1GTW A;  3WUV A;  5AVW B;  4G1M B;  5CCH A;  1EDK A;  4PV1 B;  4HAA A;  3WMM 0;  2W56 B;  4AKY A;  5IEP A;  2P10 A;  3V4Q A;  4XE5 B;  3QWO C;  5KAF H;  1OGX A;  4I2L C;  3HD7 D;  2D2C C;  5GTI E;  3CCM P;  4R4M A;  3KN4 A;  4WB4 A;  2F99 A;  1O7H B;  3B4P A;  1KZU B;  3N8B A;  1L0N G;  1M57 D;  1GS3 A;  2P0M A;  1NJI 4;  2BCC G;  3GWR A;  1MOL A;  1Y9B A;  1FU1 A;  2JKV A;  3AE9 C;  3P8C D;  5FGO A;  4Y99 B;  4J9A A;  1VF5 B;  2W6A A;  3CCM 3;  2HYN A;  1IQ8 A;  3PLN A;  1LQG C;  3LW5 J;  3WMD A;  2RGQ A;  3G71 P;  3L75 J;  1EDL A;  3A5T A;  2V4H A;  3HTK B;  1GD4 A;  4UB6 H;  3L71 J;  1R4C A;  1JB5 A;  1GYB A;  2QE7 H;  3DGL A;  1HU9 A;  3K5B A;  4MMY B;  1SAR A;  1GK6 A;  1MZ9 A;  1UCI A;  3H32 A;  1ZX2 A;  5AI1 A;  3TNU A;  1NTK E;  1C54 A;  3G6E P;  1EC5 A;  1YGW A;  4PD4 I;  3PYJ A;  3H1J J;  3BCC G;  3N4X A;  1A2K A;  1RH5 B;  1BNF A;  3UJM A;  4Q53 A;  1CI6 B;  2KNC B;  2K3R A;  2OQE A;  5IG5 A;  3R4Y A;  2FYU E;  3V4W A;  4W7Z A;  3VF1 A;  3FF0 A;  1IK7 A;  3U1A A;  1UCJ A;  3CCL P;  3PTZ A;  4HJL B;  2YO3 A;  3Q1C A;  1FUW A;  1VQL 3;  1U7M A;  5GSP A;  1BGS A;  2CK3 H;  3UL5 A;  4BU4 A;  3DGM A;  2KIK A;  2XDJ A;  3RDE A;  3MSO A;  4OVM A;  2V1L A;  2XSO B;  1DD4 A;  3T97 B;  1KIL E;  2W90 A;  5APX A;  2ZVN B;  1EZV D;  4PJ0 E;  1AV4 A;  3SWY A;  3F5H A;  2E74 D;  2RKL A;  3PCR A;  3AEF C;  1I8V A;  3OAK A;  5BU4 A;  3PP5 A;  2XND H;  3F40 A;  1JMB A;  2PNC A;  1NTZ J;  3H1I G;  3KZI E;  1PPJ D;  1YIJ P;  2B24 B;  1RGA A;  2E2U A;  2QJP C;  3L0R A;  4LC1 A;  1KYO E;  2NPS B;  1X8Y A;  2ZAE B;  1FA3 A;  1DD3 A;  1OVV A;  5CCG D;  3L75 E;  3MZW B;  2K9Y A;  4GDO A;  4LGD E;  2W6J H;  2CPS A;  5KJ7 C;  5JPU A;  3L71 E;  1FZC A;  1KOR A;  3I5C A;  2JP3 A;  3ZDM A;  1KIL A;  1L2P A;  1F8N A;  1YIJ 3;  1T3U A;  2H43 A;  2W03 A;  1IVW A;  1YJW P;  1G02 A;  2QA4 3;  4BXL A;  4MN4 C;  2E75 D;  1N86 A;  1EQK A;  4EXR A;  4WFO A;  2F86 B;  2IUK A;  1NU1 J;  2XGL A;  1OXZ A;  1G0T A;  1GY6 A;  2Y73 A;  5H2F H;  3TGU E;  1QAL A;  1LNQ A;  1Q40 B;  4J5G A;  2KUB A;  3X42 A;  2VRS A;  3B5N C;  1XTC C;  1Q86 Q;  5AW0 B;  3ALA A;  1VQ7 P;  3OJA B;  2K0M A;  2UGI A;  2FBW C;  5CLK A;  2KF4 A;  2P7J A;  2UUG C;  5APS A;  1BU4 A;  3V6I A;  1M1X B;  1N73 B;  3L36 A;  4H61 A;  1Q81 4;  3K63 A;  1LTJ A;  2MKV A;  1HKX A;  5CK6 A;  1O7P B;  3NTN A;  1IT8 A;  3AE1 C;  1KD1 4;  4JQ0 D;  3WU2 E;  3K5T A;  2W27 A;  1VQ7 3;  2WSC H;  4H3U A;  1VQP 3;  1N7L A;  4XB5 A;  3L72 E;  1AVY A;  3PHL A;  1RNT A;  1AY7 A;  2C10 A;  2BO9 B;  3H1H D;  1YHQ P;  1VQN 3;  2KB7 P;  4HM4 B;  3EE1 A;  3LZA A;  3OW2 2;  4B86 A;  1PYL A;  3WOF B;  3F89 A;  2WSS H;  3G0K A;  1E3R A;  2IDB A;  1H8A A;  1VL2 A;  1X22 A;  5M1A A;  3G8Z A;  1ZS7 A;  2I1J A;  2HR3 A;  4YTP C;  4OGQ D;  3CC4 P;  3SED A;  3G4S P;  1SFC B;  1BE3 J;  3L70 J;  5D82 A;  1SQV K;  3H1J G;  4GOE A;  1LT9 B;  3VMZ A;  4GKG A;  2CX1 A;  1VQ5 P;  1HYF A;  1FBM A;  1N9J A;  3CWB J;  1ROV A;  3H1K D;  3CCR P;  1JKG B;  2Y0E A;  4RZM A;  1LTT C;  2NZ2 A;  4PV1 C;  1J2B A;  1FZG A;  1TFO A;  1NU1 E;  1N9E A;  4L7K A;  1M8O B;  3Q5P A;  3G4S 3;  2GUS A;  1SQP D;  4EDF A;  3VYI A;  1BSA A;  1YQ4 C;  1I2F A;  1D7M A;  2C4B A;  3MP7 B;  2QM8 A;  5AIH A;  1IFP A;  1H88 A;  2W9Q A;  5B66 E;  1KV4 A;  1QGK B;  2E5Y A;  1B2Z A;  2RMZ A;  3FXD A;  1AA0 A;  2O9U X;  3KII A;  3WDG B;  1LP1 A;  1LXE A;  4Y99 C;  1NTZ G;  1SQQ J;  2FYN B;  1RMS A;  2KAA A;  2C0X A;  4R4K A;  1USD A;  1OH0 A;  2O01 J;  1GL2 C;  3M0A A;  1X1W A;  2K9J B;  1EZV E;  3W68 A;  3NM7 A;  2CH9 A;  3ROB A;  1E79 H;  1FDO A;  1BCC J;  1W6G A;  2IY2 A;  1VQM P;  4IL6 H;  1LWU C;  1URQ A;  3X40 A;  5AW5 B;  3X41 A;  1UCK A;  4OVN F;  1PPJ E;  1L0L J;  3DGY A;  4W7Y A;  1LTB C;  5KLI B;  3VGN A;  3PJS K;  4C7N A;  1ZRT D;  1CEW I;  1AVO A;  1BVI A;  6STD A;  1BUQ A;  1O7G B;  1IQX A;  2XSH B;  1BE3 E;  3L70 E;  1X0T A;  4DJG A;  1OUN A;  2HLO A;  3A7O A;  3EN1 B;  1RE3 C;  3D3L A;  3AE3 C;  2Q07 A;  2M3E A;  3HE4 B;  1I3F A;  1BAO A;  1UI7 A;  4O02 B;  3CXC 2;  4PD4 D;  1FGT A;  2XRX B;  1OF5 A;  4UB8 E;  1Q81 Q;  4JYC A;  3EB8 A;  2WTY A;  2IYP A;  4GT1 A;  1MFZ A;  3DGO A;  1AQZ A;  3E1R A;  2NPS C;  4AKZ A;  1QL1 A;  1NWW A;  1PFP A;  3KYQ A;  1SQQ E;  2P58 A;  1YNV X;  3ECF A;  3IJE B;  5KLV G;  1H0T B;  1RY3 A;  3RL0 C;  2JQ5 A;  1NO4 A;  3CMA 3;  1YYC A;  1BGY D;  3PGB A;  1YJ9 P;  4FMA A;  5IEO A;  1SQB G;  2WOF A;  1ASK A;  2ZT9 C;  4RO0 A;  4IIA A;  3EN8 A;  1VQ9 3;  2O1J A;  3E7K A;  3L74 J;  1NTM D;  5CCH D;  3I0Y A;  1BSC A;  1JTH B;  4BL2 A;  1MV8 A;  3IFM A;  5APQ A;  1JB4 A;  3L37 A;  3F8H A;  4HB1 A;  5D81 A;  2QEX 3;  4U13 A;  2N1T D;  3I55 P;  3MG3 A;  1BUJ A;  4BL3 A;  5KAF E;  1S72 P;  2H0I A;  1WRG A;  3WR2 A;  4QMA A;  3LIE A;  1KQG B;  2P05 A;  5G1K A;  1KC8 4;  2A45 I;  3NMD A;  3MPH A;  2IBZ G;  3BND A;  2FFD A;  3CCQ 3;  2OYI C;  3OW2 O;  4U3F J;  2W6B A;  2IYJ A;  1QEX A;  5CMZ A;  4K1U A;  3HK4 A;  3N9H A;  4FCM A;  3STD A;  2KSE A;  2FNQ A;  3F7S A;  3EQQ B;  4PEJ A;  2WIT A;  4HM6 B;  3RK3 D;  3BB9 A;  3A0B H;  4BTX A;  1YIT 3;  1EUI C;  3S29 A;  3SVA A;  3S4R A;  1SQV E;  1M1J B;  1NOH A;  4Y28 J;  3HX8 A;  1GOV A;  1A2P A;  4WY4 B;  3V2N A;  4UB6 E;  1OWA A;  3M8C A;  4WYK B;  1WT6 A;  5STD A;  3T8U A;  2IFM A;  3EX9 A;  2K54 A;  3RGR A;  2CW9 A;  4O2H A;  3J7Y d;  1FGM A;  3GHG C;  1WNH A;  1CW5 A;  3D5I A;  1DEE G;  1L0L G;  2XGN A;  2F98 A;  3BU4 A;  1G2C A;  1SFC C;  3KHU A;  1UUG B;  1LJ2 A;  1NWQ A;  3AE5 C;  1L0N J;  2STD A;  3F8X A;  1BAN A;  2B87 B;  2IA7 A;  1LOV A;  1LT9 C;  2BCC J;  3L74 E;  1JNQ A;  3RK2 D;  3MD0 A;  2MF7 A;  1Z56 A;  2Q1K A;  3JUQ A;  3CX5 I;  1B2M A;  3SWK A;  4JF8 A;  4DOJ A;  2KF3 A;  4D6T J;  2QJP B;  3GSP A;  3A76 A;  3H1L D;  2P1J A;  1A02 J;  2GSP A;  3VSY A;  1K04 A;  2BMR B;  4X2H A;  5BU8 B;  1PP9 E;  3G16 A;  2KOG A;  3HD7 C;  2FYU D;  2ZYG A;  1HF9 A;  1NB5 I;  2WSC J;  1GW4 A;  1LRA A;  4K3A A;  2E76 D;  2L5G B;  2ML6 A;  2BT3 A;  1Q9E A;  4KT3 B;  1GOY A;  1OHS A;  1T3J A;  1SIH A;  2AXT H;  2FYN C;  3BAS A;  1RJO A;  4YXD C;  3BCC J;  2I1K A;  3Q90 A;  2KF6 A;  3SFD C;  2JDI H;  1UCL A;  2KLV A;  1TU5 A;  3WA2 X;  4M3L A;  1KQF B;  4N78 E;  1N2D C;  2Q9I A;  1E5W A;  3KZT A;  5D83 A;  2OWP A;  3B5N B;  3CX5 H;  2E42 A;  1RDS A;  1RHZ B;  2KLU A;  3AE7 C;  5AW4 B;  2HMO B;  1QVG 2;  1WQL B;  2CIU A;  1CZQ A;  2LXB A;  5BU5 A;  4QWT A;  4WWU C;  1X9V A;  2L4V A;  2I9W A;  2O1K A;  2KZJ A;  2WPV B;  1W00 A;  3L75 D;  1L0N E;  5H2F E;  5APT A;  2B1X B;  3L71 D;  4WVZ A;  2BCC E;  3H1I J;  4XA4 A;  2CWT A;  3II6 A;  4HOH A;  2ZXX A;  2M3B A;  1VQ8 3;  2C0W A;  1N5H A;  3E1I A;  3FGY A;  3QRD A;  5RNT A;  3P8M C;  2PAJ A;  1GW3 A;  1KC8 Q;  2OYH A;  3V2P A;  3C1L A;  4OWF A;  3CC7 P;  3EFF K;  3TGU D;  2XV5 A;  5APV A;  1GDT A;  4N6T A;  2YMY A;  3SYU A;  3MUD C;  3FH1 A;  2HPC B;  1BNR A;  3UIA A;  3JUN A;  3MYT A;  1RGC A;  3S1K A;  1N7S B;  1JJ2 2;  3LTC A;  1HBW A;  1MFT A;  6RNT A;  1NTZ K;  3S5C A;  1W2E A;  4DZO A;  1J2J B;  4FMC A;  4WWI A;  4BRY B;  1AVL A;  2Z6B A;  2NRG A;  2W56 A;  1SS1 A;  4RJT A;  1Q86 4;  1TIJ A;  3JC2 2;  1FDM A;  4XBT A;  3IAO A;  3RK3 E;  1GD2 E;  3OXA A;  1BNI A;  3L73 G;  2OTL P;  1G1J A;  4R9K A;  2N1T A;  3L72 D;  1ZN5 A;  3SOY A;  2GU3 A;  4ASV A;  1NNV A;  4J8T A;  1HUC A;  2OAR A;  1KB9 H;  2Q5U A;  4HJG H;  2GBX B;  1PGQ A;  3M0D A;  5APY A;  1LNH A;  1EKM A;  1NGM B;  2ZVO B;  3IPT A;  1VPC A;  3MHV A;  1NU1 K;  3LID A;  1OCV A;  2B9B A;  5IW9 A;  4D6T G;  4LEH A;  5AYR B;  2RN0 A;  1U8C B;  5B5E H;  1T2H A;  4ZM8 A;  1X1Y A;  3HTK A;  3H1I E;  1M90 4;  1GL2 B;  1HJ0 A;  4CCV A;  3CU3 A;  1NU3 A;  5AW2 B;  4NHF A;  3MWZ A;  1IK3 A;  3SFE C;  2KS1 B;  1BIR A;  3CPO A;  1LWU B;  1NU1 D;  5AEU B;  4HZB B;  1AV1 A;  2YFL B;  3H1L E;  1VQK P;  3G71 3;  2Y0D A;  4FCJ A;  4K1V A;  2PP6 A;  1B27 A;  2C9L Y;  1M1J C;  1YTZ I;  2BAS A;  1RN4 A;  1URQ D;  2LKM A;  5TIS E;  2A15 A;  1YTZ T;  1CI6 A;  2KNC A;  4WY4 C;  2WSF J;  1JN5 B;  4A7P A;  2WVR A;  1AQ5 A;  1IV7 A;  3A2A A;  2XH9 A;  2OOV C;  1ZO2 A;  2QG4 A;  3NUV A;  1Q82 4;  1Q2N A;  1OFC X;  1W5Z A;  1KN7 A;  2YKP A;  4N6N B;  3G6E 3;  4IL6 E;  2RBI A;  1X79 B;  2F56 A;  2OCT A;  2Q3E A;  4KT0 J;  3NV0 B;  2V7Q H;  1RGH A;  2N9B A;  4H44 D;  3SX1 A;  3T97 A;  1N5P A;  3S27 A;  3OWS A;  5KP4 A;  2ML5 A;  3CCL 3;  3F7X A;  3F14 A;  1I2G A;  2HMJ B;  3T0U A;  3D5G A;  3CNM A;  2E5T A;  1BRI A;  4EOT A;  2R3C A;  2QJK B;  3PS8 A;  3TF5 A;  2OTJ P;  5AVZ B;  1VQ6 P;  4GB5 A;  4XM4 A;  1FZU A;  4HYZ A;  3RL0 B;  4TX4 A;  1BRH A;  4R9L A;  2E43 A;  1BE3 D;  3L70 D;  1B2S A;  4J5K A;  1B20 A;  1M1K 4;  4H0L D;  2ZT9 B;  4R4L A;  4FMB A;  2O3O A;  3Q5S A;  3HOH A;  5CF2 A;  3CX5 D;  3CWB D;  1RN7 A;  1QVG O;  2FY8 A;  3Q5R A;  2OTJ 3;  5M18 A;  2D2C D;  5E79 H;  2SBL A;  1BNG A;  1ZGX A;  4JPZ B;  1SQQ K;  1NTK G;  2O01 N;  5CHX A;  3LH4 A;  3VOP A;  3NXJ A;  4I4K A;  3H1J E;  3EBY A;  4HM1 B;  4NPD A;  1MWT A;  2HOH A;  1FZC B;  1Q40 A;  1DE3 A;  1RE4 C;  3FX0 A;  1K9M 4;  1DH3 A;  3MKI A;  1SQX G;  2O3J A;  3CCU P;  1RGK A;  1YJW 3;  1Y8A A;  1W6C A;  2C9N Y;  3A0H H;  2F5M A;  3Q2P A;  4LMI A;  5IG0 A;  3ER7 A;  3U59 A;  1GD3 A;  3WHO A;  2WOH A;  5IG4 A;  1Q7Y Q;  2GM4 A;  2HMN B;  2ZYA A;  2IFN A;  2OYI B;  1SQQ D;  2Q3I A;  2F5W A;  1L0L K;  1N73 A;  3LTB A;  1YJN P;  2KP8 A;  3LOY A;  8CHO A;  3KSE D;  1BSH A;  1IFJ A;  2H89 C;  3MHE A;  3PH0 A;  3AEB C;  3IN6 A;  3NX0 A;  3CCU 3;  3D79 A;  3D9R A;  1VQO P;  2FXT A;  2LYX A;  3D71 A;  1ZR2 A;  1BCC D;  2PFX A;  2A06 G;  3G3Z A;  1JY2 P;  1HWT C;  1NAY A;  1B21 A;  5AYS C;  1AVK A;  4L8O A;  1YGE A;  1CYU A;  3SLU A;  1NTZ E;  4WBA A;  1US1 A;  3HE5 B;  5KLV J;  1T2K D;  2UX0 A;  1M90 Q;  2POH A;  3U97 A;  3HIG A;  2WGQ A;  1SQB J;  3GHG B;  3VMA A;  4KFF A;  1RQV A;  3N54 B;  1S9K D;  1SFC A;  5CJ4 A;  3A0B E;  2Z76 A;  1QVF 2;  1WMN A;  3L35 A;  1N7S C;  3X3Z A; 
#chains in the Genus database with same CATH homology
 5G2G A;  4FMA A;  5IEO A;  1YHQ 3;  3H3H A;  3UNL A;  2WOF A;  1ASK A;  4EC6 A;  3E99 A;  4IIA A;  3EN8 A;  1VQ9 3;  1VQK 3;  3EHC A;  3I0Y A;  2MC8 A;  3NV0 A;  1AR0 A;  4RBN A;  4HBR A;  4STD A;  3DGN A;  2BNG A;  1WTH A;  3EC9 A;  3CC4 3;  1JB4 A;  3F8H A;  5D81 A;  1DVC A;  2QEX 3;  1RRH A;  4U13 A;  5JPP A;  1DMM A;  3CC2 3;  5AII A;  3MG3 A;  3NM2 A;  4MJD A;  3FG1 A;  3B4O A;  4HM0 B;  4KFD A;  3NBR A;  1VQ5 3;  3KKG A;  3GZY B;  4QMA A;  3CCV 3;  3CCR 3;  3WOE B;  3GAX A;  1KC8 4;  2P05 A;  3MPH A;  1O7N B;  1UUV B;  4RNZ A;  3BND A;  2W9P A;  2RFR A;  1NDO B;  2RSX A;  3CCQ 3;  1TUH A;  2CFW A;  4MMZ B;  5IER A;  3NBB A;  3B8L A;  4K1U A;  2C11 A;  3LT9 A;  5EEO A;  3FZW A;  2P09 A;  4N6U A;  3HK4 A;  3N9H A;  4FCM A;  1DYU A;  1RKY A;  2CFK A;  3EBT A;  3STD A;  2FNQ A;  3F7S A;  4N6L A;  3EQQ B;  4PEJ A;  3OV4 A;  1O7W B;  2CG0 A;  4HM6 B;  2E2V A;  3BB9 A;  4XBY A;  2M7O A;  4BTX A;  5AIF A;  1A90 A;  2CG1 A;  1YIT 3;  3NBJ A;  5LC7 A;  3S29 A;  4FMD A;  1IU7 A;  5AIG A;  3SVA A;  3CME 3;  1ULJ B;  1VZZ A;  2D1W A;  1O7M B;  3OX9 A;  3HX8 A;  5DRE A;  1VQ6 3;  3LTD A;  2BMO B;  2GXF A;  1UW1 A;  3M8C A;  4WYK B;  2ZL8 A;  4FR9 A;  3PZW A;  5STD A;  2IMJ A;  3T8U A;  3EX9 A;  3USS A;  2K54 A;  2WO0 A;  3X3X A;  3RGR A;  2CW9 A;  3UB1 A;  3O8Y A;  3FG3 A;  4O2H A;  7STD A;  3J7Y d;  1FGM A;  3SOA A;  1WNH A;  1IDP A;  2WGO A;  3H51 A;  2Z7A A;  3F9S A;  1ULI B;  2XGN A;  1OHO A;  5JBS A;  2F98 A;  4G1M B;  3EJV A;  2BMQ B;  4AKY A;  2W56 B;  1VQM 3;  5IEP A;  3LTA A;  1DMQ A;  2STD A;  1C7H A;  4O3V A;  1SPU A;  3F8X A;  3JUM A;  2IA7 A;  3WA3 A;  1OGX A;  3CCJ 3;  1JNQ A;  2P0X A;  2MF7 A;  3KSP A;  4CDL A;  3KN4 A;  1K73 4;  3JUQ A;  2F99 A;  1O7H B;  3B4P A;  4JF8 A;  1U5O A;  3N8B A;  1GS3 A;  2P0M A;  3LXU X;  2OQE C;  4IT7 A;  3GWR A;  3S67 A;  1PU4 A;  1NJI 4;  1MOL A;  3A76 A;  4ORL A;  4L8P A;  3VSY A;  1OGZ A;  2BMR B;  1LOX A;  5FGO A;  4X2H A;  4J9A A;  1IT7 A;  3G16 A;  1YJN 3;  3CCM 3;  1IQ8 A;  1ISK A;  5I97 A;  3WMD A;  2RGQ A;  3V92 A;  1CYV A;  1STF I;  1SII A;  1GD4 A;  2P38 A;  1NB5 I;  1R4C A;  4BTY A;  1JB5 A;  3LT8 A;  1VQO 3;  1GYB A;  2QE7 H;  3DGL A;  2ML6 A;  2BT3 A;  4MEI A;  3AMO B;  1OHS A;  1SIH A;  1HU9 A;  1RJO A;  1S5A A;  2W0Q A;  4MMY B;  3Q90 A;  1W2B 2;  4GL6 A;  3NQY A;  1QMA A;  1ZX2 A;  5AI1 A;  1GY7 A;  2JDI H;  3EF8 A;  1TU5 A;  3WA2 X;  1E3V A;  3QK9 A;  3PYJ A;  1CQS A;  1JKG A;  1A2K A;  3KZT A;  5D83 A;  2OWP A;  4EBG A;  3UL6 A;  3UJM A;  1KSI A;  4Q53 A;  2QIY A;  2D42 A;  2XR8 B;  2OQE A;  5IG5 A;  1A2V A;  4KVH A;  3VF1 A;  3FF0 A;  2CWV A;  2FGT A;  1W6Y A;  1YJ9 3;  4HJL B;  2HMO B;  3Q1C A;  1QVG 2;  1FUW A;  1WQL B;  2CIU A;  4FCZ A;  1W02 A;  4QWT A;  4WWU C;  1VQL 3;  2CFD A;  2L4V A;  2I9W A;  1QAF A;  2LQV A;  1IVV A;  2CK3 H;  1W00 A;  3UL5 A;  4EV2 A;  3DGM A;  5CXO A;  3RDE A;  2BHM A;  3MSO A;  4YXW H;  5BXQ A;  1N8R 4;  4OVM A;  2V1L A;  2B1X B;  1E97 A;  4WVZ A;  2XSO B;  3MG2 A;  4N6O B;  2CWT A;  3U1W A;  1AV4 A;  1VQ8 3;  3PCR A;  2ZDJ A;  3DZL A;  1DVD A;  1N5H A;  3FGY A;  3QRD A;  3I55 3;  2R4I A;  4KFE A;  2XND H;  5TGN A;  3F40 A;  4HM8 B;  4R1K A;  2PNC A;  1S72 3;  1BSN A;  2B24 B;  2E2U A;  3L0R A;  4JRF A;  4OK0 A;  1UUW B;  3EFF K;  3DMC A;  1FA3 A;  4MMX B;  2IUJ A;  3DM8 A;  4N6T A;  1W2Z A;  3FH1 A;  3CPW 2;  3GZB A;  4WYK A;  5AEW B;  3IMA B;  3JUN A;  3LYG A;  5CF1 A;  3MYT A;  2KCD A;  2OOV A;  1JV2 B;  2W6J H;  1JJ2 2;  5JPU A;  3LTC A;  1WMP A;  1F8N A;  5DRV A;  1VQ4 3;  3S5C A;  1YIJ 3;  4FMC A;  2YFI B;  2W03 A;  1IVW A;  3K7C A;  3FF2 A;  1AVL A;  2QA4 3;  1JB2 A;  2Z6B A;  1W7C A;  2W56 A;  4RNY A;  1EQK A;  3MG1 A;  4EXR A;  1Q86 4;  1TIJ A;  4WFO A;  2F86 B;  2IUK A;  4XBT A;  3OXA A;  4K90 B;  2XGL A;  1GY6 A;  3S28 A;  2Y73 A;  1QAL A;  3NHX A;  4R9K A;  1Q42 A;  4XDW A;  1Q40 B;  3CNX A;  5IEN A;  3SOY A;  2GU3 A;  5KP1 A;  3WOD G;  4K61 A;  1W01 A;  4J8T A;  3X42 A;  2HML B;  4AEQ A;  4TLF A;  5BVB A;  3SXX A;  1UI8 A;  1V74 A;  2GBX B;  4HM3 B;  3ALA A;  2K0M A;  1LNH A;  2W2C A;  1EKM A;  5CLK A;  3IPT A;  2GBW B;  3OWY A;  1YVB I;  2HMK B;  1OCV A;  5LC6 A;  1M1X B;  5IW9 A;  4H61 A;  4LEH A;  5AYR B;  1Q81 4;  3K63 A;  1HKX A;  5CK6 A;  4KZ1 A;  1O7P B;  3JUO A;  1IT8 A;  1U8C B;  4ZM8 A;  5A0O B;  1M90 4;  1KD1 4;  1STD A;  4CCV A;  3CU3 A;  3K5T A;  1NU3 A;  3X3Y A;  1QJG A;  3AMO A;  4HM7 B;  1VQ7 3;  4NHF A;  3HI7 A;  1OF5 B;  3MWZ A;  4H3U A;  1VQP 3;  1IK3 A;  2XEP A;  4XB5 A;  4WHA A;  3X3Z A;  1EG9 B;  1K41 A;  3BNB A;  1JEK A;  3CPO A;  2C10 A;  2BO9 B;  3K0Z A;  5FW5 A;  1VQN 3;  3PXM A;  5AEU B;  4HM4 B;  4HZB B;  3EE1 A;  3LZA A;  3OW2 2;  3WOF B;  2YFL B;  2WSS H;  3CCE 3;  2KRT A;  1SQW A;  3G71 3;  3G0K A;  1E3R A;  1G96 A;  4FCJ A;  3JVC A;  4K1V A;  1FGQ A;  1IVU A;  1AQT A;  1IVX A;  2A15 A;  1MNL A;  3G8Z A;  3NQZ A;  4OUQ A;  2CHC A;  1JN5 B;  1FS0 E;  5IG3 A;  1IV7 A;  4HZ9 B;  3SED A;  3V99 A;  2XH9 A;  4X2O A;  2OOV C;  1ZO2 A;  5D82 A;  3NUV A;  1Q82 4;  1D6Y A;  3GZX B;  1W5Z A;  2E2T A;  1SJW A;  4N6N B;  3G6E 3;  4NRE A;  3PCS A;  2OCT A;  1N9J A;  1ROV A;  3NV0 B;  1JKG B;  2V7Q H;  2XFS A;  3CCS 3;  4RZM A;  2INX A;  1J2B A;  3SX1 A;  1TFO A;  1D6Z A;  1N9E A;  1N5P A;  2Y74 A;  4L7K A;  1QAK A;  3S27 A;  3OWS A;  1JRQ A;  2CFL A;  3G4S 3;  5KP4 A;  4LGQ A;  4O8S A;  1RRL A;  5IF6 A;  1L5G B;  2ML5 A;  1IQY A;  1GY5 A;  3CCL 3;  3F7X A;  3F14 A;  3B7C A;  3HII A;  3FLJ A;  5AIH A;  1IFP A;  2HMJ B;  3KE7 A;  3T0U A;  2W9Q A;  3BNE A;  3CNM A;  2E5T A;  2E5Y A;  4HM2 B;  1A67 A;  2O9U X;  3I56 3;  3T8N A;  3KII A;  3WDG B;  1FGR A;  1LXE A;  3PS8 A;  3DXO A;  3TDG A;  3DUK A;  2XFT A;  4GB5 A;  4XM4 A;  4HYZ A;  3FG4 A;  2CC3 A;  2YX9 A;  4R9L A;  3OWU A;  4TX4 A;  1OPY A;  2Z77 A;  1WMO A;  5ELU A;  4R4K A;  4HM5 B;  1OHP A;  3BLZ A;  1OH0 A;  3DY5 A;  1M9G A;  1M1K 4;  2GEX A;  2CH9 A;  3NM7 A;  3ROB A;  2HMM B;  4FMB A;  2O3O A;  1E79 H;  4N3V A;  5CF2 A;  1K28 A;  3CC7 3;  2XF3 A;  4BTW A;  1TFK A;  1RN7 A;  1W6G A;  2RCD A;  5EVH A;  2OTJ 3;  2GEY A;  4IPB A;  3X40 A;  3X41 A;  1Y4K A;  2SBL A;  3HZP A;  3FSD A;  1Q7Y 4;  3LH4 A;  3FCS B;  3NXJ A;  4I4K A;  1TP6 A;  2QGU A;  3EBY A;  3VGN A;  3V98 A;  2KXG A;  4HM1 B;  3PJS K;  1W4N A;  1Q40 A;  2GU1 A;  1CEW I;  2CWU A;  1K9M 4;  3MKI A;  4LZI A;  4LSO A;  1ROA A;  6STD A;  1BUQ A;  1O7G B;  1YJW 3;  1IQX A;  1W6C A;  3Q2P A;  2XSH B;  1D6U A;  4LMI A;  4WP5 A;  5IG0 A;  4EYC A;  3ER7 A;  1GD3 A;  2W04 A;  1OUN A;  4DJG A;  2WOH A;  1EA2 A;  1KWI A;  5IG4 A;  5ELJ A;  2HMN B;  1NB3 I;  3EN1 B;  1KQS 2;  5EQL A;  3CD6 3;  1IV9 A;  3GRD A;  3D3L A;  2OTL 3;  4HKV B;  3LTB A;  2Q07 A;  3LOY A;  8CHO A;  3KSE D;  1BSH A;  3MHE A;  4R80 A;  4N6M A;  1UI7 A;  4O02 B;  4EV5 A;  3NX0 A;  3CCU 3;  3CXC 2;  3D9R A;  2FXT A;  2LYX A;  4N6V 0;  2CKF B;  5KP3 A;  1FGT A;  2XRX B;  1OF5 A;  5AYS C;  1AVK A;  2CFG A;  1NO3 A;  3EB8 A;  1YGE A;  3KFQ C;  4L8O A;  1US1 A;  4XBX A;  5HGR A;  3SLU A;  1CYU A;  2UX0 A;  1DMN A;  1Z1S A;  3DGO A;  3BNC A;  3U97 A;  2PZV A;  4HVN A;  4AKZ A;  1LVN A;  1FGO A;  1NWW A;  1PFP A;  2WGQ A;  3HIG A;  3K9M C;  4XDV A;  1YI2 3;  1T5Y A;  1N8Q A;  1K8A 4;  3LML A;  3ECF A;  1JN5 A;  3IJE B;  2YFJ B;  3GZR A;  3JUP A;  4KFF A;  2JQ5 A;  3N54 B;  1QVF 2;  2Z76 A;  3CMA 3;  1WMN A;  3PGB A;  1OAC A;  3RGA A;  3FKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...