2JDIH

Ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
88
Chain Sequence
b'SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
publication title Ground State Structure of F1-ATPase from Bovine Heart Mitochondria at 1.9 A Resolution
pubmed doi rcsb
molecule tags Hydrolase
total genus 11
structure length 88
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2jdiH02
3.10.450.640 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2jdiH01
1AQTA 2E5YA 4DJGA 3PJSK 2WSSH 3USSA 1JEKA 1BSNA 4WVZA 2CK3H 2W6JH 3EFFK 4TLFA 1E79H 1BSHA 1IFPA 4YXWH 2V7QH 2E5TA 2XNDH 1FS0E 4QMAA 2QE7H 2JDIH
chains in the Genus database with same CATH superfamily
1AQTA 1EZVD 3A5TA 1BSBA 1LWUC 3MG3A 3X3YA 1OACA 2BEQD 2C9NY 5ELUA 2M3EA 3OAKA 4WWUC 2C0XA 4I7ZC 3R4YA 1IT8A 4DKIA 3CX5E 3QWOC 4L8PA 2E74B 1R8EA 3IF4A 1DVDA 3H1LE 2Z6BA 3IMAB 1R5SA 3AEDC 3N7NA 2A06E 2AXTH 4AKYA 2OTJP 1T2KC 3L73G 2YO2A 2XFSA 1URQA 9RNTA 3OJAB 1PP9D 1VZZA 3L71G 1GMJA 2IYPA 3HX8A 3RDEA 3GSPA 1T3UA 2XH9A 1JKGA 4H13C 1JNMA 3HOHA 3CCM3 2D2CB 2XZRA 1MKMA 1YTZI 3H1JG 3JC22 3CCR3 3PYJA 1SQXJ 3CCUP 4N6LA 2QSIA 3V2NA 2IUJA 1W2EA 1IO4A 1HKXA 1IVXA 3CX5H 4Y28J 4U3FG 1LT9A 3MIWA 4ZNCA 1UIXA 1OVVA 1SQVE 4NPFX 3JUMA 2F4YA 2KCDA 1A02J 4N6MA 1GY7A 2H0HA 2BO9B 1E3RA 1P84D 4GDOA 3WUVA 4LGDE 2NPSA 1YI2P 1A2VA 3GF7A 4WWIA 6RNTA 4FMCA 4R9KA 4L74A 3L70E 1R4CA 3KSPA 2R41A 4FCMA 2YKOA 1NVOA 3H51A 3AE9C 1SFCC 1IV7A 2BIRA 2WWWA 1IK9A 3AE2C 3II6A 2BCCD 1QMAA 3CC7P 2KP8A 5DRVA 2UGIA 3KXDA 1P84H 1AVYA 2ZJSE 3LXUX 3S27A 2M5AA 1KZUB 2PNCA 1G02A 3S67A 2OTL3 5G1KA 1AQZA 1JBRA 1N86A 4JBZA 4H0LD 1ULIB 4XA4A 2K37A 1EUIC 3MTUE 3KE7A 1G1IA 3I5CA 2N9BA 5IERA 3VN0A 3FGAD 3L72D 4IL6X 4GL6A 1UCLA 1K9MQ 5KP1A 1RJOA 1Y8AA 1BNSA 1FOSE 1O7NB 1RGKA 3H1HG 2SARA 1FS0E 1VQOP 2IBZE 1NTZK 1NTKG 4D6TD 2HG5D 1GTWA 3LTDA 5CMZA 4YPCA 3UL6A 3SOAA 2WPQA 1Q7Y4 4HM7B 1Y47A 4Z1MH 3CPW2 3U59A 1VF5C 1UCKA 4HM4B 2O1JA 1BE3G 1EG9B 3NM2A 1N7SB 4EI2A 2GBXB 3RBZA 1PY3A 1JZOA 2O01H 2JP3A 5IG3A 4C46A 1M9GA 2Z4EA 1W02A 2B87B 3RL0C 5BVBA 4RNZA 3MYTA 4WP5A 1LTGC 1ZX2A 1KQS2 2KI7B 3SXXA 2KRTA 3GHGC 1Q7HA 4PV1D 2AAEA 1SIHA 3PP5A 1RNBA 1BGYJ 1X79B 1FGMA 2VRSA 1SQPJ 2XFTA 3U97A 4OGQD 1KTMA 2FKWB 3I56P 3EQ2A 3HZPA 1SQQE 5ELJA 2CFKA 3SVAA 3X3ZA 1ZS7A 1S5AA 2L4VA 4IPBA 3CCV3 1U7JA 1YHQP 2OYHA 3V2RA 1LOYA 1KQLA 2H8PD 1KD1Q 2BNGA 4J9AA 5G2GA 4XB5A 2QEXP 4DT0A 3AE3C 1K41A 3NX0A 3SX1A 2IFMA 2Y74A 1KILB 2W03A 1BCCJ 1S5LE 5CXOA 2NPSB 1EEJA 1TP6A 3FG4A 5APWA 5AVRB 4Y99B 1VQMP 2SPZA 4GIFA 1HUCA 2E74D 1O7PB 3V5BA 4AUWA 2ZHXB 3H1KD 3CNMA 2CFDA 4R9LA 1VQ6P 3OWUA 1X1XA 2W6AA 3L73E 1M904 1JY2P 4YTPC 2FFDC 3EHCA 1FZEA 1JY2O 1JMMA 4WB4A 2CH9A 3OA7A 2M5AB 1NTZJ 4Q53A 2D2CD 1UGHI 1SJWA 2JKVA 3B7CA 3LT9A 2W90A 2UUGC 1S5LH 4EIJA 3SWKA 3GHGA 3WHOA 3SFEC 2Y9ZA 3HRNA 5M1AA 5I97A 1MFZA 2QVAA 3EFGA 1N9JA 1M1XB 3CWBG 3L75J 5CCGC 4U3FE 5CBOA 1YJ93 2XU6A 2K3DA 5AIGA 3H1IE 2K9YA 5AYSC 1OMIA 2OOVC 4XDWA 4HB1A 4U13A 3D70A 1ZRTD 1MWTA 1BRKA 1W4NA 2FYUD 2O01N 1W01A 4H44C 3RGAA 4FMBA 5AIIA 1TRQA 1AQ5A 3QK9A 2JO1A 1LP1B 1SQBE 4GOEA 3A3YB 2OYOA 2RSXA 3Q2PA 1X22A 2W04A 1GS3A 7RNTA 3JVCA 2D42A 2HMOB 1UGIA 3RGRA 2P2UA 2BCCJ 4BXLA 1KB9I 4PEJA 1KORA 1TIJA 2P1JA 3ZG0A 1I2EA 3EX9A 2G8YA 3LTCA 1IFJA 2WSFH 1Q40A 3S1KA 1JV2B 1YYCA 1SS1A 1Q90D 1MOLA 1EQ7A 1BOXA 4BIRA 1GMRA 3CC23 5AI1A 5AIFA 4LMIA 1T6AA 1T3JA 1RCKA 2CK3H 1L0NE 3DGMA 2XKMA 4R4LA 2HPCA 2FFDA 1JB5A 1Y9BA 1B2XA 4C7NA 3CXHI 3HE4A 1E5WA 3UB1A 3DGNA 1Q2NA 2OYHB 1VQL3 2FNQA 1QL1A 3G0KA 3X42A 3E1IA 3VMAA 2Y9YA 2QIYA 1RCLA 4NPDA 3AE4C 4HM3B 4OVNF 4CPGA 1QJGA 1NDOB 5CF1A 4D6TJ 1LTIC 2KS1A 1YJW3 1QEXA 1VQP3 4I2LC 4WVZA 3IN6A 3B8LA 1GW3A 1CI6B 3A7OA 2OYIB 1N7SD 5CCGA 3K5TA 3H1LG 3Q5PA 1Q814 3RBXA 2A06G 4K1VA 3M0DC 1OVUA 1OW6A 1UCJA 1NO3A 2W2CA 2F98A 2HMJB 2OOVA 3O8YA 2KIKA 4X2OA 2AEJA 2A45I 1PPJG 1GL2C 3AE7C 2ZVNB 3FWNA 1LTBC 4ZKUA 1NTKD 3Q90A 1W6CA 1NJI4 3EFFK 5GTHE 4GSPA 1DVCA 4I4KA 5KAIE 1BVIA 1W2ZA 3B8EB 1SQXD 1RLSA 2E76B 3G4S3 3G16A 3CCJP 3LTAA 5L8RJ 3TGUE 1KWIA 4G1MB 3NXJA 1GSPA 1KQGB 4L7KA 2B24B 4XE5B 4JYBA 3USSA 1SQVG 1EXIA 1BSDA 3FF2A 1JBTA 3PH0A 1GD2E 3RGUA 1V58A 2P10A 3RNTA 1RRHA 1VPCA 3TDGA 1TJDA 8RNTA 3BASA 1VQ73 2J5UA 3SWFA 4DZOA 5APVA 5DREA 4KJMA 1A02F 1SVFA 4IL6E 1KILD 3L70G 1V57A 4N3YB 5LC7A 5E79H 1N9EA 5GTHH 2WMMA 1FZCB 5KAIH 1AVOA 2AADA 2LQVA 2HMMB 3WUTA 1JRQA 1YIJ3 5CCHC 1QALA 1PL5A 3CCQP 4I1LA 1Y4KA 2P05A 4R1KA 3DZLA 1BNRA 3HUSB 5C39A 2K1AA 4WY4C 3BCCJ 1WTHA 3UNLA 2KK7A 3M0DA 2CKFB 1FYSA 3BLZA 4IL6H 1OW8A 1J2JB 1K04A 3FG3A 3KPEA 5JPPA 2MJZA 5GTIH 5KLVE 1GL2A 4IT7A 4FR9A 1NHLA 2IBZG 4K35A 1LRAA 1FZUA 2LKMA 1NTKK 1BU4A 3HE4B 1N8RQ 3Q5SA 4TX4A 3QH9A 2Q7CA 1CYVA 1VL2A 4GOFA 3CPWO 3AGNA 2F56A 3M0AA 5KP3A 4EYYQ 2Q07A 1L5GB 3L71J 6STDA 1STFI 1RRLA 1RF1B 1FUTA 4UB6E 5M1BA 1AA0A 3IAOA 3TSIA 2L91A 3H1JJ 3T8UA 1SQPE 1KQSO 5CF2A 1DX7A 1K05A 1RGFA 5FW5A 1ZXGA 2YIUB 3VMYA 1L0LE 3F8XA 1J1DC 3KCHA 2JQ5A 1SIIA 3MWZA 4FCJA 1RSNA 5CHXA 1VQ93 1SQQG 3DH2A 3NFQA 3MKIA 4BTXA 3V92A 5BU8B 5CCHA 3AEGC 4JF8A 1BSAA 1XTCC 2YFLB 2M0BA 3HE5B 2YMYA 2XNXA 3P8CD 3H32A 5HGRA 3WR2A 3NTNA 4UB6H 1FUSA 3EF8A 3CU3A 3TF5A 5HOHA 4WY4A 5D83A 1BIRA 2E5TA 1EZVE 4XDVA 2GBWB 1LXEA 3L36A 1TFOA 1B2MA 4XBTA 1BCCD 2BMRB 2IA7A 1H8AA 1RF0C 1NU1G 1QGKB 3IJEB 1NYHA 4FMDA 1H0TB 3LW5J 1AV4A 1BNFA 2WGQA 1O7MB 3AE8C 3NQYA 1TU5A 3A2AA 1MUUA 4MJDA 3C1LA 3PLNA 1BNIA 1NTME 1OVRA 1PP9E 1UI7A 1N5PA 2RN0A 3S5CA 2KSEA 3O6QA 4N6TA 1ZW0A 1XTGB 1JZDA 1KFMA 1BDCA 1PPJE 3H1HJ 1NTZD 3P7KA 1KB9D 3Q1CA 3TYYA 4KFEA 1YJN3 3CCRP 1NKZB 1NTKJ 2FXMA 3GZYB 2K0MA 1NH4A 2LXCB 5EFWB 3H6PA 2B1XB 2KF3A 2XRXB 2RMZA 2IZ1A 2FGTA 1HVVA 2E76D 3LMLA 5M19A 2ZXXA 4XFJA 1B2ZA 3AMOA 3CMA3 1N2DC 3HD7C 1YITP 3L75D 3MP7B 5M18A 1TUHA 3GMAA 1FGRA 5APTA 1P84E 3NV0A 2OGUA 1D6ZA 1L4AC 1LQMB 5KJ7D 3H1IG 3CXHD 3X3XA 4EOTA 4UB8E 1IFNA 4BL2A 2Y73A 1DMQA 3U1AA 5KKZC 3JUPA 2OARA 1KYOI 2XV5A 3A76A 3CCU3 3B5NC 1BRIA 3Q3DA 1SQBG 1YGEA 2V1LA 1E3VA 3CL3D 1RGCA 4N78D 2IY2A 4ZM8A 3RK2C 1Q9EA 1JN5A 1FBMA 1JNQA 1VQ8P 1RF0A 1JO5A 3BU4A 3CXHH 2OTLP 5IF6A 1LWUA 4N6NB 1OFCX 4RNYA 4O9BA 1FDOA 4HM8B 1STDA 2QE7H 2HMLB 3L72E 4N6V0 3MUDC 4UB8H 3PCRA 4HM6B 3MG2A 4JPZB 1I2FA 5AVUB 3LTBA 1K9M4 1L0NG 3OXAA 3D4AA 3VGNA 1I3FA 4EV2A 2CX1A 4K3AA 2GXFA 1HBWA 2BMQB 1HH0A 1ZO2A 4B86A 1Z56A 3AHWA 4C7RA 5D81A 1GOVA 4WY4B 2A45H 1JOCA 3J7Yd 3ZFZA 1FDIA 1JEKA 1BRSA 4NHFA 2ZVOB 4N6OB 6GSPA 4EDFA 1VQ53 1JY3O 4J8TA 2N1TD 3HD7A 2IYJA 2QJKB 5EEOA 7STDA 3L74E 1IC2A 2HODA 5CJ4A 1GK4A 1L4AA 3PHLA 3G8ZA 1BRNL 3LT8A 3V4WA 1NOHA 1CQSA 3N4XA 2Z77A 4DJGA 4OH8B 4CCVA 3UIAA 3VOPA 4L75A 1X9VA 2ZT9B 3WOEB 3AE6C 2CWUA 3V4QA 3CWBJ 2IYOA 3O6QB 1URQB 3RK3B 3B5NA 2C10A 3OWSA 1SFCA 3GG2A 1LTJC 1MZ9A 2Y0DA 3WUUA 2R44A 3NBRA 5FGOA 3TGUG 1JKGB 3STDA 2QJYC 3CCVP 2KF6A 4IFMA 3JCUE 1SLQA 4OWFA 4HM2B 4IFFA 5AIHA 1JCCA 3DGOA 2P67A 2SBLA 1SQVK 1FJKA 1I0VA 1VQN3 1J1EC 5CJ0A 1KD14 2O3JA 2I9WA 2RFRA 2XGLA 3FX0A 2W9PA 1LTSC 1PGQA 3MUDA 1LT9B 1ZV8A 3V2PA 1OZHA 1GMQA 3M8CA 1FZGA 4J5GA 2GSPA 1S1CX 5JBSA 4WFOA 4GKGA 1DMMA 3B4SA 2E75B 1NU1E 3C8VA 1LTAC 1D7MA 2FYNC 3M9HA 1CZQA 3H1KE 3AE5C 3SYUA 5A0OB 4M3LA 2KSJA 2CFLA 1VQQA 1RQVA 3EN1B 4HM0B 2KUBA 3JCUH 1OCVA 1Q86Q 1ZR2A 4AKZA 4HKZH 3Q2YA 2HLOA 3GZRA 4H0LC 3BCCD 2RNTA 4HJLB 4PD4D 1OGZA 1YVSA 2WSEJ 2QJPC 1LWUB 1ZMEC 5KP4A 3D6YA 5KLIC 4K90B 1JY3N 3WA3A 2G3AA 2NRGA 2HOHA 1JTHA 4U7JA 1DIPA 4I7ZB 2WOFA 3FKAA 3G713 1YGWA 2Z7AA 2JWDA 1YNVX 4KFDA 5KLVG 3LOYA 4RBNA 1YJ9P 4MMXB 3KFQC 5AEUB 1EDIA 2Z5IA 3H1LJ 2E5YA 1GU4A 3L73D 5AEWB 1LTJA 2Y0CA 1IDPA 1ZRTE 2IUKA 1N7LA 2FYUE 5AW7B 4H13B 3L71D 2YFIB 5RNTA 1B27A 2PZVA 3F7SA 1CH0A 3A5EA 4JQ0D 1QVG2 3FG1A 3PXMA 1JMBA 4K1UA 3TDKA 3D71A 3H1JD 1B20A 1HJBA 1UI8A 3ZG5A 1BGYG 2WITA 1SQPG 1S72P 1W5CE 2GU1A 4PV1C 3U1CA 1BNGA 4BRYA 5JPUA 4WYKA 2HMNB 2W9QA 1BRHA 3SFDC 1L0LG 4U3FD 5AW3B 1PFPA 1ISKA 1PIXA 4HJGH 4OGQC 1SQVJ 3FSDA 2WGOA 1YQ3C 3BIRA 1WMNA 3PTZA 2WOHA 5KKZB 3T97A 3CC2P 1SQQK 1WMPA 3BATA 3CX5I 3OX9A 5IW9A 3FF0A 5TGNA 3B5NB 4OVMA 3ABVC 1SFCB 5AVXB 4N6JA 1FDMA 3DGLA 3S4RA 1BSNA 3LH4A 3L70J 1N8QA 2GEXA 3OV4A 5AW9B 2GA1A 3CCE3 4JRFA 1VQK3 1ZR4A 2KZJA 1VQLP 1JBSA 3VYIA 1ZN5A 2YX9A 1EZVG 1FUWA 2WO0A 3Q1MA 2B89A 2M3BA 3ITKA 1VQPP 1FZAA 3DXOA 3B4OA 1W7CA 3KSED 1HGZA 2H88C 1OHOA 2R3SA 3URPA 3OW22 3WMM0 2AEMA 3F8HA 2YXQB 2GU3A 2R5DA 1NAFA 2KZIA 4O02B 3K0ZA 2E74C 1PGJA 2IMJA 3TNUA 1QVF2 1BRGA 3T0UA 1LT1A 1KN7A 1NTMG 2I8DA 2O01J 1L0ND 2WSCJ 2IFNA 1NNVA 1KYOD 3P8MC 1LQGC 1PP9G 2Y0EA 4GT1A 2KF4A 3SSUA 3H1HD 2YFJB 2K9JA 3D6ZA 3CPOA 2ZT9D 3LW5H 2WZ7A 1SQXE 1RN7A 3I553 1UCIA 5AVQB 5BU5A 5E79E 1URQD 2IPPA 3RK3D 1IQXA 2R32A 3G4SP 3VMXA 1VF5B 4GODA 2WPSA 3GZXB 1O7GB 2KNCA 3CCS3 1BUQA 1BE3D 1RHLA 1AVLA 1GD3A 1RHZB 3RL0B 5IEPA 4HYTB 1BANA 1HJ0A 3GHGB 2JWAA 2WTYA 1VQ7P 3W67A 1K8AQ 2W6BA 1KC8Q 1HTLC 1KILE 1T5YA 3K63A 2YO3A 5AYRB 1LJ2A 5AW4B 2Q3EA 3EBYA 3ER7A 3F40A 1EDLA 2BCCG 2MC8A 2E75D 5GTIE 4EYCA 1M8OB 2H89C 2NPSD 1YIJP 1SQBK 5H2FE 1W6YA 1S9KE 3M9QA 1SQQJ 2RKLA 1GU5A 4RZMA 5D82A 3IR9A 1RDSA 1AV1A 2KAAA 2W8ZA 1N73C 2A45G 5APQA 2P0MA 2K3RA 4CPKA 4BRYB 1LNIA 4EW5A 4DCKA 1OXZA 2Q1KA 3KDPB 1NGMB 2J58A 3LIEA 1UW1A 2O1KA 2F5WA 3IFMA 4NREA 1FA3A 3CME3 3L72G 2CX0A 1Q40B 1M7LA 1HWTC 5EQLA 5KAFH 3AECC 2IZ0A 4WBAA 2MF7A 1L0NK 3MSOA 1GYBA 1WQLB 1IU7A 1M1KQ 4PJ0E 3CCLP 2LYXA 2WPVB 4D6TG 2P58A 4RNTA 1HZ1A 5H2FH 1U57A 1T2KD 4H3UA 2C11A 1U5OA 1GK6A 1QX8A 5B5EE 3G6E3 2PGDA 2HPCB 1N8R4 2FFDB 3CC43 3AGOA 4AEQA 3G9RA 2XSHB 4C7NB 5B66H 2P38A 5KLIB 3L73J 1X8YA 4H13D 2ZDJA 4H61A 1UUWB 1RTUA 1LGHB 3L4FA 1N7SC 3PS8A 2V7QJ 2RCDA 4AYCA 1MNLA 3L74G 1WMOA 2E2TA 3EC9A 1Q82Q 1G96A 1FGQA 2KS1B 2YKQA 4L73A 1IYYA 1A2KA 3KYQA 1OWAA 2QA43 4QMAA 1BGYE 3TNUB 1BNEA 4KT3B 1X0TA 1I70A 1EDJA 4PJ0H 2PAJA 3AEAC 4PD4I 1FZBA 1CSBA 5APYA 3CWBD 1DE3A 4OUQA 3H3HA 1NWQA 2CIUA 4FMAA 5B5EH 4U3FJ 1VQ9P 2D1WA 4MMYB 2WSFJ 1EDKA 2I1KA 2K9JB 2OQEC 2GM4A 2K88A 1AR0A 1NWWA 4STDA 3H1IJ 4NPEA 3MZWB 3R2PA 1RNTA 3L35A 4H44B 3V2QA 1OIPA 2ZA4A 3OWYA 1K73Q 3B5ND 3P8CE 2FXPA 1SFCD 2CPBA 1N73A 2BT3A 3VTPC 1BSCA 1RGEA 4GB5A 1MV8A 3FLJA 1G2CA 3IPTA 1X1UA 1SQBJ 1BCCE 1TU3F 4OGQB 1G1JA 1FZFA 1VQ43 1W2B2 4ZMDA 1LTTC 1TFKA 1KILC 4CJNA 1UUGB 3MGNA 1IFDA 2J59M 4IOIH 1KQFB 4Y99C 4DOJA 3D3LA 3ZDMA 3S29A 3G3ZA 3LYGA 3H1KG 2QGUA 2CFWA 2FXOA 5G1LA 2W6JH 2JEEA 2ML5A 3NQZA 1MFTA 3F89A 1B2UA 4LLHA 5BIRA 2POHA 2UX0A 2YMKA 3KIIA 1L0NJ 5IENA 1FC2C 1NTZE 4LGQA 1GY5A 1KB9E 4R4KA 1M1JC 1N7SA 2L5GB 1T8ZA 2WSSH 1YJNP 1IFMA 2ZYAA 3CCMP 5AW0B 3CD63 1Q42A 3AEFC 1KFNA 1FW7A 2B87A 1H88A 3EWKA 1VDFA 3CLQA 4RJTA 1IK3A 1VF5D 1ZP0C 4HM1B 3CMAP 3UL5A 3L75E 3N54B 1YTZT 1FJPA 1A90A 3S9OA 3V6IA 5KLVK 2WT7A 3D9RA 3CX5D 3WU2H 4FCZA 4LYLB 1NTMD 1W5ZA 2C9LY 1PU4A 3H1LD 3PZWA 3RL0D 1BE3J 2A06D 1LOWA 3CXHE 2OTJ3 3DY5A 2OQEA 2CFGA 2STDA 2WSEH 2KOGA 1GL2B 3HTKA 3NMDA 1RN4A 5K5GB 1FGTA 4O2HA 3FCSB 4XBYA 4BU4A 2FYUG 2FBWC 2FXTA 1PPJD 1IVVA 1KB9H 1EXJA 3MHEA 3FZWA 3NHXA 1QVGO 1IK7A 4LEHA 4N6UA 1KSIA 2YNYA 3ECFA 1T3BA 2BCCE 4N78E 3DGYA 1E97A 3WODG 1SQPK 2N9YB 3SLUA 4HZ9B 1YIT3 1NKNA 3VMZA 3TGUJ 3W68A 1A2PA 1KILA 5AW8B 1L0LK 2XF3A 1IJDB 1SQVD 1UDII 4HVNA 4QWTA 2KLVA 1DYUA 1T2HA 3MD0A 3WOFB 3FWLA 3KN4A 2XSOB 3D5IA 1B3SA 2MKVA 1YI23 5BVZA 4ASVA 5AW6B 3VF1A 3L70D 3TK1A 1RN1A 3WA2X 1AVKA 1AY7A 1D6YA 1M1JA 1RE4C 1N73B 1OH0A 4YXWH 2W56A 2QIWA 1LNHA 1VQ83 4D6TE 2OYHC 3CC73 3EN8A 3V98A 1OPYA 1F8NA 1G2CB 2QM8A 4RKUJ 3H32B 3C9IA 1PFIA 1VQ5P 2GUSA 3OW2O 1JM0A 1AJYA 3WDGB 2F86B 1JY3P 2F5MA 4GHOA 7GSPA 1SQWA 3MG1A 1OHSA 3WMDA 2Q9IA 4OK0A 2OYIC 3D5GA 2H43A 1BAOA 1QVFO 4K61A 4BTYA 1US1A 1NTMK 2BEZF 2Q3IA 3A0BE 2RBIA 2XNDH 2L1SA 3JUOA 3KHUA 4MMZB 2CG0A 1EA2A 2Z5HA 1IZNB 1I3IA 4TT3H 2JDIH 2JJLA 5CCGD 5KLVJ 1VQO3 2KXGA 2IBZD 1RY3A 1IQYA 1A67A 1SQXG 1M57D 1GMPA 4MN4C 1Q7YQ 3PGBA 1LP1A 2HR3A 2E42A 3GRDA 1U8CB 1QAFA 2RH0A 2H0GA 2E76C 1FOSF 4HZBB 2WSCH 1WMKA 4R4MA 3KKGA 1YBKA 4CDLA 3L0RA 4H44D 3MHVA 2K54A 5STDA 3QRDA 3L74D 1TTOA 5EVHA 1VQNP 3E7KA 2ZXEB 4W7YA 4HM5B 3NXSA 3S28A 1CW5A 2WT7B 4EXRA 2JR8A 3A0BH 4YXDC 5KJ7C 5BU4A 3AMOB 1J1DB 4EBGA 2O9UX 2PRRA 1WRGA 3F7XA 4N3VA 1R5LA 1MGRA 4HH2A 2HFED 1L0LJ 3NV0B 4BWNA 1BGSA 3HTKB 1FU1A 2CWVA 4RESB 3X40A 3D79A 3FGYA 1GDTA 3E1RA 3BNDA 4EC6A 5IG0A 3I563 4XM4A 1RE4A 4RO0A 1FZCC 1FGOA 4LC1A 3LZAA 5AVTB 2W83C 1LOVA 1SQQD 2NZ2A 3EE1A 3LIDA 1IQ8A 1I2GA 3DUKA 2ZYDA 3SWYA 3GWRA 1EQKA 2LXBA 2V4HA 1IVWA 1YHQ3 1Q864 1GW4A 3BCCE 1RE3C 3BRVB 1RGHA 4PD4E 2M7OA 1G0TA 4ORLA 1S3JA 1GD4A 1ASKA 3HUSC 1JUNA 2ZFCA 2W27A 2B88A 4KHXA 1CI6A 1ZGXA 2QEX3 2OYIA 1JN5B 4L8OA 4LSOA 2ZAEB 2Z76A 1NB5I 3G71P 2E43A 4ASWA 3N9HA 1NU1D 2A15A 1E79H 1BSHA 1VQM3 1BUJA 1MWSA 1BDDA 4ZKPA 5BXQA 1N5HA 2LR2A 2YKPA 1VQ63 1NTMJ 1M90Q 3NUVA 1M1JB 1GY6A 1QL2A 1B2SA 1RKYA 3L71E 2HYNA 2W56B 1PP9J 1GL2D 4PD4H 5CLKA 8CHOA 3AE1C 2N1TC 3F5HA 1S4XA 4LZIA 4MEIA 3H1JE 3F14A 1DMNA 1USDA 1C7HA 1L2PA 2XGNA 1RF1C 2HMKB 1GZLA 5IG4A 1X1WA 5KJ7A 3GAXA 3GZBA 3JSVC 2GEYA 1J2BA 5GSPA 1UIIA 1O7WB 3HD7B 1DH3A 3NBJA 1C54A 3PJSK 2H7HA 2PP6A 1T2IA 1HYFA 2YIUC 5APSA 1EZVI 1W6GA 2HODB 2IX7C 1USEA 3K9MC 4X2HA 1L4AB 1YQ4C 3EB8A 3Q3FA 4IFDK 4L76A 1QAKA 1FZCA 1QLED 3CNXA 2V7QH 3H1ID 1GOYA 3JUNA 1I8VA 2P0XA 3HIIA 1D6UA 3BNEA 3T8NA 1YVBI 1RE3A 1GOUA 4XBXA 3AEBC 3CCEP 1VQKP 3RL0g 3HUSA 3FH1A 1S723 1NAYA 3KZIE 3Q5RA 4WHAA 1SQBD 3M9BA 1H89A 4HYZA 3RK2B 4TLFA 5CCHD 1IFPA 1MWRA 3GF3A 1BCCG 1EKMA 1W2BO 2QRXA 1AFOA 3FXDA 1TRPA 3DMCA 4KFFA 3X41A 2QM7A 2ZYGA 2W0QA 2CPSA 3NBBA 2CW9A 1YJWP 1RH5B 4WY4D 5CK6A 1NU1K 2CHCA 2ZL8A 5IEOA 1KYOE 3BB9A 3JUQA 4W80A 1HU9A 1IT7A 1EC5A 3GLMA 3L72J 2R3CA 4BTWA 1DD4A 1ROAA 3HIGA 1P84I 3H1HE 2RGQA 4JYCA 3FXEA 3KZIH 2N1TA 1NTZG 1NTKE 1PGOA 1JY2N 1NU3A 3I55P 3RK3E 3EQQB 1NO4A 2WQYC 3HK4A 1RF1A 5DJTB 1OX3A 2KB7P 2D2CC 2B9BA 2BU4A 1RGAA 1BE3E 2Q5UA 3CCSP 1JB0J 3L75G 1JJ22 1CEWI 2BMOB 4HKVB 2PFXA 3E99A 1Q81Q 3M91A 3B71A 5DJUB 2CG1A 1JTHB 1KYOH 1ZOYC 3A0HE 3U1WA 1Z1SA 4HBRA 1DD3A 3L74J 1HF9A 1S2EA 3I0YA 2R5BA 1R4YA 1RMSA 1SPUA 2KXPB 1K8A4 2XR8B 3BNBA 1KC84 5AVVB 5AVWB 3SOYA 1PGPA 1IV9A 2FYUK 1FE6A 4I6MC 3M06A 1NJIQ 1LNQA 3HE5A 1LTJB 3ROBA 5KAFE 1K28A 4EV5A 3SEDA 1DEEG 1PV3A 4NPBA 3B4PA 4KZ1A 2QJYB 1ULJB 3CCJ3 1IVUA 1MWUA 1RGGA 3PCSA 3TGUD 2AXCA 2AEFA 1OF5A 4W7ZA 2QG4A 1SARA 1J1EB 2IBZI 2Q6QA 3A0HH 3K7CA 1H0TA 2E2VA 2OTKE 2OWPA 5TJHA 3CXC2 5B66E 2P7JA 3H25A 3AHSA 4WYKB 3CMEP 4IIAA 2OQQA 1X1YA 2C0WA 1BRJA 1M56D 1JB2A 3VSYA 2CC3A 2E2UA 2FYNB 1B21A 1M1K4 3T97B 2I1JA 1IFIA 5APXA 3VP8A 1NU1J 1S9KD 5AW1B 2UWJE 2KF5A 1FAVA 3G6EP 3H1KJ 3CC4P 1PYLA 3CCQ3 2BHMA 1DETA 3DM8A 4H0LB 2F99A 2QJPB 4ILFA 3F9SA 2WPRA 2QJKC 2ML6A 4O3VA 1I0XA 1JB4A 1OGXA 4BL3A 3AEEC 1Q824 2QA4P 1S5LX 2CWTA 5KTBA 1SP4A 1BSEA 3EJVA 3ALAA 3CCL3 1OHPA 2J8XB 3HD7D 4AQRD 3VP9A 1DEBA 1OW7A 3CWBE 5KLVD 1RGLA 2KLUA 3V99A 3O8ZA 3N8BA 1UUVB 2ZT9C 3CI9A 1U7MA 2WVRA 1L4AD 5LC6A 3NM7A 5APUA 1SQXK 2XEPA 1URQC 2N1TB 3RK3C 4O8SA 5AVSB 2H0IA 1WNHA 4KT0J 1NB3I 2BASA 1WT6A 2FYUJ 3BVHA 1LVNA 1K734 1PZQA 5TISE 5CBNA 1MGWA 2ITAA 5AVYB 3MPHA 1OUNA 1W00A 3EBTA 2GUVA 1RQUA 2KYVA 1CYUA 4PV1B 1V74A 1BGYD 1ZLLA 1VQ4P 1SQPD 2KNCB 1KV4A 3RK2D 2P09A 4KVHA 1LT9C 5IG5A 2INXA 1LOXA 2OCTA 3L37A 1L0LD 1O7HB 1BNJA 4R80A 2M8RA 1KMIZ 4HOHA 3KZTA 3GW6A 1JCDA 2E75C 2FYZA 5AW5B 2XDJA 2NPSC 2AXTE 3KQGA 3HI7A 4J5KA 3BNCA 2C4BA 4JF7A 3WU2E 4I5QA 4A7PA 3K5BA 2IDBA 3BRTB 3P32A 3UJMA 5TISH 5AVZB 2R4IA 1HGVA 3BCCG 2FY8A 1ROVA 4HAAA 3PRJA 1OF5B 5AW2B 2O3OA 3CD6P 2DW3A 2YXRB
chains in the Genus database with same CATH topology
1AQTA 1N9EA 3MG3A 2GU1A 2KXGA 1VQO3 3X3YA 1OACA 5ELUA 4WYKA 2HMNB 2W9QA 5JPUA 4WWUC 2LQVA 1IQYA 1A67A 2HMMB 1JRQA 1IT8A 1PFPA 1YIJ3 1ISKA 3PGBA 4L8PA 3GRDA 1DVDA 1QALA 1U8CB 1QAFA 2Z6BA 3IMAB 3FSDA 2WGOA 1Y4KA 4HZBB 2P05A 4R1KA 3DZLA 3KKGA 4CDLA 1WMNA 3L0RA 4AKYA 2WOHA 2K54A 5STDA 2XFSA 3QRDA 1WMPA 5EVHA 3OX9A 5IW9A 3FF0A 5TGNA 1WTHA 4OVMA 1VZZA 3DGLA 4HM5B 3S28A 3HX8A 3UNLA 1BSNA 3RDEA 3LH4A 4EXRA 1N8QA 2XH9A 1JKGA 2GEXA 2CKFB 3OV4A 3BLZA 3CCM3 3AMOB 4EBGA 2O9UX 3CCE3 3FG3A 4JRFA 1VQK3 3F7XA 5JPPA 4N3VA 3CCR3 4IT7A 2YX9A 3PYJA 3NV0B 1FUWA 4N6LA 2CWVA 4FR9A 3X40A 2WO0A 2IUJA 3FGYA 1HKXA 1IVXA 3B4OA 3DXOA 1W7CA 3BNDA 3KSED 5IG0A 4EC6A 3I563 4XM4A 1OHOA 1FGOA 3OW22 3LZAA 3F8HA 3JUMA 3EE1A 4TX4A 2KCDA 2GU3A 4O02B 1CYVA 1IQ8A 3K0ZA 4N6MA 1GY7A 3DUKA 2BO9B 2IMJA 1E3RA 5KP3A 2Q07A 3GWRA 1QVF2 1EQKA 1IVWA 1L5GB 3T0UA 1YHQ3 1Q864 6STDA 1A2VA 2M7OA 4ORLA 1STFI 1GD4A 4FMCA 1ASKA 1RRLA 4R9KA 1R4CA 3KSPA 4FCMA 2QEX3 3H51A 1JN5B 3T8UA 4L8OA 1IV7A 2YFJB 5CF2A 4LSOA 3CPOA 2Z76A 5FW5A 1NB5I 3F8XA 1RN7A 1QMAA 3N9HA 3I553 2JQ5A 2A15A 1SIIA 1IQXA 3MWZA 1E79H 1BSHA 4FCJA 5DRVA 1VQM3 5BXQA 3GZXB 1N5HA 3LXUX 3S27A 1O7GB 2PNCA 3CCS3 1VQ93 1BUQA 3S67A 2OTL3 3MKIA 4BTXA 1AVLA 1GD3A 3V92A 1VQ63 3NUVA 5IEPA 1GY6A 1ULIB 1RKYA 4JF8A 2W56B 3KE7A 2YFLB 5CLKA 8CHOA 5IERA 5HGRA 3EF8A 3CU3A 4GL6A 4LZIA 1T5YA 4MEIA 5KP1A 5D83A 1RJOA 3K63A 3F14A 1DMNA 1C7HA 2XGNA 2E5TA 1O7NB 4XDVA 2GBWB 5AYRB 2HMKB 5IG4A 1LXEA 1FS0E 3GAXA 1TFOA 3GZBA 2GEYA 3EBYA 3ER7A 3F40A 4XBTA 1J2BA 2BMRB 2IA7A 2MC8A 1O7WB 3NBJA 3PJSK 3IJEB 3LTDA 4EYCA 4FMDA 3UL6A 3SOAA 1AV4A 1W6YA 2WGQA 1W6GA 1Q7Y4 1O7MB 4X2HA 3K9MC 4RZMA 4HM7B 5D82A 3NQYA 3CPW2 1TU5A 3EB8A 4MJDA 4HM4B 1QAKA 1EG9B 3NM2A 2P0MA 2GBXB 3CNXA 2V7QH 5IG3A 1UI7A 1N5PA 3JUNA 1M9GA 2P0XA 3HIIA 3S5CA 1W02A 1D6UA 5BVBA 4RNZA 3MYTA 4N6TA 3BNEA 1UW1A 4WP5A 3T8NA 1ZX2A 1YVBI 4NREA 1KQS2 3SXXA 3CME3 2KRTA 1FA3A 4XBXA 1SIHA 1Q40B 3FH1A 5EQLA 1S723 3Q1CA 4KFEA 1YJN3 4WHAA 2MF7A 3GZYB 4HYZA 2K0MA 1GYBA 4TLFA 1WQLB 1FGMA 1IU7A 3MSOA 2B1XB 1IFPA 2XFTA 1EKMA 2XRXB 3U97A 2LYXA 2FGTA 3LMLA 3DMCA 4KFFA 3HZPA 3X41A 4H3UA 3AMOA 2C11A 3CMA3 5ELJA 1U5OA 2W0QA 2CFKA 3SVAA 3NBBA 3G6E3 2CW9A 1TUHA 3X3ZA 1N8R4 3CC43 1FGRA 5CK6A 4AEQA 1S5AA 2XSHB 2L4VA 2CHCA 3NV0A 4IPBA 2ZL8A 1D6ZA 3CCV3 2P38A 5IEOA 3BB9A 2ZDJA 3JUQA 4H61A 1HU9A 1UUWB 1IT7A 3X3XA 2BNGA 3PS8A 4J9AA 5G2GA 4BTWA 1ROAA 4XB5A 2RCDA 3HIGA 1MNLA 1WMOA 2Y73A 1DMQA 2E2TA 3EC9A 1G96A 1FGQA 1K41A 2RGQA 3NX0A 3SX1A 3JUPA 1A2KA 2Y74A 2QA43 2W03A 4QMAA 3A76A 3CCU3 1NU3A 5CXOA 1YGEA 3FG4A 1TP6A 2V1LA 1E3VA 3EQQB 3HK4A 4ZM8A 1JN5A 1O7PB 4OUQA 1JNQA 3H3HA 2CIUA 4FMAA 4MMYB 2D1WA 3CNMA 2CFDA 2OQEC 5IF6A 4R9LA 1JJ22 1AR0A 1CEWI 2BMOB 4HKVB 3E99A 1NWWA 4N6NB 4STDA 3OWUA 4RNYA 1M904 2CG1A 3U1WA 3OWYA 4HM8B 1STDA 3EHCA 2QE7H 1Z1SA 2HMLB 4HBRA 4N6V0 2BT3A 3PCRA 4HM6B 3I0YA 3MG2A 4GB5A 2CH9A 1SPUA 1K8A4 2XR8B 3BNBA 1KC84 3FLJA 3LTBA 4Q53A 1K9M4 3SOYA 3OXAA 1IV9A 3B7CA 1SJWA 3IPTA 3VGNA 3LT9A 4EV2A 1VQ43 1W2B2 2GXFA 3ROBA 1TFKA 1K28A 2BMQB 1ZO2A 4EV5A 3SEDA 5I97A 3B4PA 1N9JA 1M1XB 4KZ1A 5D81A 1ULJB 3CCJ3 1IVUA 3D3LA 3J7Yd 1YJ93 3PCSA 3S29A 1JEKA 4NHFA 3LYGA 4N6OB 1OF5A 2QGUA 5AYSC 4J8TA 5AIGA 2CFWA 1VQ53 2OOVC 4XDWA 2W6JH 4U13A 2ML5A 3NQZA 5EEOA 3K7CA 7STDA 2E2VA 2OWPA 3CXC2 1W4NA 1W01A 2UX0A 3G8ZA 3KIIA 4FMBA 4IIAA 4WYKB 3LT8A 5AIIA 3RGAA 5IENA 4LGQA 1GY5A 3QK9A 1CQSA 2Z77A 4R4KA 4DJGA 1JB2A 2WSSH 3VSYA 4CCVA 2CC3A 3CD63 1Q42A 2E2UA 3Q2PA 2RSXA 2W04A 3WOEB 1GS3A 3JVCA 2D42A 2HMOB 1M1K4 3RGRA 2CWUA 1IK3A 4PEJA 2C10A 4HM1B 1TIJA 3UL5A 3OWSA 3N54B 3EX9A 1A90A 3LTCA 1Q40A 3D9RA 1JV2B 3NBRA 4FCZA 5FGOA 1W5ZA 3CCQ3 1MOLA 1JKGB 2BHMA 3STDA 1PU4A 3PZWA 3DM8A 2OTJ3 4HM2B 2F99A 5AIHA 3DY5A 3DGOA 2OQEA 2CFGA 2STDA 3CC23 5AI1A 5AIFA 2SBLA 4LMIA 2CK3H 4O2HA 1VQN3 1FGTA 3F9SA 3FCSB 4XBYA 3DGMA 2ML6A 1KD14 4O3VA 2FXTA 2I9WA 2RFRA 2XGLA 1IVVA 1JB5A 2W9PA 1JB4A 1OGXA 1Q824 3MHEA 2CWTA 3FZWA 3NHXA 3UB1A 3DGNA 3M8CA 3EJVA 3ALAA 4LEHA 4N6UA 3CCL3 1VQL3 1OHPA 1KSIA 2FNQA 5JBSA 3ECFA 3G0KA 3X42A 4WFOA 2QIYA 1DMMA 1E97A 4HM3B 3WODG 3V99A 1QJGA 3SLUA 3N8BA 1NDOB 4HZ9B 5CF1A 1YIT3 1UUVB 1YJW3 1VQP3 4WVZA 5LC6A 5A0OB 3NM7A 3B8LA 2CFLA 2XF3A 2XEPA 4O8SA 3EN1B 4HM0B 4HVNA 4QWTA 3K5TA 1Q814 1DYUA 1OCVA 3WOFB 1WNHA 4AKZA 4K1VA 3KN4A 1NB3I 2XSOB 1LVNA 1NO3A 2W2CA 2F98A 2HMJB 1K734 1YI23 2OOVA 3GZRA 3O8YA 4HJLB 3MPHA 1OUNA 1OGZA 1W00A 3EBTA 4X2OA 3VF1A 5KP4A 1CYUA 4K90B 1V74A 3WA3A 3WA2X 3Q90A 1AVKA 1W6CA 1NJI4 3EFFK 2WOFA 3FKAA 2P09A 1D6YA 4I4KA 4KVHA 1DVCA 3G713 1OH0A 5IG5A 2INXA 2Z7AA 1LOXA 2OCTA 1W2ZA 4YXWH 2W56A 1O7HB 4KFDA 1LNHA 1VQ83 3CC73 4R80A 3G4S3 3G16A 3EN8A 3LOYA 3V98A 3LTAA 4RBNA 1OPYA 1F8NA 1KWIA 3KZTA 4G1MB 4MMXB 3KFQC 5AEUB 3NXJA 2E5YA 4L7KA 2B24B 3WDGB 3USSA 5AEWB 2F86B 3HI7A 1IDPA 3BNCA 3FF2A 2IUKA 1SQWA 3MG1A 1OHSA 3WMDA 4OK0A 1RRHA 3UJMA 2YFIB 3TDGA 4K61A 2R4IA 2PZVA 4BTYA 3F7SA 1US1A 1VQ73 1ROVA 5DREA 2XNDH 3FG1A 3JUOA 1QVG2 3PXMA 1OF5B 4K1UA 4MMZB 2CG0A 1EA2A 5LC7A 2O3OA 1UI8A 2JDIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQT A;  2E5Y A;  4DJG A;  3PJS K;  2WSS H;  3USS A;  1JEK A;  1BSN A;  4WVZ A;  2CK3 H;  2W6J H;  3EFF K;  4TLF A;  1E79 H;  1BSH A;  1IFP A;  4YXW H;  2V7Q H;  2E5T A;  2XND H;  1FS0 E;  4QMA A;  2QE7 H;  2JDI H; 
#chains in the Genus database with same CATH topology
 1AQT A;  1EZV D;  3A5T A;  1BSB A;  1LWU C;  3MG3 A;  3X3Y A;  1OAC A;  2BEQ D;  2C9N Y;  5ELU A;  2M3E A;  3OAK A;  4WWU C;  2C0X A;  4I7Z C;  3R4Y A;  1IT8 A;  4DKI A;  3CX5 E;  3QWO C;  4L8P A;  2E74 B;  1R8E A;  3IF4 A;  1DVD A;  3H1L E;  2Z6B A;  3IMA B;  1R5S A;  3AED C;  3N7N A;  2A06 E;  2AXT H;  4AKY A;  2OTJ P;  1T2K C;  3L73 G;  2YO2 A;  2XFS A;  1URQ A;  9RNT A;  3OJA B;  1PP9 D;  1VZZ A;  3L71 G;  1GMJ A;  2IYP A;  3HX8 A;  3RDE A;  3GSP A;  1T3U A;  2XH9 A;  1JKG A;  4H13 C;  1JNM A;  3HOH A;  3CCM 3;  2D2C B;  2XZR A;  1MKM A;  1YTZ I;  3H1J G;  3JC2 2;  3CCR 3;  3PYJ A;  1SQX J;  3CCU P;  4N6L A;  2QSI A;  3V2N A;  2IUJ A;  1W2E A;  1IO4 A;  1HKX A;  1IVX A;  3CX5 H;  4Y28 J;  4U3F G;  1LT9 A;  3MIW A;  4ZNC A;  1UIX A;  1OVV A;  1SQV E;  4NPF X;  3JUM A;  2F4Y A;  2KCD A;  1A02 J;  4N6M A;  1GY7 A;  2H0H A;  2BO9 B;  1E3R A;  1P84 D;  4GDO A;  3WUV A;  4LGD E;  2NPS A;  1YI2 P;  1A2V A;  3GF7 A;  4WWI A;  6RNT A;  4FMC A;  4R9K A;  4L74 A;  3L70 E;  1R4C A;  3KSP A;  2R41 A;  4FCM A;  2YKO A;  1NVO A;  3H51 A;  3AE9 C;  1SFC C;  1IV7 A;  2BIR A;  2WWW A;  1IK9 A;  3AE2 C;  3II6 A;  2BCC D;  1QMA A;  3CC7 P;  2KP8 A;  5DRV A;  2UGI A;  3KXD A;  1P84 H;  1AVY A;  2ZJS E;  3LXU X;  3S27 A;  2M5A A;  1KZU B;  2PNC A;  1G02 A;  3S67 A;  2OTL 3;  5G1K A;  1AQZ A;  1JBR A;  1N86 A;  4JBZ A;  4H0L D;  1ULI B;  4XA4 A;  2K37 A;  1EUI C;  3MTU E;  3KE7 A;  1G1I A;  3I5C A;  2N9B A;  5IER A;  3VN0 A;  3FGA D;  3L72 D;  4IL6 X;  4GL6 A;  1UCL A;  1K9M Q;  5KP1 A;  1RJO A;  1Y8A A;  1BNS A;  1FOS E;  1O7N B;  1RGK A;  3H1H G;  2SAR A;  1FS0 E;  1VQO P;  2IBZ E;  1NTZ K;  1NTK G;  4D6T D;  2HG5 D;  1GTW A;  3LTD A;  5CMZ A;  4YPC A;  3UL6 A;  3SOA A;  2WPQ A;  1Q7Y 4;  4HM7 B;  1Y47 A;  4Z1M H;  3CPW 2;  3U59 A;  1VF5 C;  1UCK A;  4HM4 B;  2O1J A;  1BE3 G;  1EG9 B;  3NM2 A;  1N7S B;  4EI2 A;  2GBX B;  3RBZ A;  1PY3 A;  1JZO A;  2O01 H;  2JP3 A;  5IG3 A;  4C46 A;  1M9G A;  2Z4E A;  1W02 A;  2B87 B;  3RL0 C;  5BVB A;  4RNZ A;  3MYT A;  4WP5 A;  1LTG C;  1ZX2 A;  1KQS 2;  2KI7 B;  3SXX A;  2KRT A;  3GHG C;  1Q7H A;  4PV1 D;  2AAE A;  1SIH A;  3PP5 A;  1RNB A;  1BGY J;  1X79 B;  1FGM A;  2VRS A;  1SQP J;  2XFT A;  3U97 A;  4OGQ D;  1KTM A;  2FKW B;  3I56 P;  3EQ2 A;  3HZP A;  1SQQ E;  5ELJ A;  2CFK A;  3SVA A;  3X3Z A;  1ZS7 A;  1S5A A;  2L4V A;  4IPB A;  3CCV 3;  1U7J A;  1YHQ P;  2OYH A;  3V2R A;  1LOY A;  1KQL A;  2H8P D;  1KD1 Q;  2BNG A;  4J9A A;  5G2G A;  4XB5 A;  2QEX P;  4DT0 A;  3AE3 C;  1K41 A;  3NX0 A;  3SX1 A;  2IFM A;  2Y74 A;  1KIL B;  2W03 A;  1BCC J;  1S5L E;  5CXO A;  2NPS B;  1EEJ A;  1TP6 A;  3FG4 A;  5APW A;  5AVR B;  4Y99 B;  1VQM P;  2SPZ A;  4GIF A;  1HUC A;  2E74 D;  1O7P B;  3V5B A;  4AUW A;  2ZHX B;  3H1K D;  3CNM A;  2CFD A;  4R9L A;  1VQ6 P;  3OWU A;  1X1X A;  2W6A A;  3L73 E;  1M90 4;  1JY2 P;  4YTP C;  2FFD C;  3EHC A;  1FZE A;  1JY2 O;  1JMM A;  4WB4 A;  2CH9 A;  3OA7 A;  2M5A B;  1NTZ J;  4Q53 A;  2D2C D;  1UGH I;  1SJW A;  2JKV A;  3B7C A;  3LT9 A;  2W90 A;  2UUG C;  1S5L H;  4EIJ A;  3SWK A;  3GHG A;  3WHO A;  3SFE C;  2Y9Z A;  3HRN A;  5M1A A;  5I97 A;  1MFZ A;  2QVA A;  3EFG A;  1N9J A;  1M1X B;  3CWB G;  3L75 J;  5CCG C;  4U3F E;  5CBO A;  1YJ9 3;  2XU6 A;  2K3D A;  5AIG A;  3H1I E;  2K9Y A;  5AYS C;  1OMI A;  2OOV C;  4XDW A;  4HB1 A;  4U13 A;  3D70 A;  1ZRT D;  1MWT A;  1BRK A;  1W4N A;  2FYU D;  2O01 N;  1W01 A;  4H44 C;  3RGA A;  4FMB A;  5AII A;  1TRQ A;  1AQ5 A;  3QK9 A;  2JO1 A;  1LP1 B;  1SQB E;  4GOE A;  3A3Y B;  2OYO A;  2RSX A;  3Q2P A;  1X22 A;  2W04 A;  1GS3 A;  7RNT A;  3JVC A;  2D42 A;  2HMO B;  1UGI A;  3RGR A;  2P2U A;  2BCC J;  4BXL A;  1KB9 I;  4PEJ A;  1KOR A;  1TIJ A;  2P1J A;  3ZG0 A;  1I2E A;  3EX9 A;  2G8Y A;  3LTC A;  1IFJ A;  2WSF H;  1Q40 A;  3S1K A;  1JV2 B;  1YYC A;  1SS1 A;  1Q90 D;  1MOL A;  1EQ7 A;  1BOX A;  4BIR A;  1GMR A;  3CC2 3;  5AI1 A;  5AIF A;  4LMI A;  1T6A A;  1T3J A;  1RCK A;  2CK3 H;  1L0N E;  3DGM A;  2XKM A;  4R4L A;  2HPC A;  2FFD A;  1JB5 A;  1Y9B A;  1B2X A;  4C7N A;  3CXH I;  3HE4 A;  1E5W A;  3UB1 A;  3DGN A;  1Q2N A;  2OYH B;  1VQL 3;  2FNQ A;  1QL1 A;  3G0K A;  3X42 A;  3E1I A;  3VMA A;  2Y9Y A;  2QIY A;  1RCL A;  4NPD A;  3AE4 C;  4HM3 B;  4OVN F;  4CPG A;  1QJG A;  1NDO B;  5CF1 A;  4D6T J;  1LTI C;  2KS1 A;  1YJW 3;  1QEX A;  1VQP 3;  4I2L C;  4WVZ A;  3IN6 A;  3B8L A;  1GW3 A;  1CI6 B;  3A7O A;  2OYI B;  1N7S D;  5CCG A;  3K5T A;  3H1L G;  3Q5P A;  1Q81 4;  3RBX A;  2A06 G;  4K1V A;  3M0D C;  1OVU A;  1OW6 A;  1UCJ A;  1NO3 A;  2W2C A;  2F98 A;  2HMJ B;  2OOV A;  3O8Y A;  2KIK A;  4X2O A;  2AEJ A;  2A45 I;  1PPJ G;  1GL2 C;  3AE7 C;  2ZVN B;  3FWN A;  1LTB C;  4ZKU A;  1NTK D;  3Q90 A;  1W6C A;  1NJI 4;  3EFF K;  5GTH E;  4GSP A;  1DVC A;  4I4K A;  5KAI E;  1BVI A;  1W2Z A;  3B8E B;  1SQX D;  1RLS A;  2E76 B;  3G4S 3;  3G16 A;  3CCJ P;  3LTA A;  5L8R J;  3TGU E;  1KWI A;  4G1M B;  3NXJ A;  1GSP A;  1KQG B;  4L7K A;  2B24 B;  4XE5 B;  4JYB A;  3USS A;  1SQV G;  1EXI A;  1BSD A;  3FF2 A;  1JBT A;  3PH0 A;  1GD2 E;  3RGU A;  1V58 A;  2P10 A;  3RNT A;  1RRH A;  1VPC A;  3TDG A;  1TJD A;  8RNT A;  3BAS A;  1VQ7 3;  2J5U A;  3SWF A;  4DZO A;  5APV A;  5DRE A;  4KJM A;  1A02 F;  1SVF A;  4IL6 E;  1KIL D;  3L70 G;  1V57 A;  4N3Y B;  5LC7 A;  5E79 H;  1N9E A;  5GTH H;  2WMM A;  1FZC B;  5KAI H;  1AVO A;  2AAD A;  2LQV A;  2HMM B;  3WUT A;  1JRQ A;  1YIJ 3;  5CCH C;  1QAL A;  1PL5 A;  3CCQ P;  4I1L A;  1Y4K A;  2P05 A;  4R1K A;  3DZL A;  1BNR A;  3HUS B;  5C39 A;  2K1A A;  4WY4 C;  3BCC J;  1WTH A;  3UNL A;  2KK7 A;  3M0D A;  2CKF B;  1FYS A;  3BLZ A;  4IL6 H;  1OW8 A;  1J2J B;  1K04 A;  3FG3 A;  3KPE A;  5JPP A;  2MJZ A;  5GTI H;  5KLV E;  1GL2 A;  4IT7 A;  4FR9 A;  1NHL A;  2IBZ G;  4K35 A;  1LRA A;  1FZU A;  2LKM A;  1NTK K;  1BU4 A;  3HE4 B;  1N8R Q;  3Q5S A;  4TX4 A;  3QH9 A;  2Q7C A;  1CYV A;  1VL2 A;  4GOF A;  3CPW O;  3AGN A;  2F56 A;  3M0A A;  5KP3 A;  4EYY Q;  2Q07 A;  1L5G B;  3L71 J;  6STD A;  1STF I;  1RRL A;  1RF1 B;  1FUT A;  4UB6 E;  5M1B A;  1AA0 A;  3IAO A;  3TSI A;  2L91 A;  3H1J J;  3T8U A;  1SQP E;  1KQS O;  5CF2 A;  1DX7 A;  1K05 A;  1RGF A;  5FW5 A;  1ZXG A;  2YIU B;  3VMY A;  1L0L E;  3F8X A;  1J1D C;  3KCH A;  2JQ5 A;  1SII A;  3MWZ A;  4FCJ A;  1RSN A;  5CHX A;  1VQ9 3;  1SQQ G;  3DH2 A;  3NFQ A;  3MKI A;  4BTX A;  3V92 A;  5BU8 B;  5CCH A;  3AEG C;  4JF8 A;  1BSA A;  1XTC C;  2YFL B;  2M0B A;  3HE5 B;  2YMY A;  2XNX A;  3P8C D;  3H32 A;  5HGR A;  3WR2 A;  3NTN A;  4UB6 H;  1FUS A;  3EF8 A;  3CU3 A;  3TF5 A;  5HOH A;  4WY4 A;  5D83 A;  1BIR A;  2E5T A;  1EZV E;  4XDV A;  2GBW B;  1LXE A;  3L36 A;  1TFO A;  1B2M A;  4XBT A;  1BCC D;  2BMR B;  2IA7 A;  1H8A A;  1RF0 C;  1NU1 G;  1QGK B;  3IJE B;  1NYH A;  4FMD A;  1H0T B;  3LW5 J;  1AV4 A;  1BNF A;  2WGQ A;  1O7M B;  3AE8 C;  3NQY A;  1TU5 A;  3A2A A;  1MUU A;  4MJD A;  3C1L A;  3PLN A;  1BNI A;  1NTM E;  1OVR A;  1PP9 E;  1UI7 A;  1N5P A;  2RN0 A;  3S5C A;  2KSE A;  3O6Q A;  4N6T A;  1ZW0 A;  1XTG B;  1JZD A;  1KFM A;  1BDC A;  1PPJ E;  3H1H J;  1NTZ D;  3P7K A;  1KB9 D;  3Q1C A;  3TYY A;  4KFE A;  1YJN 3;  3CCR P;  1NKZ B;  1NTK J;  2FXM A;  3GZY B;  2K0M A;  1NH4 A;  2LXC B;  5EFW B;  3H6P A;  2B1X B;  2KF3 A;  2XRX B;  2RMZ A;  2IZ1 A;  2FGT A;  1HVV A;  2E76 D;  3LML A;  5M19 A;  2ZXX A;  4XFJ A;  1B2Z A;  3AMO A;  3CMA 3;  1N2D C;  3HD7 C;  1YIT P;  3L75 D;  3MP7 B;  5M18 A;  1TUH A;  3GMA A;  1FGR A;  5APT A;  1P84 E;  3NV0 A;  2OGU A;  1D6Z A;  1L4A C;  1LQM B;  5KJ7 D;  3H1I G;  3CXH D;  3X3X A;  4EOT A;  4UB8 E;  1IFN A;  4BL2 A;  2Y73 A;  1DMQ A;  3U1A A;  5KKZ C;  3JUP A;  2OAR A;  1KYO I;  2XV5 A;  3A76 A;  3CCU 3;  3B5N C;  1BRI A;  3Q3D A;  1SQB G;  1YGE A;  2V1L A;  1E3V A;  3CL3 D;  1RGC A;  4N78 D;  2IY2 A;  4ZM8 A;  3RK2 C;  1Q9E A;  1JN5 A;  1FBM A;  1JNQ A;  1VQ8 P;  1RF0 A;  1JO5 A;  3BU4 A;  3CXH H;  2OTL P;  5IF6 A;  1LWU A;  4N6N B;  1OFC X;  4RNY A;  4O9B A;  1FDO A;  4HM8 B;  1STD A;  2QE7 H;  2HML B;  3L72 E;  4N6V 0;  3MUD C;  4UB8 H;  3PCR A;  4HM6 B;  3MG2 A;  4JPZ B;  1I2F A;  5AVU B;  3LTB A;  1K9M 4;  1L0N G;  3OXA A;  3D4A A;  3VGN A;  1I3F A;  4EV2 A;  2CX1 A;  4K3A A;  2GXF A;  1HBW A;  2BMQ B;  1HH0 A;  1ZO2 A;  4B86 A;  1Z56 A;  3AHW A;  4C7R A;  5D81 A;  1GOV A;  4WY4 B;  2A45 H;  1JOC A;  3J7Y d;  3ZFZ A;  1FDI A;  1JEK A;  1BRS A;  4NHF A;  2ZVO B;  4N6O B;  6GSP A;  4EDF A;  1VQ5 3;  1JY3 O;  4J8T A;  2N1T D;  3HD7 A;  2IYJ A;  2QJK B;  5EEO A;  7STD A;  3L74 E;  1IC2 A;  2HOD A;  5CJ4 A;  1GK4 A;  1L4A A;  3PHL A;  3G8Z A;  1BRN L;  3LT8 A;  3V4W A;  1NOH A;  1CQS A;  3N4X A;  2Z77 A;  4DJG A;  4OH8 B;  4CCV A;  3UIA A;  3VOP A;  4L75 A;  1X9V A;  2ZT9 B;  3WOE B;  3AE6 C;  2CWU A;  3V4Q A;  3CWB J;  2IYO A;  3O6Q B;  1URQ B;  3RK3 B;  3B5N A;  2C10 A;  3OWS A;  1SFC A;  3GG2 A;  1LTJ C;  1MZ9 A;  2Y0D A;  3WUU A;  2R44 A;  3NBR A;  5FGO A;  3TGU G;  1JKG B;  3STD A;  2QJY C;  3CCV P;  2KF6 A;  4IFM A;  3JCU E;  1SLQ A;  4OWF A;  4HM2 B;  4IFF A;  5AIH A;  1JCC A;  3DGO A;  2P67 A;  2SBL A;  1SQV K;  1FJK A;  1I0V A;  1VQN 3;  1J1E C;  5CJ0 A;  1KD1 4;  2O3J A;  2I9W A;  2RFR A;  2XGL A;  3FX0 A;  2W9P A;  1LTS C;  1PGQ A;  3MUD A;  1LT9 B;  1ZV8 A;  3V2P A;  1OZH A;  1GMQ A;  3M8C A;  1FZG A;  4J5G A;  2GSP A;  1S1C X;  5JBS A;  4WFO A;  4GKG A;  1DMM A;  3B4S A;  2E75 B;  1NU1 E;  3C8V A;  1LTA C;  1D7M A;  2FYN C;  3M9H A;  1CZQ A;  3H1K E;  3AE5 C;  3SYU A;  5A0O B;  4M3L A;  2KSJ A;  2CFL A;  1VQQ A;  1RQV A;  3EN1 B;  4HM0 B;  2KUB A;  3JCU H;  1OCV A;  1Q86 Q;  1ZR2 A;  4AKZ A;  4HKZ H;  3Q2Y A;  2HLO A;  3GZR A;  4H0L C;  3BCC D;  2RNT A;  4HJL B;  4PD4 D;  1OGZ A;  1YVS A;  2WSE J;  2QJP C;  1LWU B;  1ZME C;  5KP4 A;  3D6Y A;  5KLI C;  4K90 B;  1JY3 N;  3WA3 A;  2G3A A;  2NRG A;  2HOH A;  1JTH A;  4U7J A;  1DIP A;  4I7Z B;  2WOF A;  3FKA A;  3G71 3;  1YGW A;  2Z7A A;  2JWD A;  1YNV X;  4KFD A;  5KLV G;  3LOY A;  4RBN A;  1YJ9 P;  4MMX B;  3KFQ C;  5AEU B;  1EDI A;  2Z5I A;  3H1L J;  2E5Y A;  1GU4 A;  3L73 D;  5AEW B;  1LTJ A;  2Y0C A;  1IDP A;  1ZRT E;  2IUK A;  1N7L A;  2FYU E;  5AW7 B;  4H13 B;  3L71 D;  2YFI B;  5RNT A;  1B27 A;  2PZV A;  3F7S A;  1CH0 A;  3A5E A;  4JQ0 D;  1QVG 2;  3FG1 A;  3PXM A;  1JMB A;  4K1U A;  3TDK A;  3D71 A;  3H1J D;  1B20 A;  1HJB A;  1UI8 A;  3ZG5 A;  1BGY G;  2WIT A;  1SQP G;  1S72 P;  1W5C E;  2GU1 A;  4PV1 C;  3U1C A;  1BNG A;  4BRY A;  5JPU A;  4WYK A;  2HMN B;  2W9Q A;  1BRH A;  3SFD C;  1L0L G;  4U3F D;  5AW3 B;  1PFP A;  1ISK A;  1PIX A;  4HJG H;  4OGQ C;  1SQV J;  3FSD A;  2WGO A;  1YQ3 C;  3BIR A;  1WMN A;  3PTZ A;  2WOH A;  5KKZ B;  3T97 A;  3CC2 P;  1SQQ K;  1WMP A;  3BAT A;  3CX5 I;  3OX9 A;  5IW9 A;  3FF0 A;  5TGN A;  3B5N B;  4OVM A;  3ABV C;  1SFC B;  5AVX B;  4N6J A;  1FDM A;  3DGL A;  3S4R A;  1BSN A;  3LH4 A;  3L70 J;  1N8Q A;  2GEX A;  3OV4 A;  5AW9 B;  2GA1 A;  3CCE 3;  4JRF A;  1VQK 3;  1ZR4 A;  2KZJ A;  1VQL P;  1JBS A;  3VYI A;  1ZN5 A;  2YX9 A;  1EZV G;  1FUW A;  2WO0 A;  3Q1M A;  2B89 A;  2M3B A;  3ITK A;  1VQP P;  1FZA A;  3DXO A;  3B4O A;  1W7C A;  3KSE D;  1HGZ A;  2H88 C;  1OHO A;  2R3S A;  3URP A;  3OW2 2;  3WMM 0;  2AEM A;  3F8H A;  2YXQ B;  2GU3 A;  2R5D A;  1NAF A;  2KZI A;  4O02 B;  3K0Z A;  2E74 C;  1PGJ A;  2IMJ A;  3TNU A;  1QVF 2;  1BRG A;  3T0U A;  1LT1 A;  1KN7 A;  1NTM G;  2I8D A;  2O01 J;  1L0N D;  2WSC J;  2IFN A;  1NNV A;  1KYO D;  3P8M C;  1LQG C;  1PP9 G;  2Y0E A;  4GT1 A;  2KF4 A;  3SSU A;  3H1H D;  2YFJ B;  2K9J A;  3D6Z A;  3CPO A;  2ZT9 D;  3LW5 H;  2WZ7 A;  1SQX E;  1RN7 A;  3I55 3;  1UCI A;  5AVQ B;  5BU5 A;  5E79 E;  1URQ D;  2IPP A;  3RK3 D;  1IQX A;  2R32 A;  3G4S P;  3VMX A;  1VF5 B;  4GOD A;  2WPS A;  3GZX B;  1O7G B;  2KNC A;  3CCS 3;  1BUQ A;  1BE3 D;  1RHL A;  1AVL A;  1GD3 A;  1RHZ B;  3RL0 B;  5IEP A;  4HYT B;  1BAN A;  1HJ0 A;  3GHG B;  2JWA A;  2WTY A;  1VQ7 P;  3W67 A;  1K8A Q;  2W6B A;  1KC8 Q;  1HTL C;  1KIL E;  1T5Y A;  3K63 A;  2YO3 A;  5AYR B;  1LJ2 A;  5AW4 B;  2Q3E A;  3EBY A;  3ER7 A;  3F40 A;  1EDL A;  2BCC G;  2MC8 A;  2E75 D;  5GTI E;  4EYC A;  1M8O B;  2H89 C;  2NPS D;  1YIJ P;  1SQB K;  5H2F E;  1W6Y A;  1S9K E;  3M9Q A;  1SQQ J;  2RKL A;  1GU5 A;  4RZM A;  5D82 A;  3IR9 A;  1RDS A;  1AV1 A;  2KAA A;  2W8Z A;  1N73 C;  2A45 G;  5APQ A;  2P0M A;  2K3R A;  4CPK A;  4BRY B;  1LNI A;  4EW5 A;  4DCK A;  1OXZ A;  2Q1K A;  3KDP B;  1NGM B;  2J58 A;  3LIE A;  1UW1 A;  2O1K A;  2F5W A;  3IFM A;  4NRE A;  1FA3 A;  3CME 3;  3L72 G;  2CX0 A;  1Q40 B;  1M7L A;  1HWT C;  5EQL A;  5KAF H;  3AEC C;  2IZ0 A;  4WBA A;  2MF7 A;  1L0N K;  3MSO A;  1GYB A;  1WQL B;  1IU7 A;  1M1K Q;  4PJ0 E;  3CCL P;  2LYX A;  2WPV B;  4D6T G;  2P58 A;  4RNT A;  1HZ1 A;  5H2F H;  1U57 A;  1T2K D;  4H3U A;  2C11 A;  1U5O A;  1GK6 A;  1QX8 A;  5B5E E;  3G6E 3;  2PGD A;  2HPC B;  1N8R 4;  2FFD B;  3CC4 3;  3AGO A;  4AEQ A;  3G9R A;  2XSH B;  4C7N B;  5B66 H;  2P38 A;  5KLI B;  3L73 J;  1X8Y A;  4H13 D;  2ZDJ A;  4H61 A;  1UUW B;  1RTU A;  1LGH B;  3L4F A;  1N7S C;  3PS8 A;  2V7Q J;  2RCD A;  4AYC A;  1MNL A;  3L74 G;  1WMO A;  2E2T A;  3EC9 A;  1Q82 Q;  1G96 A;  1FGQ A;  2KS1 B;  2YKQ A;  4L73 A;  1IYY A;  1A2K A;  3KYQ A;  1OWA A;  2QA4 3;  4QMA A;  1BGY E;  3TNU B;  1BNE A;  4KT3 B;  1X0T A;  1I70 A;  1EDJ A;  4PJ0 H;  2PAJ A;  3AEA C;  4PD4 I;  1FZB A;  1CSB A;  5APY A;  3CWB D;  1DE3 A;  4OUQ A;  3H3H A;  1NWQ A;  2CIU A;  4FMA A;  5B5E H;  4U3F J;  1VQ9 P;  2D1W A;  4MMY B;  2WSF J;  1EDK A;  2I1K A;  2K9J B;  2OQE C;  2GM4 A;  2K88 A;  1AR0 A;  1NWW A;  4STD A;  3H1I J;  4NPE A;  3MZW B;  3R2P A;  1RNT A;  3L35 A;  4H44 B;  3V2Q A;  1OIP A;  2ZA4 A;  3OWY A;  1K73 Q;  3B5N D;  3P8C E;  2FXP A;  1SFC D;  2CPB A;  1N73 A;  2BT3 A;  3VTP C;  1BSC A;  1RGE A;  4GB5 A;  1MV8 A;  3FLJ A;  1G2C A;  3IPT A;  1X1U A;  1SQB J;  1BCC E;  1TU3 F;  4OGQ B;  1G1J A;  1FZF A;  1VQ4 3;  1W2B 2;  4ZMD A;  1LTT C;  1TFK A;  1KIL C;  4CJN A;  1UUG B;  3MGN A;  1IFD A;  2J59 M;  4IOI H;  1KQF B;  4Y99 C;  4DOJ A;  3D3L A;  3ZDM A;  3S29 A;  3G3Z A;  3LYG A;  3H1K G;  2QGU A;  2CFW A;  2FXO A;  5G1L A;  2W6J H;  2JEE A;  2ML5 A;  3NQZ A;  1MFT A;  3F89 A;  1B2U A;  4LLH A;  5BIR A;  2POH A;  2UX0 A;  2YMK A;  3KII A;  1L0N J;  5IEN A;  1FC2 C;  1NTZ E;  4LGQ A;  1GY5 A;  1KB9 E;  4R4K A;  1M1J C;  1N7S A;  2L5G B;  1T8Z A;  2WSS H;  1YJN P;  1IFM A;  2ZYA A;  3CCM P;  5AW0 B;  3CD6 3;  1Q42 A;  3AEF C;  1KFN A;  1FW7 A;  2B87 A;  1H88 A;  3EWK A;  1VDF A;  3CLQ A;  4RJT A;  1IK3 A;  1VF5 D;  1ZP0 C;  4HM1 B;  3CMA P;  3UL5 A;  3L75 E;  3N54 B;  1YTZ T;  1FJP A;  1A90 A;  3S9O A;  3V6I A;  5KLV K;  2WT7 A;  3D9R A;  3CX5 D;  3WU2 H;  4FCZ A;  4LYL B;  1NTM D;  1W5Z A;  2C9L Y;  1PU4 A;  3H1L D;  3PZW A;  3RL0 D;  1BE3 J;  2A06 D;  1LOW A;  3CXH E;  2OTJ 3;  3DY5 A;  2OQE A;  2CFG A;  2STD A;  2WSE H;  2KOG A;  1GL2 B;  3HTK A;  3NMD A;  1RN4 A;  5K5G B;  1FGT A;  4O2H A;  3FCS B;  4XBY A;  4BU4 A;  2FYU G;  2FBW C;  2FXT A;  1PPJ D;  1IVV A;  1KB9 H;  1EXJ A;  3MHE A;  3FZW A;  3NHX A;  1QVG O;  1IK7 A;  4LEH A;  4N6U A;  1KSI A;  2YNY A;  3ECF A;  1T3B A;  2BCC E;  4N78 E;  3DGY A;  1E97 A;  3WOD G;  1SQP K;  2N9Y B;  3SLU A;  4HZ9 B;  1YIT 3;  1NKN A;  3VMZ A;  3TGU J;  3W68 A;  1A2P A;  1KIL A;  5AW8 B;  1L0L K;  2XF3 A;  1IJD B;  1SQV D;  1UDI I;  4HVN A;  4QWT A;  2KLV A;  1DYU A;  1T2H A;  3MD0 A;  3WOF B;  3FWL A;  3KN4 A;  2XSO B;  3D5I A;  1B3S A;  2MKV A;  1YI2 3;  5BVZ A;  4ASV A;  5AW6 B;  3VF1 A;  3L70 D;  3TK1 A;  1RN1 A;  3WA2 X;  1AVK A;  1AY7 A;  1D6Y A;  1M1J A;  1RE4 C;  1N73 B;  1OH0 A;  4YXW H;  2W56 A;  2QIW A;  1LNH A;  1VQ8 3;  4D6T E;  2OYH C;  3CC7 3;  3EN8 A;  3V98 A;  1OPY A;  1F8N A;  1G2C B;  2QM8 A;  4RKU J;  3H32 B;  3C9I A;  1PFI A;  1VQ5 P;  2GUS A;  3OW2 O;  1JM0 A;  1AJY A;  3WDG B;  2F86 B;  1JY3 P;  2F5M A;  4GHO A;  7GSP A;  1SQW A;  3MG1 A;  1OHS A;  3WMD A;  2Q9I A;  4OK0 A;  2OYI C;  3D5G A;  2H43 A;  1BAO A;  1QVF O;  4K61 A;  4BTY A;  1US1 A;  1NTM K;  2BEZ F;  2Q3I A;  3A0B E;  2RBI A;  2XND H;  2L1S A;  3JUO A;  3KHU A;  4MMZ B;  2CG0 A;  1EA2 A;  2Z5H A;  1IZN B;  1I3I A;  4TT3 H;  2JDI H;  2JJL A;  5CCG D;  5KLV J;  1VQO 3;  2KXG A;  2IBZ D;  1RY3 A;  1IQY A;  1A67 A;  1SQX G;  1M57 D;  1GMP A;  4MN4 C;  1Q7Y Q;  3PGB A;  1LP1 A;  2HR3 A;  2E42 A;  3GRD A;  1U8C B;  1QAF A;  2RH0 A;  2H0G A;  2E76 C;  1FOS F;  4HZB B;  2WSC H;  1WMK A;  4R4M A;  3KKG A;  1YBK A;  4CDL A;  3L0R A;  4H44 D;  3MHV A;  2K54 A;  5STD A;  3QRD A;  3L74 D;  1TTO A;  5EVH A;  1VQN P;  3E7K A;  2ZXE B;  4W7Y A;  4HM5 B;  3NXS A;  3S28 A;  1CW5 A;  2WT7 B;  4EXR A;  2JR8 A;  3A0B H;  4YXD C;  5KJ7 C;  5BU4 A;  3AMO B;  1J1D B;  4EBG A;  2O9U X;  2PRR A;  1WRG A;  3F7X A;  4N3V A;  1R5L A;  1MGR A;  4HH2 A;  2HFE D;  1L0L J;  3NV0 B;  4BWN A;  1BGS A;  3HTK B;  1FU1 A;  2CWV A;  4RES B;  3X40 A;  3D79 A;  3FGY A;  1GDT A;  3E1R A;  3BND A;  4EC6 A;  5IG0 A;  3I56 3;  4XM4 A;  1RE4 A;  4RO0 A;  1FZC C;  1FGO A;  4LC1 A;  3LZA A;  5AVT B;  2W83 C;  1LOV A;  1SQQ D;  2NZ2 A;  3EE1 A;  3LID A;  1IQ8 A;  1I2G A;  3DUK A;  2ZYD A;  3SWY A;  3GWR A;  1EQK A;  2LXB A;  2V4H A;  1IVW A;  1YHQ 3;  1Q86 4;  1GW4 A;  3BCC E;  1RE3 C;  3BRV B;  1RGH A;  4PD4 E;  2M7O A;  1G0T A;  4ORL A;  1S3J A;  1GD4 A;  1ASK A;  3HUS C;  1JUN A;  2ZFC A;  2W27 A;  2B88 A;  4KHX A;  1CI6 A;  1ZGX A;  2QEX 3;  2OYI A;  1JN5 B;  4L8O A;  4LSO A;  2ZAE B;  2Z76 A;  1NB5 I;  3G71 P;  2E43 A;  4ASW A;  3N9H A;  1NU1 D;  2A15 A;  1E79 H;  1BSH A;  1VQM 3;  1BUJ A;  1MWS A;  1BDD A;  4ZKP A;  5BXQ A;  1N5H A;  2LR2 A;  2YKP A;  1VQ6 3;  1NTM J;  1M90 Q;  3NUV A;  1M1J B;  1GY6 A;  1QL2 A;  1B2S A;  1RKY A;  3L71 E;  2HYN A;  2W56 B;  1PP9 J;  1GL2 D;  4PD4 H;  5CLK A;  8CHO A;  3AE1 C;  2N1T C;  3F5H A;  1S4X A;  4LZI A;  4MEI A;  3H1J E;  3F14 A;  1DMN A;  1USD A;  1C7H A;  1L2P A;  2XGN A;  1RF1 C;  2HMK B;  1GZL A;  5IG4 A;  1X1W A;  5KJ7 A;  3GAX A;  3GZB A;  3JSV C;  2GEY A;  1J2B A;  5GSP A;  1UII A;  1O7W B;  3HD7 B;  1DH3 A;  3NBJ A;  1C54 A;  3PJS K;  2H7H A;  2PP6 A;  1T2I A;  1HYF A;  2YIU C;  5APS A;  1EZV I;  1W6G A;  2HOD B;  2IX7 C;  1USE A;  3K9M C;  4X2H A;  1L4A B;  1YQ4 C;  3EB8 A;  3Q3F A;  4IFD K;  4L76 A;  1QAK A;  1FZC A;  1QLE D;  3CNX A;  2V7Q H;  3H1I D;  1GOY A;  3JUN A;  1I8V A;  2P0X A;  3HII A;  1D6U A;  3BNE A;  3T8N A;  1YVB I;  1RE3 A;  1GOU A;  4XBX A;  3AEB C;  3CCE P;  1VQK P;  3RL0 g;  3HUS A;  3FH1 A;  1S72 3;  1NAY A;  3KZI E;  3Q5R A;  4WHA A;  1SQB D;  3M9B A;  1H89 A;  4HYZ A;  3RK2 B;  4TLF A;  5CCH D;  1IFP A;  1MWR A;  3GF3 A;  1BCC G;  1EKM A;  1W2B O;  2QRX A;  1AFO A;  3FXD A;  1TRP A;  3DMC A;  4KFF A;  3X41 A;  2QM7 A;  2ZYG A;  2W0Q A;  2CPS A;  3NBB A;  2CW9 A;  1YJW P;  1RH5 B;  4WY4 D;  5CK6 A;  1NU1 K;  2CHC A;  2ZL8 A;  5IEO A;  1KYO E;  3BB9 A;  3JUQ A;  4W80 A;  1HU9 A;  1IT7 A;  1EC5 A;  3GLM A;  3L72 J;  2R3C A;  4BTW A;  1DD4 A;  1ROA A;  3HIG A;  1P84 I;  3H1H E;  2RGQ A;  4JYC A;  3FXE A;  3KZI H;  2N1T A;  1NTZ G;  1NTK E;  1PGO A;  1JY2 N;  1NU3 A;  3I55 P;  3RK3 E;  3EQQ B;  1NO4 A;  2WQY C;  3HK4 A;  1RF1 A;  5DJT B;  1OX3 A;  2KB7 P;  2D2C C;  2B9B A;  2BU4 A;  1RGA A;  1BE3 E;  2Q5U A;  3CCS P;  1JB0 J;  3L75 G;  1JJ2 2;  1CEW I;  2BMO B;  4HKV B;  2PFX A;  3E99 A;  1Q81 Q;  3M91 A;  3B71 A;  5DJU B;  2CG1 A;  1JTH B;  1KYO H;  1ZOY C;  3A0H E;  3U1W A;  1Z1S A;  4HBR A;  1DD3 A;  3L74 J;  1HF9 A;  1S2E A;  3I0Y A;  2R5B A;  1R4Y A;  1RMS A;  1SPU A;  2KXP B;  1K8A 4;  2XR8 B;  3BNB A;  1KC8 4;  5AVV B;  5AVW B;  3SOY A;  1PGP A;  1IV9 A;  2FYU K;  1FE6 A;  4I6M C;  3M06 A;  1NJI Q;  1LNQ A;  3HE5 A;  1LTJ B;  3ROB A;  5KAF E;  1K28 A;  4EV5 A;  3SED A;  1DEE G;  1PV3 A;  4NPB A;  3B4P A;  4KZ1 A;  2QJY B;  1ULJ B;  3CCJ 3;  1IVU A;  1MWU A;  1RGG A;  3PCS A;  3TGU D;  2AXC A;  2AEF A;  1OF5 A;  4W7Z A;  2QG4 A;  1SAR A;  1J1E B;  2IBZ I;  2Q6Q A;  3A0H H;  3K7C A;  1H0T A;  2E2V A;  2OTK E;  2OWP A;  5TJH A;  3CXC 2;  5B66 E;  2P7J A;  3H25 A;  3AHS A;  4WYK B;  3CME P;  4IIA A;  2OQQ A;  1X1Y A;  2C0W A;  1BRJ A;  1M56 D;  1JB2 A;  3VSY A;  2CC3 A;  2E2U A;  2FYN B;  1B21 A;  1M1K 4;  3T97 B;  2I1J A;  1IFI A;  5APX A;  3VP8 A;  1NU1 J;  1S9K D;  5AW1 B;  2UWJ E;  2KF5 A;  1FAV A;  3G6E P;  3H1K J;  3CC4 P;  1PYL A;  3CCQ 3;  2BHM A;  1DET A;  3DM8 A;  4H0L B;  2F99 A;  2QJP B;  4ILF A;  3F9S A;  2WPR A;  2QJK C;  2ML6 A;  4O3V A;  1I0X A;  1JB4 A;  1OGX A;  4BL3 A;  3AEE C;  1Q82 4;  2QA4 P;  1S5L X;  2CWT A;  5KTB A;  1SP4 A;  1BSE A;  3EJV A;  3ALA A;  3CCL 3;  1OHP A;  2J8X B;  3HD7 D;  4AQR D;  3VP9 A;  1DEB A;  1OW7 A;  3CWB E;  5KLV D;  1RGL A;  2KLU A;  3V99 A;  3O8Z A;  3N8B A;  1UUV B;  2ZT9 C;  3CI9 A;  1U7M A;  2WVR A;  1L4A D;  5LC6 A;  3NM7 A;  5APU A;  1SQX K;  2XEP A;  1URQ C;  2N1T B;  3RK3 C;  4O8S A;  5AVS B;  2H0I A;  1WNH A;  4KT0 J;  1NB3 I;  2BAS A;  1WT6 A;  2FYU J;  3BVH A;  1LVN A;  1K73 4;  1PZQ A;  5TIS E;  5CBN A;  1MGW A;  2ITA A;  5AVY B;  3MPH A;  1OUN A;  1W00 A;  3EBT A;  2GUV A;  1RQU A;  2KYV A;  1CYU A;  4PV1 B;  1V74 A;  1BGY D;  1ZLL A;  1VQ4 P;  1SQP D;  2KNC B;  1KV4 A;  3RK2 D;  2P09 A;  4KVH A;  1LT9 C;  5IG5 A;  2INX A;  1LOX A;  2OCT A;  3L37 A;  1L0L D;  1O7H B;  1BNJ A;  4R80 A;  2M8R A;  1KMI Z;  4HOH A;  3KZT A;  3GW6 A;  1JCD A;  2E75 C;  2FYZ A;  5AW5 B;  2XDJ A;  2NPS C;  2AXT E;  3KQG A;  3HI7 A;  4J5K A;  3BNC A;  2C4B A;  4JF7 A;  3WU2 E;  4I5Q A;  4A7P A;  3K5B A;  2IDB A;  3BRT B;  3P32 A;  3UJM A;  5TIS H;  5AVZ B;  2R4I A;  1HGV A;  3BCC G;  2FY8 A;  1ROV A;  4HAA A;  3PRJ A;  1OF5 B;  5AW2 B;  2O3O A;  3CD6 P;  2DW3 A;  2YXR B; 
#chains in the Genus database with same CATH homology
 1AQT A;  1N9E A;  3MG3 A;  2GU1 A;  2KXG A;  1VQO 3;  3X3Y A;  1OAC A;  5ELU A;  4WYK A;  2HMN B;  2W9Q A;  5JPU A;  4WWU C;  2LQV A;  1IQY A;  1A67 A;  2HMM B;  1JRQ A;  1IT8 A;  1PFP A;  1YIJ 3;  1ISK A;  3PGB A;  4L8P A;  3GRD A;  1DVD A;  1QAL A;  1U8C B;  1QAF A;  2Z6B A;  3IMA B;  3FSD A;  2WGO A;  1Y4K A;  4HZB B;  2P05 A;  4R1K A;  3DZL A;  3KKG A;  4CDL A;  1WMN A;  3L0R A;  4AKY A;  2WOH A;  2K54 A;  5STD A;  2XFS A;  3QRD A;  1WMP A;  5EVH A;  3OX9 A;  5IW9 A;  3FF0 A;  5TGN A;  1WTH A;  4OVM A;  1VZZ A;  3DGL A;  4HM5 B;  3S28 A;  3HX8 A;  3UNL A;  1BSN A;  3RDE A;  3LH4 A;  4EXR A;  1N8Q A;  2XH9 A;  1JKG A;  2GEX A;  2CKF B;  3OV4 A;  3BLZ A;  3CCM 3;  3AMO B;  4EBG A;  2O9U X;  3CCE 3;  3FG3 A;  4JRF A;  1VQK 3;  3F7X A;  5JPP A;  4N3V A;  3CCR 3;  4IT7 A;  2YX9 A;  3PYJ A;  3NV0 B;  1FUW A;  4N6L A;  2CWV A;  4FR9 A;  3X40 A;  2WO0 A;  2IUJ A;  3FGY A;  1HKX A;  1IVX A;  3B4O A;  3DXO A;  1W7C A;  3BND A;  3KSE D;  5IG0 A;  4EC6 A;  3I56 3;  4XM4 A;  1OHO A;  1FGO A;  3OW2 2;  3LZA A;  3F8H A;  3JUM A;  3EE1 A;  4TX4 A;  2KCD A;  2GU3 A;  4O02 B;  1CYV A;  1IQ8 A;  3K0Z A;  4N6M A;  1GY7 A;  3DUK A;  2BO9 B;  2IMJ A;  1E3R A;  5KP3 A;  2Q07 A;  3GWR A;  1QVF 2;  1EQK A;  1IVW A;  1L5G B;  3T0U A;  1YHQ 3;  1Q86 4;  6STD A;  1A2V A;  2M7O A;  4ORL A;  1STF I;  1GD4 A;  4FMC A;  1ASK A;  1RRL A;  4R9K A;  1R4C A;  3KSP A;  4FCM A;  2QEX 3;  3H51 A;  1JN5 B;  3T8U A;  4L8O A;  1IV7 A;  2YFJ B;  5CF2 A;  4LSO A;  3CPO A;  2Z76 A;  5FW5 A;  1NB5 I;  3F8X A;  1RN7 A;  1QMA A;  3N9H A;  3I55 3;  2JQ5 A;  2A15 A;  1SII A;  1IQX A;  3MWZ A;  1E79 H;  1BSH A;  4FCJ A;  5DRV A;  1VQM 3;  5BXQ A;  3GZX B;  1N5H A;  3LXU X;  3S27 A;  1O7G B;  2PNC A;  3CCS 3;  1VQ9 3;  1BUQ A;  3S67 A;  2OTL 3;  3MKI A;  4BTX A;  1AVL A;  1GD3 A;  3V92 A;  1VQ6 3;  3NUV A;  5IEP A;  1GY6 A;  1ULI B;  1RKY A;  4JF8 A;  2W56 B;  3KE7 A;  2YFL B;  5CLK A;  8CHO A;  5IER A;  5HGR A;  3EF8 A;  3CU3 A;  4GL6 A;  4LZI A;  1T5Y A;  4MEI A;  5KP1 A;  5D83 A;  1RJO A;  3K63 A;  3F14 A;  1DMN A;  1C7H A;  2XGN A;  2E5T A;  1O7N B;  4XDV A;  2GBW B;  5AYR B;  2HMK B;  5IG4 A;  1LXE A;  1FS0 E;  3GAX A;  1TFO A;  3GZB A;  2GEY A;  3EBY A;  3ER7 A;  3F40 A;  4XBT A;  1J2B A;  2BMR B;  2IA7 A;  2MC8 A;  1O7W B;  3NBJ A;  3PJS K;  3IJE B;  3LTD A;  4EYC A;  4FMD A;  3UL6 A;  3SOA A;  1AV4 A;  1W6Y A;  2WGQ A;  1W6G A;  1Q7Y 4;  1O7M B;  4X2H A;  3K9M C;  4RZM A;  4HM7 B;  5D82 A;  3NQY A;  3CPW 2;  1TU5 A;  3EB8 A;  4MJD A;  4HM4 B;  1QAK A;  1EG9 B;  3NM2 A;  2P0M A;  2GBX B;  3CNX A;  2V7Q H;  5IG3 A;  1UI7 A;  1N5P A;  3JUN A;  1M9G A;  2P0X A;  3HII A;  3S5C A;  1W02 A;  1D6U A;  5BVB A;  4RNZ A;  3MYT A;  4N6T A;  3BNE A;  1UW1 A;  4WP5 A;  3T8N A;  1ZX2 A;  1YVB I;  4NRE A;  1KQS 2;  3SXX A;  3CME 3;  2KRT A;  1FA3 A;  4XBX A;  1SIH A;  1Q40 B;  3FH1 A;  5EQL A;  1S72 3;  3Q1C A;  4KFE A;  1YJN 3;  4WHA A;  2MF7 A;  3GZY B;  4HYZ A;  2K0M A;  1GYB A;  4TLF A;  1WQL B;  1FGM A;  1IU7 A;  3MSO A;  2B1X B;  1IFP A;  2XFT A;  1EKM A;  2XRX B;  3U97 A;  2LYX A;  2FGT A;  3LML A;  3DMC A;  4KFF A;  3HZP A;  3X41 A;  4H3U A;  3AMO A;  2C11 A;  3CMA 3;  5ELJ A;  1U5O A;  2W0Q A;  2CFK A;  3SVA A;  3NBB A;  3G6E 3;  2CW9 A;  1TUH A;  3X3Z A;  1N8R 4;  3CC4 3;  1FGR A;  5CK6 A;  4AEQ A;  1S5A A;  2XSH B;  2L4V A;  2CHC A;  3NV0 A;  4IPB A;  2ZL8 A;  1D6Z A;  3CCV 3;  2P38 A;  5IEO A;  3BB9 A;  2ZDJ A;  3JUQ A;  4H61 A;  1HU9 A;  1UUW B;  1IT7 A;  3X3X A;  2BNG A;  3PS8 A;  4J9A A;  5G2G A;  4BTW A;  1ROA A;  4XB5 A;  2RCD A;  3HIG A;  1MNL A;  1WMO A;  2Y73 A;  1DMQ A;  2E2T A;  3EC9 A;  1G96 A;  1FGQ A;  1K41 A;  2RGQ A;  3NX0 A;  3SX1 A;  3JUP A;  1A2K A;  2Y74 A;  2QA4 3;  2W03 A;  4QMA A;  3A76 A;  3CCU 3;  1NU3 A;  5CXO A;  1YGE A;  3FG4 A;  1TP6 A;  2V1L A;  1E3V A;  3EQQ B;  3HK4 A;  4ZM8 A;  1JN5 A;  1O7P B;  4OUQ A;  1JNQ A;  3H3H A;  2CIU A;  4FMA A;  4MMY B;  2D1W A;  3CNM A;  2CFD A;  2OQE C;  5IF6 A;  4R9L A;  1JJ2 2;  1AR0 A;  1CEW I;  2BMO B;  4HKV B;  3E99 A;  1NWW A;  4N6N B;  4STD A;  3OWU A;  4RNY A;  1M90 4;  2CG1 A;  3U1W A;  3OWY A;  4HM8 B;  1STD A;  3EHC A;  2QE7 H;  1Z1S A;  2HML B;  4HBR A;  4N6V 0;  2BT3 A;  3PCR A;  4HM6 B;  3I0Y A;  3MG2 A;  4GB5 A;  2CH9 A;  1SPU A;  1K8A 4;  2XR8 B;  3BNB A;  1KC8 4;  3FLJ A;  3LTB A;  4Q53 A;  1K9M 4;  3SOY A;  3OXA A;  1IV9 A;  3B7C A;  1SJW A;  3IPT A;  3VGN A;  3LT9 A;  4EV2 A;  1VQ4 3;  1W2B 2;  2GXF A;  3ROB A;  1TFK A;  1K28 A;  2BMQ B;  1ZO2 A;  4EV5 A;  3SED A;  5I97 A;  3B4P A;  1N9J A;  1M1X B;  4KZ1 A;  5D81 A;  1ULJ B;  3CCJ 3;  1IVU A;  3D3L A;  3J7Y d;  1YJ9 3;  3PCS A;  3S29 A;  1JEK A;  4NHF A;  3LYG A;  4N6O B;  1OF5 A;  2QGU A;  5AYS C;  4J8T A;  5AIG A;  2CFW A;  1VQ5 3;  2OOV C;  4XDW A;  2W6J H;  4U13 A;  2ML5 A;  3NQZ A;  5EEO A;  3K7C A;  7STD A;  2E2V A;  2OWP A;  3CXC 2;  1W4N A;  1W01 A;  2UX0 A;  3G8Z A;  3KII A;  4FMB A;  4IIA A;  4WYK B;  3LT8 A;  5AII A;  3RGA A;  5IEN A;  4LGQ A;  1GY5 A;  3QK9 A;  1CQS A;  2Z77 A;  4R4K A;  4DJG A;  1JB2 A;  2WSS H;  3VSY A;  4CCV A;  2CC3 A;  3CD6 3;  1Q42 A;  2E2U A;  3Q2P A;  2RSX A;  2W04 A;  3WOE B;  1GS3 A;  3JVC A;  2D42 A;  2HMO B;  1M1K 4;  3RGR A;  2CWU A;  1IK3 A;  4PEJ A;  2C10 A;  4HM1 B;  1TIJ A;  3UL5 A;  3OWS A;  3N54 B;  3EX9 A;  1A90 A;  3LTC A;  1Q40 A;  3D9R A;  1JV2 B;  3NBR A;  4FCZ A;  5FGO A;  1W5Z A;  3CCQ 3;  1MOL A;  1JKG B;  2BHM A;  3STD A;  1PU4 A;  3PZW A;  3DM8 A;  2OTJ 3;  4HM2 B;  2F99 A;  5AIH A;  3DY5 A;  3DGO A;  2OQE A;  2CFG A;  2STD A;  3CC2 3;  5AI1 A;  5AIF A;  2SBL A;  4LMI A;  2CK3 H;  4O2H A;  1VQN 3;  1FGT A;  3F9S A;  3FCS B;  4XBY A;  3DGM A;  2ML6 A;  1KD1 4;  4O3V A;  2FXT A;  2I9W A;  2RFR A;  2XGL A;  1IVV A;  1JB5 A;  2W9P A;  1JB4 A;  1OGX A;  1Q82 4;  3MHE A;  2CWT A;  3FZW A;  3NHX A;  3UB1 A;  3DGN A;  3M8C A;  3EJV A;  3ALA A;  4LEH A;  4N6U A;  3CCL 3;  1VQL 3;  1OHP A;  1KSI A;  2FNQ A;  5JBS A;  3ECF A;  3G0K A;  3X42 A;  4WFO A;  2QIY A;  1DMM A;  1E97 A;  4HM3 B;  3WOD G;  3V99 A;  1QJG A;  3SLU A;  3N8B A;  1NDO B;  4HZ9 B;  5CF1 A;  1YIT 3;  1UUV B;  1YJW 3;  1VQP 3;  4WVZ A;  5LC6 A;  5A0O B;  3NM7 A;  3B8L A;  2CFL A;  2XF3 A;  2XEP A;  4O8S A;  3EN1 B;  4HM0 B;  4HVN A;  4QWT A;  3K5T A;  1Q81 4;  1DYU A;  1OCV A;  3WOF B;  1WNH A;  4AKZ A;  4K1V A;  3KN4 A;  1NB3 I;  2XSO B;  1LVN A;  1NO3 A;  2W2C A;  2F98 A;  2HMJ B;  1K73 4;  1YI2 3;  2OOV A;  3GZR A;  3O8Y A;  4HJL B;  3MPH A;  1OUN A;  1OGZ A;  1W00 A;  3EBT A;  4X2O A;  3VF1 A;  5KP4 A;  1CYU A;  4K90 B;  1V74 A;  3WA3 A;  3WA2 X;  3Q90 A;  1AVK A;  1W6C A;  1NJI 4;  3EFF K;  2WOF A;  3FKA A;  2P09 A;  1D6Y A;  4I4K A;  4KVH A;  1DVC A;  3G71 3;  1OH0 A;  5IG5 A;  2INX A;  2Z7A A;  1LOX A;  2OCT A;  1W2Z A;  4YXW H;  2W56 A;  1O7H B;  4KFD A;  1LNH A;  1VQ8 3;  3CC7 3;  4R80 A;  3G4S 3;  3G16 A;  3EN8 A;  3LOY A;  3V98 A;  3LTA A;  4RBN A;  1OPY A;  1F8N A;  1KWI A;  3KZT A;  4G1M B;  4MMX B;  3KFQ C;  5AEU B;  3NXJ A;  2E5Y A;  4L7K A;  2B24 B;  3WDG B;  3USS A;  5AEW B;  2F86 B;  3HI7 A;  1IDP A;  3BNC A;  3FF2 A;  2IUK A;  1SQW A;  3MG1 A;  1OHS A;  3WMD A;  4OK0 A;  1RRH A;  3UJM A;  2YFI B;  3TDG A;  4K61 A;  2R4I A;  2PZV A;  4BTY A;  3F7S A;  1US1 A;  1VQ7 3;  1ROV A;  5DRE A;  2XND H;  3FG1 A;  3JUO A;  1QVG 2;  3PXM A;  1OF5 B;  4K1U A;  4MMZ B;  2CG0 A;  1EA2 A;  5LC7 A;  2O3O A;  1UI8 A;  2JDI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...