3DM8A

Crystal structure of putative isomerase from rhodopseudomonas palustris
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
135
structure length
135
Chain Sequence
b'MTEHSLWRFSRALHRALNDRQTEELATIIDDNIDWAIYGPIDMFPFFGARQGKAAVLEVCRQIADSVRIYRYHRESVMLGIDSAASMVRYSLTAAGTNRPISVRMALFTQFQNGRLTNLRMVLDTFDLVEQALGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein RPA4348
publication title Crystal Structure of Putative Isomerase from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 44
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dm8A00
3UNLA 4RZMA 1U5OA 3MG3A 4H3UA 4I4KA 1OPYA 5STDA 3OXAA 3EC9A 1DMNA 1W02A 3GZYB 2JQ5A 4N3VA 3GWRA 1EG9B 4HM3B 4X2OA 3VGNA 4HM6B 2XRXB 5BVBA 2XSOB 2QGUA 4J9AA 3DMCA 3M8CA 5DREA 3MG1A 2YFIB 5DRVA 5HGRA 3ER7A 2BNGA 3RGRA 3A76A 3BLZA 3FGYA 2HMKB 3MHEA 3ECFA 3G0KA 3GZBA 2STDA 1JB5A 3FKAA 2BMRB 2GEXA 3K0ZA 2UX0A 4LEHA 3IPTA 4HZBB 1CQSA 3LZAA 1OGZA 3OWSA 1JB4A 2GEYA 3B8LA 4FCMA 1O7WB 1O7MB 2BMQB 4XBYA 3KSPA 5AI1A 2BMOB 4XBTA 4KVHA 4L8OA 3D9RA 1OHOA 5IENA 5BXQA 3JUOA 4J8TA 2PZVA 2K54A 4HZ9B 1ULIB 1JN5A 4XB5A 3NM2A 5IG5A 1K41A 3MKIA 3OX9A 5CF2A 3F40A 3STDA 4WWUC 3E99A 8CHOA 1JN5B 3HZPA 2Z7AA 3KZTA 4R1KA 3JUQA 3DM8A 2F98A 1W6YA 2RFRA 4OUQA 3T8UA 1OGXA 3EN8A 1TUHA 1Q40A 1TP6A 3G8ZA 3FZWA 5AIHA 5KP4A 1QJGA 3EJVA 4IIAA 3NV0A 1ISKA 4HKVB 3EX9A 3HK4A 1GY5A 5CXOA 4HVNA 1O7HB 4HM8B 5IG3A 3Q90A 2GXFA 3FSDA 5G2GA 1Q40B 3GZRA 4WP5A 3FF0A 4K1UA 5IERA 3GZXB 2Z77A 1OH0A 2HMMB 4XBXA 3NV0B 4STDA 1OCVA 2R4IA 3G16A 2I9WA 2B1XB 1QMAA 2F86B 2HMJB 4XM4A 2HMOB 1VZZA 1EA2A 3JUNA 1IDPA 3NUVA 5AEUB 1UUVB 1WQLB 3F8XA 2B24B 5D83A 4U13A 1OUNA 2GBWB 3VSYA 3H51A 5D81A 1NU3A 5EVHA 2Z76A 5FW5A 4MJDA 3SOAA 4HM5B 5JPPA 3HX8A 4PEJA 1ZO2A 3MYTA 3OWYA 1SJWA 3ROBA 2INXA 2RGQA 3CNMA 3FH1A 5AEWB 5IEOA 2QIYA 1ULJB 2W2CA 3CPOA 5CF1A 3F8HA 2HMNB 1E3RA 4K1VA 1HKXA 1JKGA 3UJMA 4HM1B 1OHSA 3EBTA 4ORLA 3JUPA 5TGNA 3NXJA 2CHCA 1GS3A 4HM0B 1JB2A 4HM2B 2RCDA 6STDA 2YFJB 1STDA 3GRDA 3K7CA 2OWPA 4R9KA 3RGAA 1JKGB 3F9SA 3BB9A 3SEDA 2YFLB 4OVMA 1BUQA 3MSOA 5CLKA 3DZLA 2XSHB 5AIGA 1O7PB 1A2KA 5KP1A 7STDA 4WYKA 3F14A 5AIFA 3EF8A 2GBXB 1AR0A 1Z1SA 4HM7B 3NBRA 1GYBA 1ZX2A 3B4OA 2IMJA 2F99A 4WYKB 1UUWB 1GY6A 1O7NB 1NDOB 1O7GB 3JUMA 2A15A 4LGQA 3EQQB 4Q53A 1C7HA 3B7CA 3T8NA 3OV4A 3F7SA 5CK6A 5AIIA 3CU3A 4FCJA 3KKGA 5JPUA 2HMLB 4L8PA 1E97A 4XDVA 3SOYA 4XDWA 4LMIA 5IG0A 3MG2A 3B4PA 3DUKA 3LYGA 1ASKA 3I0YA 2CKFB 3EBYA 5D82A 1E3VA 1S5AA 4HJLB 3NHXA 1OF5A 3S5CA 5IEPA 3EHCA 1W00A 3H3HA 3OWUA 5IF6A 3DXOA 1GY7A 3EN1B 1DMMA 1DMQA 5KP3A 1NWWA 3KE7A 3WMDA 1OF5B 1OHPA 4CDLA 5IG4A 4X2HA 4GB5A 3FF2A 4HM4B 1Q42A 3F7XA 1W01A 4L7KA 3FLJA 2XR8B 3CNXA 4R9LA
chains in the Genus database with same CATH superfamily
3UNLA 1G96A 3KN4A 4RZMA 1U5OA 3MG3A 4H3UA 4I4KA 1OPYA 4R4KA 3LT8A 1GD3A 4WHAA 5STDA 1UUGB 3OXAA 3EC9A 5JBSA 2E2TA 1IK3A 3WODG 3Q3FA 1GMQA 1DMNA 1NNVA 1W02A 4N6OB 3RNTA 3GZYB 2KAAA 1UCKA 3CMA3 3NBBA 4BL2A 2JQ5A 2C10A 4N3VA 3GWRA 1EG9B 4HM3B 3PS8A 3AGNA 2CK3H 4X2OA 4FMAA 2H0GA 4EV5A 3VGNA 2P09A 4MEIA 4OK0A 4ILFA 4HM6B 2XRXB 5BVBA 5GSPA 1BNFA 1TU5A 1GOVA 2UUGC 1L5GB 2XSOB 2QGUA 3I563 3CC43 4J9AA 1QALA 3NQYA 3DMCA 3UL5A 1PY3A 2W0QA 3M8CA 3MPHA 3SXXA 1B2MA 4ZM8A 3DGYA 3HI7A 4HYZA 4QWTA 1RDSA 1R4YA 2E2VA 3PCSA 1K8A4 3CCR3 2KRTA 1BSDA 2CWUA 1VQL3 3O8YA 2CWVA 3G6E3 2BIRA 5DREA 2CFLA 2K0MA 2H0HA 2CH9A 1RGAA 3MG1A 4MMZB 2YFIB 3KFQC 1MOLA 3CCQ3 5DRVA 1I2GA 4CJNA 5HGRA 1I3IA 3ER7A 4N6UA 4O2HA 1C54A 2BNGA 3RGRA 3A76A 3BLZA 4K61A 2P38A 3PCRA 3CXC2 1LQGC 3FGYA 2HMKB 3N9HA 2PNCA 3CCM3 2P05A 1BUJA 2W6JH 3X3XA 3MHEA 3ECFA 3G0KA 3GZBA 4FR9A 1VQK3 1CEWI 1B27A 2RNTA 3EE1A 4LZIA 1AY7A 2STDA 2P0MA 1JB5A 2XF3A 3FKAA 1EEJA 1MWTA 2BMRB 1B21A 1FGMA 2MC8A 3G4S3 1W7CA 2GEXA 1LNHA 3K0ZA 1A67A 1T2HA 1X1WA 2UX0A 1TFOA 1V57A 3NQZA 3IPTA 4HZBB 4LEHA 1W2ZA 1CQSA 3LZAA 4RBNA 5EQLA 3KSED 2IUJA 1OGZA 4O02B 3OWSA 1JB4A 4IPBA 2GEYA 3B8LA 3CCE3 2O3OA 4FCMA 5ELUA 1O7WB 1BRSA 1O7MB 2BMQB 3AMOA 3DGNA 5EEOA 3Q1CA 4XBYA 3KSPA 1BRJA 1UCJA 2ML5A 5AI1A 4BTYA 1HZ1A 3NX0A 2BMOB 1I70A 1MWRA 1RGCA 4KVHA 4L8OA 4XBTA 3D9RA 4JRFA 2FXTA 1SIHA 1IVXA 1FZUA 1CYUA 1OHOA 1B2SA 1I2EA 5IENA 2FGTA 5BXQA 1WMNA 3JUOA 4FMCA 4J8TA 2PZVA 2K54A 4HZ9B 1ULIB 1RKYA 1EQKA 1JN5A 4XB5A 5M18A 3NM2A 1R4CA 1KWIA 1UCIA 5IG5A 2ML6A 1LOXA 3IMAB 1B3SA 3HIIA 1YJW3 1W6CA 2K3DA 1K41A 3FG3A 3MKIA 1VQ73 3OX9A 5CF2A 1TFKA 1D6ZA 3F40A 1YIT3 3STDA 1TJDA 1YGEA 5AYRB 4WWUC 1SIIA 4NHFA 1JBTA 1BRKA 4JF8A 5LC6A 1FW7A 1Q824 2IUKA 1VQ43 3E99A 2KF5A 3LXUX 5AYSC 8CHOA 1X1YA 1MGRA 3OW22 1BIRA 1JN5B 1SARA 3HZPA 2Z7AA 3KZTA 1JV2B 1IQ8A 1M1K4 4R1KA 1M904 1MWSA 1Y4KA 3JUQA 1B2ZA 2C11A 3DM8A 3BIRA 1RCKA 2F98A 4RNZA 3G713 1BVIA 1W6YA 2RFRA 2J8XB 1RMSA 3I553 4OUQA 3T8UA 1PU4A 1OGXA 2XGLA 1TUHA 1X1UA 3EN8A 1VQM3 1Q40A 4NPBA 1YJ93 1TP6A 3G8ZA 1RNBA 4EW5A 3FZWA 2CG1A 5AIHA 5KP4A 3ZG0A 1N5PA 4NREA 1T3BA 3DY5A 1QJGA 2SARA 3LMLA 2OTL3 1QVF2 3EJVA 4IIAA 1F8NA 4FCZA 1LOYA 1RN1A 1T5YA 2F56A 3T0UA 1LRAA 1RRHA 1GD4A 2JDIH 3V98A 9RNTA 3D5GA 3NV0A 2Y74A 3ALAA 1ISKA 4AKYA 4HKVB 3EX9A 3HK4A 1GY5A 4EBGA 5CXOA 2GU3A 4I5QA 1VQ53 2W04A 1HU9A 3FG1A 5HOHA 4HVNA 1O7HB 1I0XA 3RDEA 1RGHA 4HM8B 4EC6A 1VQQA 5IG3A 1SPUA 1MNLA 3Q90A 2GXFA 1IVUA 3FSDA 1Q40B 3GZRA 4WP5A 5G2GA 4FMDA 4R80A 2CFDA 3FF0A 4EXRA 1VQ93 2OQEA 1FGRA 3J7Yd 1N8QA 1UGHI 4K1UA 5IERA 1RRLA 3BU4A 3LOYA 3UL6A 3VF1A 4BU4A 5IW9A 1DE3A 3GZXB 2Z77A 3U1WA 3X3ZA 1IVWA 3SX1A 1RTUA 1OH0A 2HMMB 4N6LA 4XBXA 3NV0B 1D6YA 3CME3 1STFI 4BL3A 4STDA 4N6MA 1Q864 1AV4A 4J5GA 2AADA 1OCVA 2R4IA 1GMRA 3G16A 2I9WA 2B1XB 1AQZA 1B2UA 1FUTA 3NM7A 1BANA 1QMAA 2F86B 2XFTA 4FMBA 4EV2A 4HBRA 2HMJB 3WA3A 2FNQA 1GSPA 4J5KA 4XM4A 2HMOB 1VZZA 2P0XA 3LTCA 3IJEB 1EA2A 5G1KA 3PGBA 1BNJA 1UI8A 3JUNA 1IDPA 3NUVA 4LSOA 1FUSA 2QA43 5AEUB 4KT3B 1RSNA 3WHOA 1UUVB 1W4NA 1WQLB 2W9PA 5ELJA 2F4YA 3F8XA 5BIRA 2B24B 3CCJ3 5D83A 1JJ22 1G0TA 2HOHA 4U13A 1OUNA 3SLUA 1D6UA 2CX0A 5M1AA 1A2PA 2D42A 1VQ83 2GBWB 3VSYA 1SQWA 3H51A 5LC7A 3AHSA 7RNTA 3WR2A 2XH9A 3U97A 5D81A 1NU3A 2LQVA 5EVHA 2WOFA 2Z76A 5FW5A 5A0OB 8RNTA 1FUWA 4MJDA 3BNCA 3SOAA 1UCLA 2RBIA 2F5WA 3D79A 4HM5B 3FG4A 3HX8A 3K63A 5JPPA 1RGKA 4AKZA 1I2FA 1FYSA 1BNGA 1EKMA 2BHMA 4H61A 2M7OA 5FGOA 3WOEB 1RGEA 2UGIA 3S27A 3EB8A 3D3LA 4PEJA 1ZO2A 2CC3A 3MYTA 1VQP3 1BOXA 3OWYA 4WFOA 1TIJA 1BSAA 3N8BA 4RNTA 1YVBI 3ZFZA 2YX9A 1UI7A 1BSCA 1SJWA 3AMOB 2INXA 3FCSB 3QRDA 3ROBA 2QEX3 2RGQA 2IA7A 1IV9A 2BU4A 3CNMA 1RLSA 3FH1A 5AEWB 5IEOA 2QIYA 3AGOA 1ULJB 2LYXA 2W2CA 1KC84 1K28A 3PZWA 1BNSA 1B20A 3CPOA 1BU4A 3F8HA 1LXEA 2HMNB 1E3RA 1T2IA 3AHWA 4KFFA 4K1VA 5CF1A 1HKXA 1JKGA 6RNTA 1M9GA 2D1WA 3UJMA 1KQS2 1NO3A 4HM1B 2WGOA 1RN4A 1RJOA 2H0IA 1OHSA 1IVVA 3EBTA 3CCV3 4ORLA 3CCS3 4TX4A 3CC73 1QVG2 1A90A 3JUPA 1BGSA 1BRIA 3S28A 5TGNA 3NXJA 2W56A 3DGOA 2CFGA 2CHCA 1GS3A 4HM0B 1BSBA 1JB2A 4HM2B 3Q2PA 3X40A 3SVAA 2RCDA 2L1SA 2YFJB 6STDA 4AEQA 1STDA 3A5EA 1NJI4 3GRDA 3D4AA 5G1LA 1I3FA 3K7CA 1IQYA 1RGGA 1KSIA 1BNIA 2OWPA 4R9KA 3RGAA 1LVNA 1JKGB 2IY2A 3F9SA 1LOWA 2GU1A 3BB9A 3KCHA 1BRGA 2AAEA 5I97A 1IT7A 1BNEA 3SEDA 2YFLB 4OVMA 3GAXA 7GSPA 3D5IA 3DGLA 2E2UA 1UW1A 3WA2X 1FGTA 1IQXA 3CPW2 1G02A 1BUQA 5M19A 3MSOA 1IT8A 1ZS7A 5CLKA 2W56B 3SYUA 2CX1A 1VQ63 1JZDA 3DZLA 1W6GA 3KIIA 2XSHB 1N9EA 5AIGA 3CCL3 1W2B2 2CW9A 2MF7A 1BRHA 1A2KA 1O7PB 1JNQA 4IT7A 5KP1A 1MGWA 3GSPA 3K5TA 2OOVC 7STDA 4WYKA 3ZG5A 4EYCA 1YHQ3 1KD14 3F14A 1BRNL 2KCDA 1BAOA 4HOHA 4K90B 1US1A 3X42A 5AIFA 1PYLA 2KXGA 3EF8A 2GBXB 3URPA 1GOYA 1AR0A 1U8CB 1NB5I 1Z1SA 1ROAA 2Z6BA 1BSEA 2BT3A 2WO0A 4HM7B 1K734 3K9MC 3NBRA 3NBJA 1GYBA 5BU4A 1N5HA 5RNTA 1ZX2A 1W5ZA 3DGMA 4GL6A 4CCVA 1MWUA 1EUIC 2XEPA 2IMJA 2XGNA 3B4OA 1S723 2F99A 2C4BA 4WYKB 1UUWB 2R41A 1GY6A 1O7NB 2IYJA 1NDOB 1V74A 1Q7HA 1DETA 1JZOA 4O8SA 4BIRA 1JBRA 1LOVA 2ZL8A 3JVCA 2W9QA 3X41A 1O7GB 2KF3A 2A15A 3JUMA 4LGQA 2KF4A 3EQQB 4G1MB 4MMXB 4Q53A 1C7HA 4N6NB 3LTDA 1LQMB 2F5MA 3B7CA 1DVCA 3LT9A 3S67A 2OTJ3 1DYUA 2O9UX 1V58A 1YIJ3 3WOFB 3T8NA 1N9JA 1Q9EA 3OV4A 1DVDA 3F7SA 5CK6A 5AIIA 3CU3A 1TRPA 1WNHA 2KF6A 4FCJA 2L4VA 1GMPA 1FGQA 3KKGA 2OOVA 1FA3A 5JPUA 2HMLB 4L8PA 1E97A 2Y73A 1I0VA 3HIGA 1QAKA 3LTBA 4LMIA 3BNDA 4RNYA 4XDVA 4XDWA 3SOYA 4BTWA 5IG0A 1NB3I 3MG2A 1IV7A 3B4PA 3DUKA 1X1XA 3LYGA 1ASKA 3I0YA 2CKFB 3EBYA 3MWZA 2WGQA 1E3VA 1YGWA 1YNVX 5D82A 1S5AA 4BTXA 1GOUA 1WMPA 4HJLB 2SBLA 1M1XB 1CYVA 2CFKA 3NHXA 3L0RA 3WDGB 1CH0A 2Q07A 3N54B 1TTOA 1FGOA 1TRQA 1BNRA 1OF5A 4MMYB 1RHLA 3CCU3 4N6V0 1UDII 1QAFA 4GSPA 3S5CA 3CD63 1RNTA 3V92A 6GSPA 1Q7Y4 5IEPA 2W03A 1A2VA 3QK9A 1RGLA 3EHCA 2ZDJA 1W00A 3H3HA 3OWUA 3CC23 3PXMA 4KFEA 1YVSA 3LTAA 3DXOA 1GY7A 1RGFA 4N6TA 5IF6A 2CIUA 3LH4A 1AVKA 1RN7A 3EN1B 1DMMA 1N8R4 1I8VA 1B2XA 1DMQA 2GSPA 1VQN3 5KP3A 3TDGA 1NWWA 2ZHXB 3V99A 2CWTA 4KFDA 3KE7A 2OQEC 3WMDA 3PYJA 2RSXA 4KZ1A 1OF5B 4CPKA 1UGIA 1Q814 1OHPA 3HOHA 4CDLA 5IG4A 1VQO3 1YI23 4O3VA 1ZGXA 1IYYA 2OCTA 2CG0A 3S29A 1J2BA 1PFPA 3BNBA 1K9M4 4X2HA 4GHOA 1HYFA 4HAAA 3BNEA 2WOHA 3UB1A 4GB5A 1OACA 1YJN3 1IU7A 3FF2A 4HM4B 2ZA4A 2CFWA 1Q42A 3DH2A 2V1LA 3F7XA 2XFSA 1W01A 3X3YA 4DKIA 4L7KA 4LYLB 1JRQA 2BO9B 3FLJA 1AVLA 1WMOA 1WTHA 1JBSA 2XR8B 1RCLA 1ROVA 3CNXA 4R9LA 1LNIA
chains in the Genus database with same CATH topology
3UNLA 1G96A 3KN4A 4RZMA 1U5OA 3MG3A 4H3UA 4I4KA 1OPYA 4R4KA 3LT8A 1GD3A 4WHAA 5STDA 3OXAA 3EC9A 5JBSA 2E2TA 1IK3A 3WODG 1DMNA 4N6OB 1W02A 3GZYB 3CMA3 3NBBA 2JQ5A 2C10A 4N3VA 3GWRA 1EG9B 4HM3B 3PS8A 2CK3H 4X2OA 4FMAA 4EV5A 3VGNA 2P09A 4MEIA 4OK0A 4HM6B 2XRXB 5BVBA 1TU5A 1L5GB 2XSOB 2QGUA 3I563 3CC43 4J9AA 1QALA 3NQYA 3DMCA 3UL5A 2W0QA 3M8CA 3MPHA 3SXXA 4ZM8A 3HI7A 4HYZA 4QWTA 2E2VA 3PCSA 1K8A4 3CCR3 2KRTA 1VQL3 2CWUA 3O8YA 2CWVA 3G6E3 5DREA 2CFLA 2K0MA 2CH9A 3MG1A 4MMZB 2YFIB 3KFQC 1MOLA 3CCQ3 5DRVA 5HGRA 3ER7A 4N6UA 4O2HA 2BNGA 3RGRA 3A76A 3BLZA 4K61A 2P38A 3PCRA 3CXC2 3FGYA 2HMKB 3N9HA 2PNCA 3CCM3 2P05A 2W6JH 3X3XA 3MHEA 3ECFA 3G0KA 3GZBA 4FR9A 1VQK3 1CEWI 3EE1A 4LZIA 2STDA 2P0MA 1JB5A 2XF3A 3FKAA 3G4S3 2BMRB 2MC8A 1FGMA 1W7CA 2GEXA 1LNHA 3K0ZA 1A67A 2UX0A 1TFOA 4LEHA 3NQZA 3IPTA 4HZBB 4RBNA 1W2ZA 1CQSA 3LZAA 5EQLA 3KSED 2IUJA 1OGZA 4O02B 3OWSA 1JB4A 4IPBA 2GEYA 3B8LA 3CCE3 2O3OA 4FCMA 5ELUA 1O7WB 1O7MB 2BMQB 3AMOA 3DGNA 5EEOA 3Q1CA 4XBYA 3KSPA 4BTYA 2ML5A 5AI1A 3NX0A 2BMOB 4XBTA 4KVHA 4L8OA 3D9RA 4JRFA 2FXTA 1SIHA 1IVXA 1CYUA 1OHOA 5IENA 2FGTA 5BXQA 1WMNA 3JUOA 4FMCA 4J8TA 2PZVA 2K54A 4HZ9B 1ULIB 1RKYA 1EQKA 1JN5A 4XB5A 3NM2A 1R4CA 1KWIA 5IG5A 2ML6A 1LOXA 3IMAB 1YJW3 3HIIA 1W6CA 1K41A 3FG3A 3MKIA 1VQ73 3OX9A 5CF2A 1TFKA 1D6ZA 3F40A 1YIT3 3STDA 1YGEA 5AYRB 4WWUC 1SIIA 4NHFA 4JF8A 5LC6A 1Q824 2IUKA 1VQ43 3E99A 3LXUX 5AYSC 8CHOA 3OW22 1JN5B 3HZPA 2Z7AA 3KZTA 1JV2B 1IQ8A 1M1K4 4R1KA 1M904 1Y4KA 3JUQA 2C11A 3DM8A 4RNZA 2F98A 3G713 1W6YA 2RFRA 3I553 4OUQA 3T8UA 1PU4A 1OGXA 2XGLA 1TUHA 3EN8A 1VQM3 1Q40A 1YJ93 1TP6A 3G8ZA 3FZWA 2CG1A 5AIHA 5KP4A 1N5PA 4NREA 3DY5A 1QJGA 3LMLA 2OTL3 1QVF2 3EJVA 4IIAA 1F8NA 4FCZA 1T5YA 3T0UA 1RRHA 1GD4A 2JDIH 3V98A 3NV0A 2Y74A 3ALAA 1ISKA 4AKYA 4HKVB 3EX9A 3HK4A 1GY5A 4EBGA 5CXOA 2GU3A 1VQ53 2W04A 1HU9A 3FG1A 4HVNA 1O7HB 3RDEA 4HM8B 5IG3A 4EC6A 1SPUA 1MNLA 3Q90A 2GXFA 1IVUA 3FSDA 1Q40B 3GZRA 4WP5A 5G2GA 4FMDA 4R80A 2CFDA 3FF0A 4EXRA 1VQ93 2OQEA 1FGRA 3J7Yd 1N8QA 4K1UA 5IERA 1RRLA 3LOYA 3UL6A 3VF1A 5IW9A 3GZXB 2Z77A 3U1WA 3X3ZA 1IVWA 3SX1A 1OH0A 2HMMB 4N6LA 4XBXA 3NV0B 1D6YA 3CME3 1STFI 4STDA 4N6MA 1Q864 1AV4A 1OCVA 2R4IA 3G16A 2I9WA 2B1XB 3NM7A 1QMAA 2F86B 2XFTA 4FMBA 4EV2A 4HBRA 2HMJB 3WA3A 2FNQA 4XM4A 2HMOB 1VZZA 2P0XA 3LTCA 3IJEB 1EA2A 3PGBA 1UI8A 3JUNA 1IDPA 3NUVA 4LSOA 2QA43 5AEUB 1UUVB 1W4NA 1WQLB 2W9PA 5ELJA 3F8XA 2B24B 3CCJ3 5D83A 1JJ22 4U13A 1OUNA 3SLUA 1D6UA 2D42A 1VQ83 2GBWB 3VSYA 1SQWA 3H51A 5LC7A 2XH9A 3U97A 5D81A 1NU3A 2LQVA 5EVHA 2Z76A 2WOFA 5FW5A 5A0OB 1FUWA 4MJDA 3BNCA 3SOAA 4HM5B 3FG4A 3HX8A 3K63A 5JPPA 4AKZA 5FGOA 4H61A 1EKMA 2BHMA 3WOEB 2M7OA 3S27A 3EB8A 3D3LA 4PEJA 1ZO2A 2CC3A 3MYTA 1VQP3 4WFOA 3OWYA 1TIJA 3N8BA 1YVBI 2YX9A 1UI7A 1SJWA 3AMOB 3FCSB 2INXA 3QRDA 3ROBA 2QEX3 2RGQA 2IA7A 1IV9A 3CNMA 3FH1A 5AEWB 5IEOA 2QIYA 1ULJB 2LYXA 2W2CA 1KC84 1K28A 3PZWA 4KFFA 3CPOA 5CF1A 3F8HA 1LXEA 2HMNB 1E3RA 4K1VA 1HKXA 1JKGA 1M9GA 2D1WA 3UJMA 1KQS2 1NO3A 4HM1B 2WGOA 1RJOA 3CCV3 1OHSA 1IVVA 3EBTA 4ORLA 3CCS3 4TX4A 3CC73 1QVG2 1A90A 3JUPA 3S28A 5TGNA 3NXJA 2W56A 3DGOA 2CFGA 2CHCA 1GS3A 4HM0B 1JB2A 4HM2B 3Q2PA 3X40A 3SVAA 2RCDA 6STDA 2YFJB 4AEQA 1STDA 1NJI4 3GRDA 3K7CA 1IQYA 1KSIA 2OWPA 4R9KA 3RGAA 1LVNA 1JKGB 3F9SA 2GU1A 3BB9A 5I97A 1IT7A 3SEDA 2YFLB 4OVMA 3GAXA 3WA2X 3DGLA 2E2UA 1UW1A 1FGTA 1IQXA 3CPW2 1BUQA 3MSOA 1IT8A 5CLKA 2W56B 1VQ63 3DZLA 1W6GA 3KIIA 2XSHB 1N9EA 5AIGA 3CCL3 1W2B2 2CW9A 2MF7A 1O7PB 1A2KA 1JNQA 4IT7A 5KP1A 3K5TA 2OOVC 7STDA 4WYKA 4EYCA 1YHQ3 1KD14 3F14A 2KCDA 4K90B 1US1A 3X42A 5AIFA 2KXGA 3EF8A 2GBXB 1AR0A 1U8CB 1NB5I 1Z1SA 1ROAA 2Z6BA 4HM7B 2BT3A 2WO0A 1K734 3K9MC 3NBRA 3NBJA 1GYBA 1N5HA 1ZX2A 1W5ZA 3DGMA 4GL6A 4CCVA 2XEPA 3B4OA 2IMJA 2XGNA 1S723 2F99A 4WYKB 1UUWB 1GY6A 1O7NB 1NDOB 1V74A 4O8SA 2ZL8A 3JVCA 2W9QA 3X41A 1O7GB 3JUMA 2A15A 4LGQA 4G1MB 3EQQB 4MMXB 4Q53A 1C7HA 4N6NB 3LTDA 3B7CA 1DVCA 3LT9A 3S67A 2OTJ3 1DYUA 2O9UX 1YIJ3 3WOFB 3T8NA 1N9JA 3OV4A 1DVDA 3F7SA 5CK6A 5AIIA 3CU3A 1WNHA 4FCJA 2L4VA 2OOVA 1FGQA 3KKGA 1FA3A 5JPUA 2HMLB 4L8PA 1E97A 2Y73A 3HIGA 3LTBA 1QAKA 4XDVA 4LMIA 3BNDA 4RNYA 4XDWA 3SOYA 4BTWA 5IG0A 1NB3I 3MG2A 1IV7A 3B4PA 3DUKA 3LYGA 1ASKA 3I0YA 2CKFB 3EBYA 3MWZA 2WGQA 1E3VA 5D82A 1S5AA 4BTXA 1WMPA 4HJLB 2SBLA 1M1XB 1CYVA 2CFKA 3NHXA 3L0RA 3WDGB 3N54B 2Q07A 1FGOA 1OF5A 4MMYB 3CCU3 4N6V0 1QAFA 3S5CA 3CD63 3V92A 1Q7Y4 5IEPA 2W03A 1A2VA 3QK9A 3EHCA 2ZDJA 1W00A 3H3HA 3OWUA 3CC23 3PXMA 4KFEA 5IF6A 3LTAA 3DXOA 1GY7A 4N6TA 2CIUA 3LH4A 1AVKA 1RN7A 3EN1B 1DMMA 1N8R4 1DMQA 1VQN3 5KP3A 3TDGA 1NWWA 3V99A 2CWTA 4KFDA 3KE7A 2OQEC 3WMDA 3PYJA 2RSXA 4KZ1A 1OF5B 1Q814 1OHPA 4CDLA 5IG4A 1VQO3 1YI23 4O3VA 2OCTA 2CG0A 3S29A 1J2BA 1PFPA 3BNBA 1K9M4 4X2HA 3BNEA 2WOHA 3UB1A 4GB5A 1OACA 1YJN3 1IU7A 3FF2A 4HM4B 2CFWA 1Q42A 2V1LA 3F7XA 2XFSA 1W01A 3X3YA 4L7KA 1JRQA 2BO9B 3FLJA 1AVLA 1WMOA 1WTHA 2XR8B 1ROVA 3CNXA 4R9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UNL A;  4RZM A;  1U5O A;  3MG3 A;  4H3U A;  4I4K A;  1OPY A;  5STD A;  3OXA A;  3EC9 A;  1DMN A;  1W02 A;  3GZY B;  2JQ5 A;  4N3V A;  3GWR A;  1EG9 B;  4HM3 B;  4X2O A;  3VGN A;  4HM6 B;  2XRX B;  5BVB A;  2XSO B;  2QGU A;  4J9A A;  3DMC A;  3M8C A;  5DRE A;  3MG1 A;  2YFI B;  5DRV A;  5HGR A;  3ER7 A;  2BNG A;  3RGR A;  3A76 A;  3BLZ A;  3FGY A;  2HMK B;  3MHE A;  3ECF A;  3G0K A;  3GZB A;  2STD A;  1JB5 A;  3FKA A;  2BMR B;  2GEX A;  3K0Z A;  2UX0 A;  4LEH A;  3IPT A;  4HZB B;  1CQS A;  3LZA A;  1OGZ A;  3OWS A;  1JB4 A;  2GEY A;  3B8L A;  4FCM A;  1O7W B;  1O7M B;  2BMQ B;  4XBY A;  3KSP A;  5AI1 A;  2BMO B;  4XBT A;  4KVH A;  4L8O A;  3D9R A;  1OHO A;  5IEN A;  5BXQ A;  3JUO A;  4J8T A;  2PZV A;  2K54 A;  4HZ9 B;  1ULI B;  1JN5 A;  4XB5 A;  3NM2 A;  5IG5 A;  1K41 A;  3MKI A;  3OX9 A;  5CF2 A;  3F40 A;  3STD A;  4WWU C;  3E99 A;  8CHO A;  1JN5 B;  3HZP A;  2Z7A A;  3KZT A;  4R1K A;  3JUQ A;  3DM8 A;  2F98 A;  1W6Y A;  2RFR A;  4OUQ A;  3T8U A;  1OGX A;  3EN8 A;  1TUH A;  1Q40 A;  1TP6 A;  3G8Z A;  3FZW A;  5AIH A;  5KP4 A;  1QJG A;  3EJV A;  4IIA A;  3NV0 A;  1ISK A;  4HKV B;  3EX9 A;  3HK4 A;  1GY5 A;  5CXO A;  4HVN A;  1O7H B;  4HM8 B;  5IG3 A;  3Q90 A;  2GXF A;  3FSD A;  5G2G A;  1Q40 B;  3GZR A;  4WP5 A;  3FF0 A;  4K1U A;  5IER A;  3GZX B;  2Z77 A;  1OH0 A;  2HMM B;  4XBX A;  3NV0 B;  4STD A;  1OCV A;  2R4I A;  3G16 A;  2I9W A;  2B1X B;  1QMA A;  2F86 B;  2HMJ B;  4XM4 A;  2HMO B;  1VZZ A;  1EA2 A;  3JUN A;  1IDP A;  3NUV A;  5AEU B;  1UUV B;  1WQL B;  3F8X A;  2B24 B;  5D83 A;  4U13 A;  1OUN A;  2GBW B;  3VSY A;  3H51 A;  5D81 A;  1NU3 A;  5EVH A;  2Z76 A;  5FW5 A;  4MJD A;  3SOA A;  4HM5 B;  5JPP A;  3HX8 A;  4PEJ A;  1ZO2 A;  3MYT A;  3OWY A;  1SJW A;  3ROB A;  2INX A;  2RGQ A;  3CNM A;  3FH1 A;  5AEW B;  5IEO A;  2QIY A;  1ULJ B;  2W2C A;  3CPO A;  5CF1 A;  3F8H A;  2HMN B;  1E3R A;  4K1V A;  1HKX A;  1JKG A;  3UJM A;  4HM1 B;  1OHS A;  3EBT A;  4ORL A;  3JUP A;  5TGN A;  3NXJ A;  2CHC A;  1GS3 A;  4HM0 B;  1JB2 A;  4HM2 B;  2RCD A;  6STD A;  2YFJ B;  1STD A;  3GRD A;  3K7C A;  2OWP A;  4R9K A;  3RGA A;  1JKG B;  3F9S A;  3BB9 A;  3SED A;  2YFL B;  4OVM A;  1BUQ A;  3MSO A;  5CLK A;  3DZL A;  2XSH B;  5AIG A;  1O7P B;  1A2K A;  5KP1 A;  7STD A;  4WYK A;  3F14 A;  5AIF A;  3EF8 A;  2GBX B;  1AR0 A;  1Z1S A;  4HM7 B;  3NBR A;  1GYB A;  1ZX2 A;  3B4O A;  2IMJ A;  2F99 A;  4WYK B;  1UUW B;  1GY6 A;  1O7N B;  1NDO B;  1O7G B;  3JUM A;  2A15 A;  4LGQ A;  3EQQ B;  4Q53 A;  1C7H A;  3B7C A;  3T8N A;  3OV4 A;  3F7S A;  5CK6 A;  5AII A;  3CU3 A;  4FCJ A;  3KKG A;  5JPU A;  2HML B;  4L8P A;  1E97 A;  4XDV A;  3SOY A;  4XDW A;  4LMI A;  5IG0 A;  3MG2 A;  3B4P A;  3DUK A;  3LYG A;  1ASK A;  3I0Y A;  2CKF B;  3EBY A;  5D82 A;  1E3V A;  1S5A A;  4HJL B;  3NHX A;  1OF5 A;  3S5C A;  5IEP A;  3EHC A;  1W00 A;  3H3H A;  3OWU A;  5IF6 A;  3DXO A;  1GY7 A;  3EN1 B;  1DMM A;  1DMQ A;  5KP3 A;  1NWW A;  3KE7 A;  3WMD A;  1OF5 B;  1OHP A;  4CDL A;  5IG4 A;  4X2H A;  4GB5 A;  3FF2 A;  4HM4 B;  1Q42 A;  3F7X A;  1W01 A;  4L7K A;  3FLJ A;  2XR8 B;  3CNX A;  4R9L A; 
#chains in the Genus database with same CATH topology
 3UNL A;  1G96 A;  3KN4 A;  4RZM A;  1U5O A;  3MG3 A;  4H3U A;  4I4K A;  1OPY A;  4R4K A;  3LT8 A;  1GD3 A;  4WHA A;  5STD A;  1UUG B;  3OXA A;  3EC9 A;  5JBS A;  2E2T A;  1IK3 A;  3WOD G;  3Q3F A;  1GMQ A;  1DMN A;  1NNV A;  1W02 A;  4N6O B;  3RNT A;  3GZY B;  2KAA A;  1UCK A;  3CMA 3;  3NBB A;  4BL2 A;  2JQ5 A;  2C10 A;  4N3V A;  3GWR A;  1EG9 B;  4HM3 B;  3PS8 A;  3AGN A;  2CK3 H;  4X2O A;  4FMA A;  2H0G A;  4EV5 A;  3VGN A;  2P09 A;  4MEI A;  4OK0 A;  4ILF A;  4HM6 B;  2XRX B;  5BVB A;  5GSP A;  1BNF A;  1TU5 A;  1GOV A;  2UUG C;  1L5G B;  2XSO B;  2QGU A;  3I56 3;  3CC4 3;  4J9A A;  1QAL A;  3NQY A;  3DMC A;  3UL5 A;  1PY3 A;  2W0Q A;  3M8C A;  3MPH A;  3SXX A;  1B2M A;  4ZM8 A;  3DGY A;  3HI7 A;  4HYZ A;  4QWT A;  1RDS A;  1R4Y A;  2E2V A;  3PCS A;  1K8A 4;  3CCR 3;  2KRT A;  1BSD A;  2CWU A;  1VQL 3;  3O8Y A;  2CWV A;  3G6E 3;  2BIR A;  5DRE A;  2CFL A;  2K0M A;  2H0H A;  2CH9 A;  1RGA A;  3MG1 A;  4MMZ B;  2YFI B;  3KFQ C;  1MOL A;  3CCQ 3;  5DRV A;  1I2G A;  4CJN A;  5HGR A;  1I3I A;  3ER7 A;  4N6U A;  4O2H A;  1C54 A;  2BNG A;  3RGR A;  3A76 A;  3BLZ A;  4K61 A;  2P38 A;  3PCR A;  3CXC 2;  1LQG C;  3FGY A;  2HMK B;  3N9H A;  2PNC A;  3CCM 3;  2P05 A;  1BUJ A;  2W6J H;  3X3X A;  3MHE A;  3ECF A;  3G0K A;  3GZB A;  4FR9 A;  1VQK 3;  1CEW I;  1B27 A;  2RNT A;  3EE1 A;  4LZI A;  1AY7 A;  2STD A;  2P0M A;  1JB5 A;  2XF3 A;  3FKA A;  1EEJ A;  1MWT A;  2BMR B;  1B21 A;  1FGM A;  2MC8 A;  3G4S 3;  1W7C A;  2GEX A;  1LNH A;  3K0Z A;  1A67 A;  1T2H A;  1X1W A;  2UX0 A;  1TFO A;  1V57 A;  3NQZ A;  3IPT A;  4HZB B;  4LEH A;  1W2Z A;  1CQS A;  3LZA A;  4RBN A;  5EQL A;  3KSE D;  2IUJ A;  1OGZ A;  4O02 B;  3OWS A;  1JB4 A;  4IPB A;  2GEY A;  3B8L A;  3CCE 3;  2O3O A;  4FCM A;  5ELU A;  1O7W B;  1BRS A;  1O7M B;  2BMQ B;  3AMO A;  3DGN A;  5EEO A;  3Q1C A;  4XBY A;  3KSP A;  1BRJ A;  1UCJ A;  2ML5 A;  5AI1 A;  4BTY A;  1HZ1 A;  3NX0 A;  2BMO B;  1I70 A;  1MWR A;  1RGC A;  4KVH A;  4L8O A;  4XBT A;  3D9R A;  4JRF A;  2FXT A;  1SIH A;  1IVX A;  1FZU A;  1CYU A;  1OHO A;  1B2S A;  1I2E A;  5IEN A;  2FGT A;  5BXQ A;  1WMN A;  3JUO A;  4FMC A;  4J8T A;  2PZV A;  2K54 A;  4HZ9 B;  1ULI B;  1RKY A;  1EQK A;  1JN5 A;  4XB5 A;  5M18 A;  3NM2 A;  1R4C A;  1KWI A;  1UCI A;  5IG5 A;  2ML6 A;  1LOX A;  3IMA B;  1B3S A;  3HII A;  1YJW 3;  1W6C A;  2K3D A;  1K41 A;  3FG3 A;  3MKI A;  1VQ7 3;  3OX9 A;  5CF2 A;  1TFK A;  1D6Z A;  3F40 A;  1YIT 3;  3STD A;  1TJD A;  1YGE A;  5AYR B;  4WWU C;  1SII A;  4NHF A;  1JBT A;  1BRK A;  4JF8 A;  5LC6 A;  1FW7 A;  1Q82 4;  2IUK A;  1VQ4 3;  3E99 A;  2KF5 A;  3LXU X;  5AYS C;  8CHO A;  1X1Y A;  1MGR A;  3OW2 2;  1BIR A;  1JN5 B;  1SAR A;  3HZP A;  2Z7A A;  3KZT A;  1JV2 B;  1IQ8 A;  1M1K 4;  4R1K A;  1M90 4;  1MWS A;  1Y4K A;  3JUQ A;  1B2Z A;  2C11 A;  3DM8 A;  3BIR A;  1RCK A;  2F98 A;  4RNZ A;  3G71 3;  1BVI A;  1W6Y A;  2RFR A;  2J8X B;  1RMS A;  3I55 3;  4OUQ A;  3T8U A;  1PU4 A;  1OGX A;  2XGL A;  1TUH A;  1X1U A;  3EN8 A;  1VQM 3;  1Q40 A;  4NPB A;  1YJ9 3;  1TP6 A;  3G8Z A;  1RNB A;  4EW5 A;  3FZW A;  2CG1 A;  5AIH A;  5KP4 A;  3ZG0 A;  1N5P A;  4NRE A;  1T3B A;  3DY5 A;  1QJG A;  2SAR A;  3LML A;  2OTL 3;  1QVF 2;  3EJV A;  4IIA A;  1F8N A;  4FCZ A;  1LOY A;  1RN1 A;  1T5Y A;  2F56 A;  3T0U A;  1LRA A;  1RRH A;  1GD4 A;  2JDI H;  3V98 A;  9RNT A;  3D5G A;  3NV0 A;  2Y74 A;  3ALA A;  1ISK A;  4AKY A;  4HKV B;  3EX9 A;  3HK4 A;  1GY5 A;  4EBG A;  5CXO A;  2GU3 A;  4I5Q A;  1VQ5 3;  2W04 A;  1HU9 A;  3FG1 A;  5HOH A;  4HVN A;  1O7H B;  1I0X A;  3RDE A;  1RGH A;  4HM8 B;  4EC6 A;  1VQQ A;  5IG3 A;  1SPU A;  1MNL A;  3Q90 A;  2GXF A;  1IVU A;  3FSD A;  1Q40 B;  3GZR A;  4WP5 A;  5G2G A;  4FMD A;  4R80 A;  2CFD A;  3FF0 A;  4EXR A;  1VQ9 3;  2OQE A;  1FGR A;  3J7Y d;  1N8Q A;  1UGH I;  4K1U A;  5IER A;  1RRL A;  3BU4 A;  3LOY A;  3UL6 A;  3VF1 A;  4BU4 A;  5IW9 A;  1DE3 A;  3GZX B;  2Z77 A;  3U1W A;  3X3Z A;  1IVW A;  3SX1 A;  1RTU A;  1OH0 A;  2HMM B;  4N6L A;  4XBX A;  3NV0 B;  1D6Y A;  3CME 3;  1STF I;  4BL3 A;  4STD A;  4N6M A;  1Q86 4;  1AV4 A;  4J5G A;  2AAD A;  1OCV A;  2R4I A;  1GMR A;  3G16 A;  2I9W A;  2B1X B;  1AQZ A;  1B2U A;  1FUT A;  3NM7 A;  1BAN A;  1QMA A;  2F86 B;  2XFT A;  4FMB A;  4EV2 A;  4HBR A;  2HMJ B;  3WA3 A;  2FNQ A;  1GSP A;  4J5K A;  4XM4 A;  2HMO B;  1VZZ A;  2P0X A;  3LTC A;  3IJE B;  1EA2 A;  5G1K A;  3PGB A;  1BNJ A;  1UI8 A;  3JUN A;  1IDP A;  3NUV A;  4LSO A;  1FUS A;  2QA4 3;  5AEU B;  4KT3 B;  1RSN A;  3WHO A;  1UUV B;  1W4N A;  1WQL B;  2W9P A;  5ELJ A;  2F4Y A;  3F8X A;  5BIR A;  2B24 B;  3CCJ 3;  5D83 A;  1JJ2 2;  1G0T A;  2HOH A;  4U13 A;  1OUN A;  3SLU A;  1D6U A;  2CX0 A;  5M1A A;  1A2P A;  2D42 A;  1VQ8 3;  2GBW B;  3VSY A;  1SQW A;  3H51 A;  5LC7 A;  3AHS A;  7RNT A;  3WR2 A;  2XH9 A;  3U97 A;  5D81 A;  1NU3 A;  2LQV A;  5EVH A;  2WOF A;  2Z76 A;  5FW5 A;  5A0O B;  8RNT A;  1FUW A;  4MJD A;  3BNC A;  3SOA A;  1UCL A;  2RBI A;  2F5W A;  3D79 A;  4HM5 B;  3FG4 A;  3HX8 A;  3K63 A;  5JPP A;  1RGK A;  4AKZ A;  1I2F A;  1FYS A;  1BNG A;  1EKM A;  2BHM A;  4H61 A;  2M7O A;  5FGO A;  3WOE B;  1RGE A;  2UGI A;  3S27 A;  3EB8 A;  3D3L A;  4PEJ A;  1ZO2 A;  2CC3 A;  3MYT A;  1VQP 3;  1BOX A;  3OWY A;  4WFO A;  1TIJ A;  1BSA A;  3N8B A;  4RNT A;  1YVB I;  3ZFZ A;  2YX9 A;  1UI7 A;  1BSC A;  1SJW A;  3AMO B;  2INX A;  3FCS B;  3QRD A;  3ROB A;  2QEX 3;  2RGQ A;  2IA7 A;  1IV9 A;  2BU4 A;  3CNM A;  1RLS A;  3FH1 A;  5AEW B;  5IEO A;  2QIY A;  3AGO A;  1ULJ B;  2LYX A;  2W2C A;  1KC8 4;  1K28 A;  3PZW A;  1BNS A;  1B20 A;  3CPO A;  1BU4 A;  3F8H A;  1LXE A;  2HMN B;  1E3R A;  1T2I A;  3AHW A;  4KFF A;  4K1V A;  5CF1 A;  1HKX A;  1JKG A;  6RNT A;  1M9G A;  2D1W A;  3UJM A;  1KQS 2;  1NO3 A;  4HM1 B;  2WGO A;  1RN4 A;  1RJO A;  2H0I A;  1OHS A;  1IVV A;  3EBT A;  3CCV 3;  4ORL A;  3CCS 3;  4TX4 A;  3CC7 3;  1QVG 2;  1A90 A;  3JUP A;  1BGS A;  1BRI A;  3S28 A;  5TGN A;  3NXJ A;  2W56 A;  3DGO A;  2CFG A;  2CHC A;  1GS3 A;  4HM0 B;  1BSB A;  1JB2 A;  4HM2 B;  3Q2P A;  3X40 A;  3SVA A;  2RCD A;  2L1S A;  2YFJ B;  6STD A;  4AEQ A;  1STD A;  3A5E A;  1NJI 4;  3GRD A;  3D4A A;  5G1L A;  1I3F A;  3K7C A;  1IQY A;  1RGG A;  1KSI A;  1BNI A;  2OWP A;  4R9K A;  3RGA A;  1LVN A;  1JKG B;  2IY2 A;  3F9S A;  1LOW A;  2GU1 A;  3BB9 A;  3KCH A;  1BRG A;  2AAE A;  5I97 A;  1IT7 A;  1BNE A;  3SED A;  2YFL B;  4OVM A;  3GAX A;  7GSP A;  3D5I A;  3DGL A;  2E2U A;  1UW1 A;  3WA2 X;  1FGT A;  1IQX A;  3CPW 2;  1G02 A;  1BUQ A;  5M19 A;  3MSO A;  1IT8 A;  1ZS7 A;  5CLK A;  2W56 B;  3SYU A;  2CX1 A;  1VQ6 3;  1JZD A;  3DZL A;  1W6G A;  3KII A;  2XSH B;  1N9E A;  5AIG A;  3CCL 3;  1W2B 2;  2CW9 A;  2MF7 A;  1BRH A;  1A2K A;  1O7P B;  1JNQ A;  4IT7 A;  5KP1 A;  1MGW A;  3GSP A;  3K5T A;  2OOV C;  7STD A;  4WYK A;  3ZG5 A;  4EYC A;  1YHQ 3;  1KD1 4;  3F14 A;  1BRN L;  2KCD A;  1BAO A;  4HOH A;  4K90 B;  1US1 A;  3X42 A;  5AIF A;  1PYL A;  2KXG A;  3EF8 A;  2GBX B;  3URP A;  1GOY A;  1AR0 A;  1U8C B;  1NB5 I;  1Z1S A;  1ROA A;  2Z6B A;  1BSE A;  2BT3 A;  2WO0 A;  4HM7 B;  1K73 4;  3K9M C;  3NBR A;  3NBJ A;  1GYB A;  5BU4 A;  1N5H A;  5RNT A;  1ZX2 A;  1W5Z A;  3DGM A;  4GL6 A;  4CCV A;  1MWU A;  1EUI C;  2XEP A;  2IMJ A;  2XGN A;  3B4O A;  1S72 3;  2F99 A;  2C4B A;  4WYK B;  1UUW B;  2R41 A;  1GY6 A;  1O7N B;  2IYJ A;  1NDO B;  1V74 A;  1Q7H A;  1DET A;  1JZO A;  4O8S A;  4BIR A;  1JBR A;  1LOV A;  2ZL8 A;  3JVC A;  2W9Q A;  3X41 A;  1O7G B;  2KF3 A;  2A15 A;  3JUM A;  4LGQ A;  2KF4 A;  3EQQ B;  4G1M B;  4MMX B;  4Q53 A;  1C7H A;  4N6N B;  3LTD A;  1LQM B;  2F5M A;  3B7C A;  1DVC A;  3LT9 A;  3S67 A;  2OTJ 3;  1DYU A;  2O9U X;  1V58 A;  1YIJ 3;  3WOF B;  3T8N A;  1N9J A;  1Q9E A;  3OV4 A;  1DVD A;  3F7S A;  5CK6 A;  5AII A;  3CU3 A;  1TRP A;  1WNH A;  2KF6 A;  4FCJ A;  2L4V A;  1GMP A;  1FGQ A;  3KKG A;  2OOV A;  1FA3 A;  5JPU A;  2HML B;  4L8P A;  1E97 A;  2Y73 A;  1I0V A;  3HIG A;  1QAK A;  3LTB A;  4LMI A;  3BND A;  4RNY A;  4XDV A;  4XDW A;  3SOY A;  4BTW A;  5IG0 A;  1NB3 I;  3MG2 A;  1IV7 A;  3B4P A;  3DUK A;  1X1X A;  3LYG A;  1ASK A;  3I0Y A;  2CKF B;  3EBY A;  3MWZ A;  2WGQ A;  1E3V A;  1YGW A;  1YNV X;  5D82 A;  1S5A A;  4BTX A;  1GOU A;  1WMP A;  4HJL B;  2SBL A;  1M1X B;  1CYV A;  2CFK A;  3NHX A;  3L0R A;  3WDG B;  1CH0 A;  2Q07 A;  3N54 B;  1TTO A;  1FGO A;  1TRQ A;  1BNR A;  1OF5 A;  4MMY B;  1RHL A;  3CCU 3;  4N6V 0;  1UDI I;  1QAF A;  4GSP A;  3S5C A;  3CD6 3;  1RNT A;  3V92 A;  6GSP A;  1Q7Y 4;  5IEP A;  2W03 A;  1A2V A;  3QK9 A;  1RGL A;  3EHC A;  2ZDJ A;  1W00 A;  3H3H A;  3OWU A;  3CC2 3;  3PXM A;  4KFE A;  1YVS A;  3LTA A;  3DXO A;  1GY7 A;  1RGF A;  4N6T A;  5IF6 A;  2CIU A;  3LH4 A;  1AVK A;  1RN7 A;  3EN1 B;  1DMM A;  1N8R 4;  1I8V A;  1B2X A;  1DMQ A;  2GSP A;  1VQN 3;  5KP3 A;  3TDG A;  1NWW A;  2ZHX B;  3V99 A;  2CWT A;  4KFD A;  3KE7 A;  2OQE C;  3WMD A;  3PYJ A;  2RSX A;  4KZ1 A;  1OF5 B;  4CPK A;  1UGI A;  1Q81 4;  1OHP A;  3HOH A;  4CDL A;  5IG4 A;  1VQO 3;  1YI2 3;  4O3V A;  1ZGX A;  1IYY A;  2OCT A;  2CG0 A;  3S29 A;  1J2B A;  1PFP A;  3BNB A;  1K9M 4;  4X2H A;  4GHO A;  1HYF A;  4HAA A;  3BNE A;  2WOH A;  3UB1 A;  4GB5 A;  1OAC A;  1YJN 3;  1IU7 A;  3FF2 A;  4HM4 B;  2ZA4 A;  2CFW A;  1Q42 A;  3DH2 A;  2V1L A;  3F7X A;  2XFS A;  1W01 A;  3X3Y A;  4DKI A;  4L7K A;  4LYL B;  1JRQ A;  2BO9 B;  3FLJ A;  1AVL A;  1WMO A;  1WTH A;  1JBS A;  2XR8 B;  1RCL A;  1ROV A;  3CNX A;  4R9L A;  1LNI A; 
#chains in the Genus database with same CATH homology
 3UNL A;  1G96 A;  3KN4 A;  4RZM A;  1U5O A;  3MG3 A;  4H3U A;  4I4K A;  1OPY A;  4R4K A;  3LT8 A;  1GD3 A;  4WHA A;  5STD A;  3OXA A;  3EC9 A;  5JBS A;  2E2T A;  1IK3 A;  3WOD G;  1DMN A;  4N6O B;  1W02 A;  3GZY B;  3CMA 3;  3NBB A;  2JQ5 A;  2C10 A;  4N3V A;  3GWR A;  1EG9 B;  4HM3 B;  3PS8 A;  2CK3 H;  4X2O A;  4FMA A;  4EV5 A;  3VGN A;  2P09 A;  4MEI A;  4OK0 A;  4HM6 B;  2XRX B;  5BVB A;  1TU5 A;  1L5G B;  2XSO B;  2QGU A;  3I56 3;  3CC4 3;  4J9A A;  1QAL A;  3NQY A;  3DMC A;  3UL5 A;  2W0Q A;  3M8C A;  3MPH A;  3SXX A;  4ZM8 A;  3HI7 A;  4HYZ A;  4QWT A;  2E2V A;  3PCS A;  1K8A 4;  3CCR 3;  2KRT A;  1VQL 3;  2CWU A;  3O8Y A;  2CWV A;  3G6E 3;  5DRE A;  2CFL A;  2K0M A;  2CH9 A;  3MG1 A;  4MMZ B;  2YFI B;  3KFQ C;  1MOL A;  3CCQ 3;  5DRV A;  5HGR A;  3ER7 A;  4N6U A;  4O2H A;  2BNG A;  3RGR A;  3A76 A;  3BLZ A;  4K61 A;  2P38 A;  3PCR A;  3CXC 2;  3FGY A;  2HMK B;  3N9H A;  2PNC A;  3CCM 3;  2P05 A;  2W6J H;  3X3X A;  3MHE A;  3ECF A;  3G0K A;  3GZB A;  4FR9 A;  1VQK 3;  1CEW I;  3EE1 A;  4LZI A;  2STD A;  2P0M A;  1JB5 A;  2XF3 A;  3FKA A;  3G4S 3;  2BMR B;  2MC8 A;  1FGM A;  1W7C A;  2GEX A;  1LNH A;  3K0Z A;  1A67 A;  2UX0 A;  1TFO A;  4LEH A;  3NQZ A;  3IPT A;  4HZB B;  4RBN A;  1W2Z A;  1CQS A;  3LZA A;  5EQL A;  3KSE D;  2IUJ A;  1OGZ A;  4O02 B;  3OWS A;  1JB4 A;  4IPB A;  2GEY A;  3B8L A;  3CCE 3;  2O3O A;  4FCM A;  5ELU A;  1O7W B;  1O7M B;  2BMQ B;  3AMO A;  3DGN A;  5EEO A;  3Q1C A;  4XBY A;  3KSP A;  4BTY A;  2ML5 A;  5AI1 A;  3NX0 A;  2BMO B;  4XBT A;  4KVH A;  4L8O A;  3D9R A;  4JRF A;  2FXT A;  1SIH A;  1IVX A;  1CYU A;  1OHO A;  5IEN A;  2FGT A;  5BXQ A;  1WMN A;  3JUO A;  4FMC A;  4J8T A;  2PZV A;  2K54 A;  4HZ9 B;  1ULI B;  1RKY A;  1EQK A;  1JN5 A;  4XB5 A;  3NM2 A;  1R4C A;  1KWI A;  5IG5 A;  2ML6 A;  1LOX A;  3IMA B;  1YJW 3;  3HII A;  1W6C A;  1K41 A;  3FG3 A;  3MKI A;  1VQ7 3;  3OX9 A;  5CF2 A;  1TFK A;  1D6Z A;  3F40 A;  1YIT 3;  3STD A;  1YGE A;  5AYR B;  4WWU C;  1SII A;  4NHF A;  4JF8 A;  5LC6 A;  1Q82 4;  2IUK A;  1VQ4 3;  3E99 A;  3LXU X;  5AYS C;  8CHO A;  3OW2 2;  1JN5 B;  3HZP A;  2Z7A A;  3KZT A;  1JV2 B;  1IQ8 A;  1M1K 4;  4R1K A;  1M90 4;  1Y4K A;  3JUQ A;  2C11 A;  3DM8 A;  4RNZ A;  2F98 A;  3G71 3;  1W6Y A;  2RFR A;  3I55 3;  4OUQ A;  3T8U A;  1PU4 A;  1OGX A;  2XGL A;  1TUH A;  3EN8 A;  1VQM 3;  1Q40 A;  1YJ9 3;  1TP6 A;  3G8Z A;  3FZW A;  2CG1 A;  5AIH A;  5KP4 A;  1N5P A;  4NRE A;  3DY5 A;  1QJG A;  3LML A;  2OTL 3;  1QVF 2;  3EJV A;  4IIA A;  1F8N A;  4FCZ A;  1T5Y A;  3T0U A;  1RRH A;  1GD4 A;  2JDI H;  3V98 A;  3NV0 A;  2Y74 A;  3ALA A;  1ISK A;  4AKY A;  4HKV B;  3EX9 A;  3HK4 A;  1GY5 A;  4EBG A;  5CXO A;  2GU3 A;  1VQ5 3;  2W04 A;  1HU9 A;  3FG1 A;  4HVN A;  1O7H B;  3RDE A;  4HM8 B;  5IG3 A;  4EC6 A;  1SPU A;  1MNL A;  3Q90 A;  2GXF A;  1IVU A;  3FSD A;  1Q40 B;  3GZR A;  4WP5 A;  5G2G A;  4FMD A;  4R80 A;  2CFD A;  3FF0 A;  4EXR A;  1VQ9 3;  2OQE A;  1FGR A;  3J7Y d;  1N8Q A;  4K1U A;  5IER A;  1RRL A;  3LOY A;  3UL6 A;  3VF1 A;  5IW9 A;  3GZX B;  2Z77 A;  3U1W A;  3X3Z A;  1IVW A;  3SX1 A;  1OH0 A;  2HMM B;  4N6L A;  4XBX A;  3NV0 B;  1D6Y A;  3CME 3;  1STF I;  4STD A;  4N6M A;  1Q86 4;  1AV4 A;  1OCV A;  2R4I A;  3G16 A;  2I9W A;  2B1X B;  3NM7 A;  1QMA A;  2F86 B;  2XFT A;  4FMB A;  4EV2 A;  4HBR A;  2HMJ B;  3WA3 A;  2FNQ A;  4XM4 A;  2HMO B;  1VZZ A;  2P0X A;  3LTC A;  3IJE B;  1EA2 A;  3PGB A;  1UI8 A;  3JUN A;  1IDP A;  3NUV A;  4LSO A;  2QA4 3;  5AEU B;  1UUV B;  1W4N A;  1WQL B;  2W9P A;  5ELJ A;  3F8X A;  2B24 B;  3CCJ 3;  5D83 A;  1JJ2 2;  4U13 A;  1OUN A;  3SLU A;  1D6U A;  2D42 A;  1VQ8 3;  2GBW B;  3VSY A;  1SQW A;  3H51 A;  5LC7 A;  2XH9 A;  3U97 A;  5D81 A;  1NU3 A;  2LQV A;  5EVH A;  2Z76 A;  2WOF A;  5FW5 A;  5A0O B;  1FUW A;  4MJD A;  3BNC A;  3SOA A;  4HM5 B;  3FG4 A;  3HX8 A;  3K63 A;  5JPP A;  4AKZ A;  5FGO A;  4H61 A;  1EKM A;  2BHM A;  3WOE B;  2M7O A;  3S27 A;  3EB8 A;  3D3L A;  4PEJ A;  1ZO2 A;  2CC3 A;  3MYT A;  1VQP 3;  4WFO A;  3OWY A;  1TIJ A;  3N8B A;  1YVB I;  2YX9 A;  1UI7 A;  1SJW A;  3AMO B;  3FCS B;  2INX A;  3QRD A;  3ROB A;  2QEX 3;  2RGQ A;  2IA7 A;  1IV9 A;  3CNM A;  3FH1 A;  5AEW B;  5IEO A;  2QIY A;  1ULJ B;  2LYX A;  2W2C A;  1KC8 4;  1K28 A;  3PZW A;  4KFF A;  3CPO A;  5CF1 A;  3F8H A;  1LXE A;  2HMN B;  1E3R A;  4K1V A;  1HKX A;  1JKG A;  1M9G A;  2D1W A;  3UJM A;  1KQS 2;  1NO3 A;  4HM1 B;  2WGO A;  1RJO A;  3CCV 3;  1OHS A;  1IVV A;  3EBT A;  4ORL A;  3CCS 3;  4TX4 A;  3CC7 3;  1QVG 2;  1A90 A;  3JUP A;  3S28 A;  5TGN A;  3NXJ A;  2W56 A;  3DGO A;  2CFG A;  2CHC A;  1GS3 A;  4HM0 B;  1JB2 A;  4HM2 B;  3Q2P A;  3X40 A;  3SVA A;  2RCD A;  6STD A;  2YFJ B;  4AEQ A;  1STD A;  1NJI 4;  3GRD A;  3K7C A;  1IQY A;  1KSI A;  2OWP A;  4R9K A;  3RGA A;  1LVN A;  1JKG B;  3F9S A;  2GU1 A;  3BB9 A;  5I97 A;  1IT7 A;  3SED A;  2YFL B;  4OVM A;  3GAX A;  3WA2 X;  3DGL A;  2E2U A;  1UW1 A;  1FGT A;  1IQX A;  3CPW 2;  1BUQ A;  3MSO A;  1IT8 A;  5CLK A;  2W56 B;  1VQ6 3;  3DZL A;  1W6G A;  3KII A;  2XSH B;  1N9E A;  5AIG A;  3CCL 3;  1W2B 2;  2CW9 A;  2MF7 A;  1O7P B;  1A2K A;  1JNQ A;  4IT7 A;  5KP1 A;  3K5T A;  2OOV C;  7STD A;  4WYK A;  4EYC A;  1YHQ 3;  1KD1 4;  3F14 A;  2KCD A;  4K90 B;  1US1 A;  3X42 A;  5AIF A;  2KXG A;  3EF8 A;  2GBX B;  1AR0 A;  1U8C B;  1NB5 I;  1Z1S A;  1ROA A;  2Z6B A;  4HM7 B;  2BT3 A;  2WO0 A;  1K73 4;  3K9M C;  3NBR A;  3NBJ A;  1GYB A;  1N5H A;  1ZX2 A;  1W5Z A;  3DGM A;  4GL6 A;  4CCV A;  2XEP A;  3B4O A;  2IMJ A;  2XGN A;  1S72 3;  2F99 A;  4WYK B;  1UUW B;  1GY6 A;  1O7N B;  1NDO B;  1V74 A;  4O8S A;  2ZL8 A;  3JVC A;  2W9Q A;  3X41 A;  1O7G B;  3JUM A;  2A15 A;  4LGQ A;  4G1M B;  3EQQ B;  4MMX B;  4Q53 A;  1C7H A;  4N6N B;  3LTD A;  3B7C A;  1DVC A;  3LT9 A;  3S67 A;  2OTJ 3;  1DYU A;  2O9U X;  1YIJ 3;  3WOF B;  3T8N A;  1N9J A;  3OV4 A;  1DVD A;  3F7S A;  5CK6 A;  5AII A;  3CU3 A;  1WNH A;  4FCJ A;  2L4V A;  2OOV A;  1FGQ A;  3KKG A;  1FA3 A;  5JPU A;  2HML B;  4L8P A;  1E97 A;  2Y73 A;  3HIG A;  3LTB A;  1QAK A;  4XDV A;  4LMI A;  3BND A;  4RNY A;  4XDW A;  3SOY A;  4BTW A;  5IG0 A;  1NB3 I;  3MG2 A;  1IV7 A;  3B4P A;  3DUK A;  3LYG A;  1ASK A;  3I0Y A;  2CKF B;  3EBY A;  3MWZ A;  2WGQ A;  1E3V A;  5D82 A;  1S5A A;  4BTX A;  1WMP A;  4HJL B;  2SBL A;  1M1X B;  1CYV A;  2CFK A;  3NHX A;  3L0R A;  3WDG B;  3N54 B;  2Q07 A;  1FGO A;  1OF5 A;  4MMY B;  3CCU 3;  4N6V 0;  1QAF A;  3S5C A;  3CD6 3;  3V92 A;  1Q7Y 4;  5IEP A;  2W03 A;  1A2V A;  3QK9 A;  3EHC A;  2ZDJ A;  1W00 A;  3H3H A;  3OWU A;  3CC2 3;  3PXM A;  4KFE A;  5IF6 A;  3LTA A;  3DXO A;  1GY7 A;  4N6T A;  2CIU A;  3LH4 A;  1AVK A;  1RN7 A;  3EN1 B;  1DMM A;  1N8R 4;  1DMQ A;  1VQN 3;  5KP3 A;  3TDG A;  1NWW A;  3V99 A;  2CWT A;  4KFD A;  3KE7 A;  2OQE C;  3WMD A;  3PYJ A;  2RSX A;  4KZ1 A;  1OF5 B;  1Q81 4;  1OHP A;  4CDL A;  5IG4 A;  1VQO 3;  1YI2 3;  4O3V A;  2OCT A;  2CG0 A;  3S29 A;  1J2B A;  1PFP A;  3BNB A;  1K9M 4;  4X2H A;  3BNE A;  2WOH A;  3UB1 A;  4GB5 A;  1OAC A;  1YJN 3;  1IU7 A;  3FF2 A;  4HM4 B;  2CFW A;  1Q42 A;  2V1L A;  3F7X A;  2XFS A;  1W01 A;  3X3Y A;  4L7K A;  1JRQ A;  2BO9 B;  3FLJ A;  1AVL A;  1WMO A;  1WTH A;  2XR8 B;  1ROV A;  3CNX A;  4R9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...