3DM8A

Crystal structure of putative isomerase from rhodopseudomonas palustris
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
135
structure length
135
Chain Sequence
MTEHSLWRFSRALHRALNDRQTEELATIIDDNIDWAIYGPIDMFPFFGARQGKAAVLEVCRQIADSVRIYRYHRESVMLGIDSAASMVRYSLTAAGTNRPISVRMALFTQFQNGRLTNLRMVLDTFDLVEQALGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Isomerase from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein RPA4348
total genus 44
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dm8A00
1UUWB 1O7GB 3GZBA 4K1VA 5D82A 1ZO2A 1ULJB 1W02A 3IPTA 1U5OA 4OUQA 2GBXB 3B4OA 2HMJB 3EQQB 4L8PA 3MG1A 3G8ZA 5KP1A 3NV0A 4FCMA 2PZVA 2YFIB 3K7CA 3H51A 1TP6A 3FLJA 3FSDA 1SJWA 5EVHA 5IG0A 3ROBA 5CF1A 1UUVB 1OHSA 5AI1A 4J8TA 2XSHB 2HMLB 3DMCA 1GYBA 1BUQA 2HMMB 3G16A 4PEJA 5IERA 5BVBA 1TUHA 3D9RA 3ER7A 2CKFB 3B4PA 3MKIA 3SOAA 3LZAA 3SEDA 3F40A 3MG2A 3DUKA 2I9WA 3HX8A 2STDA 4LEHA 3F7XA 3MYTA 4R9LA 1OUNA 3MHEA 1JN5B 1E97A 3EN1B 1IDPA 3E99A 5HGRA 1W01A 3RGRA 3CPOA 3KSPA 1EA2A 1Q40B 3JUNA 4L8OA 4WP5A 3B8LA 4XBXA 5IG3A 2B1XB 1OGXA 3FKAA 3EBYA 1QMAA 3KKGA 4X2OA 1DMMA 2RCDA 2Z77A 4HJLB 4XBYA 3HZPA 1AR0A 3OV4A 5AIGA 4HVNA 1JB2A 1O7WB 5DRVA 4L7KA 1A2KA 5KP3A 1ISKA 4HM6B 5BXQA 2A15A 1NWWA 1OH0A 5IEOA 1O7PB 1ZX2A 2XSOB 3FH1A 3VSYA 2HMNB 2CHCA 4HZ9B 4N3VA 3OWUA 4HM3B 5CF2A 4RZMA 5AIFA 3JUPA 5D83A 5IG5A 1STDA 3DXOA 2OWPA 5CK6A 2YFLB 3GZRA 3EHCA 4IIAA 1HKXA 2GBWB 3H3HA 3OWSA 1O7NB 4HM7B 2BMRB 4LMIA 4ORLA 4XDVA 3JUMA 5KP4A 1VZZA 1Q42A 1Z1SA 2HMKB 3CNXA 3DM8A 3GZXB 3MSOA 3NXJA 1JKGB 1O7MB 4HZBB 5AEUB 5JPPA 1NU3A 1ULIB 4HM8B 4WYKB 5CLKA 2F99A 3RGAA 3HK4A 3F8XA 1OHOA 1OPYA 3NM2A 4HM5B 4XM4A 3CU3A 4K1UA 3VGNA 3G0KA 2BMQB 3SOYA 1E3RA 1GY5A 1ASKA 5IENA 1C7HA 2HMOB 3FF2A 4R1KA 5G2GA 5STDA 4Q53A 1E3VA 3FF0A 4HM4B 2GEXA 1GY6A 1W00A 4R9KA 5IEPA 3NHXA 1JKGA 1WQLB 2W2CA 3S5CA 3DZLA 3FZWA 3EX9A 5D81A 8CHOA 3K0ZA 1OGZA 1OF5B 2Z76A 3F14A 3GZYB 4HM1B 5CXOA 5IG4A 5DREA 2F98A 3STDA 3UJMA 3JUQA 2XRXB 3BB9A 3NUVA 2UX0A 3EC9A 3NV0B 2INXA 2QIYA 3ECFA 3CNMA 3LYGA 3OWYA 4HM0B 4KVHA 1EG9B 2BMOB 2RGQA 4H3UA 5IF6A 3EN8A 3EJVA 1GS3A 3GRDA 1S5AA 3I0YA 3MG3A 1NDOB 3KZTA 4I4KA 4XDWA 2JQ5A 4HM2B 2GXFA 4GB5A 5FW5A 2QGUA 4MJDA 3OX9A 3JUOA 3FGYA 1OF5A 3B7CA 4LGQA 2GEYA 3NBRA 4OVMA 5AEWB 1K41A 3F8HA 7STDA 1DMNA 1OHPA 3T8NA 3WMDA 1W6YA 2BNGA 1JB4A 2B24B 4U13A 4WYKA 3T8UA 1JN5A 6STDA 2YFJB 4FCJA 1GY7A 4WWUC 4X2HA 1QJGA 1O7HB 2R4IA 3EF8A 4XBTA 2Z7AA 1Q40A 2XR8B 3OXAA 4HKVB 4CDLA 4J9AA 5AIHA 5JPUA 2RFRA 3UNLA 2F86B 3KE7A 1OCVA 1CQSA 5TGNA 2K54A 3BLZA 3A76A 5AIIA 4STDA 3M8CA 4XB5A 3F9SA 1DMQA 2IMJA 3Q90A 3EBTA 1JB5A 3GWRA 3F7SA
chains in the Genus database with same CATH superfamily
3GZBA 1ZO2A 3CC23 2GU1A 3MG1A 1W2B2 3G8ZA 5KP1A 4FCMA 4MMZB 4QWTA 1TP6A 3FLJA 3FSDA 4O02B 5IG0A 3T0UA 1MGRA 5M18A 1ZGXA 2KF4A 3LTDA 3D3LA 1BNRA 1YJ93 1RGGA 2CG1A 3NM7A 2OTJ3 4R4KA 1IQXA 1RJOA 3U1WA 1FGMA 1PFPA 3MPHA 1OACA 1FGQA 3LMLA 4LYLB 2OOVC 3F7XA 2CFWA 2L4VA 3MYTA 3VF1A 1OUNA 1KQS2 1YNVX 3CCS3 3DGLA 1BOXA 1D6YA 3Q3FA 1IDPA 1B21A 1B27A 1EA2A 4L8OA 1MWSA 3U97A 1UUGB 5IG3A 2Y74A 1N5PA 1QAFA 1RGFA 3PXMA 1FUWA 3NQYA 4XBYA 4EXRA 5IG5A 5AIGA 1Q814 1IK3A 1VQ43 1JB2A 1O7WB 1C54A 1MOLA 2CFDA 2CWUA 2FGTA 3HI7A 3NX0A 5BU4A 3WA3A 2A15A 1VQ83 4ILFA 2XSOB 1UI7A 1YHQ3 1FGOA 2W56A 2CHCA 4EV2A 2XGNA 1KSIA 5M19A 3CCU3 2YFLB 2Z6BA 1RHLA 3GZRA 1VQP3 2GBWB 2XH9A 4H61A 5GSPA 2BMRB 1JNQA 4LMIA 4ORLA 4XDVA 3CME3 4BL3A 3PCRA 4KFDA 3CNXA 2HMKB 5D82A 4KT3B 5ELUA 1T2IA 1JKGB 5AEUB 5CLKA 2OOVA 4HYZA 1YIT3 4WFOA 3HK4A 3NM2A 1OPYA 1T2HA 3G4S3 2W04A 1K9M4 4WHAA 1ASKA 3CPW2 1BNIA 2HMOB 3FF2A 5G2GA 4MMYB 1UCJA 1VQQA 4RNTA 1IQ8A 3NHXA 3S67A 1QVG2 3S5CA 1BRJA 2AAEA 8CHOA 2CWVA 2IUJA 2Z76A 2KXGA 1V57A 3BNBA 4BTWA 1UCKA 2H0HA 3BB9A 3NUVA 3EC9A 1D6UA 3EB8A 2RGQA 3N8BA 1BSAA 3X42A 1DETA 1ZS7A 2WOFA 4I4KA 2JQ5A 4IT7A 4HM2B 2GXFA 1VQK3 3CCV3 2QGUA 2SBLA 1LNIA 3JUOA 3FGYA 3D79A 3CCE3 3D5GA 3D5IA 1AV4A 2BT3A 4FMBA 1BNGA 2BU4A 3AHSA 4N6OB 3UL6A 3WMDA 4EC6A 1T3BA 2BNGA 2CH9A 1JBSA 3PCSA 4FCJA 3TDGA 1GY7A 4X2HA 1QJGA 2R4IA 3EF8A 1UGHI 2Z7AA 2WGOA 3OXAA 2OTL3 4K61A 2RFRA 2CWTA 4CPKA 1I2EA 1CQSA 1LVNA 4OK0A 3BLZA 5AIIA 3URPA 3V92A 1ROVA 3HIIA 1GD3A 2UUGC 2O9UX 3M8CA 1IYYA 2IUKA 3F9SA 2IMJA 2WGQA 3SYUA 3DGYA 3GWRA 2KRTA 2RNTA 3IPTA 2E2UA 4RNYA 5EQLA 1UCIA 1W2ZA 2GBXB 3J7Yd 3KSED 1EQKA 2H0GA 2L1SA 3GAXA 1VQ73 2O3OA 2YFIB 1RGKA 1RGEA 1W6CA 1VQL3 1M1K4 1MNLA 1D6ZA 1FGTA 1OHSA 4J8TA 3PZWA 1A90A 1HZ1A 2HMLB 3DMCA 1BUQA 3G713 3G16A 4PEJA 1TUHA 2J8XB 3D9RA 2CKFB 3B4PA 3ER7A 4MEIA 1UDII 3ZG0A 3LZAA 4N6LA 2XEPA 3SEDA 1NB5I 3MG2A 1NO3A 3Q2PA 1RN7A 4LEHA 2W03A 1Q7HA 1M904 1US1A 2BHMA 1PYLA 1LOVA 1JN5B 1N5HA 3MHEA 1IV7A 1E97A 5AYSC 3E99A 4N6V0 1W01A 4BTYA 3BNCA 1R4CA 3JUNA 4EV5A 4EW5A 6RNTA 3WDGB 4FMDA 4X2OA 3EBYA 1QMAA 1DMMA 2Z77A 1RGLA 1AR0A 1QALA 4J5KA 1ISKA 4GHOA 2IY2A 1NB3I 1TFOA 2W6JH 1BU4A 3FG4A 4R80A 5IEOA 1BSEA 5M1AA 1TJDA 7RNTA 1FW7A 3AMOB 2OWPA 3BIRA 2GU3A 4FCZA 3OWSA 2Q07A 5AEWB 1GMPA 1JZDA 4HM7B 5KP4A 3S28A 3JUMA 4BTXA 1Q42A 1VQ63 1Q9EA 3LOYA 1B2SA 3ZFZA 4HZBB 3OW22 1ULIB 3RGAA 4EYCA 3NBBA 1BSCA 3LTCA 3EE1A 1W4NA 4HM5B 4XM4A 1Q824 3Q1CA 1BSDA 2BMQB 3G0KA 3KN4A 3SOYA 1VQM3 4AEQA 1C7HA 2CK3H 4R1KA 1BRSA 2CG0A 3CCR3 1E3VA 1DE3A 3QK9A 1YVSA 1GY6A 5G1LA 1IU7A 2XGLA 3EX9A 5D81A 1MWUA 1IT7A 1OGZA 1OF5B 3GZYB 1UGIA 1IVXA 5CF2A 3UJMA 5JBSA 2XRXB 2QIYA 3OWYA 1EG9B 2BMOB 2ML5A 5IF6A 2WOHA 3EJVA 3EN8A 1TFKA 1NDOB 3KFQC 4FMCA 3K5TA 3NQZA 1K8A4 1R4YA 1WNHA 2C11A 5FW5A 3X3ZA 3KCHA 1RGHA 2AADA 4J5GA 3OX9A 3X40A 2W9QA 3ZG5A 2K3DA 3B7CA 1MGWA 3NBRA 1K41A 3FG3A 2CC3A 1RLSA 1TRQA 4K90B 3SXXA 2GSPA 1JB4A 1AVLA 1M1XB 1WMNA 4WYKA 4GL6A 1JN5A 1B2ZA 2YFJB 2LYXA 1I2GA 4WWUC 3N9HA 1O7HB 2QEX3 4AKYA 2XR8B 1LOXA 4NREA 4CDLA 1SQWA 5JPUA 3CCJ3 1Q7Y4 1BSBA 1LQGC 3FG1A 1BRHA 1LXEA 5TGNA 1N9EA 1RDSA 1LOWA 2K54A 2P38A 5AIFA 1CYUA 3DY5A 3A5EA 2CW9A 1Q864 4HAAA 1O7GB 1X1UA 2H0IA 4GSPA 1ULJB 1FA3A 4OUQA 4NPBA 2HMJB 3AMOA 1FGRA 4L8PA 1GSPA 3NV0A 1SARA 2PZVA 3K7CA 2P0MA 5EVHA 1SJWA 2RBIA 1W6GA 4O8SA 5AI1A 5ELJA 2D1WA 1GYBA 1RNTA 2BIRA 1IT8A 2HMMB 1FZUA 2UGIA 4MMXB 1RRLA 4CCVA 3RNTA 2E2VA 4DKIA 5BVBA 5IW9A 3X41A 3BNDA 1RGCA 1B2XA 3I563 2WO0A 1WMPA 1F8NA 2C10A 3ALAA 2I9WA 2Y73A 3HX8A 5LC7A 2F5WA 2STDA 3O8YA 4FMAA 6GSPA 4R9LA 1I0VA 1RTUA 3DH2A 4LZIA 1BUJA 1I3IA 1W5ZA 5HGRA 1N9JA 2ZDJA 3CPOA 1BAOA 2PNCA 3B8LA 2CFGA 4XBXA 2B1XB 4EBGA 5BIRA 3FKAA 3FCSB 5STDA 2M7OA 1BRIA 4HJLB 3HZPA 3OV4A 4O3VA 1BRKA 4HVNA 5DRVA 5KP3A 4L7KA 3BNEA 4CJNA 4HM6B 1WTHA 1NWWA 3S29A 1OH0A 4BU4A 1HU9A 1O7PB 1ZX2A 2CFKA 1QAKA 2P09A 3FH1A 4TX4A 1VQ53 4N3VA 3S27A 1CH0A 3WOFB 4RZMA 4RBNA 3WHOA 1PY3A 3QRDA 1BNEA 1RGAA 2F5MA 4IIAA 1RN4A 3T8UA 4RNZA 1O7NB 2LQVA 4KFEA 8RNTA 1N8R4 1B2MA 1VZZA 3GZXB 3DM8A 3CMA3 1BNSA 2FXTA 3K9MC 4ZM8A 1O7MB 3PYJA 2KAAA 4HM8B 4WYKB 2F99A 1QVF2 5RNTA 3WODG 3UB1A 3F8XA 1AVKA 2KCDA 1SPUA 3SX1A 1E3RA 1GY5A 1GMQA 3CC73 3CXC2 1JV2B 1GOUA 3RDEA 4Q53A 1BANA 4HM4B 4R9KA 1W00A 3BU4A 4LSOA 2IYJA 1JKGA 2XF3A 2XFSA 4JF8A 3K0ZA 3F14A 1HYFA 4HM1B 1K734 5IG4A 5DREA 3STDA 1J2BA 1BNJA 3JUQA 1IVUA 9RNTA 3NV0B 2F4YA 2INXA 3HOHA 3ECFA 3CNMA 3GSPA 3LYGA 1UCLA 1TRPA 2IA7A 4HM0B 1PU4A 3I0YA 4XDWA 1S5AA 3KZTA 3CCM3 3X3YA 3G6E3 1RCKA 3CC43 5EEOA 1YJN3 3NBJA 4MJDA 1STFI 5AYRB 3WA2X 1AQZA 1GOYA 4LGQA 1BRGA 2GEYA 2HOHA 4OVMA 1BIRA 3F8HA 1JBTA 1RNBA 1KD14 3L0RA 3T8NA 3LTAA 1W6YA 4IPBA 4U13A 2ZA4A 1TIJA 1N8QA 3LH4A 1I8VA 2ZL8A 3V99A 1A2VA 3AGOA 2KF6A 4J9AA 4O2HA 5FGOA 3UNLA 1RCLA 2F86B 3KE7A 2ML6A 1CYVA 2OCTA 1K28A 4STDA 5D83A 1EUIC 3DGOA 3V98A 1I3FA 4G1MB 3JVCA 1DYUA 3AGNA 1DMQA 4HZ9B 1V58A 1JB5A 1MWTA 1UW1A 1UUWB 3F7SA 5I97A 4K1VA 1VQN3 1W02A 1U5OA 1JJ22 3B4OA 1S723 3EQQB 3CCL3 1JRQA 1SIHA 1GMRA 1FYSA 1GD4A 1I0XA 1RN1A 2RSXA 3DGNA 3H51A 1VQO3 1NJI4 1VQ93 3ROBA 5CF1A 1UUVB 4N6UA 1KC84 1I2FA 2E2TA 1Y4KA 2XSHB 1FUSA 1BVIA 2C4BA 3LT8A 5IERA 4BL2A 3MKIA 3SLUA 3SOAA 3F40A 1LQMB 3DUKA 1EEJA 1KWIA 3WR2A 4I5QA 1A2PA 5G1KA 3D4AA 1W7CA 1G02A 1B2UA 1BNFA 3K63A 3EN1B 2W9PA 1BRNL 7GSPA 3RGRA 3KSPA 1YVBI 1IV9A 1Q40B 1GOVA 4WP5A 5A0OB 3LT9A 1OGXA 3SVAA 3KKGA 2CIUA 2RCDA 2F56A 2W0QA 1A2KA 1X1XA 3CCQ3 1IQYA 5BXQA 1JBRA 4HOHA 3N54B 2P0XA 1AY7A 3VSYA 2HMNB 1T5YA 1B3SA 3OWUA 2ZHXB 1B20A 2KF3A 3JUPA 1G0TA 4HM3B 4N6TA 1G96A 1STDA 2CX0A 2KF5A 3DXOA 5CK6A 1YIJ3 1A67A 3EHCA 1RSNA 1HKXA 3H3HA 6STDA 1IVWA 1Z1SA 3MSOA 3NXJA 1RRHA 5HOHA 1JZOA 5JPPA 1NU3A 3PS8A 1V74A 4AKZA 4KFFA 2YX9A 1M9GA 2JDIH 1OHOA 2CX1A 3CU3A 3PGBA 4K1UA 3VGNA 1U8CB 5IENA 5LC6A 3FF0A 5IEPA 2GEXA 1NNVA 2CFLA 3I553 1WQLB 1FUTA 2W2CA 4N6NB 2FNQA 3AHWA 2OQEC 3DZLA 3FZWA 1LNHA 3CD63 3LTBA 3MWZA 1CEWI 2K0MA 1X1YA 2F98A 3IJEB 1MWRA 2V1LA 1UI8A 3WOEB 2UX0A 4KVHA 1IVVA 4KZ1A 2SARA 4H3UA 3UL5A 3GRDA 1GS3A 1ROAA 3MG3A 1RMSA 2W56B 1L5GB 2P05A 4GB5A 1YI23 1TU5A 4JRFA 3X3XA 1OF5A 1LRAA 2XFTA 2OQEA 2MF7A 1EKMA 7STDA 1DMNA 1OHPA 2B24B 3HIGA 4HBRA 1WMOA 1YGEA 1LOYA 1RKYA 1YGWA 2R41A 4N6MA 1YJW3 1X1WA 4XBTA 1BGSA 1Q40A 3LXUX 4HKVB 3KIIA 1I70A 5AIHA 1DVDA 2MC8A 1OCVA 4BIRA 3IMAB 2BO9B 3A76A 2D42A 4NHFA 1SIIA 4FR9A 4XB5A 1DVCA 1TTOA 5CXOA 3Q90A 3DGMA 3EBTA 2QA43
chains in the Genus database with same CATH topology
3GZBA 1ZO2A 3CC23 2GU1A 3MG1A 1W2B2 3G8ZA 5KP1A 4FCMA 4MMZB 4QWTA 1TP6A 3FLJA 3FSDA 4O02B 5IG0A 3T0UA 3LTDA 3D3LA 2CG1A 3NM7A 2OTJ3 4R4KA 1IQXA 1RJOA 3U1WA 1FGMA 1PFPA 3MPHA 1OACA 1FGQA 3LMLA 2OOVC 3F7XA 2CFWA 2L4VA 3MYTA 3VF1A 1OUNA 1KQS2 3CCS3 3DGLA 1D6YA 1IDPA 1EA2A 4L8OA 3U97A 5IG3A 2Y74A 1N5PA 1QAFA 3PXMA 1FUWA 3NQYA 4XBYA 4EXRA 5IG5A 5AIGA 1Q814 1IK3A 1VQ43 1JB2A 1O7WB 1MOLA 2CFDA 2CWUA 2FGTA 3HI7A 3NX0A 3WA3A 1VQ83 2A15A 2XSOB 1UI7A 1YHQ3 1FGOA 2W56A 2CHCA 4EV2A 2XGNA 1KSIA 3CCU3 1VQP3 2YFLB 2Z6BA 3GZRA 2GBWB 2XH9A 4H61A 2BMRB 1JNQA 4LMIA 4ORLA 4XDVA 3CME3 3PCRA 4KFDA 3CNXA 2HMKB 5D82A 5ELUA 1JKGB 5AEUB 5CLKA 2OOVA 4HYZA 1YIT3 4WFOA 3HK4A 3NM2A 1OPYA 3G4S3 2W04A 1K9M4 4WHAA 1ASKA 3CPW2 2HMOB 3FF2A 5G2GA 4MMYB 1IQ8A 3NHXA 3S67A 1QVG2 3S5CA 8CHOA 2CWVA 2IUJA 2Z76A 2KXGA 3BNBA 4BTWA 3BB9A 3NUVA 3EC9A 1D6UA 3EB8A 2RGQA 3N8BA 3X42A 2WOFA 4I4KA 2JQ5A 4IT7A 4HM2B 2GXFA 1VQK3 3CCV3 2QGUA 2SBLA 3JUOA 3FGYA 3CCE3 1AV4A 2BT3A 4FMBA 4N6OB 3UL6A 3WMDA 4EC6A 2BNGA 2CH9A 3PCSA 4FCJA 3TDGA 1GY7A 4X2HA 1QJGA 2R4IA 3EF8A 2Z7AA 2WGOA 3OXAA 2OTL3 4K61A 2RFRA 2CWTA 1CQSA 1LVNA 3BLZA 5AIIA 3V92A 1ROVA 3HIIA 1GD3A 2O9UX 3M8CA 2IUKA 3F9SA 2IMJA 2WGQA 3GWRA 2KRTA 3IPTA 2E2UA 4RNYA 5EQLA 1W2ZA 3J7Yd 2GBXB 1EQKA 3KSED 3GAXA 1VQ73 2O3OA 2YFIB 1W6CA 1VQL3 1M1K4 1MNLA 1D6ZA 1FGTA 1OHSA 4J8TA 3PZWA 1A90A 2HMLB 3DMCA 1BUQA 3G713 3G16A 4PEJA 1TUHA 3D9RA 3ER7A 2CKFB 3B4PA 4MEIA 1NB5I 3LZAA 4N6LA 2XEPA 3SEDA 3MG2A 1NO3A 3Q2PA 1RN7A 4LEHA 2W03A 1M904 1US1A 2BHMA 3MHEA 1JN5B 1N5HA 1IV7A 1E97A 5AYSC 3E99A 4N6V0 1W01A 4BTYA 3BNCA 1R4CA 3JUNA 4EV5A 3WDGB 4FMDA 4X2OA 3EBYA 1QMAA 1DMMA 2Z77A 1AR0A 1QALA 1ISKA 1NB3I 1TFOA 2W6JH 5IEOA 3FG4A 4R80A 3AMOB 2OWPA 2GU3A 4FCZA 3OWSA 2Q07A 5AEWB 5KP4A 4HM7B 3S28A 3JUMA 4BTXA 1Q42A 1VQ63 3LOYA 4HZBB 3OW22 1ULIB 3RGAA 4EYCA 3NBBA 3LTCA 3EE1A 1W4NA 4HM5B 4XM4A 1Q824 3Q1CA 3G0KA 2BMQB 3KN4A 3SOYA 1VQM3 4AEQA 1C7HA 2CK3H 4R1KA 2CG0A 3CCR3 1E3VA 3QK9A 1GY6A 1IU7A 2XGLA 3EX9A 5D81A 1IT7A 1OGZA 1OF5B 3GZYB 1IVXA 5JBSA 3UJMA 2XRXB 2QIYA 3OWYA 1EG9B 2BMOB 2ML5A 5IF6A 2WOHA 3EJVA 3EN8A 1TFKA 1NDOB 3KFQC 4FMCA 3K5TA 3NQZA 1K8A4 1WNHA 2C11A 5FW5A 3X3ZA 3OX9A 3X40A 2W9QA 3B7CA 3NBRA 1K41A 3FG3A 2CC3A 4K90B 3SXXA 1JB4A 1AVLA 1M1XB 1WMNA 4WYKA 4GL6A 1JN5A 2YFJB 2LYXA 4WWUC 3N9HA 1O7HB 2QEX3 4AKYA 2XR8B 1LOXA 4NREA 4CDLA 1SQWA 5JPUA 3CCJ3 1Q7Y4 3FG1A 1LXEA 5TGNA 1N9EA 2K54A 1CYUA 2P38A 3DY5A 1Q864 2CW9A 1O7GB 1ULJB 1FA3A 4OUQA 2HMJB 3AMOA 1FGRA 4L8PA 3NV0A 2PZVA 3K7CA 2P0MA 5EVHA 1SJWA 1W6GA 4O8SA 5AI1A 5ELJA 2D1WA 1GYBA 1IT8A 2HMMB 4MMXB 4CCVA 1RRLA 5BVBA 2E2VA 5IW9A 3X41A 3BNDA 3I563 2WO0A 1WMPA 1F8NA 2C10A 3ALAA 2I9WA 2Y73A 3HX8A 5LC7A 2STDA 3O8YA 4FMAA 4R9LA 4LZIA 1W5ZA 5HGRA 1N9JA 2ZDJA 3CPOA 2PNCA 3B8LA 2CFGA 4XBXA 2B1XB 4EBGA 3FKAA 3FCSB 5STDA 2M7OA 4HJLB 4O3VA 3HZPA 3OV4A 5KP3A 4HVNA 5DRVA 4L7KA 3BNEA 4HM6B 1WTHA 1NWWA 3S29A 1OH0A 1YJ93 1HU9A 1O7PB 1ZX2A 2CFKA 1QAKA 2P09A 3FH1A 4TX4A 1VQ53 4N3VA 3S27A 3WOFB 4RZMA 4RBNA 3QRDA 4IIAA 3T8UA 1N8R4 4RNZA 1O7NB 2LQVA 4KFEA 1VZZA 3GZXB 3DM8A 3CMA3 4ZM8A 2FXTA 3K9MC 1O7MB 3PYJA 4HM8B 4WYKB 2F99A 1QVF2 3WODG 3UB1A 3F8XA 1AVKA 2KCDA 1SPUA 3SX1A 1E3RA 1GY5A 3CC73 3CXC2 1JV2B 3RDEA 4Q53A 4HM4B 4R9KA 1W00A 4LSOA 1JKGA 2XF3A 2XFSA 4JF8A 3K0ZA 3F14A 4HM1B 1K734 5IG4A 5DREA 3STDA 1J2BA 3JUQA 1IVUA 3NV0B 2INXA 3LYGA 3ECFA 3CNMA 4HM0B 2IA7A 1PU4A 3I0YA 4XDWA 1S5AA 3KZTA 3CCM3 3X3YA 3G6E3 3CC43 5EEOA 1YJN3 3NBJA 4MJDA 1STFI 5AYRB 3WA2X 4LGQA 2GEYA 4OVMA 3F8HA 1KD14 3L0RA 3T8NA 3LTAA 1W6YA 4IPBA 4U13A 1TIJA 1N8QA 3LH4A 2ZL8A 3V99A 1A2VA 4J9AA 4O2HA 5FGOA 3UNLA 2F86B 3KE7A 2ML6A 1CYVA 2OCTA 1K28A 4STDA 3V98A 3DGOA 4G1MB 3JVCA 1DYUA 1DMQA 4HZ9B 1JB5A 1UW1A 1UUWB 3F7SA 5I97A 4K1VA 1VQN3 1W02A 1U5OA 1JJ22 3B4OA 1S723 3EQQB 3CCL3 1JRQA 1SIHA 1GD4A 3DGNA 2RSXA 1VQO3 1NJI4 3H51A 1VQ93 3ROBA 5CF1A 1UUVB 4N6UA 1KC84 2E2TA 1Y4KA 2XSHB 3LT8A 5IERA 3MKIA 3SLUA 3SOAA 3F40A 3DUKA 1KWIA 1W7CA 3K63A 3EN1B 2W9PA 3RGRA 3KSPA 1YVBI 1IV9A 1Q40B 4WP5A 5A0OB 3LT9A 1OGXA 3SVAA 3KKGA 2CIUA 2RCDA 2W0QA 1A2KA 3CCQ3 1IQYA 5BXQA 3N54B 2P0XA 3VSYA 2HMNB 1T5YA 3OWUA 4HM3B 4N6TA 4OK0A 5AIFA 3JUPA 5D83A 5CF2A 1A67A 1G96A 1STDA 3DXOA 5CK6A 1YIJ3 3EHCA 1HKXA 3H3HA 6STDA 1IVWA 1Z1SA 3MSOA 3NXJA 1RRHA 5JPPA 1NU3A 3PS8A 1V74A 4AKZA 4KFFA 2YX9A 1M9GA 2JDIH 1OHOA 3CU3A 3PGBA 4K1UA 3VGNA 1U8CB 5IENA 5LC6A 3FF0A 5IEPA 2GEXA 2CFLA 3I553 1WQLB 2W2CA 4N6NB 2FNQA 2OQEC 3DZLA 3FZWA 1LNHA 3CD63 3LTBA 3MWZA 1CEWI 2K0MA 2F98A 3IJEB 2V1LA 1UI8A 3WOEB 2UX0A 4KVHA 1IVVA 4KZ1A 4H3UA 3UL5A 3GRDA 1GS3A 1ROAA 3MG3A 2W56B 1L5GB 2P05A 4GB5A 1YI23 1TU5A 4JRFA 3X3XA 1OF5A 2XFTA 2OQEA 2MF7A 1EKMA 7STDA 1DMNA 1OHPA 2B24B 3HIGA 4HBRA 1WMOA 1YGEA 1RKYA 4N6MA 1YJW3 4XBTA 1Q40A 3LXUX 4HKVB 3KIIA 5AIHA 1DVDA 2MC8A 1OCVA 3IMAB 2BO9B 3A76A 2D42A 4NHFA 1SIIA 4FR9A 4XB5A 1DVCA 5CXOA 3Q90A 3DGMA 3EBTA 2QA43
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUW B;  1O7G B;  3GZB A;  4K1V A;  5D82 A;  1ZO2 A;  1ULJ B;  1W02 A;  3IPT A;  1U5O A;  4OUQ A;  2GBX B;  3B4O A;  2HMJ B;  3EQQ B;  4L8P A;  3MG1 A;  3G8Z A;  5KP1 A;  3NV0 A;  4FCM A;  2PZV A;  2YFI B;  3K7C A;  3H51 A;  1TP6 A;  3FLJ A;  3FSD A;  1SJW A;  5EVH A;  5IG0 A;  3ROB A;  5CF1 A;  1UUV B;  1OHS A;  5AI1 A;  4J8T A;  2XSH B;  2HML B;  3DMC A;  1GYB A;  1BUQ A;  2HMM B;  3G16 A;  4PEJ A;  5IER A;  5BVB A;  1TUH A;  3D9R A;  3ER7 A;  2CKF B;  3B4P A;  3MKI A;  3SOA A;  3LZA A;  3SED A;  3F40 A;  3MG2 A;  3DUK A;  2I9W A;  3HX8 A;  2STD A;  4LEH A;  3F7X A;  3MYT A;  4R9L A;  1OUN A;  3MHE A;  1JN5 B;  1E97 A;  3EN1 B;  1IDP A;  3E99 A;  5HGR A;  1W01 A;  3RGR A;  3CPO A;  3KSP A;  1EA2 A;  1Q40 B;  3JUN A;  4L8O A;  4WP5 A;  3B8L A;  4XBX A;  5IG3 A;  2B1X B;  1OGX A;  3FKA A;  3EBY A;  1QMA A;  3KKG A;  4X2O A;  1DMM A;  2RCD A;  2Z77 A;  4HJL B;  4XBY A;  3HZP A;  1AR0 A;  3OV4 A;  5AIG A;  4HVN A;  1JB2 A;  1O7W B;  5DRV A;  4L7K A;  1A2K A;  5KP3 A;  1ISK A;  4HM6 B;  5BXQ A;  2A15 A;  1NWW A;  1OH0 A;  5IEO A;  1O7P B;  1ZX2 A;  2XSO B;  3FH1 A;  3VSY A;  2HMN B;  2CHC A;  4HZ9 B;  4N3V A;  3OWU A;  4HM3 B;  5CF2 A;  4RZM A;  5AIF A;  3JUP A;  5D83 A;  5IG5 A;  1STD A;  3DXO A;  2OWP A;  5CK6 A;  2YFL B;  3GZR A;  3EHC A;  4IIA A;  1HKX A;  2GBW B;  3H3H A;  3OWS A;  1O7N B;  4HM7 B;  2BMR B;  4LMI A;  4ORL A;  4XDV A;  3JUM A;  5KP4 A;  1VZZ A;  1Q42 A;  1Z1S A;  2HMK B;  3CNX A;  3DM8 A;  3GZX B;  3MSO A;  3NXJ A;  1JKG B;  1O7M B;  4HZB B;  5AEU B;  5JPP A;  1NU3 A;  1ULI B;  4HM8 B;  4WYK B;  5CLK A;  2F99 A;  3RGA A;  3HK4 A;  3F8X A;  1OHO A;  1OPY A;  3NM2 A;  4HM5 B;  4XM4 A;  3CU3 A;  4K1U A;  3VGN A;  3G0K A;  2BMQ B;  3SOY A;  1E3R A;  1GY5 A;  1ASK A;  5IEN A;  1C7H A;  2HMO B;  3FF2 A;  4R1K A;  5G2G A;  5STD A;  4Q53 A;  1E3V A;  3FF0 A;  4HM4 B;  2GEX A;  1GY6 A;  1W00 A;  4R9K A;  5IEP A;  3NHX A;  1JKG A;  1WQL B;  2W2C A;  3S5C A;  3DZL A;  3FZW A;  3EX9 A;  5D81 A;  8CHO A;  3K0Z A;  1OGZ A;  1OF5 B;  2Z76 A;  3F14 A;  3GZY B;  4HM1 B;  5CXO A;  5IG4 A;  5DRE A;  2F98 A;  3STD A;  3UJM A;  3JUQ A;  2XRX B;  3BB9 A;  3NUV A;  2UX0 A;  3EC9 A;  3NV0 B;  2INX A;  2QIY A;  3ECF A;  3CNM A;  3LYG A;  3OWY A;  4HM0 B;  4KVH A;  1EG9 B;  2BMO B;  2RGQ A;  4H3U A;  5IF6 A;  3EN8 A;  3EJV A;  1GS3 A;  3GRD A;  1S5A A;  3I0Y A;  3MG3 A;  1NDO B;  3KZT A;  4I4K A;  4XDW A;  2JQ5 A;  4HM2 B;  2GXF A;  4GB5 A;  5FW5 A;  2QGU A;  4MJD A;  3OX9 A;  3JUO A;  3FGY A;  1OF5 A;  3B7C A;  4LGQ A;  2GEY A;  3NBR A;  4OVM A;  5AEW B;  1K41 A;  3F8H A;  7STD A;  1DMN A;  1OHP A;  3T8N A;  3WMD A;  1W6Y A;  2BNG A;  1JB4 A;  2B24 B;  4U13 A;  4WYK A;  3T8U A;  1JN5 A;  6STD A;  2YFJ B;  4FCJ A;  1GY7 A;  4WWU C;  4X2H A;  1QJG A;  1O7H B;  2R4I A;  3EF8 A;  4XBT A;  2Z7A A;  1Q40 A;  2XR8 B;  3OXA A;  4HKV B;  4CDL A;  4J9A A;  5AIH A;  5JPU A;  2RFR A;  3UNL A;  2F86 B;  3KE7 A;  1OCV A;  1CQS A;  5TGN A;  2K54 A;  3BLZ A;  3A76 A;  5AII A;  4STD A;  3M8C A;  4XB5 A;  3F9S A;  1DMQ A;  2IMJ A;  3Q90 A;  3EBT A;  1JB5 A;  3GWR A;  3F7S A; 
#chains in the Genus database with same CATH topology
 3GZB A;  1ZO2 A;  3CC2 3;  2GU1 A;  3MG1 A;  1W2B 2;  3G8Z A;  5KP1 A;  4FCM A;  4MMZ B;  4QWT A;  1TP6 A;  3FLJ A;  3FSD A;  4O02 B;  5IG0 A;  3T0U A;  1MGR A;  5M18 A;  1ZGX A;  2KF4 A;  3LTD A;  3D3L A;  1BNR A;  1YJ9 3;  1RGG A;  2CG1 A;  3NM7 A;  2OTJ 3;  4R4K A;  1IQX A;  1RJO A;  3U1W A;  1FGM A;  1PFP A;  3MPH A;  1OAC A;  1FGQ A;  3LML A;  4LYL B;  2OOV C;  3F7X A;  2CFW A;  2L4V A;  3MYT A;  3VF1 A;  1OUN A;  1KQS 2;  1YNV X;  3CCS 3;  3DGL A;  1BOX A;  1D6Y A;  3Q3F A;  1IDP A;  1B21 A;  1B27 A;  1EA2 A;  4L8O A;  1MWS A;  3U97 A;  1UUG B;  5IG3 A;  2Y74 A;  1N5P A;  1QAF A;  1RGF A;  3PXM A;  1FUW A;  3NQY A;  4XBY A;  4EXR A;  5IG5 A;  5AIG A;  1Q81 4;  1IK3 A;  1VQ4 3;  1JB2 A;  1O7W B;  1C54 A;  1MOL A;  2CFD A;  2CWU A;  2FGT A;  3HI7 A;  3NX0 A;  5BU4 A;  3WA3 A;  2A15 A;  1VQ8 3;  4ILF A;  2XSO B;  1UI7 A;  1YHQ 3;  1FGO A;  2W56 A;  2CHC A;  4EV2 A;  2XGN A;  1KSI A;  5M19 A;  3CCU 3;  2YFL B;  2Z6B A;  1RHL A;  3GZR A;  1VQP 3;  2GBW B;  2XH9 A;  4H61 A;  5GSP A;  2BMR B;  1JNQ A;  4LMI A;  4ORL A;  4XDV A;  3CME 3;  4BL3 A;  3PCR A;  4KFD A;  3CNX A;  2HMK B;  5D82 A;  4KT3 B;  5ELU A;  1T2I A;  1JKG B;  5AEU B;  5CLK A;  2OOV A;  4HYZ A;  1YIT 3;  4WFO A;  3HK4 A;  3NM2 A;  1OPY A;  1T2H A;  3G4S 3;  2W04 A;  1K9M 4;  4WHA A;  1ASK A;  3CPW 2;  1BNI A;  2HMO B;  3FF2 A;  5G2G A;  4MMY B;  1UCJ A;  1VQQ A;  4RNT A;  1IQ8 A;  3NHX A;  3S67 A;  1QVG 2;  3S5C A;  1BRJ A;  2AAE A;  8CHO A;  2CWV A;  2IUJ A;  2Z76 A;  2KXG A;  1V57 A;  3BNB A;  4BTW A;  1UCK A;  2H0H A;  3BB9 A;  3NUV A;  3EC9 A;  1D6U A;  3EB8 A;  2RGQ A;  3N8B A;  1BSA A;  3X42 A;  1DET A;  1ZS7 A;  2WOF A;  4I4K A;  2JQ5 A;  4IT7 A;  4HM2 B;  2GXF A;  1VQK 3;  3CCV 3;  2QGU A;  2SBL A;  1LNI A;  3JUO A;  3FGY A;  3D79 A;  3CCE 3;  3D5G A;  3D5I A;  1AV4 A;  2BT3 A;  4FMB A;  1BNG A;  2BU4 A;  3AHS A;  4N6O B;  3UL6 A;  3WMD A;  4EC6 A;  1T3B A;  2BNG A;  2CH9 A;  1JBS A;  3PCS A;  4FCJ A;  3TDG A;  1GY7 A;  4X2H A;  1QJG A;  2R4I A;  3EF8 A;  1UGH I;  2Z7A A;  2WGO A;  3OXA A;  2OTL 3;  4K61 A;  2RFR A;  2CWT A;  4CPK A;  1I2E A;  1CQS A;  1LVN A;  4OK0 A;  3BLZ A;  5AII A;  3URP A;  3V92 A;  1ROV A;  3HII A;  1GD3 A;  2UUG C;  2O9U X;  3M8C A;  1IYY A;  2IUK A;  3F9S A;  2IMJ A;  2WGQ A;  3SYU A;  3DGY A;  3GWR A;  2KRT A;  2RNT A;  3IPT A;  2E2U A;  4RNY A;  5EQL A;  1UCI A;  1W2Z A;  2GBX B;  3J7Y d;  3KSE D;  1EQK A;  2H0G A;  2L1S A;  3GAX A;  1VQ7 3;  2O3O A;  2YFI B;  1RGK A;  1RGE A;  1W6C A;  1VQL 3;  1M1K 4;  1MNL A;  1D6Z A;  1FGT A;  1OHS A;  4J8T A;  3PZW A;  1A90 A;  1HZ1 A;  2HML B;  3DMC A;  1BUQ A;  3G71 3;  3G16 A;  4PEJ A;  1TUH A;  2J8X B;  3D9R A;  2CKF B;  3B4P A;  3ER7 A;  4MEI A;  1UDI I;  3ZG0 A;  3LZA A;  4N6L A;  2XEP A;  3SED A;  1NB5 I;  3MG2 A;  1NO3 A;  3Q2P A;  1RN7 A;  4LEH A;  2W03 A;  1Q7H A;  1M90 4;  1US1 A;  2BHM A;  1PYL A;  1LOV A;  1JN5 B;  1N5H A;  3MHE A;  1IV7 A;  1E97 A;  5AYS C;  3E99 A;  4N6V 0;  1W01 A;  4BTY A;  3BNC A;  1R4C A;  3JUN A;  4EV5 A;  4EW5 A;  6RNT A;  3WDG B;  4FMD A;  4X2O A;  3EBY A;  1QMA A;  1DMM A;  2Z77 A;  1RGL A;  1AR0 A;  1QAL A;  4J5K A;  1ISK A;  4GHO A;  2IY2 A;  1NB3 I;  1TFO A;  2W6J H;  1BU4 A;  3FG4 A;  4R80 A;  5IEO A;  1BSE A;  5M1A A;  1TJD A;  7RNT A;  1FW7 A;  3AMO B;  2OWP A;  3BIR A;  2GU3 A;  4FCZ A;  3OWS A;  2Q07 A;  5AEW B;  1GMP A;  1JZD A;  4HM7 B;  5KP4 A;  3S28 A;  3JUM A;  4BTX A;  1Q42 A;  1VQ6 3;  1Q9E A;  3LOY A;  1B2S A;  3ZFZ A;  4HZB B;  3OW2 2;  1ULI B;  3RGA A;  4EYC A;  3NBB A;  1BSC A;  3LTC A;  3EE1 A;  1W4N A;  4HM5 B;  4XM4 A;  1Q82 4;  3Q1C A;  1BSD A;  2BMQ B;  3G0K A;  3KN4 A;  3SOY A;  1VQM 3;  4AEQ A;  1C7H A;  2CK3 H;  4R1K A;  1BRS A;  2CG0 A;  3CCR 3;  1E3V A;  1DE3 A;  3QK9 A;  1YVS A;  1GY6 A;  5G1L A;  1IU7 A;  2XGL A;  3EX9 A;  5D81 A;  1MWU A;  1IT7 A;  1OGZ A;  1OF5 B;  3GZY B;  1UGI A;  1IVX A;  5CF2 A;  3UJM A;  5JBS A;  2XRX B;  2QIY A;  3OWY A;  1EG9 B;  2BMO B;  2ML5 A;  5IF6 A;  2WOH A;  3EJV A;  3EN8 A;  1TFK A;  1NDO B;  3KFQ C;  4FMC A;  3K5T A;  3NQZ A;  1K8A 4;  1R4Y A;  1WNH A;  2C11 A;  5FW5 A;  3X3Z A;  3KCH A;  1RGH A;  2AAD A;  4J5G A;  3OX9 A;  3X40 A;  2W9Q A;  3ZG5 A;  2K3D A;  3B7C A;  1MGW A;  3NBR A;  1K41 A;  3FG3 A;  2CC3 A;  1RLS A;  1TRQ A;  4K90 B;  3SXX A;  2GSP A;  1JB4 A;  1AVL A;  1M1X B;  1WMN A;  4WYK A;  4GL6 A;  1JN5 A;  1B2Z A;  2YFJ B;  2LYX A;  1I2G A;  4WWU C;  3N9H A;  1O7H B;  2QEX 3;  4AKY A;  2XR8 B;  1LOX A;  4NRE A;  4CDL A;  1SQW A;  5JPU A;  3CCJ 3;  1Q7Y 4;  1BSB A;  1LQG C;  3FG1 A;  1BRH A;  1LXE A;  5TGN A;  1N9E A;  1RDS A;  1LOW A;  2K54 A;  2P38 A;  5AIF A;  1CYU A;  3DY5 A;  3A5E A;  2CW9 A;  1Q86 4;  4HAA A;  1O7G B;  1X1U A;  2H0I A;  4GSP A;  1ULJ B;  1FA3 A;  4OUQ A;  4NPB A;  2HMJ B;  3AMO A;  1FGR A;  4L8P A;  1GSP A;  3NV0 A;  1SAR A;  2PZV A;  3K7C A;  2P0M A;  5EVH A;  1SJW A;  2RBI A;  1W6G A;  4O8S A;  5AI1 A;  5ELJ A;  2D1W A;  1GYB A;  1RNT A;  2BIR A;  1IT8 A;  2HMM B;  1FZU A;  2UGI A;  4MMX B;  1RRL A;  4CCV A;  3RNT A;  2E2V A;  4DKI A;  5BVB A;  5IW9 A;  3X41 A;  3BND A;  1RGC A;  1B2X A;  3I56 3;  2WO0 A;  1WMP A;  1F8N A;  2C10 A;  3ALA A;  2I9W A;  2Y73 A;  3HX8 A;  5LC7 A;  2F5W A;  2STD A;  3O8Y A;  4FMA A;  6GSP A;  4R9L A;  1I0V A;  1RTU A;  3DH2 A;  4LZI A;  1BUJ A;  1I3I A;  1W5Z A;  5HGR A;  1N9J A;  2ZDJ A;  3CPO A;  1BAO A;  2PNC A;  3B8L A;  2CFG A;  4XBX A;  2B1X B;  4EBG A;  5BIR A;  3FKA A;  3FCS B;  5STD A;  2M7O A;  1BRI A;  4HJL B;  3HZP A;  3OV4 A;  4O3V A;  1BRK A;  4HVN A;  5DRV A;  5KP3 A;  4L7K A;  3BNE A;  4CJN A;  4HM6 B;  1WTH A;  1NWW A;  3S29 A;  1OH0 A;  4BU4 A;  1HU9 A;  1O7P B;  1ZX2 A;  2CFK A;  1QAK A;  2P09 A;  3FH1 A;  4TX4 A;  1VQ5 3;  4N3V A;  3S27 A;  1CH0 A;  3WOF B;  4RZM A;  4RBN A;  3WHO A;  1PY3 A;  3QRD A;  1BNE A;  1RGA A;  2F5M A;  4IIA A;  1RN4 A;  3T8U A;  4RNZ A;  1O7N B;  2LQV A;  4KFE A;  8RNT A;  1N8R 4;  1B2M A;  1VZZ A;  3GZX B;  3DM8 A;  3CMA 3;  1BNS A;  2FXT A;  3K9M C;  4ZM8 A;  1O7M B;  3PYJ A;  2KAA A;  4HM8 B;  4WYK B;  2F99 A;  1QVF 2;  5RNT A;  3WOD G;  3UB1 A;  3F8X A;  1AVK A;  2KCD A;  1SPU A;  3SX1 A;  1E3R A;  1GY5 A;  1GMQ A;  3CC7 3;  3CXC 2;  1JV2 B;  1GOU A;  3RDE A;  4Q53 A;  1BAN A;  4HM4 B;  4R9K A;  1W00 A;  3BU4 A;  4LSO A;  2IYJ A;  1JKG A;  2XF3 A;  2XFS A;  4JF8 A;  3K0Z A;  3F14 A;  1HYF A;  4HM1 B;  1K73 4;  5IG4 A;  5DRE A;  3STD A;  1J2B A;  1BNJ A;  3JUQ A;  1IVU A;  9RNT A;  3NV0 B;  2F4Y A;  2INX A;  3HOH A;  3ECF A;  3CNM A;  3GSP A;  3LYG A;  1UCL A;  1TRP A;  2IA7 A;  4HM0 B;  1PU4 A;  3I0Y A;  4XDW A;  1S5A A;  3KZT A;  3CCM 3;  3X3Y A;  3G6E 3;  1RCK A;  3CC4 3;  5EEO A;  1YJN 3;  3NBJ A;  4MJD A;  1STF I;  5AYR B;  3WA2 X;  1AQZ A;  1GOY A;  4LGQ A;  1BRG A;  2GEY A;  2HOH A;  4OVM A;  1BIR A;  3F8H A;  1JBT A;  1RNB A;  1KD1 4;  3L0R A;  3T8N A;  3LTA A;  1W6Y A;  4IPB A;  4U13 A;  2ZA4 A;  1TIJ A;  1N8Q A;  3LH4 A;  1I8V A;  2ZL8 A;  3V99 A;  1A2V A;  3AGO A;  2KF6 A;  4J9A A;  4O2H A;  5FGO A;  3UNL A;  1RCL A;  2F86 B;  3KE7 A;  2ML6 A;  1CYV A;  2OCT A;  1K28 A;  4STD A;  5D83 A;  1EUI C;  3DGO A;  3V98 A;  1I3F A;  4G1M B;  3JVC A;  1DYU A;  3AGN A;  1DMQ A;  4HZ9 B;  1V58 A;  1JB5 A;  1MWT A;  1UW1 A;  1UUW B;  3F7S A;  5I97 A;  4K1V A;  1VQN 3;  1W02 A;  1U5O A;  1JJ2 2;  3B4O A;  1S72 3;  3EQQ B;  3CCL 3;  1JRQ A;  1SIH A;  1GMR A;  1FYS A;  1GD4 A;  1I0X A;  1RN1 A;  2RSX A;  3DGN A;  3H51 A;  1VQO 3;  1NJI 4;  1VQ9 3;  3ROB A;  5CF1 A;  1UUV B;  4N6U A;  1KC8 4;  1I2F A;  2E2T A;  1Y4K A;  2XSH B;  1FUS A;  1BVI A;  2C4B A;  3LT8 A;  5IER A;  4BL2 A;  3MKI A;  3SLU A;  3SOA A;  3F40 A;  1LQM B;  3DUK A;  1EEJ A;  1KWI A;  3WR2 A;  4I5Q A;  1A2P A;  5G1K A;  3D4A A;  1W7C A;  1G02 A;  1B2U A;  1BNF A;  3K63 A;  3EN1 B;  2W9P A;  1BRN L;  7GSP A;  3RGR A;  3KSP A;  1YVB I;  1IV9 A;  1Q40 B;  1GOV A;  4WP5 A;  5A0O B;  3LT9 A;  1OGX A;  3SVA A;  3KKG A;  2CIU A;  2RCD A;  2F56 A;  2W0Q A;  1A2K A;  1X1X A;  3CCQ 3;  1IQY A;  5BXQ A;  1JBR A;  4HOH A;  3N54 B;  2P0X A;  1AY7 A;  3VSY A;  2HMN B;  1T5Y A;  1B3S A;  3OWU A;  2ZHX B;  1B20 A;  2KF3 A;  3JUP A;  1G0T A;  4HM3 B;  4N6T A;  1G96 A;  1STD A;  2CX0 A;  2KF5 A;  3DXO A;  5CK6 A;  1YIJ 3;  1A67 A;  3EHC A;  1RSN A;  1HKX A;  3H3H A;  6STD A;  1IVW A;  1Z1S A;  3MSO A;  3NXJ A;  1RRH A;  5HOH A;  1JZO A;  5JPP A;  1NU3 A;  3PS8 A;  1V74 A;  4AKZ A;  4KFF A;  2YX9 A;  1M9G A;  2JDI H;  1OHO A;  2CX1 A;  3CU3 A;  3PGB A;  4K1U A;  3VGN A;  1U8C B;  5IEN A;  5LC6 A;  3FF0 A;  5IEP A;  2GEX A;  1NNV A;  2CFL A;  3I55 3;  1WQL B;  1FUT A;  2W2C A;  4N6N B;  2FNQ A;  3AHW A;  2OQE C;  3DZL A;  3FZW A;  1LNH A;  3CD6 3;  3LTB A;  3MWZ A;  1CEW I;  2K0M A;  1X1Y A;  2F98 A;  3IJE B;  1MWR A;  2V1L A;  1UI8 A;  3WOE B;  2UX0 A;  4KVH A;  1IVV A;  4KZ1 A;  2SAR A;  4H3U A;  3UL5 A;  3GRD A;  1GS3 A;  1ROA A;  3MG3 A;  1RMS A;  2W56 B;  1L5G B;  2P05 A;  4GB5 A;  1YI2 3;  1TU5 A;  4JRF A;  3X3X A;  1OF5 A;  1LRA A;  2XFT A;  2OQE A;  2MF7 A;  1EKM A;  7STD A;  1DMN A;  1OHP A;  2B24 B;  3HIG A;  4HBR A;  1WMO A;  1YGE A;  1LOY A;  1RKY A;  1YGW A;  2R41 A;  4N6M A;  1YJW 3;  1X1W A;  4XBT A;  1BGS A;  1Q40 A;  3LXU X;  4HKV B;  3KII A;  1I70 A;  5AIH A;  1DVD A;  2MC8 A;  1OCV A;  4BIR A;  3IMA B;  2BO9 B;  3A76 A;  2D42 A;  4NHF A;  1SII A;  4FR9 A;  4XB5 A;  1DVC A;  1TTO A;  5CXO A;  3Q90 A;  3DGM A;  3EBT A;  2QA4 3; 
#chains in the Genus database with same CATH homology
 3GZB A;  1ZO2 A;  3CC2 3;  2GU1 A;  3MG1 A;  1W2B 2;  3G8Z A;  5KP1 A;  4FCM A;  4MMZ B;  4QWT A;  1TP6 A;  3FLJ A;  3FSD A;  4O02 B;  5IG0 A;  3T0U A;  3LTD A;  3D3L A;  2CG1 A;  3NM7 A;  2OTJ 3;  4R4K A;  1IQX A;  1RJO A;  3U1W A;  1FGM A;  1PFP A;  3MPH A;  1OAC A;  1FGQ A;  3LML A;  2OOV C;  3F7X A;  2CFW A;  2L4V A;  3MYT A;  3VF1 A;  1OUN A;  1KQS 2;  3CCS 3;  3DGL A;  1D6Y A;  1IDP A;  1EA2 A;  4L8O A;  3U97 A;  5IG3 A;  2Y74 A;  1N5P A;  1QAF A;  3PXM A;  1FUW A;  3NQY A;  4XBY A;  4EXR A;  5IG5 A;  5AIG A;  1Q81 4;  1IK3 A;  1VQ4 3;  1JB2 A;  1O7W B;  1MOL A;  2CFD A;  2CWU A;  2FGT A;  3HI7 A;  3NX0 A;  3WA3 A;  1VQ8 3;  2A15 A;  2XSO B;  1UI7 A;  1YHQ 3;  1FGO A;  2W56 A;  2CHC A;  4EV2 A;  2XGN A;  1KSI A;  3CCU 3;  1VQP 3;  2YFL B;  2Z6B A;  3GZR A;  2GBW B;  2XH9 A;  4H61 A;  2BMR B;  1JNQ A;  4LMI A;  4ORL A;  4XDV A;  3CME 3;  3PCR A;  4KFD A;  3CNX A;  2HMK B;  5D82 A;  5ELU A;  1JKG B;  5AEU B;  5CLK A;  2OOV A;  4HYZ A;  1YIT 3;  4WFO A;  3HK4 A;  3NM2 A;  1OPY A;  3G4S 3;  2W04 A;  1K9M 4;  4WHA A;  1ASK A;  3CPW 2;  2HMO B;  3FF2 A;  5G2G A;  4MMY B;  1IQ8 A;  3NHX A;  3S67 A;  1QVG 2;  3S5C A;  8CHO A;  2CWV A;  2IUJ A;  2Z76 A;  2KXG A;  3BNB A;  4BTW A;  3BB9 A;  3NUV A;  3EC9 A;  1D6U A;  3EB8 A;  2RGQ A;  3N8B A;  3X42 A;  2WOF A;  4I4K A;  2JQ5 A;  4IT7 A;  4HM2 B;  2GXF A;  1VQK 3;  3CCV 3;  2QGU A;  2SBL A;  3JUO A;  3FGY A;  3CCE 3;  1AV4 A;  2BT3 A;  4FMB A;  4N6O B;  3UL6 A;  3WMD A;  4EC6 A;  2BNG A;  2CH9 A;  3PCS A;  4FCJ A;  3TDG A;  1GY7 A;  4X2H A;  1QJG A;  2R4I A;  3EF8 A;  2Z7A A;  2WGO A;  3OXA A;  2OTL 3;  4K61 A;  2RFR A;  2CWT A;  1CQS A;  1LVN A;  3BLZ A;  5AII A;  3V92 A;  1ROV A;  3HII A;  1GD3 A;  2O9U X;  3M8C A;  2IUK A;  3F9S A;  2IMJ A;  2WGQ A;  3GWR A;  2KRT A;  3IPT A;  2E2U A;  4RNY A;  5EQL A;  1W2Z A;  3J7Y d;  2GBX B;  1EQK A;  3KSE D;  3GAX A;  1VQ7 3;  2O3O A;  2YFI B;  1W6C A;  1VQL 3;  1M1K 4;  1MNL A;  1D6Z A;  1FGT A;  1OHS A;  4J8T A;  3PZW A;  1A90 A;  2HML B;  3DMC A;  1BUQ A;  3G71 3;  3G16 A;  4PEJ A;  1TUH A;  3D9R A;  3ER7 A;  2CKF B;  3B4P A;  4MEI A;  1NB5 I;  3LZA A;  4N6L A;  2XEP A;  3SED A;  3MG2 A;  1NO3 A;  3Q2P A;  1RN7 A;  4LEH A;  2W03 A;  1M90 4;  1US1 A;  2BHM A;  3MHE A;  1JN5 B;  1N5H A;  1IV7 A;  1E97 A;  5AYS C;  3E99 A;  4N6V 0;  1W01 A;  4BTY A;  3BNC A;  1R4C A;  3JUN A;  4EV5 A;  3WDG B;  4FMD A;  4X2O A;  3EBY A;  1QMA A;  1DMM A;  2Z77 A;  1AR0 A;  1QAL A;  1ISK A;  1NB3 I;  1TFO A;  2W6J H;  5IEO A;  3FG4 A;  4R80 A;  3AMO B;  2OWP A;  2GU3 A;  4FCZ A;  3OWS A;  2Q07 A;  5AEW B;  5KP4 A;  4HM7 B;  3S28 A;  3JUM A;  4BTX A;  1Q42 A;  1VQ6 3;  3LOY A;  4HZB B;  3OW2 2;  1ULI B;  3RGA A;  4EYC A;  3NBB A;  3LTC A;  3EE1 A;  1W4N A;  4HM5 B;  4XM4 A;  1Q82 4;  3Q1C A;  3G0K A;  2BMQ B;  3KN4 A;  3SOY A;  1VQM 3;  4AEQ A;  1C7H A;  2CK3 H;  4R1K A;  2CG0 A;  3CCR 3;  1E3V A;  3QK9 A;  1GY6 A;  1IU7 A;  2XGL A;  3EX9 A;  5D81 A;  1IT7 A;  1OGZ A;  1OF5 B;  3GZY B;  1IVX A;  5JBS A;  3UJM A;  2XRX B;  2QIY A;  3OWY A;  1EG9 B;  2BMO B;  2ML5 A;  5IF6 A;  2WOH A;  3EJV A;  3EN8 A;  1TFK A;  1NDO B;  3KFQ C;  4FMC A;  3K5T A;  3NQZ A;  1K8A 4;  1WNH A;  2C11 A;  5FW5 A;  3X3Z A;  3OX9 A;  3X40 A;  2W9Q A;  3B7C A;  3NBR A;  1K41 A;  3FG3 A;  2CC3 A;  4K90 B;  3SXX A;  1JB4 A;  1AVL A;  1M1X B;  1WMN A;  4WYK A;  4GL6 A;  1JN5 A;  2YFJ B;  2LYX A;  4WWU C;  3N9H A;  1O7H B;  2QEX 3;  4AKY A;  2XR8 B;  1LOX A;  4NRE A;  4CDL A;  1SQW A;  5JPU A;  3CCJ 3;  1Q7Y 4;  3FG1 A;  1LXE A;  5TGN A;  1N9E A;  2K54 A;  1CYU A;  2P38 A;  3DY5 A;  1Q86 4;  2CW9 A;  1O7G B;  1ULJ B;  1FA3 A;  4OUQ A;  2HMJ B;  3AMO A;  1FGR A;  4L8P A;  3NV0 A;  2PZV A;  3K7C A;  2P0M A;  5EVH A;  1SJW A;  1W6G A;  4O8S A;  5AI1 A;  5ELJ A;  2D1W A;  1GYB A;  1IT8 A;  2HMM B;  4MMX B;  4CCV A;  1RRL A;  5BVB A;  2E2V A;  5IW9 A;  3X41 A;  3BND A;  3I56 3;  2WO0 A;  1WMP A;  1F8N A;  2C10 A;  3ALA A;  2I9W A;  2Y73 A;  3HX8 A;  5LC7 A;  2STD A;  3O8Y A;  4FMA A;  4R9L A;  4LZI A;  1W5Z A;  5HGR A;  1N9J A;  2ZDJ A;  3CPO A;  2PNC A;  3B8L A;  2CFG A;  4XBX A;  2B1X B;  4EBG A;  3FKA A;  3FCS B;  5STD A;  2M7O A;  4HJL B;  4O3V A;  3HZP A;  3OV4 A;  5KP3 A;  4HVN A;  5DRV A;  4L7K A;  3BNE A;  4HM6 B;  1WTH A;  1NWW A;  3S29 A;  1OH0 A;  1YJ9 3;  1HU9 A;  1O7P B;  1ZX2 A;  2CFK A;  1QAK A;  2P09 A;  3FH1 A;  4TX4 A;  1VQ5 3;  4N3V A;  3S27 A;  3WOF B;  4RZM A;  4RBN A;  3QRD A;  4IIA A;  3T8U A;  1N8R 4;  4RNZ A;  1O7N B;  2LQV A;  4KFE A;  1VZZ A;  3GZX B;  3DM8 A;  3CMA 3;  4ZM8 A;  2FXT A;  3K9M C;  1O7M B;  3PYJ A;  4HM8 B;  4WYK B;  2F99 A;  1QVF 2;  3WOD G;  3UB1 A;  3F8X A;  1AVK A;  2KCD A;  1SPU A;  3SX1 A;  1E3R A;  1GY5 A;  3CC7 3;  3CXC 2;  1JV2 B;  3RDE A;  4Q53 A;  4HM4 B;  4R9K A;  1W00 A;  4LSO A;  1JKG A;  2XF3 A;  2XFS A;  4JF8 A;  3K0Z A;  3F14 A;  4HM1 B;  1K73 4;  5IG4 A;  5DRE A;  3STD A;  1J2B A;  3JUQ A;  1IVU A;  3NV0 B;  2INX A;  3LYG A;  3ECF A;  3CNM A;  4HM0 B;  2IA7 A;  1PU4 A;  3I0Y A;  4XDW A;  1S5A A;  3KZT A;  3CCM 3;  3X3Y A;  3G6E 3;  3CC4 3;  5EEO A;  1YJN 3;  3NBJ A;  4MJD A;  1STF I;  5AYR B;  3WA2 X;  4LGQ A;  2GEY A;  4OVM A;  3F8H A;  1KD1 4;  3L0R A;  3T8N A;  3LTA A;  1W6Y A;  4IPB A;  4U13 A;  1TIJ A;  1N8Q A;  3LH4 A;  2ZL8 A;  3V99 A;  1A2V A;  4J9A A;  4O2H A;  5FGO A;  3UNL A;  2F86 B;  3KE7 A;  2ML6 A;  1CYV A;  2OCT A;  1K28 A;  4STD A;  3V98 A;  3DGO A;  4G1M B;  3JVC A;  1DYU A;  1DMQ A;  4HZ9 B;  1JB5 A;  1UW1 A;  1UUW B;  3F7S A;  5I97 A;  4K1V A;  1VQN 3;  1W02 A;  1U5O A;  1JJ2 2;  3B4O A;  1S72 3;  3EQQ B;  3CCL 3;  1JRQ A;  1SIH A;  1GD4 A;  3DGN A;  2RSX A;  1VQO 3;  1NJI 4;  3H51 A;  1VQ9 3;  3ROB A;  5CF1 A;  1UUV B;  4N6U A;  1KC8 4;  2E2T A;  1Y4K A;  2XSH B;  3LT8 A;  5IER A;  3MKI A;  3SLU A;  3SOA A;  3F40 A;  3DUK A;  1KWI A;  1W7C A;  3K63 A;  3EN1 B;  2W9P A;  3RGR A;  3KSP A;  1YVB I;  1IV9 A;  1Q40 B;  4WP5 A;  5A0O B;  3LT9 A;  1OGX A;  3SVA A;  3KKG A;  2CIU A;  2RCD A;  2W0Q A;  1A2K A;  3CCQ 3;  1IQY A;  5BXQ A;  3N54 B;  2P0X A;  3VSY A;  2HMN B;  1T5Y A;  3OWU A;  4HM3 B;  4N6T A;  4OK0 A;  5AIF A;  3JUP A;  5D83 A;  5CF2 A;  1A67 A;  1G96 A;  1STD A;  3DXO A;  5CK6 A;  1YIJ 3;  3EHC A;  1HKX A;  3H3H A;  6STD A;  1IVW A;  1Z1S A;  3MSO A;  3NXJ A;  1RRH A;  5JPP A;  1NU3 A;  3PS8 A;  1V74 A;  4AKZ A;  4KFF A;  2YX9 A;  1M9G A;  2JDI H;  1OHO A;  3CU3 A;  3PGB A;  4K1U A;  3VGN A;  1U8C B;  5IEN A;  5LC6 A;  3FF0 A;  5IEP A;  2GEX A;  2CFL A;  3I55 3;  1WQL B;  2W2C A;  4N6N B;  2FNQ A;  2OQE C;  3DZL A;  3FZW A;  1LNH A;  3CD6 3;  3LTB A;  3MWZ A;  1CEW I;  2K0M A;  2F98 A;  3IJE B;  2V1L A;  1UI8 A;  3WOE B;  2UX0 A;  4KVH A;  1IVV A;  4KZ1 A;  4H3U A;  3UL5 A;  3GRD A;  1GS3 A;  1ROA A;  3MG3 A;  2W56 B;  1L5G B;  2P05 A;  4GB5 A;  1YI2 3;  1TU5 A;  4JRF A;  3X3X A;  1OF5 A;  2XFT A;  2OQE A;  2MF7 A;  1EKM A;  7STD A;  1DMN A;  1OHP A;  2B24 B;  3HIG A;  4HBR A;  1WMO A;  1YGE A;  1RKY A;  4N6M A;  1YJW 3;  4XBT A;  1Q40 A;  3LXU X;  4HKV B;  3KII A;  5AIH A;  1DVD A;  2MC8 A;  1OCV A;  3IMA B;  2BO9 B;  3A76 A;  2D42 A;  4NHF A;  1SII A;  4FR9 A;  4XB5 A;  1DVC A;  5CXO A;  3Q90 A;  3DGM A;  3EBT A;  2QA4 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...