3DM8A

Crystal structure of putative isomerase from rhodopseudomonas palustris
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
135
structure length
135
Chain Sequence
MTEHSLWRFSRALHRALNDRQTEELATIIDDNIDWAIYGPIDMFPFFGARQGKAAVLEVCRQIADSVRIYRYHRESVMLGIDSAASMVRYSLTAAGTNRPISVRMALFTQFQNGRLTNLRMVLDTFDLVEQALGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein RPA4348
publication title Crystal Structure of Putative Isomerase from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
total genus 44
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dm8A00
5CXOA 2A15A 4XBTA 5AEWB 3OV4A 1OF5B 3CU3A 1GY6A 5CF1A 2RGQA 1OGZA 1JKGB 4HZBB 1OH0A 1STDA 4GB5A 3F9SA 4K1VA 1JN5B 3B8LA 1UUVB 5G2GA 1O7HB 3EQQB 3NUVA 4MJDA 3DXOA 3JUQA 4IIAA 1GY5A 2GBWB 1O7MB 3H51A 5AEUB 3GZXB 1JN5A 3B7CA 4WYKB 2Z76A 4FCMA 3ROBA 5CK6A 2YFLB 3F7SA 3MHEA 4X2HA 5AIIA 4LMIA 3FF0A 3OWUA 3UNLA 2XR8B 2BMOB 5IENA 3FKAA 4PEJA 2R4IA 4R9LA 1E3RA 3NV0A 3DZLA 3MKIA 2BMRB 3DMCA 5FW5A 3E99A 1SJWA 5KP4A 4HM6B 1OCVA 3JUNA 2HMNB 3NHXA 3SOYA 1ULJB 2GEYA 2Z77A 3EN8A 1Z1SA 1TP6A 1Q42A 3ECFA 2BNGA 5IEOA 2STDA 3KZTA 2JQ5A 3JUMA 3JUOA 2INXA 1OHPA 1DMQA 3FLJA 8CHOA 3FZWA 1JB5A 4Q53A 1GS3A 3T8NA 3UJMA 1ISKA 1OHSA 3EC9A 5HGRA 3G8ZA 5EVHA 3OWYA 5D83A 3DM8A 1OF5A 5CF2A 1DMNA 3EBYA 2Z7AA 3F7XA 1JKGA 2UX0A 4I4KA 1VZZA 4L7KA 1ZO2A 1Q40B 1OHOA 2CKFB 2F99A 3HZPA 4WWUC 3LZAA 2IMJA 4XM4A 5AI1A 3VSYA 2YFJB 3F40A 5KP1A 3GRDA 3FGYA 1AR0A 2RCDA 4L8PA 3KSPA 1EA2A 3NM2A 3K7CA 2XRXB 4XBYA 1EG9B 4LEHA 3FH1A 3MG3A 4HM2B 4J9AA 2RFRA 5D82A 1UUWB 4WYKA 3MYTA 5AIGA 3EJVA 1S5AA 1W6YA 5IF6A 1ULIB 5DREA 4R1KA 1WQLB 1OUNA 3OX9A 3T8UA 5AIHA 4WP5A 1E3VA 4LGQA 4XB5A 1BUQA 3HX8A 3CNXA 4HZ9B 3WMDA 3JUPA 2I9WA 2PZVA 1NWWA 2GXFA 2HMLB 4OVMA 2QIYA 2W2CA 4H3UA 3EBTA 1CQSA 3K0ZA 3GZBA 3KKGA 2F86B 4HM3B 1O7WB 3HK4A 5IG3A 3BLZA 1NDOB 3M8CA 5KP3A 1DMMA 1O7NB 3G0KA 1NU3A 5D81A 4HVNA 2B24B 3MSOA 3H3HA 2HMOB 4HM1B 7STDA 3FF2A 5IG5A 2K54A 2F98A 1K41A 4HM0B 4FCJA 1W00A 4KVHA 3ER7A 3SEDA 1GY7A 3B4OA 4HM8B 3Q90A 4HM4B 5JPUA 3F8XA 2XSOB 3F8HA 3GZRA 4XDVA 4HKVB 3BB9A 3D9RA 2YFIB 5DRVA 3GWRA 3S5CA 3LYGA 3EHCA 4RZMA 4X2OA 2HMKB 1JB4A 3FSDA 3B4PA 3F14A 3GZYB 4HM5B 1JB2A 5BVBA 3NXJA 5CLKA 3VGNA 3MG1A 1IDPA 4XDWA 1Q40A 1GYBA 3OXAA 4L8OA 1ZX2A 3G16A 2QGUA 3IPTA 4K1UA 4OUQA 2HMMB 3OWSA 3RGAA 5IERA 6STDA 4HM7B 4ORLA 2CHCA 3NV0B 4XBXA 1W01A 1A2KA 1QJGA 5STDA 5AIFA 1O7PB 3KE7A 5IG0A 1C7HA 4N3VA 3I0YA 5JPPA 3EN1B 3RGRA 3EX9A 1HKXA 2BMQB 1ASKA 4U13A 1OPYA 2HMJB 3A76A 1QMAA 4STDA 2GEXA 5IEPA 3STDA 3SOAA 3CNMA 2OWPA 5IG4A 1OGXA 4CDLA 3CPOA 2B1XB 2XSHB 3NBRA 3DUKA 4HJLB 1W02A 3MG2A 5BXQA 5TGNA 1O7GB 1TUHA 4J8TA 2GBXB 1U5OA 4R9KA 1E97A 3EF8A
chains in the Genus database with same CATH superfamily
5CXOA 3IJEB 2L1SA 2A15A 4XBTA 4EC6A 1MWRA 5AEWB 3OV4A 1OF5B 3BNCA 3CU3A 1GY6A 4RBNA 5CF1A 1K8A4 2OQEA 2RGQA 3WOFB 1OGZA 1JKGB 1ROAA 1V57A 1YGWA 3BIRA 4NPBA 1KD14 3CD63 1LVNA 3LH4A 3SLUA 3WDGB 9RNTA 1UGIA 3AHSA 1OH0A 2K3DA 2O9UX 1FYSA 3JVCA 4HZBB 1X1UA 1WMNA 1STDA 4GB5A 3F9SA 5ELJA 4HOHA 4K1VA 3U97A 4CCVA 2ML6A 1W7CA 1UCLA 1JN5B 3B8LA 1N9EA 1D6YA 1UUVB 1GD4A 2W56B 1WMOA 4MMXB 5G2GA 3LXUX 1W2B2 1O7HB 3EQQB 4HYZA 1VQ43 3NUVA 4MJDA 3DXOA 1BSAA 2CH9A 1YJW3 1TU5A 1EQKA 1BAOA 2CFGA 3JUQA 2CC3A 3NM7A 1LRAA 2OOVC 4IIAA 1BNIA 1GY5A 2GBWB 3CCV3 1SIHA 1O7MB 3H51A 2F5MA 1JBTA 2M7OA 3UL6A 3CCQ3 1UGHI 1V58A 5AEUB 2SARA 1KSIA 3GZXB 5RNTA 2XH9A 1BOXA 1FZUA 1NNVA 5M18A 1JN5A 3G6E3 3B7CA 1M904 3BU4A 2W56A 3LTAA 5ELUA 5EQLA 7GSPA 1BGSA 1FGQA 4BTYA 4WYKB 2Z76A 1A2PA 4FCMA 2CK3H 2Q07A 5LC7A 1N8R4 1VQM3 1ZGXA 1CEWI 2R41A 2KF6A 3ROBA 1V74A 5CK6A 4MMZB 1B20A 1T3BA 1C54A 1T2IA 2JDIH 2YFLB 1VQ83 3F7SA 4N6NB 4CPKA 3MHEA 4X2HA 3CCS3 4J5KA 1CH0A 1G02A 3DGYA 1LXEA 1JRQA 3D79A 1TTOA 1IV7A 1FUSA 1CYVA 3K63A 3NQYA 1BRSA 2P09A 5AIIA 1BNGA 1N5HA 1BRGA 3A5EA 4LMIA 1YGEA 1B2SA 2CX1A 3FF0A 3FG3A 1EUIC 1WMPA 1WNHA 1MWUA 2CFLA 1FA3A 3ZFZA 3OWUA 1YIT3 1U8CB 1R4CA 2E2UA 2H0HA 1X1YA 3UNLA 4NHFA 2XR8B 2BMOB 4KZ1A 3Q1CA 5IENA 1UW1A 3ZG5A 3FKAA 4GL6A 1Q7Y4 2R4IA 1NB3I 4LZIA 4PEJA 3SX1A 1I2GA 1HYFA 1BRKA 1S723 1MWTA 4N6MA 4R9LA 1E3RA 4EXRA 3NV0A 2XEPA 1KC84 3DZLA 3MKIA 4RNZA 2BMRB 3DMCA 3Q3FA 5FW5A 2H0GA 2RSXA 2Y73A 3E99A 1LQGC 1MOLA 1N9JA 1SJWA 2P0XA 4HM6B 1OCVA 4JRFA 3JUNA 5KP4A 2CX0A 2HMNB 3NHXA 3SOYA 1ULJB 3GSPA 1IVUA 3G4S3 2GEYA 3BNBA 1YI23 3WHOA 2Z77A 1GMQA 1JBSA 3EN8A 4FCZA 1Z1SA 2H0IA 1TP6A 1LNIA 1Q42A 3ECFA 1RGFA 2BNGA 4I5QA 5IEOA 2J8XB 2STDA 2CWVA 3DH2A 2IUJA 3S29A 3WR2A 4BIRA 3KZTA 3X40A 4EBGA 3G713 1IQ8A 2JQ5A 3OW22 1RCLA 2V1LA 3JUOA 2ZL8A 3JUMA 1US1A 1SARA 2INXA 1RHLA 3D5IA 3SYUA 1HU9A 1OHPA 1AY7A 1DMQA 1VQ63 3QK9A 3FLJA 2IY2A 2GSPA 8CHOA 2CWTA 2RBIA 4AKZA 2UUGC 2OCTA 3WA3A 1UCIA 3FZWA 1JB5A 1VQO3 1QVG2 3HIIA 3V98A 1MGRA 1GS3A 2FNQA 1SPUA 3AHWA 1JNQA 4Q53A 3T8NA 1FGMA 3DGMA 3UJMA 1VQ73 1RGGA 1ISKA 1OHSA 3EC9A 5HGRA 3G8ZA 3KSED 2CW9A 5EVHA 1B27A 3OWYA 5D83A 1IU7A 1RRLA 4BTWA 4J5GA 4N6OB 1Y4KA 2IUKA 1QAFA 1LQMB 1GMRA 3HIGA 1YVSA 3DM8A 3K9MC 2XGNA 5HOHA 2D1WA 1OF5A 4HBRA 1X1WA 3RNTA 2IA7A 1DMNA 5CF2A 1GD3A 1RN1A 3EBYA 2Z7AA 3KIIA 3F7XA 4G1MB 1JKGA 1LNHA 1RCKA 3DGOA 4AEQA 1VQP3 3CC73 1BNFA 2W9QA 2UX0A 1RSNA 2W03A 1VZZA 4I4KA 5I97A 4FMDA 1LOWA 2MF7A 4BTXA 4L7KA 2WOFA 3LT9A 1ZO2A 4CJNA 2FGTA 3NBBA 1VQL3 1Q40B 1N8QA 1A2VA 1BANA 1OHOA 1RDSA 3LTBA 2CKFB 4O02B 4MEIA 1EEJA 2F99A 3HZPA 3KN4A 3UL5A 3V92A 3WODG 3KFQC 1G96A 3VF1A 1M1XB 1YVBI 1RKYA 4WWUC 3LOYA 3I553 3CXC2 3LZAA 1HZ1A 2IMJA 1BNSA 4XM4A 5AI1A 2YFJB 3VSYA 1AQZA 3F40A 1BNRA 2KCDA 5KP1A 4LYLB 3HOHA 3GRDA 3NQZA 3FGYA 1AR0A 5BU4A 4IPBA 2W0QA 1RGHA 2ZDJA 2RCDA 3CC23 1W6CA 4L8PA 3LTCA 1AVKA 2WO0A 5AYRB 1I3FA 1KQS2 1PU4A 3KSPA 1EA2A 1A67A 3GAXA 3S28A 3NM2A 1G0TA 3X3ZA 4BL3A 3K7CA 2XRXB 3CPW2 1MNLA 2E2VA 2OQEC 4XBYA 1EG9B 4LEHA 3FG4A 4KFEA 1L5GB 3FH1A 3MG3A 3D3LA 4HM2B 2MC8A 1GMPA 4J9AA 1R4YA 1BSDA 1M1K4 3EB8A 2XFTA 2RFRA 2KF4A 3D5GA 5D82A 1UUWB 1VQQA 2CG0A 4WYKA 1I3IA 3MYTA 3RDEA 5AIGA 1JZOA 1IVVA 3DGLA 3EJVA 3PXMA 1S5AA 2K0MA 2ML5A 1J2BA 1W6YA 5IF6A 1YIJ3 1ULIB 1VQ93 1FGRA 5DREA 4R1KA 2P38A 1WQLB 3FG1A 1OUNA 5GSPA 1BUJA 1RN4A 3BNEA 4NREA 3OX9A 2PNCA 5AIHA 2BO9B 4WP5A 3T8UA 1E3VA 1GOVA 2CG1A 1A90A 4LGQA 3UB1A 4XB5A 1BUQA 3PCRA 4TX4A 2C4BA 3HX8A 3KCHA 4WHAA 1BRNL 3CNXA 4HZ9B 3WMDA 3D4AA 2I9WA 3JUPA 3CCL3 1UDII 2PZVA 4O3VA 4FMBA 4OK0A 3HI7A 3X3XA 2BIRA 1B2ZA 1NWWA 2L4VA 2GXFA 1JV2B 2HMLB 2OOVA 3SXXA 4OVMA 1JJ22 2QIYA 2W2CA 4JF8A 3NBJA 4FMCA 1Q824 4R4KA 4H3UA 2XF3A 1W5ZA 3N54B 3EBTA 1CQSA 5M19A 2WGOA 3K0ZA 3AGOA 1WTHA 2C10A 3TDGA 3GZBA 3KKGA 4DKIA 2F86B 1VQ53 2E2TA 4BL2A 1BRHA 1RGCA 4EV2A 1RRHA 3PZWA 4HM3B 1O7WB 3HK4A 1MWSA 4WFOA 5IG3A 1DYUA 1RGAA 3BLZA 2KF5A 4ZM8A 1NDOB 1M9GA 3PS8A 3M8CA 5KP3A 1DMMA 1O7NB 3PCSA 4GHOA 2C11A 2WOHA 4QWTA 3G0KA 1LOVA 1NU3A 4RNTA 5D81A 4HVNA 3S67A 1QVF2 1PY3A 2B24B 1SQWA 3MSOA 1IQYA 3FCSB 1TRPA 1RJOA 2W9PA 1IK3A 1QALA 4N6UA 1IT7A 3CCU3 1K734 2Y74A 1TFOA 1KWIA 1TFKA 1UI7A 1BSCA 3PYJA 1BU4A 3BNDA 3H3HA 2HMOB 4HM1B 4N6V0 1I0VA 3FF2A 3V99A 1W6GA 4HAAA 7STDA 5IG5A 2K54A 2F98A 1RN7A 3AMOB 1K41A 2D42A 3IMAB 4FCJA 4HM0B 1FGTA 1W00A 4KVHA 1NO3A 1BRIA 3O8YA 1IVWA 3ER7A 3SEDA 1GY7A 3B4OA 3X3YA 1B2MA 1YJ93 4HM8B 4KFFA 1TIJA 3Q90A 4HM4B 3LT8A 1BVIA 2F5WA 2CWUA 2CIUA 5JPUA 1JZDA 1K9M4 4FMAA 4N6LA 3F8XA 1I2EA 2XSOB 1IVXA 3F8HA 3GZRA 3EE1A 1BNEA 4XDVA 2OTL3 4HKVB 3BB9A 1F8NA 1UCKA 3D9RA 2YFIB 5DRVA 3GWRA 1GOUA 3S5CA 3LYGA 1PYLA 3DY5A 3EHCA 4RZMA 4X2OA 2HMKB 1JB4A 1N5PA 3FSDA 4RNYA 1RTUA 3NX0A 3WA2X 2QA43 2HOHA 3B4PA 1B2XA 3AMOA 3PGBA 4EYCA 3S27A 1I70A 3F14A 2KAAA 5IW9A 1UI8A 3K5TA 3N9HA 3GZYB 4HM5B 1JB2A 2F56A 1RLSA 4N6TA 5BVBA 3SVAA 1Q864 4K61A 2W6JH 3ALAA 2CFDA 2YX9A 3AGNA 2BT3A 3NXJA 2CFWA 4GSPA 5CLKA 3CCJ3 1YJN3 1VQN3 4FR9A 3VGNA 1NJI4 3MG1A 4AKYA 1IDPA 4XDWA 3LTDA 1Q814 1Q40A 1PFPA 1Q9EA 2LYXA 1BRJA 1DE3A 1STFI 1YHQ3 3L0RA 1D6ZA 1GYBA 3OXAA 4O2HA 4BU4A 3CCM3 2QEX3 4KT3B 1ZX2A 3G16A 4L8OA 1DVCA 1RNTA 1VQK3 5BIRA 1GOYA 3MPHA 1DETA 3QRDA 2QGUA 1IQXA 1K28A 3N8BA 4O8SA 3IPTA 1ROVA 5A0OB 1SIIA 2RNTA 4IT7A 1RGKA 3URPA 3ZG0A 4K1UA 1FUWA 1RGLA 4OUQA 4LSOA 2HMMB 1NB5I 1Q7HA 4EV5A 1CYUA 1W2ZA 1I2FA 3OWSA 4EW5A 1FW7A 3RGAA 3CME3 1FGOA 1RGEA 6STDA 5IERA 1AV4A 1B2UA 4HM7B 4ORLA 6RNTA 4KFDA 2P05A 2CHCA 3CCR3 3NV0B 1BSBA 4XBXA 1GSPA 2OTJ3 1D6UA 1B3SA 1W01A 1A2KA 2LQVA 3CMA3 2WGQA 1QJGA 5STDA 2AADA 5AIFA 2AAEA 1RMSA 2KXGA 1O7PB 3CC43 3X41A 3U1WA 3KE7A 2KF3A 4K90B 1I0XA 5IG0A 1C7HA 4N3VA 6GSPA 1QAKA 3I0YA 3EN1B 5JPPA 1ZS7A 1TJDA 3MWZA 2KRTA 3RGRA 1UCJA 1I8VA 2XGLA 1MGWA 3EX9A 5G1LA 5JBSA 1HKXA 3Q2PA 5FGOA 1TRQA 2BMQB 1FUTA 1ASKA 8RNTA 4U13A 1B21A 1BSEA 1OPYA 1YNVX 2HMJB 2P0MA 3A76A 4ILFA 1IT8A 1QMAA 4STDA 5LC6A 2GEXA 3WOEB 2ZHXB 7RNTA 2CFKA 1T2HA 2FXTA 3STDA 5IEPA 1JBRA 3SOAA 2BHMA 1DVDA 2GU1A 3CNMA 2OWPA 1IV9A 1LOYA 3X42A 3J7Yd 5IG4A 2XFSA 1OGXA 4H61A 1BNJA 1BIRA 2F4YA 2ZA4A 3LMLA 2BU4A 4CDLA 1X1XA 3CPOA 2SBLA 2B1XB 4MMYB 2XSHB 3NBRA 5AYSC 1UUGB 3T0UA 3DUKA 3I563 1LOXA 2Z6BA 1W02A 2IYJA 4HJLB 5M1AA 3MG2A 4R80A 5TGNA 5BXQA 2UGIA 3DGNA 1RNBA 1O7GB 1TUHA 5EEOA 1IYYA 1AVLA 1T5YA 1W4NA 1OACA 4J8TA 2W04A 2GBXB 3CCE3 2O3OA 1U5OA 4R9KA 5G1KA 2GU3A 1EKMA 1E97A 3EF8A
chains in the Genus database with same CATH topology
5CXOA 3IJEB 2A15A 4XBTA 4EC6A 5AEWB 3OV4A 1OF5B 3BNCA 3CU3A 1GY6A 4RBNA 5CF1A 1K8A4 2OQEA 2RGQA 3WOFB 1OGZA 1JKGB 1ROAA 1KD14 3CD63 1LVNA 3LH4A 3SLUA 3WDGB 4HZBB 1OH0A 2O9UX 3JVCA 1WMNA 1STDA 4GB5A 3F9SA 5ELJA 4K1VA 3U97A 4CCVA 2ML6A 1W7CA 1JN5B 3B8LA 1N9EA 1D6YA 1UUVB 1GD4A 2W56B 1WMOA 4MMXB 5G2GA 3LXUX 1W2B2 1O7HB 3EQQB 4HYZA 1VQ43 3NUVA 4MJDA 3DXOA 2CH9A 1YJW3 1TU5A 1EQKA 2CFGA 3JUQA 2CC3A 3NM7A 2OOVC 4IIAA 1GY5A 2GBWB 3CCV3 1SIHA 1O7MB 3H51A 2M7OA 3UL6A 3CCQ3 5AEUB 1KSIA 3GZXB 2XH9A 1JN5A 3G6E3 3B7CA 1M904 2W56A 3LTAA 5ELUA 5EQLA 1FGQA 4BTYA 4WYKB 2Z76A 4FCMA 2CK3H 2Q07A 5LC7A 1N8R4 1VQM3 1CEWI 3ROBA 1V74A 5CK6A 4MMZB 2JDIH 2YFLB 1VQ83 3F7SA 4N6NB 3MHEA 4X2HA 3CCS3 1LXEA 1JRQA 1IV7A 1CYVA 3K63A 3NQYA 2P09A 5AIIA 1N5HA 4LMIA 1YGEA 3FF0A 3FG3A 1WMPA 1WNHA 1FA3A 2CFLA 1YIT3 3OWUA 1U8CB 1R4CA 2E2UA 3UNLA 4NHFA 2XR8B 2BMOB 4KZ1A 3Q1CA 5IENA 1UW1A 3FKAA 4GL6A 1Q7Y4 2R4IA 1NB3I 4LZIA 4PEJA 3SX1A 1S723 4N6MA 4R9LA 1E3RA 4EXRA 3NV0A 2XEPA 1KC84 3DZLA 3MKIA 4RNZA 2BMRB 3DMCA 5FW5A 2RSXA 2Y73A 3E99A 1MOLA 1N9JA 1SJWA 2P0XA 4HM6B 4JRFA 1OCVA 5KP4A 3JUNA 2HMNB 3NHXA 3SOYA 1ULJB 1IVUA 3G4S3 2GEYA 3BNBA 1YI23 2Z77A 3EN8A 4FCZA 1Z1SA 1TP6A 1Q42A 3ECFA 2BNGA 5IEOA 2STDA 2CWVA 2IUJA 3S29A 3KZTA 3X40A 4EBGA 3G713 1IQ8A 2JQ5A 3OW22 2V1LA 3JUOA 3JUMA 2ZL8A 1US1A 2INXA 1HU9A 1OHPA 1VQ63 1DMQA 3QK9A 3FLJA 8CHOA 2CWTA 4AKZA 2OCTA 3WA3A 3FZWA 1JB5A 1VQO3 1QVG2 3HIIA 3V98A 4Q53A 1GS3A 2FNQA 1SPUA 3T8NA 1JNQA 1VQ73 1FGMA 3DGMA 3UJMA 1ISKA 1OHSA 3EC9A 5HGRA 3G8ZA 3KSED 2CW9A 5EVHA 3OWYA 5D83A 1IU7A 1RRLA 4BTWA 4N6OB 1Y4KA 2IUKA 1QAFA 3HIGA 3DM8A 3K9MC 2XGNA 2D1WA 1OF5A 4HBRA 2IA7A 1DMNA 5CF2A 1GD3A 3EBYA 2Z7AA 3KIIA 3F7XA 4G1MB 1JKGA 1LNHA 4AEQA 3DGOA 1VQP3 3CC73 2W9QA 2UX0A 2W03A 4I4KA 1VZZA 5I97A 4FMDA 2MF7A 4BTXA 4L7KA 2WOFA 3LT9A 1ZO2A 2FGTA 3NBBA 1VQL3 1Q40B 1N8QA 1A2VA 1OHOA 3LTBA 2CKFB 4O02B 4MEIA 3KN4A 2F99A 3HZPA 3V92A 3UL5A 3WODG 3KFQC 1G96A 3VF1A 1M1XB 1YVBI 1RKYA 4WWUC 3LOYA 3I553 3CXC2 3LZAA 2IMJA 4XM4A 5AI1A 3VSYA 2YFJB 3F40A 2KCDA 5KP1A 3GRDA 3NQZA 3FGYA 1AR0A 4IPBA 2W0QA 2ZDJA 2RCDA 3CC23 1W6CA 4L8PA 3LTCA 1AVKA 2WO0A 5AYRB 1KQS2 1PU4A 3KSPA 1EA2A 1A67A 3GAXA 3S28A 3NM2A 3X3ZA 3K7CA 2XRXB 3CPW2 1MNLA 2E2VA 2OQEC 4XBYA 1EG9B 4LEHA 3FG4A 4KFEA 1L5GB 3FH1A 3MG3A 3D3LA 4HM2B 2MC8A 4J9AA 1M1K4 3EB8A 2XFTA 2RFRA 5D82A 1UUWB 2CG0A 4WYKA 3RDEA 3MYTA 5AIGA 1IVVA 3DGLA 3EJVA 3PXMA 1S5AA 2K0MA 2ML5A 1J2BA 1W6YA 5IF6A 1YIJ3 1ULIB 1VQ93 1FGRA 5DREA 4R1KA 2P38A 1WQLB 3FG1A 1OUNA 3BNEA 4NREA 3OX9A 2PNCA 5AIHA 2BO9B 4WP5A 3T8UA 1E3VA 2CG1A 1A90A 4LGQA 3UB1A 4XB5A 1BUQA 3PCRA 4TX4A 3HX8A 4WHAA 3CNXA 4HZ9B 3WMDA 3JUPA 2I9WA 3CCL3 2PZVA 4O3VA 4FMBA 4OK0A 3HI7A 3X3XA 2L4VA 1NWWA 2OOVA 2GXFA 1JV2B 2HMLB 3SXXA 4OVMA 1JJ22 2QIYA 2W2CA 4JF8A 3NBJA 4FMCA 1Q824 4R4KA 4H3UA 2XF3A 1W5ZA 3N54B 3EBTA 1CQSA 2WGOA 3K0ZA 3TDGA 1WTHA 2C10A 3GZBA 3KKGA 1VQ53 2F86B 2E2TA 4EV2A 1RRHA 3PZWA 4HM3B 1O7WB 3HK4A 4WFOA 5IG3A 1DYUA 3BLZA 4ZM8A 1NDOB 1M9GA 3PS8A 3M8CA 5KP3A 1DMMA 1O7NB 3PCSA 2C11A 2WOHA 4QWTA 3G0KA 1NU3A 5D81A 3S67A 4HVNA 1QVF2 2B24B 1SQWA 3MSOA 1IQYA 3FCSB 1RJOA 2W9PA 1IK3A 1QALA 4N6UA 1IT7A 3CCU3 1K734 2Y74A 1TFOA 1KWIA 1TFKA 1UI7A 3PYJA 3BNDA 3H3HA 2HMOB 4HM1B 4N6V0 3FF2A 3V99A 7STDA 1W6GA 5IG5A 2K54A 2F98A 1RN7A 3AMOB 1K41A 2D42A 3IMAB 4FCJA 4HM0B 1FGTA 1W00A 4KVHA 1NO3A 3O8YA 1IVWA 3ER7A 3SEDA 1GY7A 3B4OA 3X3YA 1YJ93 4HM8B 4KFFA 1TIJA 3Q90A 4HM4B 3LT8A 1K9M4 5JPUA 2CWUA 2CIUA 4FMAA 4N6LA 3F8XA 2XSOB 1IVXA 3F8HA 3GZRA 3EE1A 4XDVA 2OTL3 4HKVB 3BB9A 1F8NA 3D9RA 2YFIB 5DRVA 3GWRA 3S5CA 3LYGA 3DY5A 3EHCA 4RZMA 4X2OA 2HMKB 1JB4A 1N5PA 3FSDA 4RNYA 3WA2X 3NX0A 2QA43 3B4PA 3AMOA 3PGBA 4EYCA 3S27A 5IW9A 3F14A 1UI8A 3K5TA 3N9HA 3GZYB 4HM5B 1JB2A 1Q864 4N6TA 5BVBA 3SVAA 4K61A 2W6JH 3ALAA 2CFDA 2YX9A 3NXJA 2BT3A 5CLKA 2CFWA 3CCJ3 1VQN3 1YJN3 4FR9A 3VGNA 1NJI4 3MG1A 4AKYA 1IDPA 4XDWA 3LTDA 1Q814 1Q40A 1PFPA 2LYXA 1STFI 1YHQ3 3L0RA 1D6ZA 1GYBA 3OXAA 4O2HA 3CCM3 2QEX3 4L8OA 1ZX2A 3G16A 1DVCA 1VQK3 3MPHA 3QRDA 2QGUA 1IQXA 1K28A 3N8BA 4O8SA 3IPTA 1ROVA 5A0OB 1SIIA 4IT7A 4K1UA 1FUWA 4OUQA 4LSOA 2HMMB 1NB5I 4EV5A 1CYUA 1W2ZA 3OWSA 3RGAA 3CME3 1FGOA 5IERA 6STDA 1AV4A 4HM7B 4ORLA 3CCR3 4KFDA 2P05A 2CHCA 3NV0B 4XBXA 2OTJ3 1D6UA 1W01A 1A2KA 2LQVA 3CMA3 2WGQA 1QJGA 5STDA 5AIFA 2KXGA 1O7PB 3CC43 3X41A 3U1WA 3KE7A 4K90B 5IG0A 1C7HA 4N3VA 1QAKA 3I0YA 3EN1B 5JPPA 3MWZA 2KRTA 3RGRA 5JBSA 2XGLA 3EX9A 1HKXA 3Q2PA 5FGOA 2BMQB 1ASKA 4U13A 1OPYA 2HMJB 3A76A 5LC6A 2P0MA 3WOEB 1IT8A 1QMAA 4STDA 2GEXA 5IEPA 2CFKA 2FXTA 3STDA 1DVDA 3SOAA 2BHMA 2GU1A 3CNMA 2OWPA 1IV9A 3X42A 3J7Yd 5IG4A 2XFSA 1OGXA 4H61A 3LMLA 4CDLA 3CPOA 2SBLA 2B1XB 4MMYB 2XSHB 3NBRA 5AYSC 3T0UA 3DUKA 3I563 1LOXA 2Z6BA 1W02A 4HJLB 3MG2A 4R80A 5TGNA 5BXQA 3DGNA 1O7GB 1TUHA 5EEOA 1AVLA 1T5YA 1W4NA 1OACA 4J8TA 2W04A 2GBXB 3CCE3 2O3OA 1U5OA 4R9KA 2GU3A 1EKMA 1E97A 3EF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXO A;  2A15 A;  4XBT A;  5AEW B;  3OV4 A;  1OF5 B;  3CU3 A;  1GY6 A;  5CF1 A;  2RGQ A;  1OGZ A;  1JKG B;  4HZB B;  1OH0 A;  1STD A;  4GB5 A;  3F9S A;  4K1V A;  1JN5 B;  3B8L A;  1UUV B;  5G2G A;  1O7H B;  3EQQ B;  3NUV A;  4MJD A;  3DXO A;  3JUQ A;  4IIA A;  1GY5 A;  2GBW B;  1O7M B;  3H51 A;  5AEU B;  3GZX B;  1JN5 A;  3B7C A;  4WYK B;  2Z76 A;  4FCM A;  3ROB A;  5CK6 A;  2YFL B;  3F7S A;  3MHE A;  4X2H A;  5AII A;  4LMI A;  3FF0 A;  3OWU A;  3UNL A;  2XR8 B;  2BMO B;  5IEN A;  3FKA A;  4PEJ A;  2R4I A;  4R9L A;  1E3R A;  3NV0 A;  3DZL A;  3MKI A;  2BMR B;  3DMC A;  5FW5 A;  3E99 A;  1SJW A;  5KP4 A;  4HM6 B;  1OCV A;  3JUN A;  2HMN B;  3NHX A;  3SOY A;  1ULJ B;  2GEY A;  2Z77 A;  3EN8 A;  1Z1S A;  1TP6 A;  1Q42 A;  3ECF A;  2BNG A;  5IEO A;  2STD A;  3KZT A;  2JQ5 A;  3JUM A;  3JUO A;  2INX A;  1OHP A;  1DMQ A;  3FLJ A;  8CHO A;  3FZW A;  1JB5 A;  4Q53 A;  1GS3 A;  3T8N A;  3UJM A;  1ISK A;  1OHS A;  3EC9 A;  5HGR A;  3G8Z A;  5EVH A;  3OWY A;  5D83 A;  3DM8 A;  1OF5 A;  5CF2 A;  1DMN A;  3EBY A;  2Z7A A;  3F7X A;  1JKG A;  2UX0 A;  4I4K A;  1VZZ A;  4L7K A;  1ZO2 A;  1Q40 B;  1OHO A;  2CKF B;  2F99 A;  3HZP A;  4WWU C;  3LZA A;  2IMJ A;  4XM4 A;  5AI1 A;  3VSY A;  2YFJ B;  3F40 A;  5KP1 A;  3GRD A;  3FGY A;  1AR0 A;  2RCD A;  4L8P A;  3KSP A;  1EA2 A;  3NM2 A;  3K7C A;  2XRX B;  4XBY A;  1EG9 B;  4LEH A;  3FH1 A;  3MG3 A;  4HM2 B;  4J9A A;  2RFR A;  5D82 A;  1UUW B;  4WYK A;  3MYT A;  5AIG A;  3EJV A;  1S5A A;  1W6Y A;  5IF6 A;  1ULI B;  5DRE A;  4R1K A;  1WQL B;  1OUN A;  3OX9 A;  3T8U A;  5AIH A;  4WP5 A;  1E3V A;  4LGQ A;  4XB5 A;  1BUQ A;  3HX8 A;  3CNX A;  4HZ9 B;  3WMD A;  3JUP A;  2I9W A;  2PZV A;  1NWW A;  2GXF A;  2HML B;  4OVM A;  2QIY A;  2W2C A;  4H3U A;  3EBT A;  1CQS A;  3K0Z A;  3GZB A;  3KKG A;  2F86 B;  4HM3 B;  1O7W B;  3HK4 A;  5IG3 A;  3BLZ A;  1NDO B;  3M8C A;  5KP3 A;  1DMM A;  1O7N B;  3G0K A;  1NU3 A;  5D81 A;  4HVN A;  2B24 B;  3MSO A;  3H3H A;  2HMO B;  4HM1 B;  7STD A;  3FF2 A;  5IG5 A;  2K54 A;  2F98 A;  1K41 A;  4HM0 B;  4FCJ A;  1W00 A;  4KVH A;  3ER7 A;  3SED A;  1GY7 A;  3B4O A;  4HM8 B;  3Q90 A;  4HM4 B;  5JPU A;  3F8X A;  2XSO B;  3F8H A;  3GZR A;  4XDV A;  4HKV B;  3BB9 A;  3D9R A;  2YFI B;  5DRV A;  3GWR A;  3S5C A;  3LYG A;  3EHC A;  4RZM A;  4X2O A;  2HMK B;  1JB4 A;  3FSD A;  3B4P A;  3F14 A;  3GZY B;  4HM5 B;  1JB2 A;  5BVB A;  3NXJ A;  5CLK A;  3VGN A;  3MG1 A;  1IDP A;  4XDW A;  1Q40 A;  1GYB A;  3OXA A;  4L8O A;  1ZX2 A;  3G16 A;  2QGU A;  3IPT A;  4K1U A;  4OUQ A;  2HMM B;  3OWS A;  3RGA A;  5IER A;  6STD A;  4HM7 B;  4ORL A;  2CHC A;  3NV0 B;  4XBX A;  1W01 A;  1A2K A;  1QJG A;  5STD A;  5AIF A;  1O7P B;  3KE7 A;  5IG0 A;  1C7H A;  4N3V A;  3I0Y A;  5JPP A;  3EN1 B;  3RGR A;  3EX9 A;  1HKX A;  2BMQ B;  1ASK A;  4U13 A;  1OPY A;  2HMJ B;  3A76 A;  1QMA A;  4STD A;  2GEX A;  5IEP A;  3STD A;  3SOA A;  3CNM A;  2OWP A;  5IG4 A;  1OGX A;  4CDL A;  3CPO A;  2B1X B;  2XSH B;  3NBR A;  3DUK A;  4HJL B;  1W02 A;  3MG2 A;  5BXQ A;  5TGN A;  1O7G B;  1TUH A;  4J8T A;  2GBX B;  1U5O A;  4R9K A;  1E97 A;  3EF8 A; 
#chains in the Genus database with same CATH topology
 5CXO A;  3IJE B;  2L1S A;  2A15 A;  4XBT A;  4EC6 A;  1MWR A;  5AEW B;  3OV4 A;  1OF5 B;  3BNC A;  3CU3 A;  1GY6 A;  4RBN A;  5CF1 A;  1K8A 4;  2OQE A;  2RGQ A;  3WOF B;  1OGZ A;  1JKG B;  1ROA A;  1V57 A;  1YGW A;  3BIR A;  4NPB A;  1KD1 4;  3CD6 3;  1LVN A;  3LH4 A;  3SLU A;  3WDG B;  9RNT A;  1UGI A;  3AHS A;  1OH0 A;  2K3D A;  2O9U X;  1FYS A;  3JVC A;  4HZB B;  1X1U A;  1WMN A;  1STD A;  4GB5 A;  3F9S A;  5ELJ A;  4HOH A;  4K1V A;  3U97 A;  4CCV A;  2ML6 A;  1W7C A;  1UCL A;  1JN5 B;  3B8L A;  1N9E A;  1D6Y A;  1UUV B;  1GD4 A;  2W56 B;  1WMO A;  4MMX B;  5G2G A;  3LXU X;  1W2B 2;  1O7H B;  3EQQ B;  4HYZ A;  1VQ4 3;  3NUV A;  4MJD A;  3DXO A;  1BSA A;  2CH9 A;  1YJW 3;  1TU5 A;  1EQK A;  1BAO A;  2CFG A;  3JUQ A;  2CC3 A;  3NM7 A;  1LRA A;  2OOV C;  4IIA A;  1BNI A;  1GY5 A;  2GBW B;  3CCV 3;  1SIH A;  1O7M B;  3H51 A;  2F5M A;  1JBT A;  2M7O A;  3UL6 A;  3CCQ 3;  1UGH I;  1V58 A;  5AEU B;  2SAR A;  1KSI A;  3GZX B;  5RNT A;  2XH9 A;  1BOX A;  1FZU A;  1NNV A;  5M18 A;  1JN5 A;  3G6E 3;  3B7C A;  1M90 4;  3BU4 A;  2W56 A;  3LTA A;  5ELU A;  5EQL A;  7GSP A;  1BGS A;  1FGQ A;  4BTY A;  4WYK B;  2Z76 A;  1A2P A;  4FCM A;  2CK3 H;  2Q07 A;  5LC7 A;  1N8R 4;  1VQM 3;  1ZGX A;  1CEW I;  2R41 A;  2KF6 A;  3ROB A;  1V74 A;  5CK6 A;  4MMZ B;  1B20 A;  1T3B A;  1C54 A;  1T2I A;  2JDI H;  2YFL B;  1VQ8 3;  3F7S A;  4N6N B;  4CPK A;  3MHE A;  4X2H A;  3CCS 3;  4J5K A;  1CH0 A;  1G02 A;  3DGY A;  1LXE A;  1JRQ A;  3D79 A;  1TTO A;  1IV7 A;  1FUS A;  1CYV A;  3K63 A;  3NQY A;  1BRS A;  2P09 A;  5AII A;  1BNG A;  1N5H A;  1BRG A;  3A5E A;  4LMI A;  1YGE A;  1B2S A;  2CX1 A;  3FF0 A;  3FG3 A;  1EUI C;  1WMP A;  1WNH A;  1MWU A;  2CFL A;  1FA3 A;  3ZFZ A;  3OWU A;  1YIT 3;  1U8C B;  1R4C A;  2E2U A;  2H0H A;  1X1Y A;  3UNL A;  4NHF A;  2XR8 B;  2BMO B;  4KZ1 A;  3Q1C A;  5IEN A;  1UW1 A;  3ZG5 A;  3FKA A;  4GL6 A;  1Q7Y 4;  2R4I A;  1NB3 I;  4LZI A;  4PEJ A;  3SX1 A;  1I2G A;  1HYF A;  1BRK A;  1S72 3;  1MWT A;  4N6M A;  4R9L A;  1E3R A;  4EXR A;  3NV0 A;  2XEP A;  1KC8 4;  3DZL A;  3MKI A;  4RNZ A;  2BMR B;  3DMC A;  3Q3F A;  5FW5 A;  2H0G A;  2RSX A;  2Y73 A;  3E99 A;  1LQG C;  1MOL A;  1N9J A;  1SJW A;  2P0X A;  4HM6 B;  1OCV A;  4JRF A;  3JUN A;  5KP4 A;  2CX0 A;  2HMN B;  3NHX A;  3SOY A;  1ULJ B;  3GSP A;  1IVU A;  3G4S 3;  2GEY A;  3BNB A;  1YI2 3;  3WHO A;  2Z77 A;  1GMQ A;  1JBS A;  3EN8 A;  4FCZ A;  1Z1S A;  2H0I A;  1TP6 A;  1LNI A;  1Q42 A;  3ECF A;  1RGF A;  2BNG A;  4I5Q A;  5IEO A;  2J8X B;  2STD A;  2CWV A;  3DH2 A;  2IUJ A;  3S29 A;  3WR2 A;  4BIR A;  3KZT A;  3X40 A;  4EBG A;  3G71 3;  1IQ8 A;  2JQ5 A;  3OW2 2;  1RCL A;  2V1L A;  3JUO A;  2ZL8 A;  3JUM A;  1US1 A;  1SAR A;  2INX A;  1RHL A;  3D5I A;  3SYU A;  1HU9 A;  1OHP A;  1AY7 A;  1DMQ A;  1VQ6 3;  3QK9 A;  3FLJ A;  2IY2 A;  2GSP A;  8CHO A;  2CWT A;  2RBI A;  4AKZ A;  2UUG C;  2OCT A;  3WA3 A;  1UCI A;  3FZW A;  1JB5 A;  1VQO 3;  1QVG 2;  3HII A;  3V98 A;  1MGR A;  1GS3 A;  2FNQ A;  1SPU A;  3AHW A;  1JNQ A;  4Q53 A;  3T8N A;  1FGM A;  3DGM A;  3UJM A;  1VQ7 3;  1RGG A;  1ISK A;  1OHS A;  3EC9 A;  5HGR A;  3G8Z A;  3KSE D;  2CW9 A;  5EVH A;  1B27 A;  3OWY A;  5D83 A;  1IU7 A;  1RRL A;  4BTW A;  4J5G A;  4N6O B;  1Y4K A;  2IUK A;  1QAF A;  1LQM B;  1GMR A;  3HIG A;  1YVS A;  3DM8 A;  3K9M C;  2XGN A;  5HOH A;  2D1W A;  1OF5 A;  4HBR A;  1X1W A;  3RNT A;  2IA7 A;  1DMN A;  5CF2 A;  1GD3 A;  1RN1 A;  3EBY A;  2Z7A A;  3KII A;  3F7X A;  4G1M B;  1JKG A;  1LNH A;  1RCK A;  3DGO A;  4AEQ A;  1VQP 3;  3CC7 3;  1BNF A;  2W9Q A;  2UX0 A;  1RSN A;  2W03 A;  1VZZ A;  4I4K A;  5I97 A;  4FMD A;  1LOW A;  2MF7 A;  4BTX A;  4L7K A;  2WOF A;  3LT9 A;  1ZO2 A;  4CJN A;  2FGT A;  3NBB A;  1VQL 3;  1Q40 B;  1N8Q A;  1A2V A;  1BAN A;  1OHO A;  1RDS A;  3LTB A;  2CKF B;  4O02 B;  4MEI A;  1EEJ A;  2F99 A;  3HZP A;  3KN4 A;  3UL5 A;  3V92 A;  3WOD G;  3KFQ C;  1G96 A;  3VF1 A;  1M1X B;  1YVB I;  1RKY A;  4WWU C;  3LOY A;  3I55 3;  3CXC 2;  3LZA A;  1HZ1 A;  2IMJ A;  1BNS A;  4XM4 A;  5AI1 A;  2YFJ B;  3VSY A;  1AQZ A;  3F40 A;  1BNR A;  2KCD A;  5KP1 A;  4LYL B;  3HOH A;  3GRD A;  3NQZ A;  3FGY A;  1AR0 A;  5BU4 A;  4IPB A;  2W0Q A;  1RGH A;  2ZDJ A;  2RCD A;  3CC2 3;  1W6C A;  4L8P A;  3LTC A;  1AVK A;  2WO0 A;  5AYR B;  1I3F A;  1KQS 2;  1PU4 A;  3KSP A;  1EA2 A;  1A67 A;  3GAX A;  3S28 A;  3NM2 A;  1G0T A;  3X3Z A;  4BL3 A;  3K7C A;  2XRX B;  3CPW 2;  1MNL A;  2E2V A;  2OQE C;  4XBY A;  1EG9 B;  4LEH A;  3FG4 A;  4KFE A;  1L5G B;  3FH1 A;  3MG3 A;  3D3L A;  4HM2 B;  2MC8 A;  1GMP A;  4J9A A;  1R4Y A;  1BSD A;  1M1K 4;  3EB8 A;  2XFT A;  2RFR A;  2KF4 A;  3D5G A;  5D82 A;  1UUW B;  1VQQ A;  2CG0 A;  4WYK A;  1I3I A;  3MYT A;  3RDE A;  5AIG A;  1JZO A;  1IVV A;  3DGL A;  3EJV A;  3PXM A;  1S5A A;  2K0M A;  2ML5 A;  1J2B A;  1W6Y A;  5IF6 A;  1YIJ 3;  1ULI B;  1VQ9 3;  1FGR A;  5DRE A;  4R1K A;  2P38 A;  1WQL B;  3FG1 A;  1OUN A;  5GSP A;  1BUJ A;  1RN4 A;  3BNE A;  4NRE A;  3OX9 A;  2PNC A;  5AIH A;  2BO9 B;  4WP5 A;  3T8U A;  1E3V A;  1GOV A;  2CG1 A;  1A90 A;  4LGQ A;  3UB1 A;  4XB5 A;  1BUQ A;  3PCR A;  4TX4 A;  2C4B A;  3HX8 A;  3KCH A;  4WHA A;  1BRN L;  3CNX A;  4HZ9 B;  3WMD A;  3D4A A;  2I9W A;  3JUP A;  3CCL 3;  1UDI I;  2PZV A;  4O3V A;  4FMB A;  4OK0 A;  3HI7 A;  3X3X A;  2BIR A;  1B2Z A;  1NWW A;  2L4V A;  2GXF A;  1JV2 B;  2HML B;  2OOV A;  3SXX A;  4OVM A;  1JJ2 2;  2QIY A;  2W2C A;  4JF8 A;  3NBJ A;  4FMC A;  1Q82 4;  4R4K A;  4H3U A;  2XF3 A;  1W5Z A;  3N54 B;  3EBT A;  1CQS A;  5M19 A;  2WGO A;  3K0Z A;  3AGO A;  1WTH A;  2C10 A;  3TDG A;  3GZB A;  3KKG A;  4DKI A;  2F86 B;  1VQ5 3;  2E2T A;  4BL2 A;  1BRH A;  1RGC A;  4EV2 A;  1RRH A;  3PZW A;  4HM3 B;  1O7W B;  3HK4 A;  1MWS A;  4WFO A;  5IG3 A;  1DYU A;  1RGA A;  3BLZ A;  2KF5 A;  4ZM8 A;  1NDO B;  1M9G A;  3PS8 A;  3M8C A;  5KP3 A;  1DMM A;  1O7N B;  3PCS A;  4GHO A;  2C11 A;  2WOH A;  4QWT A;  3G0K A;  1LOV A;  1NU3 A;  4RNT A;  5D81 A;  4HVN A;  3S67 A;  1QVF 2;  1PY3 A;  2B24 B;  1SQW A;  3MSO A;  1IQY A;  3FCS B;  1TRP A;  1RJO A;  2W9P A;  1IK3 A;  1QAL A;  4N6U A;  1IT7 A;  3CCU 3;  1K73 4;  2Y74 A;  1TFO A;  1KWI A;  1TFK A;  1UI7 A;  1BSC A;  3PYJ A;  1BU4 A;  3BND A;  3H3H A;  2HMO B;  4HM1 B;  4N6V 0;  1I0V A;  3FF2 A;  3V99 A;  1W6G A;  4HAA A;  7STD A;  5IG5 A;  2K54 A;  2F98 A;  1RN7 A;  3AMO B;  1K41 A;  2D42 A;  3IMA B;  4FCJ A;  4HM0 B;  1FGT A;  1W00 A;  4KVH A;  1NO3 A;  1BRI A;  3O8Y A;  1IVW A;  3ER7 A;  3SED A;  1GY7 A;  3B4O A;  3X3Y A;  1B2M A;  1YJ9 3;  4HM8 B;  4KFF A;  1TIJ A;  3Q90 A;  4HM4 B;  3LT8 A;  1BVI A;  2F5W A;  2CWU A;  2CIU A;  5JPU A;  1JZD A;  1K9M 4;  4FMA A;  4N6L A;  3F8X A;  1I2E A;  2XSO B;  1IVX A;  3F8H A;  3GZR A;  3EE1 A;  1BNE A;  4XDV A;  2OTL 3;  4HKV B;  3BB9 A;  1F8N A;  1UCK A;  3D9R A;  2YFI B;  5DRV A;  3GWR A;  1GOU A;  3S5C A;  3LYG A;  1PYL A;  3DY5 A;  3EHC A;  4RZM A;  4X2O A;  2HMK B;  1JB4 A;  1N5P A;  3FSD A;  4RNY A;  1RTU A;  3NX0 A;  3WA2 X;  2QA4 3;  2HOH A;  3B4P A;  1B2X A;  3AMO A;  3PGB A;  4EYC A;  3S27 A;  1I70 A;  3F14 A;  2KAA A;  5IW9 A;  1UI8 A;  3K5T A;  3N9H A;  3GZY B;  4HM5 B;  1JB2 A;  2F56 A;  1RLS A;  4N6T A;  5BVB A;  3SVA A;  1Q86 4;  4K61 A;  2W6J H;  3ALA A;  2CFD A;  2YX9 A;  3AGN A;  2BT3 A;  3NXJ A;  2CFW A;  4GSP A;  5CLK A;  3CCJ 3;  1YJN 3;  1VQN 3;  4FR9 A;  3VGN A;  1NJI 4;  3MG1 A;  4AKY A;  1IDP A;  4XDW A;  3LTD A;  1Q81 4;  1Q40 A;  1PFP A;  1Q9E A;  2LYX A;  1BRJ A;  1DE3 A;  1STF I;  1YHQ 3;  3L0R A;  1D6Z A;  1GYB A;  3OXA A;  4O2H A;  4BU4 A;  3CCM 3;  2QEX 3;  4KT3 B;  1ZX2 A;  3G16 A;  4L8O A;  1DVC A;  1RNT A;  1VQK 3;  5BIR A;  1GOY A;  3MPH A;  1DET A;  3QRD A;  2QGU A;  1IQX A;  1K28 A;  3N8B A;  4O8S A;  3IPT A;  1ROV A;  5A0O B;  1SII A;  2RNT A;  4IT7 A;  1RGK A;  3URP A;  3ZG0 A;  4K1U A;  1FUW A;  1RGL A;  4OUQ A;  4LSO A;  2HMM B;  1NB5 I;  1Q7H A;  4EV5 A;  1CYU A;  1W2Z A;  1I2F A;  3OWS A;  4EW5 A;  1FW7 A;  3RGA A;  3CME 3;  1FGO A;  1RGE A;  6STD A;  5IER A;  1AV4 A;  1B2U A;  4HM7 B;  4ORL A;  6RNT A;  4KFD A;  2P05 A;  2CHC A;  3CCR 3;  3NV0 B;  1BSB A;  4XBX A;  1GSP A;  2OTJ 3;  1D6U A;  1B3S A;  1W01 A;  1A2K A;  2LQV A;  3CMA 3;  2WGQ A;  1QJG A;  5STD A;  2AAD A;  5AIF A;  2AAE A;  1RMS A;  2KXG A;  1O7P B;  3CC4 3;  3X41 A;  3U1W A;  3KE7 A;  2KF3 A;  4K90 B;  1I0X A;  5IG0 A;  1C7H A;  4N3V A;  6GSP A;  1QAK A;  3I0Y A;  3EN1 B;  5JPP A;  1ZS7 A;  1TJD A;  3MWZ A;  2KRT A;  3RGR A;  1UCJ A;  1I8V A;  2XGL A;  1MGW A;  3EX9 A;  5G1L A;  5JBS A;  1HKX A;  3Q2P A;  5FGO A;  1TRQ A;  2BMQ B;  1FUT A;  1ASK A;  8RNT A;  4U13 A;  1B21 A;  1BSE A;  1OPY A;  1YNV X;  2HMJ B;  2P0M A;  3A76 A;  4ILF A;  1IT8 A;  1QMA A;  4STD A;  5LC6 A;  2GEX A;  3WOE B;  2ZHX B;  7RNT A;  2CFK A;  1T2H A;  2FXT A;  3STD A;  5IEP A;  1JBR A;  3SOA A;  2BHM A;  1DVD A;  2GU1 A;  3CNM A;  2OWP A;  1IV9 A;  1LOY A;  3X42 A;  3J7Y d;  5IG4 A;  2XFS A;  1OGX A;  4H61 A;  1BNJ A;  1BIR A;  2F4Y A;  2ZA4 A;  3LML A;  2BU4 A;  4CDL A;  1X1X A;  3CPO A;  2SBL A;  2B1X B;  4MMY B;  2XSH B;  3NBR A;  5AYS C;  1UUG B;  3T0U A;  3DUK A;  3I56 3;  1LOX A;  2Z6B A;  1W02 A;  2IYJ A;  4HJL B;  5M1A A;  3MG2 A;  4R80 A;  5TGN A;  5BXQ A;  2UGI A;  3DGN A;  1RNB A;  1O7G B;  1TUH A;  5EEO A;  1IYY A;  1AVL A;  1T5Y A;  1W4N A;  1OAC A;  4J8T A;  2W04 A;  2GBX B;  3CCE 3;  2O3O A;  1U5O A;  4R9K A;  5G1K A;  2GU3 A;  1EKM A;  1E97 A;  3EF8 A; 
#chains in the Genus database with same CATH homology
 5CXO A;  3IJE B;  2A15 A;  4XBT A;  4EC6 A;  5AEW B;  3OV4 A;  1OF5 B;  3BNC A;  3CU3 A;  1GY6 A;  4RBN A;  5CF1 A;  1K8A 4;  2OQE A;  2RGQ A;  3WOF B;  1OGZ A;  1JKG B;  1ROA A;  1KD1 4;  3CD6 3;  1LVN A;  3LH4 A;  3SLU A;  3WDG B;  4HZB B;  1OH0 A;  2O9U X;  3JVC A;  1WMN A;  1STD A;  4GB5 A;  3F9S A;  5ELJ A;  4K1V A;  3U97 A;  4CCV A;  2ML6 A;  1W7C A;  1JN5 B;  3B8L A;  1N9E A;  1D6Y A;  1UUV B;  1GD4 A;  2W56 B;  1WMO A;  4MMX B;  5G2G A;  3LXU X;  1W2B 2;  1O7H B;  3EQQ B;  4HYZ A;  1VQ4 3;  3NUV A;  4MJD A;  3DXO A;  2CH9 A;  1YJW 3;  1TU5 A;  1EQK A;  2CFG A;  3JUQ A;  2CC3 A;  3NM7 A;  2OOV C;  4IIA A;  1GY5 A;  2GBW B;  3CCV 3;  1SIH A;  1O7M B;  3H51 A;  2M7O A;  3UL6 A;  3CCQ 3;  5AEU B;  1KSI A;  3GZX B;  2XH9 A;  1JN5 A;  3G6E 3;  3B7C A;  1M90 4;  2W56 A;  3LTA A;  5ELU A;  5EQL A;  1FGQ A;  4BTY A;  4WYK B;  2Z76 A;  4FCM A;  2CK3 H;  2Q07 A;  5LC7 A;  1N8R 4;  1VQM 3;  1CEW I;  3ROB A;  1V74 A;  5CK6 A;  4MMZ B;  2JDI H;  2YFL B;  1VQ8 3;  3F7S A;  4N6N B;  3MHE A;  4X2H A;  3CCS 3;  1LXE A;  1JRQ A;  1IV7 A;  1CYV A;  3K63 A;  3NQY A;  2P09 A;  5AII A;  1N5H A;  4LMI A;  1YGE A;  3FF0 A;  3FG3 A;  1WMP A;  1WNH A;  1FA3 A;  2CFL A;  1YIT 3;  3OWU A;  1U8C B;  1R4C A;  2E2U A;  3UNL A;  4NHF A;  2XR8 B;  2BMO B;  4KZ1 A;  3Q1C A;  5IEN A;  1UW1 A;  3FKA A;  4GL6 A;  1Q7Y 4;  2R4I A;  1NB3 I;  4LZI A;  4PEJ A;  3SX1 A;  1S72 3;  4N6M A;  4R9L A;  1E3R A;  4EXR A;  3NV0 A;  2XEP A;  1KC8 4;  3DZL A;  3MKI A;  4RNZ A;  2BMR B;  3DMC A;  5FW5 A;  2RSX A;  2Y73 A;  3E99 A;  1MOL A;  1N9J A;  1SJW A;  2P0X A;  4HM6 B;  4JRF A;  1OCV A;  5KP4 A;  3JUN A;  2HMN B;  3NHX A;  3SOY A;  1ULJ B;  1IVU A;  3G4S 3;  2GEY A;  3BNB A;  1YI2 3;  2Z77 A;  3EN8 A;  4FCZ A;  1Z1S A;  1TP6 A;  1Q42 A;  3ECF A;  2BNG A;  5IEO A;  2STD A;  2CWV A;  2IUJ A;  3S29 A;  3KZT A;  3X40 A;  4EBG A;  3G71 3;  1IQ8 A;  2JQ5 A;  3OW2 2;  2V1L A;  3JUO A;  3JUM A;  2ZL8 A;  1US1 A;  2INX A;  1HU9 A;  1OHP A;  1VQ6 3;  1DMQ A;  3QK9 A;  3FLJ A;  8CHO A;  2CWT A;  4AKZ A;  2OCT A;  3WA3 A;  3FZW A;  1JB5 A;  1VQO 3;  1QVG 2;  3HII A;  3V98 A;  4Q53 A;  1GS3 A;  2FNQ A;  1SPU A;  3T8N A;  1JNQ A;  1VQ7 3;  1FGM A;  3DGM A;  3UJM A;  1ISK A;  1OHS A;  3EC9 A;  5HGR A;  3G8Z A;  3KSE D;  2CW9 A;  5EVH A;  3OWY A;  5D83 A;  1IU7 A;  1RRL A;  4BTW A;  4N6O B;  1Y4K A;  2IUK A;  1QAF A;  3HIG A;  3DM8 A;  3K9M C;  2XGN A;  2D1W A;  1OF5 A;  4HBR A;  2IA7 A;  1DMN A;  5CF2 A;  1GD3 A;  3EBY A;  2Z7A A;  3KII A;  3F7X A;  4G1M B;  1JKG A;  1LNH A;  4AEQ A;  3DGO A;  1VQP 3;  3CC7 3;  2W9Q A;  2UX0 A;  2W03 A;  4I4K A;  1VZZ A;  5I97 A;  4FMD A;  2MF7 A;  4BTX A;  4L7K A;  2WOF A;  3LT9 A;  1ZO2 A;  2FGT A;  3NBB A;  1VQL 3;  1Q40 B;  1N8Q A;  1A2V A;  1OHO A;  3LTB A;  2CKF B;  4O02 B;  4MEI A;  3KN4 A;  2F99 A;  3HZP A;  3V92 A;  3UL5 A;  3WOD G;  3KFQ C;  1G96 A;  3VF1 A;  1M1X B;  1YVB I;  1RKY A;  4WWU C;  3LOY A;  3I55 3;  3CXC 2;  3LZA A;  2IMJ A;  4XM4 A;  5AI1 A;  3VSY A;  2YFJ B;  3F40 A;  2KCD A;  5KP1 A;  3GRD A;  3NQZ A;  3FGY A;  1AR0 A;  4IPB A;  2W0Q A;  2ZDJ A;  2RCD A;  3CC2 3;  1W6C A;  4L8P A;  3LTC A;  1AVK A;  2WO0 A;  5AYR B;  1KQS 2;  1PU4 A;  3KSP A;  1EA2 A;  1A67 A;  3GAX A;  3S28 A;  3NM2 A;  3X3Z A;  3K7C A;  2XRX B;  3CPW 2;  1MNL A;  2E2V A;  2OQE C;  4XBY A;  1EG9 B;  4LEH A;  3FG4 A;  4KFE A;  1L5G B;  3FH1 A;  3MG3 A;  3D3L A;  4HM2 B;  2MC8 A;  4J9A A;  1M1K 4;  3EB8 A;  2XFT A;  2RFR A;  5D82 A;  1UUW B;  2CG0 A;  4WYK A;  3RDE A;  3MYT A;  5AIG A;  1IVV A;  3DGL A;  3EJV A;  3PXM A;  1S5A A;  2K0M A;  2ML5 A;  1J2B A;  1W6Y A;  5IF6 A;  1YIJ 3;  1ULI B;  1VQ9 3;  1FGR A;  5DRE A;  4R1K A;  2P38 A;  1WQL B;  3FG1 A;  1OUN A;  3BNE A;  4NRE A;  3OX9 A;  2PNC A;  5AIH A;  2BO9 B;  4WP5 A;  3T8U A;  1E3V A;  2CG1 A;  1A90 A;  4LGQ A;  3UB1 A;  4XB5 A;  1BUQ A;  3PCR A;  4TX4 A;  3HX8 A;  4WHA A;  3CNX A;  4HZ9 B;  3WMD A;  3JUP A;  2I9W A;  3CCL 3;  2PZV A;  4O3V A;  4FMB A;  4OK0 A;  3HI7 A;  3X3X A;  2L4V A;  1NWW A;  2OOV A;  2GXF A;  1JV2 B;  2HML B;  3SXX A;  4OVM A;  1JJ2 2;  2QIY A;  2W2C A;  4JF8 A;  3NBJ A;  4FMC A;  1Q82 4;  4R4K A;  4H3U A;  2XF3 A;  1W5Z A;  3N54 B;  3EBT A;  1CQS A;  2WGO A;  3K0Z A;  3TDG A;  1WTH A;  2C10 A;  3GZB A;  3KKG A;  1VQ5 3;  2F86 B;  2E2T A;  4EV2 A;  1RRH A;  3PZW A;  4HM3 B;  1O7W B;  3HK4 A;  4WFO A;  5IG3 A;  1DYU A;  3BLZ A;  4ZM8 A;  1NDO B;  1M9G A;  3PS8 A;  3M8C A;  5KP3 A;  1DMM A;  1O7N B;  3PCS A;  2C11 A;  2WOH A;  4QWT A;  3G0K A;  1NU3 A;  5D81 A;  3S67 A;  4HVN A;  1QVF 2;  2B24 B;  1SQW A;  3MSO A;  1IQY A;  3FCS B;  1RJO A;  2W9P A;  1IK3 A;  1QAL A;  4N6U A;  1IT7 A;  3CCU 3;  1K73 4;  2Y74 A;  1TFO A;  1KWI A;  1TFK A;  1UI7 A;  3PYJ A;  3BND A;  3H3H A;  2HMO B;  4HM1 B;  4N6V 0;  3FF2 A;  3V99 A;  7STD A;  1W6G A;  5IG5 A;  2K54 A;  2F98 A;  1RN7 A;  3AMO B;  1K41 A;  2D42 A;  3IMA B;  4FCJ A;  4HM0 B;  1FGT A;  1W00 A;  4KVH A;  1NO3 A;  3O8Y A;  1IVW A;  3ER7 A;  3SED A;  1GY7 A;  3B4O A;  3X3Y A;  1YJ9 3;  4HM8 B;  4KFF A;  1TIJ A;  3Q90 A;  4HM4 B;  3LT8 A;  1K9M 4;  5JPU A;  2CWU A;  2CIU A;  4FMA A;  4N6L A;  3F8X A;  2XSO B;  1IVX A;  3F8H A;  3GZR A;  3EE1 A;  4XDV A;  2OTL 3;  4HKV B;  3BB9 A;  1F8N A;  3D9R A;  2YFI B;  5DRV A;  3GWR A;  3S5C A;  3LYG A;  3DY5 A;  3EHC A;  4RZM A;  4X2O A;  2HMK B;  1JB4 A;  1N5P A;  3FSD A;  4RNY A;  3WA2 X;  3NX0 A;  2QA4 3;  3B4P A;  3AMO A;  3PGB A;  4EYC A;  3S27 A;  5IW9 A;  3F14 A;  1UI8 A;  3K5T A;  3N9H A;  3GZY B;  4HM5 B;  1JB2 A;  1Q86 4;  4N6T A;  5BVB A;  3SVA A;  4K61 A;  2W6J H;  3ALA A;  2CFD A;  2YX9 A;  3NXJ A;  2BT3 A;  5CLK A;  2CFW A;  3CCJ 3;  1VQN 3;  1YJN 3;  4FR9 A;  3VGN A;  1NJI 4;  3MG1 A;  4AKY A;  1IDP A;  4XDW A;  3LTD A;  1Q81 4;  1Q40 A;  1PFP A;  2LYX A;  1STF I;  1YHQ 3;  3L0R A;  1D6Z A;  1GYB A;  3OXA A;  4O2H A;  3CCM 3;  2QEX 3;  4L8O A;  1ZX2 A;  3G16 A;  1DVC A;  1VQK 3;  3MPH A;  3QRD A;  2QGU A;  1IQX A;  1K28 A;  3N8B A;  4O8S A;  3IPT A;  1ROV A;  5A0O B;  1SII A;  4IT7 A;  4K1U A;  1FUW A;  4OUQ A;  4LSO A;  2HMM B;  1NB5 I;  4EV5 A;  1CYU A;  1W2Z A;  3OWS A;  3RGA A;  3CME 3;  1FGO A;  5IER A;  6STD A;  1AV4 A;  4HM7 B;  4ORL A;  3CCR 3;  4KFD A;  2P05 A;  2CHC A;  3NV0 B;  4XBX A;  2OTJ 3;  1D6U A;  1W01 A;  1A2K A;  2LQV A;  3CMA 3;  2WGQ A;  1QJG A;  5STD A;  5AIF A;  2KXG A;  1O7P B;  3CC4 3;  3X41 A;  3U1W A;  3KE7 A;  4K90 B;  5IG0 A;  1C7H A;  4N3V A;  1QAK A;  3I0Y A;  3EN1 B;  5JPP A;  3MWZ A;  2KRT A;  3RGR A;  5JBS A;  2XGL A;  3EX9 A;  1HKX A;  3Q2P A;  5FGO A;  2BMQ B;  1ASK A;  4U13 A;  1OPY A;  2HMJ B;  3A76 A;  5LC6 A;  2P0M A;  3WOE B;  1IT8 A;  1QMA A;  4STD A;  2GEX A;  5IEP A;  2CFK A;  2FXT A;  3STD A;  1DVD A;  3SOA A;  2BHM A;  2GU1 A;  3CNM A;  2OWP A;  1IV9 A;  3X42 A;  3J7Y d;  5IG4 A;  2XFS A;  1OGX A;  4H61 A;  3LML A;  4CDL A;  3CPO A;  2SBL A;  2B1X B;  4MMY B;  2XSH B;  3NBR A;  5AYS C;  3T0U A;  3DUK A;  3I56 3;  1LOX A;  2Z6B A;  1W02 A;  4HJL B;  3MG2 A;  4R80 A;  5TGN A;  5BXQ A;  3DGN A;  1O7G B;  1TUH A;  5EEO A;  1AVL A;  1T5Y A;  1W4N A;  1OAC A;  4J8T A;  2W04 A;  2GBX B;  3CCE 3;  2O3O A;  1U5O A;  4R9K A;  2GU3 A;  1EKM A;  1E97 A;  3EF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...