3DM8A

Crystal structure of putative isomerase from rhodopseudomonas palustris
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
135
structure length
135
Chain Sequence
MTEHSLWRFSRALHRALNDRQTEELATIIDDNIDWAIYGPIDMFPFFGARQGKAAVLEVCRQIADSVRIYRYHRESVMLGIDSAASMVRYSLTAAGTNRPISVRMALFTQFQNGRLTNLRMVLDTFDLVEQALGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein RPA4348
publication title Crystal Structure of Putative Isomerase from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 44
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dm8A00
1VZZA 1BUQA 5DREA 3G16A 2GXFA 5D81A 5STDA 2STDA 5CF2A 1OPYA 3DUKA 3STDA 4L7KA 4RZMA 3B8LA 2RGQA 1SJWA 5CXOA 4N3VA 3ER7A 3B4OA 4X2HA 2GEYA 3IPTA 1OHOA 3NV0B 3JUQA 3NUVA 3HZPA 7STDA 4HJLB 4LEHA 3K0ZA 3ECFA 3FF0A 4XDVA 1O7HB 5IEPA 3KZTA 3FH1A 3UNLA 1OCVA 4K1VA 1Z1SA 1E97A 2BNGA 2CKFB 2F99A 5AEWB 1UUVB 4HM4B 5AIIA 1E3VA 5HGRA 3F8XA 4LMIA 1O7GB 3D9RA 1OF5A 1U5OA 1ISKA 1NWWA 1GY6A 4L8OA 1W00A 5AIGA 3CNXA 2YFLB 3SEDA 4HVNA 1TUHA 2W2CA 4XDWA 3EC9A 1CQSA 5IG5A 3G0KA 3K7CA 3GZBA 1HKXA 4H3UA 5IG4A 1C7HA 3F14A 3B7CA 4FCMA 2K54A 1S5AA 2HMOB 4CDLA 1NDOB 5CK6A 3HK4A 3NHXA 3SOAA 3FF2A 6STDA 1EA2A 4J8TA 3BB9A 2F86B 2R4IA 4XB5A 5CLKA 2HMLB 5KP1A 3EHCA 1OF5B 1ZO2A 2B1XB 3EBYA 2XR8B 1DMQA 2GEXA 4I4KA 4HM8B 3JUNA 4WYKA 3VSYA 3H51A 2YFIB 3NM2A 2Z7AA 2UX0A 1NU3A 2GBXB 3UJMA 2A15A 2YFJB 3FKAA 4OUQA 5AI1A 1JB4A 2CHCA 3OWYA 3EBTA 4HZ9B 1GS3A 1OGXA 2PZVA 3GZYB 1W6YA 5IG3A 1JB2A 4STDA 1TP6A 2F98A 2HMNB 3F7XA 1GY7A 3DM8A 5BVBA 3MKIA 3CU3A 4WP5A 3G8ZA 2IMJA 1O7NB 3GRDA 3GWRA 2QIYA 3SOYA 3B4PA 5KP3A 4KVHA 4X2OA 3EN1B 5IENA 3Q90A 3LZAA 2OWPA 5D83A 2JQ5A 3KSPA 1ULIB 4WYKB 3OX9A 4PEJA 3T8NA 5D82A 1QMAA 2XSOB 4HKVB 1O7MB 1UUWB 3NXJA 3CPOA 2Z76A 1OHPA 2BMQB 1GY5A 1K41A 3JUMA 1E3RA 1JB5A 5JPUA 1A2KA 5IERA 1O7PB 3CNMA 3MG3A 3FSDA 3GZRA 3JUPA 1STDA 2XRXB 2INXA 1EG9B 3LYGA 4HZBB 3JUOA 4XBXA 3F8HA 2B24B 4WWUC 4HM2B 2GBWB 1ULJB 3EX9A 5AIHA 3NBRA 4R1KA 1GYBA 1QJGA 5KP4A 3MG1A 1Q40A 4Q53A 3MHEA 1OGZA 5FW5A 3F7SA 2Z77A 1ZX2A 3OWUA 1DMMA 1WQLB 5EVHA 1DMNA 4HM0B 1JN5A 2RFRA 3DXOA 4XBYA 3OXAA 1OUNA 3DMCA 4U13A 1OH0A 1IDPA 2BMRB 2QGUA 3OV4A 2BMOB 4LGQA 5BXQA 3A76A 4ORLA 5DRVA 3EQQB 3KE7A 3BLZA 4HM3B 3M8CA 3FGYA 3H3HA 4HM5B 3I0YA 3HX8A 4XBTA 3RGRA 3F40A 5IEOA 4R9KA 5IG0A 5TGNA 1W01A 1OHSA 2HMMB 2HMJB 3MSOA 2HMKB 4OVMA 3ROBA 1JKGA 5G2GA 2I9WA 1ASKA 3EF8A 4MJDA 3EN8A 4R9LA 4FCJA 1Q40B 4HM7B 3VGNA 5AEUB 2RCDA 1JN5B 3F9SA 1AR0A 3FLJA 4XM4A 4L8PA 4K1UA 3T8UA 3DZLA 3S5CA 4J9AA 4GB5A 3EJVA 4HM6B 4IIAA 8CHOA 3NV0A 3RGAA 5AIFA 4HM1B 5CF1A 3MG2A 3OWSA 1W02A 3KKGA 1Q42A 3GZXB 1JKGB 3WMDA 3MYTA 1O7WB 3E99A 5JPPA 2XSHB 5IF6A 3FZWA
chains in the Genus database with same CATH superfamily
2MF7A 2WGOA 1NB5I 1VZZA 1BUQA 4CJNA 1UI7A 5DREA 1I3IA 1LOWA 2IY2A 1LNIA 2F56A 3G16A 2GXFA 5D81A 5STDA 2PNCA 3PCRA 5RNTA 1FUWA 1B20A 1U8CB 3NBJA 2STDA 5CF2A 1GD3A 1OPYA 1PFPA 1BOXA 2O3OA 1N8QA 3DUKA 4TX4A 3STDA 1B2ZA 1W6CA 4L7KA 4RZMA 1A67A 1FUSA 2RBIA 1BSEA 3B8LA 4J5KA 2RGQA 1IT8A 1GD4A 2FGTA 1SJWA 4RNYA 5CXOA 4N3VA 1GSPA 3ER7A 2K0MA 3X42A 2CFKA 3B4OA 4X2HA 3S28A 2CH9A 3HOHA 2GEYA 3ZG5A 3IPTA 1OHOA 3NV0B 3JUQA 3NUVA 3HZPA 3K9MC 3CC23 1YJN3 2LQVA 1EQKA 1HU9A 1Q814 7STDA 1QVG2 1VQN3 4HJLB 4LEHA 1I70A 7GSPA 3K0ZA 2IUJA 3ALAA 2CFWA 3ECFA 1K8A4 1LQMB 1D6ZA 2IYJA 1ZGXA 2SBLA 1JRQA 3FF0A 1A2PA 2ZHXB 1PY3A 2CW9A 3SLUA 4EV2A 4MMXB 1JV2B 9RNTA 2C4BA 3CCV3 3X40A 1M1K4 2IUKA 3SVAA 3LH4A 4N6LA 1N9JA 3LTDA 2QA43 1M904 4XDVA 1Q864 1RGEA 1O7HB 4ZM8A 1MWUA 2CIUA 3FG3A 1I0VA 5IEPA 3KZTA 5FGOA 3S67A 3FH1A 3CCE3 3HIIA 3UNLA 2IA7A 1VQO3 1OCVA 4RBNA 4K1VA 1Z1SA 1VQM3 1E97A 2O9UX 1AVLA 3N8BA 1ROVA 4FR9A 1G0TA 2FNQA 1W2B2 2E2TA 2BNGA 2CKFB 3LTCA 1JZOA 2F99A 1V58A 1B27A 2R41A 1UUVB 5AEWB 1D6UA 1JJ22 3NX0A 1FW7A 4WFOA 4HM4B 5AIIA 1STFI 1I2FA 4BIRA 1E3VA 1T2IA 5I97A 5HGRA 2XFSA 3F8XA 2W6JH 1FYSA 4LMIA 1O7GB 3D9RA 1OF5A 1U5OA 1V74A 2XGNA 1ISKA 4EC6A 1N8R4 1NWWA 1GY6A 1RTUA 2OQEC 4L8OA 1GOUA 1CH0A 1W00A 1JNQA 4O2HA 5AIGA 2CFLA 1Q824 3O8YA 3CNXA 2YFLB 3D3LA 3SEDA 1LOXA 1YGWA 4HVNA 4AKYA 1UDII 1TUHA 2W2CA 4NREA 4HOHA 1YIJ3 1VQ83 3D4AA 1Q7HA 3SX1A 1BSCA 1QAFA 4KFFA 5ELJA 6GSPA 1VQL3 4XDWA 1RCLA 4JF8A 3X3ZA 4HAAA 1UCJA 3EC9A 2RSXA 3BIRA 1CQSA 3IJEB 3X3XA 5IG5A 1FGRA 3LOYA 3G0KA 3K7CA 2E2UA 2P38A 3GZBA 3JVCA 3Q2PA 1IVXA 3CCR3 1GMPA 4O3VA 2WO0A 1HKXA 1RRHA 2SARA 3DGYA 4H3UA 1RCKA 2ZL8A 3GAXA 1RJOA 3DH2A 4IT7A 5IG4A 1C7HA 3F14A 3S27A 1JBTA 3FCSB 1RN7A 4N6OB 3DGLA 4RNZA 1MWRA 3B7CA 4FCMA 1PYLA 2K54A 1S5AA 1I2GA 2HMOB 3BNBA 5AYSC 3G6E3 2W9PA 4CDLA 3PYJA 1UCKA 1VQQA 1NDOB 3KFQC 5CK6A 2C10A 4QWTA 3HK4A 3NHXA 3SOAA 4FMBA 3RDEA 1OACA 4N6V0 1VQ43 2RNTA 3FF2A 1MGWA 6STDA 1EA2A 4J8TA 1JBSA 3WODG 3D5GA 3URPA 1IU7A 1RHLA 3BB9A 3J7Yd 2F86B 5GSPA 1AQZA 1B2XA 1T2HA 4FMCA 2R4IA 1M1XB 4HBRA 4XB5A 5CLKA 2HMLB 1US1A 5KP1A 3UL5A 3GSPA 3EHCA 1Q7Y4 1OF5B 1ZO2A 3BU4A 3K5TA 2B1XB 3EBYA 1TJDA 2XR8B 1BANA 1W5ZA 1YGEA 1FZUA 1C54A 1DMQA 2GEXA 2YX9A 3NQYA 4I4KA 1BNJA 5M19A 1CEWI 2W9QA 3JUNA 4HM8B 5BU4A 3V99A 4WYKA 3DGNA 3VSYA 2F5WA 1BUJA 3D5IA 3H51A 1UGHI 2YFIB 3NM2A 1DVCA 4MMZB 4EW5A 2Z7AA 1Y4KA 3PS8A 2ZDJA 2UX0A 1UGIA 2K3DA 1GOVA 1JZDA 2Z6BA 3ZFZA 1W2ZA 1K9M4 4O02B 1BGSA 3AHWA 1VQ53 4AKZA 1HYFA 1MGRA 1NU3A 1SIIA 2GBXB 2L1SA 1LXEA 3CC43 3CD63 3UJMA 2A15A 1WMNA 2YFJB 1EUIC 3FKAA 4OUQA 1IVWA 4EXRA 4BTXA 1G96A 4NPBA 5AI1A 1FGMA 3LTAA 1B3SA 3KIIA 1TRPA 1JB4A 2CHCA 3RNTA 4G1MB 2C11A 3OWYA 3CXC2 3CPW2 3EBTA 4GL6A 4HZ9B 3WHOA 2BIRA 1YIT3 1JBRA 1BAOA 1GS3A 1OGXA 5BIRA 2PZVA 3GZYB 1FGQA 2OTJ3 1W6YA 3EE1A 5IG3A 1JB2A 3PCSA 8RNTA 4STDA 3CCQ3 1WMPA 1IVUA 1FGOA 1TP6A 4EBGA 1VQ73 3ZG0A 1AVKA 1KD14 1D6YA 1I0XA 2F98A 1BNEA 2HMNB 3DGMA 3F7XA 1FGTA 1CYVA 1GY7A 3DM8A 5BVBA 1BNRA 3N9HA 3MKIA 1W7CA 3A5EA 3CU3A 4BTYA 1TFKA 2W04A 1RNTA 4WP5A 3KSED 3G8ZA 1YJW3 3CMA3 3OW22 3L0RA 2XGLA 2F5MA 3EB8A 1NO3A 2IMJA 4OK0A 1O7NB 3GRDA 3SXXA 3GWRA 2QIYA 1X1WA 3SOYA 3B4PA 4DKIA 4KVHA 5KP3A 4I5QA 4X2OA 1LOYA 3EN1B 2CWUA 2XF3A 5IENA 3AMOA 3Q90A 3LZAA 1V57A 2OWPA 2OOVA 5JBSA 1YVBI 2WOHA 5D83A 2JQ5A 1QALA 1BRHA 1BNFA 1KQS2 3KSPA 1ULIB 2H0GA 3BNDA 3OX9A 4WYKB 1L5GB 3T0UA 3NBBA 1ZS7A 4PEJA 5A0OB 3T8NA 2BHMA 1YNVX 5D82A 1QMAA 1BSDA 1RN1A 2ML5A 1IVVA 1R4CA 2KF4A 2XSOB 3WOFB 4HKVB 1RGAA 3CCL3 2H0IA 1TFOA 4EYCA 2W56A 4R4KA 3LMLA 4KT3B 1O7MB 1UUWB 3NXJA 1BNGA 3CPOA 2Z76A 1KWIA 1Q9EA 1IQXA 1OHPA 2CFGA 2W03A 1IV7A 1B2MA 2BMQB 3Q1CA 1N5HA 1EEJA 1GY5A 1BNIA 3HI7A 3Q3FA 1K41A 3G713 1FUTA 3JUMA 3I563 1E3RA 4R80A 3S29A 1BRGA 1JB5A 1A90A 1T5YA 3BNEA 2XFTA 5JPUA 2M7OA 3SYUA 1A2KA 5IERA 1GOYA 5IW9A 1O7PB 2CX0A 1SQWA 3X41A 3CNMA 3MG3A 3FG1A 4KFEA 3FSDA 3GZRA 4MMYB 1B2UA 1BRNL 1IYYA 3LXUX 2WGQA 5LC6A 1W4NA 3JUPA 1LQGC 1STDA 1DETA 3LT8A 2CG1A 2XRXB 2AAEA 2INXA 1EG9B 2ZA4A 2CG0A 4LSOA 7RNTA 3LYGA 4HZBB 1RLSA 3JUOA 3CCM3 3BNCA 4XBXA 1MWTA 2KF3A 1SARA 1RRLA 1RGKA 2CWVA 3F8HA 2MC8A 1SPUA 1NNVA 2B24B 1S723 1RMSA 1BNSA 4WWUC 3AGNA 1WNHA 1LRAA 2GBWB 1ULJB 3AMOB 4HM2B 3UL6A 3CCS3 1N9EA 3EX9A 3TDGA 2E2VA 2BT3A 1BRKA 3NBRA 4JRFA 4R1KA 1RGLA 5AIHA 1IT7A 4HYZA 3U97A 1GYBA 1QJGA 5KP4A 3MG1A 1IK3A 1G02A 1RKYA 1I2EA 1Q40A 4Q53A 3MHEA 5M1AA 3DGOA 1OGZA 5FW5A 3F7SA 4MEIA 2Z77A 1BSAA 2P09A 1ZX2A 4IPBA 3OWUA 1DMMA 1WQLB 5EVHA 3WOEB 1DMNA 3KN4A 1JN5A 2RFRA 3QRDA 4HM0B 2KAAA 3DXOA 3VF1A 1W6GA 4XBYA 1EKMA 2GU1A 3OXAA 2W56B 2GSPA 3KCHA 2KF6A 1N5PA 2Q07A 1OUNA 3DMCA 4U13A 1VQP3 3AGOA 1X1YA 1B21A 5LC7A 1RGCA 1UCIA 1M9GA 5EEOA 1OH0A 3QK9A 3WA3A 3DY5A 1AY7A 1IDPA 2BMRB 2QGUA 3OV4A 1RNBA 2BMOB 4LGQA 1YVSA 2P05A 5BXQA 3WR2A 1K734 3A76A 2UGIA 4ORLA 5DRVA 2W0QA 3WA2X 4BL3A 3PGBA 6RNTA 1DYUA 2GU3A 1F8NA 3EQQB 1VQ63 4WHAA 1UUGB 3CCU3 3KE7A 3BLZA 4HM3B 3CC73 3M8CA 1RSNA 2D42A 3FGYA 3H3HA 4HM5B 2CC3A 1AV4A 1KC84 2J8XB 3I0YA 4RNTA 4AEQA 1LOVA 3HX8A 1X1UA 3IMAB 4XBTA 3F40A 5IEOA 1I8VA 3RGRA 4ILFA 1GMRA 4R9KA 1BSBA 4N6TA 4BU4A 1DE3A 2OCTA 4K61A 4J5GA 4KZ1A 1GMQA 1J2BA 5IG0A 5TGNA 1IQYA 4CCVA 4O8SA 2BO9B 1W01A 2L4VA 2AADA 1OHSA 1YHQ3 2OQEA 2HMMB 1WMOA 3X3YA 1RGGA 2HMJB 3MSOA 1UI8A 2HMKB 2KF5A 3PZWA 1T3BA 4N6MA 4OVMA 1MWSA 3ROBA 1VQK3 1JKGA 2KCDA 5G2GA 2I9WA 1VQ93 1ASKA 1PU4A 2BU4A 1X1XA 1CYUA 2F4YA 3EF8A 1SIHA 1MNLA 4MJDA 3EN8A 4R9LA 1UW1A 2XEPA 3D79A 1MOLA 3MPHA 4FCJA 1Q40B 1BRJA 1KSIA 1K28A 1ROAA 2JDIH 4HM7B 4N6NB 4BTWA 3VGNA 5AEUB 2OTL3 4LYLB 2P0MA 2QEX3 2RCDA 1JN5B 2P0XA 1RDSA 1YI23 1QAKA 2CK3H 1R4YA 3F9SA 5ELUA 2HOHA 1AR0A 2KXGA 5AYRB 1A2VA 4FCZA 4FMAA 1NB3I 1IV9A 1RGFA 2Y74A 3N54B 4LZIA 3CCJ3 1TIJA 3FLJA 4XM4A 3K63A 4L8PA 1LVNA 2CX1A 4FMDA 4K1UA 1I3FA 1UCLA 5EQLA 3AHSA 2UUGC 5M18A 3T8UA 1BVIA 3DZLA 3S5CA 5HOHA 1TRQA 2D1WA 2XH9A 1BIRA 4J9AA 1DVDA 4GB5A 3EJVA 4HM6B 4IIAA 2V1LA 3MWZA 4N6UA 3FG4A 3PXMA 2OOVC 4CPKA 1QVF2 8CHOA 2Y73A 2CFDA 3NV0A 4H61A 3I553 1FA3A 1BU4A 3RGAA 2H0HA 1HZ1A 4K90B 5AIFA 3NM7A 1BRIA 3UB1A 4HM1B 4KFDA 2FXTA 1TU5A 3V92A 5CF1A 1RN4A 3MG2A 3WDGB 1TTOA 3LT9A 3NQZA 3OWSA 3V98A 1B2SA 1W02A 3KKGA 1Q42A 3GZXB 4EV5A 1YJ93 1RGHA 1JKGB 2ML6A 3G4S3 4GSPA 5G1KA 5G1LA 3WMDA 4GHOA 3U1WA 3HIGA 3CME3 1LNHA 2WOFA 4NHFA 2LYXA 2KRTA 2CWTA 4BL2A 1BRSA 3MYTA 1NJI4 1O7WB 1IQ8A 3E99A 5JPPA 2XSHB 5IF6A 3LTBA 1WTHA 3FZWA
chains in the Genus database with same CATH topology
2MF7A 2WGOA 1NB5I 1VZZA 1BUQA 1UI7A 5DREA 3G16A 2GXFA 5D81A 5STDA 2PNCA 3PCRA 1FUWA 1U8CB 3NBJA 2STDA 5CF2A 1GD3A 1OPYA 1PFPA 3DUKA 2O3OA 1N8QA 4TX4A 3STDA 1W6CA 4L7KA 4RZMA 1A67A 3B8LA 2RGQA 1IT8A 1GD4A 2FGTA 1SJWA 4RNYA 5CXOA 4N3VA 3ER7A 3X42A 2K0MA 2CFKA 3B4OA 4X2HA 3S28A 2CH9A 2GEYA 3IPTA 1OHOA 3NV0B 3JUQA 3NUVA 3HZPA 3K9MC 1YJN3 2LQVA 1EQKA 1HU9A 1QVG2 7STDA 1VQN3 4HJLB 4LEHA 3K0ZA 2IUJA 3ALAA 2CFWA 3ECFA 1K8A4 1D6ZA 2SBLA 1JRQA 3FF0A 2CW9A 3SLUA 4EV2A 4MMXB 1JV2B 3CCV3 3X40A 1M1K4 2IUKA 3SVAA 3LH4A 4N6LA 1N9JA 3LTDA 2QA43 1M904 4XDVA 1Q864 1O7HB 4ZM8A 2CIUA 3FG3A 5IEPA 3KZTA 5FGOA 3S67A 3FH1A 3CCE3 3HIIA 3UNLA 2IA7A 1VQO3 1OCVA 4RBNA 4K1VA 1Z1SA 1VQM3 1E97A 2O9UX 1AVLA 3N8BA 1ROVA 4FR9A 2FNQA 1W2B2 2E2TA 2BNGA 2CKFB 3LTCA 2F99A 5AEWB 1UUVB 1JJ22 1D6UA 3NX0A 4WFOA 4HM4B 5AIIA 1STFI 1E3VA 5I97A 5HGRA 2XFSA 3F8XA 2W6JH 4LMIA 1O7GB 3D9RA 1OF5A 1U5OA 1V74A 2XGNA 1ISKA 4EC6A 1N8R4 1NWWA 1GY6A 2OQEC 4L8OA 1W00A 1JNQA 4O2HA 5AIGA 2CFLA 1Q824 3O8YA 3CNXA 2YFLB 3D3LA 3SEDA 1LOXA 4HVNA 4AKYA 1TUHA 2W2CA 4NREA 1YIJ3 1VQ83 3SX1A 1QAFA 1VQL3 4KFFA 5ELJA 4XDWA 4JF8A 3X3ZA 3EC9A 2RSXA 1CQSA 3IJEB 3X3XA 5IG5A 1FGRA 3LOYA 3G0KA 3K7CA 2E2UA 2P38A 3GZBA 3JVCA 3Q2PA 1IVXA 3CCR3 4O3VA 2WO0A 1HKXA 1RRHA 4H3UA 2ZL8A 3GAXA 1RJOA 4IT7A 5IG4A 1C7HA 3F14A 3S27A 3FCSB 1RN7A 4N6OB 3DGLA 4RNZA 3B7CA 4FCMA 2K54A 1S5AA 2HMOB 3BNBA 5AYSC 3G6E3 2W9PA 4CDLA 3PYJA 1NDOB 3KFQC 5CK6A 2C10A 4QWTA 3HK4A 3NHXA 3SOAA 4FMBA 3RDEA 1OACA 4N6V0 1VQ43 3FF2A 6STDA 1EA2A 4J8TA 3WODG 1IU7A 3BB9A 3J7Yd 2F86B 4FMCA 4HBRA 2R4IA 1M1XB 4XB5A 5CLKA 2HMLB 1US1A 5KP1A 3UL5A 3EHCA 1Q7Y4 1OF5B 1ZO2A 3K5TA 2B1XB 3EBYA 2XR8B 1W5ZA 1YGEA 1DMQA 2GEXA 2YX9A 3NQYA 4I4KA 1CEWI 2W9QA 3JUNA 4HM8B 3V99A 4WYKA 3DGNA 3VSYA 3H51A 2YFIB 3NM2A 1DVCA 4MMZB 2Z7AA 1Y4KA 3PS8A 2ZDJA 2UX0A 2Z6BA 1W2ZA 1K9M4 4O02B 1VQ53 4AKZA 1NU3A 1SIIA 2GBXB 1LXEA 3CC43 3CD63 3UJMA 2A15A 1WMNA 2YFJB 3FKAA 4OUQA 1IVWA 4EXRA 4BTXA 1G96A 5AI1A 1FGMA 3LTAA 3KIIA 1JB4A 2CHCA 3CPW2 4G1MB 2C11A 3OWYA 3CXC2 3CC23 3EBTA 4GL6A 4HZ9B 1YIT3 1Q814 1GS3A 1OGXA 2PZVA 3GZYB 1FGQA 2OTJ3 1W6YA 3EE1A 5IG3A 1JB2A 3PCSA 4STDA 3CCQ3 1WMPA 1IVUA 1FGOA 1TP6A 4EBGA 1VQ73 1AVKA 1KD14 1D6YA 2F98A 2HMNB 3DGMA 3F7XA 1FGTA 1CYVA 1GY7A 3DM8A 5BVBA 3N9HA 3MKIA 1W7CA 3CU3A 4BTYA 1TFKA 2W04A 4WP5A 3KSED 3G8ZA 1YJW3 3CMA3 3OW22 3L0RA 2XGLA 3EB8A 1NO3A 2IMJA 4OK0A 1O7NB 3GRDA 3SXXA 3GWRA 2QIYA 3SOYA 3B4PA 4KVHA 5KP3A 4X2OA 3EN1B 2CWUA 2XF3A 5IENA 3AMOA 3Q90A 3LZAA 2OWPA 2OOVA 5JBSA 1YVBI 2WOHA 5D83A 2JQ5A 1QALA 1KQS2 3KSPA 1ULIB 3BNDA 4WYKB 3OX9A 1L5GB 3T0UA 3NBBA 4PEJA 5A0OB 3T8NA 2BHMA 5D82A 1QMAA 2ML5A 1IVVA 1R4CA 2XSOB 3WOFB 4HKVB 3CCL3 1TFOA 4EYCA 2W56A 4R4KA 3LMLA 1O7MB 1UUWB 3NXJA 3CPOA 2Z76A 1KWIA 1IQXA 1OHPA 2CFGA 2W03A 1IV7A 2BMQB 3Q1CA 1N5HA 1GY5A 3HI7A 1K41A 3G713 3JUMA 3I563 1E3RA 4R80A 3S29A 1JB5A 1A90A 1T5YA 3BNEA 2XFTA 5JPUA 2M7OA 1A2KA 5IERA 5IW9A 1O7PB 1SQWA 3X41A 3CNMA 3MG3A 3FG1A 4KFEA 3FSDA 3GZRA 4MMYB 3LXUX 2WGQA 1W4NA 3JUPA 1STDA 3LT8A 2CG1A 2XRXB 2INXA 1EG9B 2CG0A 4LSOA 3LYGA 4HZBB 3JUOA 3CCM3 3BNCA 4XBXA 1RRLA 2CWVA 2MC8A 3F8HA 1SPUA 2B24B 1S723 4WWUC 1WNHA 2GBWB 3AMOB 1ULJB 4HM2B 3UL6A 3CCS3 1N9EA 3EX9A 3TDGA 2E2VA 2BT3A 4JRFA 3NBRA 4R1KA 5AIHA 3U97A 1IT7A 4HYZA 1GYBA 1QJGA 5KP4A 3MG1A 1IK3A 1RKYA 1Q40A 4Q53A 3MHEA 3DGOA 1OGZA 5FW5A 3F7SA 4MEIA 2Z77A 2P09A 1ZX2A 4IPBA 3OWUA 1DMMA 1WQLB 5EVHA 3WOEB 1DMNA 3KN4A 1JN5A 2RFRA 3QRDA 4HM0B 3DXOA 3VF1A 1W6GA 4XBYA 1EKMA 2GU1A 3OXAA 2W56B 1VQP3 2Q07A 1N5PA 1OUNA 3DMCA 4U13A 5LC7A 1M9GA 5EEOA 1OH0A 3QK9A 3WA3A 3DY5A 1IDPA 2BMRB 2QGUA 3OV4A 2BMOB 4LGQA 2P05A 5BXQA 1K734 3A76A 4ORLA 5DRVA 3WA2X 2W0QA 3PGBA 1DYUA 2GU3A 1F8NA 3EQQB 1VQ63 4WHAA 3CCU3 3KE7A 3BLZA 4HM3B 3CC73 3M8CA 2D42A 3FGYA 3H3HA 4HM5B 2CC3A 1AV4A 1KC84 3I0YA 4AEQA 3HX8A 3IMAB 4XBTA 3RGRA 3F40A 5IEOA 4R9KA 4N6TA 2OCTA 4K61A 4KZ1A 1J2BA 5IG0A 5TGNA 1IQYA 4CCVA 4O8SA 2BO9B 1W01A 2L4VA 1OHSA 1YHQ3 2OQEA 2HMMB 1WMOA 3X3YA 2HMJB 3MSOA 5LC6A 1UI8A 2HMKB 4N6MA 3PZWA 4OVMA 3ROBA 1VQK3 1JKGA 2KCDA 5G2GA 2I9WA 1VQ93 1ASKA 1PU4A 1CYUA 3EF8A 1SIHA 1MNLA 4MJDA 3EN8A 4R9LA 1UW1A 2XEPA 1MOLA 3MPHA 4FCJA 1Q40B 1KSIA 1K28A 1ROAA 2JDIH 4HM7B 4N6NB 4BTWA 3VGNA 5AEUB 2OTL3 2P0MA 2QEX3 2RCDA 1JN5B 2P0XA 1YI23 1QAKA 2CK3H 3F9SA 5ELUA 1AR0A 2KXGA 5AYRB 1A2VA 4FCZA 4FMAA 1NB3I 1IV9A 2Y74A 3N54B 4LZIA 3CCJ3 1TIJA 3FLJA 4XM4A 3K63A 4L8PA 1LVNA 4FMDA 4K1UA 5EQLA 3T8UA 3DZLA 3S5CA 2D1WA 2XH9A 4J9AA 1DVDA 4GB5A 3EJVA 4HM6B 4IIAA 2V1LA 3MWZA 4N6UA 3FG4A 3PXMA 2OOVC 1QVF2 8CHOA 2Y73A 2CFDA 3NV0A 4H61A 3I553 1FA3A 3RGAA 4K90B 5AIFA 3NM7A 3UB1A 4HM1B 4KFDA 2FXTA 1TU5A 3V92A 5CF1A 3MG2A 3WDGB 3LT9A 3NQZA 3OWSA 3V98A 1W02A 3KKGA 1Q42A 3GZXB 4EV5A 1YJ93 1JKGB 2ML6A 3G4S3 3WMDA 3U1WA 3HIGA 3CME3 1LNHA 2WOFA 4NHFA 2LYXA 2KRTA 2CWTA 3MYTA 1NJI4 1O7WB 1IQ8A 3E99A 5JPPA 2XSHB 5IF6A 3LTBA 1WTHA 3FZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZZ A;  1BUQ A;  5DRE A;  3G16 A;  2GXF A;  5D81 A;  5STD A;  2STD A;  5CF2 A;  1OPY A;  3DUK A;  3STD A;  4L7K A;  4RZM A;  3B8L A;  2RGQ A;  1SJW A;  5CXO A;  4N3V A;  3ER7 A;  3B4O A;  4X2H A;  2GEY A;  3IPT A;  1OHO A;  3NV0 B;  3JUQ A;  3NUV A;  3HZP A;  7STD A;  4HJL B;  4LEH A;  3K0Z A;  3ECF A;  3FF0 A;  4XDV A;  1O7H B;  5IEP A;  3KZT A;  3FH1 A;  3UNL A;  1OCV A;  4K1V A;  1Z1S A;  1E97 A;  2BNG A;  2CKF B;  2F99 A;  5AEW B;  1UUV B;  4HM4 B;  5AII A;  1E3V A;  5HGR A;  3F8X A;  4LMI A;  1O7G B;  3D9R A;  1OF5 A;  1U5O A;  1ISK A;  1NWW A;  1GY6 A;  4L8O A;  1W00 A;  5AIG A;  3CNX A;  2YFL B;  3SED A;  4HVN A;  1TUH A;  2W2C A;  4XDW A;  3EC9 A;  1CQS A;  5IG5 A;  3G0K A;  3K7C A;  3GZB A;  1HKX A;  4H3U A;  5IG4 A;  1C7H A;  3F14 A;  3B7C A;  4FCM A;  2K54 A;  1S5A A;  2HMO B;  4CDL A;  1NDO B;  5CK6 A;  3HK4 A;  3NHX A;  3SOA A;  3FF2 A;  6STD A;  1EA2 A;  4J8T A;  3BB9 A;  2F86 B;  2R4I A;  4XB5 A;  5CLK A;  2HML B;  5KP1 A;  3EHC A;  1OF5 B;  1ZO2 A;  2B1X B;  3EBY A;  2XR8 B;  1DMQ A;  2GEX A;  4I4K A;  4HM8 B;  3JUN A;  4WYK A;  3VSY A;  3H51 A;  2YFI B;  3NM2 A;  2Z7A A;  2UX0 A;  1NU3 A;  2GBX B;  3UJM A;  2A15 A;  2YFJ B;  3FKA A;  4OUQ A;  5AI1 A;  1JB4 A;  2CHC A;  3OWY A;  3EBT A;  4HZ9 B;  1GS3 A;  1OGX A;  2PZV A;  3GZY B;  1W6Y A;  5IG3 A;  1JB2 A;  4STD A;  1TP6 A;  2F98 A;  2HMN B;  3F7X A;  1GY7 A;  3DM8 A;  5BVB A;  3MKI A;  3CU3 A;  4WP5 A;  3G8Z A;  2IMJ A;  1O7N B;  3GRD A;  3GWR A;  2QIY A;  3SOY A;  3B4P A;  5KP3 A;  4KVH A;  4X2O A;  3EN1 B;  5IEN A;  3Q90 A;  3LZA A;  2OWP A;  5D83 A;  2JQ5 A;  3KSP A;  1ULI B;  4WYK B;  3OX9 A;  4PEJ A;  3T8N A;  5D82 A;  1QMA A;  2XSO B;  4HKV B;  1O7M B;  1UUW B;  3NXJ A;  3CPO A;  2Z76 A;  1OHP A;  2BMQ B;  1GY5 A;  1K41 A;  3JUM A;  1E3R A;  1JB5 A;  5JPU A;  1A2K A;  5IER A;  1O7P B;  3CNM A;  3MG3 A;  3FSD A;  3GZR A;  3JUP A;  1STD A;  2XRX B;  2INX A;  1EG9 B;  3LYG A;  4HZB B;  3JUO A;  4XBX A;  3F8H A;  2B24 B;  4WWU C;  4HM2 B;  2GBW B;  1ULJ B;  3EX9 A;  5AIH A;  3NBR A;  4R1K A;  1GYB A;  1QJG A;  5KP4 A;  3MG1 A;  1Q40 A;  4Q53 A;  3MHE A;  1OGZ A;  5FW5 A;  3F7S A;  2Z77 A;  1ZX2 A;  3OWU A;  1DMM A;  1WQL B;  5EVH A;  1DMN A;  4HM0 B;  1JN5 A;  2RFR A;  3DXO A;  4XBY A;  3OXA A;  1OUN A;  3DMC A;  4U13 A;  1OH0 A;  1IDP A;  2BMR B;  2QGU A;  3OV4 A;  2BMO B;  4LGQ A;  5BXQ A;  3A76 A;  4ORL A;  5DRV A;  3EQQ B;  3KE7 A;  3BLZ A;  4HM3 B;  3M8C A;  3FGY A;  3H3H A;  4HM5 B;  3I0Y A;  3HX8 A;  4XBT A;  3RGR A;  3F40 A;  5IEO A;  4R9K A;  5IG0 A;  5TGN A;  1W01 A;  1OHS A;  2HMM B;  2HMJ B;  3MSO A;  2HMK B;  4OVM A;  3ROB A;  1JKG A;  5G2G A;  2I9W A;  1ASK A;  3EF8 A;  4MJD A;  3EN8 A;  4R9L A;  4FCJ A;  1Q40 B;  4HM7 B;  3VGN A;  5AEU B;  2RCD A;  1JN5 B;  3F9S A;  1AR0 A;  3FLJ A;  4XM4 A;  4L8P A;  4K1U A;  3T8U A;  3DZL A;  3S5C A;  4J9A A;  4GB5 A;  3EJV A;  4HM6 B;  4IIA A;  8CHO A;  3NV0 A;  3RGA A;  5AIF A;  4HM1 B;  5CF1 A;  3MG2 A;  3OWS A;  1W02 A;  3KKG A;  1Q42 A;  3GZX B;  1JKG B;  3WMD A;  3MYT A;  1O7W B;  3E99 A;  5JPP A;  2XSH B;  5IF6 A;  3FZW A; 
#chains in the Genus database with same CATH topology
 2MF7 A;  2WGO A;  1NB5 I;  1VZZ A;  1BUQ A;  4CJN A;  1UI7 A;  5DRE A;  1I3I A;  1LOW A;  2IY2 A;  1LNI A;  2F56 A;  3G16 A;  2GXF A;  5D81 A;  5STD A;  2PNC A;  3PCR A;  5RNT A;  1FUW A;  1B20 A;  1U8C B;  3NBJ A;  2STD A;  5CF2 A;  1GD3 A;  1OPY A;  1PFP A;  1BOX A;  2O3O A;  1N8Q A;  3DUK A;  4TX4 A;  3STD A;  1B2Z A;  1W6C A;  4L7K A;  4RZM A;  1A67 A;  1FUS A;  2RBI A;  1BSE A;  3B8L A;  4J5K A;  2RGQ A;  1IT8 A;  1GD4 A;  2FGT A;  1SJW A;  4RNY A;  5CXO A;  4N3V A;  1GSP A;  3ER7 A;  2K0M A;  3X42 A;  2CFK A;  3B4O A;  4X2H A;  3S28 A;  2CH9 A;  3HOH A;  2GEY A;  3ZG5 A;  3IPT A;  1OHO A;  3NV0 B;  3JUQ A;  3NUV A;  3HZP A;  3K9M C;  3CC2 3;  1YJN 3;  2LQV A;  1EQK A;  1HU9 A;  1Q81 4;  7STD A;  1QVG 2;  1VQN 3;  4HJL B;  4LEH A;  1I70 A;  7GSP A;  3K0Z A;  2IUJ A;  3ALA A;  2CFW A;  3ECF A;  1K8A 4;  1LQM B;  1D6Z A;  2IYJ A;  1ZGX A;  2SBL A;  1JRQ A;  3FF0 A;  1A2P A;  2ZHX B;  1PY3 A;  2CW9 A;  3SLU A;  4EV2 A;  4MMX B;  1JV2 B;  9RNT A;  2C4B A;  3CCV 3;  3X40 A;  1M1K 4;  2IUK A;  3SVA A;  3LH4 A;  4N6L A;  1N9J A;  3LTD A;  2QA4 3;  1M90 4;  4XDV A;  1Q86 4;  1RGE A;  1O7H B;  4ZM8 A;  1MWU A;  2CIU A;  3FG3 A;  1I0V A;  5IEP A;  3KZT A;  5FGO A;  3S67 A;  3FH1 A;  3CCE 3;  3HII A;  3UNL A;  2IA7 A;  1VQO 3;  1OCV A;  4RBN A;  4K1V A;  1Z1S A;  1VQM 3;  1E97 A;  2O9U X;  1AVL A;  3N8B A;  1ROV A;  4FR9 A;  1G0T A;  2FNQ A;  1W2B 2;  2E2T A;  2BNG A;  2CKF B;  3LTC A;  1JZO A;  2F99 A;  1V58 A;  1B27 A;  2R41 A;  1UUV B;  5AEW B;  1D6U A;  1JJ2 2;  3NX0 A;  1FW7 A;  4WFO A;  4HM4 B;  5AII A;  1STF I;  1I2F A;  4BIR A;  1E3V A;  1T2I A;  5I97 A;  5HGR A;  2XFS A;  3F8X A;  2W6J H;  1FYS A;  4LMI A;  1O7G B;  3D9R A;  1OF5 A;  1U5O A;  1V74 A;  2XGN A;  1ISK A;  4EC6 A;  1N8R 4;  1NWW A;  1GY6 A;  1RTU A;  2OQE C;  4L8O A;  1GOU A;  1CH0 A;  1W00 A;  1JNQ A;  4O2H A;  5AIG A;  2CFL A;  1Q82 4;  3O8Y A;  3CNX A;  2YFL B;  3D3L A;  3SED A;  1LOX A;  1YGW A;  4HVN A;  4AKY A;  1UDI I;  1TUH A;  2W2C A;  4NRE A;  4HOH A;  1YIJ 3;  1VQ8 3;  3D4A A;  1Q7H A;  3SX1 A;  1BSC A;  1QAF A;  4KFF A;  5ELJ A;  6GSP A;  1VQL 3;  4XDW A;  1RCL A;  4JF8 A;  3X3Z A;  4HAA A;  1UCJ A;  3EC9 A;  2RSX A;  3BIR A;  1CQS A;  3IJE B;  3X3X A;  5IG5 A;  1FGR A;  3LOY A;  3G0K A;  3K7C A;  2E2U A;  2P38 A;  3GZB A;  3JVC A;  3Q2P A;  1IVX A;  3CCR 3;  1GMP A;  4O3V A;  2WO0 A;  1HKX A;  1RRH A;  2SAR A;  3DGY A;  4H3U A;  1RCK A;  2ZL8 A;  3GAX A;  1RJO A;  3DH2 A;  4IT7 A;  5IG4 A;  1C7H A;  3F14 A;  3S27 A;  1JBT A;  3FCS B;  1RN7 A;  4N6O B;  3DGL A;  4RNZ A;  1MWR A;  3B7C A;  4FCM A;  1PYL A;  2K54 A;  1S5A A;  1I2G A;  2HMO B;  3BNB A;  5AYS C;  3G6E 3;  2W9P A;  4CDL A;  3PYJ A;  1UCK A;  1VQQ A;  1NDO B;  3KFQ C;  5CK6 A;  2C10 A;  4QWT A;  3HK4 A;  3NHX A;  3SOA A;  4FMB A;  3RDE A;  1OAC A;  4N6V 0;  1VQ4 3;  2RNT A;  3FF2 A;  1MGW A;  6STD A;  1EA2 A;  4J8T A;  1JBS A;  3WOD G;  3D5G A;  3URP A;  1IU7 A;  1RHL A;  3BB9 A;  3J7Y d;  2F86 B;  5GSP A;  1AQZ A;  1B2X A;  1T2H A;  4FMC A;  2R4I A;  1M1X B;  4HBR A;  4XB5 A;  5CLK A;  2HML B;  1US1 A;  5KP1 A;  3UL5 A;  3GSP A;  3EHC A;  1Q7Y 4;  1OF5 B;  1ZO2 A;  3BU4 A;  3K5T A;  2B1X B;  3EBY A;  1TJD A;  2XR8 B;  1BAN A;  1W5Z A;  1YGE A;  1FZU A;  1C54 A;  1DMQ A;  2GEX A;  2YX9 A;  3NQY A;  4I4K A;  1BNJ A;  5M19 A;  1CEW I;  2W9Q A;  3JUN A;  4HM8 B;  5BU4 A;  3V99 A;  4WYK A;  3DGN A;  3VSY A;  2F5W A;  1BUJ A;  3D5I A;  3H51 A;  1UGH I;  2YFI B;  3NM2 A;  1DVC A;  4MMZ B;  4EW5 A;  2Z7A A;  1Y4K A;  3PS8 A;  2ZDJ A;  2UX0 A;  1UGI A;  2K3D A;  1GOV A;  1JZD A;  2Z6B A;  3ZFZ A;  1W2Z A;  1K9M 4;  4O02 B;  1BGS A;  3AHW A;  1VQ5 3;  4AKZ A;  1HYF A;  1MGR A;  1NU3 A;  1SII A;  2GBX B;  2L1S A;  1LXE A;  3CC4 3;  3CD6 3;  3UJM A;  2A15 A;  1WMN A;  2YFJ B;  1EUI C;  3FKA A;  4OUQ A;  1IVW A;  4EXR A;  4BTX A;  1G96 A;  4NPB A;  5AI1 A;  1FGM A;  3LTA A;  1B3S A;  3KII A;  1TRP A;  1JB4 A;  2CHC A;  3RNT A;  4G1M B;  2C11 A;  3OWY A;  3CXC 2;  3CPW 2;  3EBT A;  4GL6 A;  4HZ9 B;  3WHO A;  2BIR A;  1YIT 3;  1JBR A;  1BAO A;  1GS3 A;  1OGX A;  5BIR A;  2PZV A;  3GZY B;  1FGQ A;  2OTJ 3;  1W6Y A;  3EE1 A;  5IG3 A;  1JB2 A;  3PCS A;  8RNT A;  4STD A;  3CCQ 3;  1WMP A;  1IVU A;  1FGO A;  1TP6 A;  4EBG A;  1VQ7 3;  3ZG0 A;  1AVK A;  1KD1 4;  1D6Y A;  1I0X A;  2F98 A;  1BNE A;  2HMN B;  3DGM A;  3F7X A;  1FGT A;  1CYV A;  1GY7 A;  3DM8 A;  5BVB A;  1BNR A;  3N9H A;  3MKI A;  1W7C A;  3A5E A;  3CU3 A;  4BTY A;  1TFK A;  2W04 A;  1RNT A;  4WP5 A;  3KSE D;  3G8Z A;  1YJW 3;  3CMA 3;  3OW2 2;  3L0R A;  2XGL A;  2F5M A;  3EB8 A;  1NO3 A;  2IMJ A;  4OK0 A;  1O7N B;  3GRD A;  3SXX A;  3GWR A;  2QIY A;  1X1W A;  3SOY A;  3B4P A;  4DKI A;  4KVH A;  5KP3 A;  4I5Q A;  4X2O A;  1LOY A;  3EN1 B;  2CWU A;  2XF3 A;  5IEN A;  3AMO A;  3Q90 A;  3LZA A;  1V57 A;  2OWP A;  2OOV A;  5JBS A;  1YVB I;  2WOH A;  5D83 A;  2JQ5 A;  1QAL A;  1BRH A;  1BNF A;  1KQS 2;  3KSP A;  1ULI B;  2H0G A;  3BND A;  3OX9 A;  4WYK B;  1L5G B;  3T0U A;  3NBB A;  1ZS7 A;  4PEJ A;  5A0O B;  3T8N A;  2BHM A;  1YNV X;  5D82 A;  1QMA A;  1BSD A;  1RN1 A;  2ML5 A;  1IVV A;  1R4C A;  2KF4 A;  2XSO B;  3WOF B;  4HKV B;  1RGA A;  3CCL 3;  2H0I A;  1TFO A;  4EYC A;  2W56 A;  4R4K A;  3LML A;  4KT3 B;  1O7M B;  1UUW B;  3NXJ A;  1BNG A;  3CPO A;  2Z76 A;  1KWI A;  1Q9E A;  1IQX A;  1OHP A;  2CFG A;  2W03 A;  1IV7 A;  1B2M A;  2BMQ B;  3Q1C A;  1N5H A;  1EEJ A;  1GY5 A;  1BNI A;  3HI7 A;  3Q3F A;  1K41 A;  3G71 3;  1FUT A;  3JUM A;  3I56 3;  1E3R A;  4R80 A;  3S29 A;  1BRG A;  1JB5 A;  1A90 A;  1T5Y A;  3BNE A;  2XFT A;  5JPU A;  2M7O A;  3SYU A;  1A2K A;  5IER A;  1GOY A;  5IW9 A;  1O7P B;  2CX0 A;  1SQW A;  3X41 A;  3CNM A;  3MG3 A;  3FG1 A;  4KFE A;  3FSD A;  3GZR A;  4MMY B;  1B2U A;  1BRN L;  1IYY A;  3LXU X;  2WGQ A;  5LC6 A;  1W4N A;  3JUP A;  1LQG C;  1STD A;  1DET A;  3LT8 A;  2CG1 A;  2XRX B;  2AAE A;  2INX A;  1EG9 B;  2ZA4 A;  2CG0 A;  4LSO A;  7RNT A;  3LYG A;  4HZB B;  1RLS A;  3JUO A;  3CCM 3;  3BNC A;  4XBX A;  1MWT A;  2KF3 A;  1SAR A;  1RRL A;  1RGK A;  2CWV A;  3F8H A;  2MC8 A;  1SPU A;  1NNV A;  2B24 B;  1S72 3;  1RMS A;  1BNS A;  4WWU C;  3AGN A;  1WNH A;  1LRA A;  2GBW B;  1ULJ B;  3AMO B;  4HM2 B;  3UL6 A;  3CCS 3;  1N9E A;  3EX9 A;  3TDG A;  2E2V A;  2BT3 A;  1BRK A;  3NBR A;  4JRF A;  4R1K A;  1RGL A;  5AIH A;  1IT7 A;  4HYZ A;  3U97 A;  1GYB A;  1QJG A;  5KP4 A;  3MG1 A;  1IK3 A;  1G02 A;  1RKY A;  1I2E A;  1Q40 A;  4Q53 A;  3MHE A;  5M1A A;  3DGO A;  1OGZ A;  5FW5 A;  3F7S A;  4MEI A;  2Z77 A;  1BSA A;  2P09 A;  1ZX2 A;  4IPB A;  3OWU A;  1DMM A;  1WQL B;  5EVH A;  3WOE B;  1DMN A;  3KN4 A;  1JN5 A;  2RFR A;  3QRD A;  4HM0 B;  2KAA A;  3DXO A;  3VF1 A;  1W6G A;  4XBY A;  1EKM A;  2GU1 A;  3OXA A;  2W56 B;  2GSP A;  3KCH A;  2KF6 A;  1N5P A;  2Q07 A;  1OUN A;  3DMC A;  4U13 A;  1VQP 3;  3AGO A;  1X1Y A;  1B21 A;  5LC7 A;  1RGC A;  1UCI A;  1M9G A;  5EEO A;  1OH0 A;  3QK9 A;  3WA3 A;  3DY5 A;  1AY7 A;  1IDP A;  2BMR B;  2QGU A;  3OV4 A;  1RNB A;  2BMO B;  4LGQ A;  1YVS A;  2P05 A;  5BXQ A;  3WR2 A;  1K73 4;  3A76 A;  2UGI A;  4ORL A;  5DRV A;  2W0Q A;  3WA2 X;  4BL3 A;  3PGB A;  6RNT A;  1DYU A;  2GU3 A;  1F8N A;  3EQQ B;  1VQ6 3;  4WHA A;  1UUG B;  3CCU 3;  3KE7 A;  3BLZ A;  4HM3 B;  3CC7 3;  3M8C A;  1RSN A;  2D42 A;  3FGY A;  3H3H A;  4HM5 B;  2CC3 A;  1AV4 A;  1KC8 4;  2J8X B;  3I0Y A;  4RNT A;  4AEQ A;  1LOV A;  3HX8 A;  1X1U A;  3IMA B;  4XBT A;  3F40 A;  5IEO A;  1I8V A;  3RGR A;  4ILF A;  1GMR A;  4R9K A;  1BSB A;  4N6T A;  4BU4 A;  1DE3 A;  2OCT A;  4K61 A;  4J5G A;  4KZ1 A;  1GMQ A;  1J2B A;  5IG0 A;  5TGN A;  1IQY A;  4CCV A;  4O8S A;  2BO9 B;  1W01 A;  2L4V A;  2AAD A;  1OHS A;  1YHQ 3;  2OQE A;  2HMM B;  1WMO A;  3X3Y A;  1RGG A;  2HMJ B;  3MSO A;  1UI8 A;  2HMK B;  2KF5 A;  3PZW A;  1T3B A;  4N6M A;  4OVM A;  1MWS A;  3ROB A;  1VQK 3;  1JKG A;  2KCD A;  5G2G A;  2I9W A;  1VQ9 3;  1ASK A;  1PU4 A;  2BU4 A;  1X1X A;  1CYU A;  2F4Y A;  3EF8 A;  1SIH A;  1MNL A;  4MJD A;  3EN8 A;  4R9L A;  1UW1 A;  2XEP A;  3D79 A;  1MOL A;  3MPH A;  4FCJ A;  1Q40 B;  1BRJ A;  1KSI A;  1K28 A;  1ROA A;  2JDI H;  4HM7 B;  4N6N B;  4BTW A;  3VGN A;  5AEU B;  2OTL 3;  4LYL B;  2P0M A;  2QEX 3;  2RCD A;  1JN5 B;  2P0X A;  1RDS A;  1YI2 3;  1QAK A;  2CK3 H;  1R4Y A;  3F9S A;  5ELU A;  2HOH A;  1AR0 A;  2KXG A;  5AYR B;  1A2V A;  4FCZ A;  4FMA A;  1NB3 I;  1IV9 A;  1RGF A;  2Y74 A;  3N54 B;  4LZI A;  3CCJ 3;  1TIJ A;  3FLJ A;  4XM4 A;  3K63 A;  4L8P A;  1LVN A;  2CX1 A;  4FMD A;  4K1U A;  1I3F A;  1UCL A;  5EQL A;  3AHS A;  2UUG C;  5M18 A;  3T8U A;  1BVI A;  3DZL A;  3S5C A;  5HOH A;  1TRQ A;  2D1W A;  2XH9 A;  1BIR A;  4J9A A;  1DVD A;  4GB5 A;  3EJV A;  4HM6 B;  4IIA A;  2V1L A;  3MWZ A;  4N6U A;  3FG4 A;  3PXM A;  2OOV C;  4CPK A;  1QVF 2;  8CHO A;  2Y73 A;  2CFD A;  3NV0 A;  4H61 A;  3I55 3;  1FA3 A;  1BU4 A;  3RGA A;  2H0H A;  1HZ1 A;  4K90 B;  5AIF A;  3NM7 A;  1BRI A;  3UB1 A;  4HM1 B;  4KFD A;  2FXT A;  1TU5 A;  3V92 A;  5CF1 A;  1RN4 A;  3MG2 A;  3WDG B;  1TTO A;  3LT9 A;  3NQZ A;  3OWS A;  3V98 A;  1B2S A;  1W02 A;  3KKG A;  1Q42 A;  3GZX B;  4EV5 A;  1YJ9 3;  1RGH A;  1JKG B;  2ML6 A;  3G4S 3;  4GSP A;  5G1K A;  5G1L A;  3WMD A;  4GHO A;  3U1W A;  3HIG A;  3CME 3;  1LNH A;  2WOF A;  4NHF A;  2LYX A;  2KRT A;  2CWT A;  4BL2 A;  1BRS A;  3MYT A;  1NJI 4;  1O7W B;  1IQ8 A;  3E99 A;  5JPP A;  2XSH B;  5IF6 A;  3LTB A;  1WTH A;  3FZW A; 
#chains in the Genus database with same CATH homology
 2MF7 A;  2WGO A;  1NB5 I;  1VZZ A;  1BUQ A;  1UI7 A;  5DRE A;  3G16 A;  2GXF A;  5D81 A;  5STD A;  2PNC A;  3PCR A;  1FUW A;  1U8C B;  3NBJ A;  2STD A;  5CF2 A;  1GD3 A;  1OPY A;  1PFP A;  3DUK A;  2O3O A;  1N8Q A;  4TX4 A;  3STD A;  1W6C A;  4L7K A;  4RZM A;  1A67 A;  3B8L A;  2RGQ A;  1IT8 A;  1GD4 A;  2FGT A;  1SJW A;  4RNY A;  5CXO A;  4N3V A;  3ER7 A;  3X42 A;  2K0M A;  2CFK A;  3B4O A;  4X2H A;  3S28 A;  2CH9 A;  2GEY A;  3IPT A;  1OHO A;  3NV0 B;  3JUQ A;  3NUV A;  3HZP A;  3K9M C;  1YJN 3;  2LQV A;  1EQK A;  1HU9 A;  1QVG 2;  7STD A;  1VQN 3;  4HJL B;  4LEH A;  3K0Z A;  2IUJ A;  3ALA A;  2CFW A;  3ECF A;  1K8A 4;  1D6Z A;  2SBL A;  1JRQ A;  3FF0 A;  2CW9 A;  3SLU A;  4EV2 A;  4MMX B;  1JV2 B;  3CCV 3;  3X40 A;  1M1K 4;  2IUK A;  3SVA A;  3LH4 A;  4N6L A;  1N9J A;  3LTD A;  2QA4 3;  1M90 4;  4XDV A;  1Q86 4;  1O7H B;  4ZM8 A;  2CIU A;  3FG3 A;  5IEP A;  3KZT A;  5FGO A;  3S67 A;  3FH1 A;  3CCE 3;  3HII A;  3UNL A;  2IA7 A;  1VQO 3;  1OCV A;  4RBN A;  4K1V A;  1Z1S A;  1VQM 3;  1E97 A;  2O9U X;  1AVL A;  3N8B A;  1ROV A;  4FR9 A;  2FNQ A;  1W2B 2;  2E2T A;  2BNG A;  2CKF B;  3LTC A;  2F99 A;  5AEW B;  1UUV B;  1JJ2 2;  1D6U A;  3NX0 A;  4WFO A;  4HM4 B;  5AII A;  1STF I;  1E3V A;  5I97 A;  5HGR A;  2XFS A;  3F8X A;  2W6J H;  4LMI A;  1O7G B;  3D9R A;  1OF5 A;  1U5O A;  1V74 A;  2XGN A;  1ISK A;  4EC6 A;  1N8R 4;  1NWW A;  1GY6 A;  2OQE C;  4L8O A;  1W00 A;  1JNQ A;  4O2H A;  5AIG A;  2CFL A;  1Q82 4;  3O8Y A;  3CNX A;  2YFL B;  3D3L A;  3SED A;  1LOX A;  4HVN A;  4AKY A;  1TUH A;  2W2C A;  4NRE A;  1YIJ 3;  1VQ8 3;  3SX1 A;  1QAF A;  1VQL 3;  4KFF A;  5ELJ A;  4XDW A;  4JF8 A;  3X3Z A;  3EC9 A;  2RSX A;  1CQS A;  3IJE B;  3X3X A;  5IG5 A;  1FGR A;  3LOY A;  3G0K A;  3K7C A;  2E2U A;  2P38 A;  3GZB A;  3JVC A;  3Q2P A;  1IVX A;  3CCR 3;  4O3V A;  2WO0 A;  1HKX A;  1RRH A;  4H3U A;  2ZL8 A;  3GAX A;  1RJO A;  4IT7 A;  5IG4 A;  1C7H A;  3F14 A;  3S27 A;  3FCS B;  1RN7 A;  4N6O B;  3DGL A;  4RNZ A;  3B7C A;  4FCM A;  2K54 A;  1S5A A;  2HMO B;  3BNB A;  5AYS C;  3G6E 3;  2W9P A;  4CDL A;  3PYJ A;  1NDO B;  3KFQ C;  5CK6 A;  2C10 A;  4QWT A;  3HK4 A;  3NHX A;  3SOA A;  4FMB A;  3RDE A;  1OAC A;  4N6V 0;  1VQ4 3;  3FF2 A;  6STD A;  1EA2 A;  4J8T A;  3WOD G;  1IU7 A;  3BB9 A;  3J7Y d;  2F86 B;  4FMC A;  4HBR A;  2R4I A;  1M1X B;  4XB5 A;  5CLK A;  2HML B;  1US1 A;  5KP1 A;  3UL5 A;  3EHC A;  1Q7Y 4;  1OF5 B;  1ZO2 A;  3K5T A;  2B1X B;  3EBY A;  2XR8 B;  1W5Z A;  1YGE A;  1DMQ A;  2GEX A;  2YX9 A;  3NQY A;  4I4K A;  1CEW I;  2W9Q A;  3JUN A;  4HM8 B;  3V99 A;  4WYK A;  3DGN A;  3VSY A;  3H51 A;  2YFI B;  3NM2 A;  1DVC A;  4MMZ B;  2Z7A A;  1Y4K A;  3PS8 A;  2ZDJ A;  2UX0 A;  2Z6B A;  1W2Z A;  1K9M 4;  4O02 B;  1VQ5 3;  4AKZ A;  1NU3 A;  1SII A;  2GBX B;  1LXE A;  3CC4 3;  3CD6 3;  3UJM A;  2A15 A;  1WMN A;  2YFJ B;  3FKA A;  4OUQ A;  1IVW A;  4EXR A;  4BTX A;  1G96 A;  5AI1 A;  1FGM A;  3LTA A;  3KII A;  1JB4 A;  2CHC A;  3CPW 2;  4G1M B;  2C11 A;  3OWY A;  3CXC 2;  3CC2 3;  3EBT A;  4GL6 A;  4HZ9 B;  1YIT 3;  1Q81 4;  1GS3 A;  1OGX A;  2PZV A;  3GZY B;  1FGQ A;  2OTJ 3;  1W6Y A;  3EE1 A;  5IG3 A;  1JB2 A;  3PCS A;  4STD A;  3CCQ 3;  1WMP A;  1IVU A;  1FGO A;  1TP6 A;  4EBG A;  1VQ7 3;  1AVK A;  1KD1 4;  1D6Y A;  2F98 A;  2HMN B;  3DGM A;  3F7X A;  1FGT A;  1CYV A;  1GY7 A;  3DM8 A;  5BVB A;  3N9H A;  3MKI A;  1W7C A;  3CU3 A;  4BTY A;  1TFK A;  2W04 A;  4WP5 A;  3KSE D;  3G8Z A;  1YJW 3;  3CMA 3;  3OW2 2;  3L0R A;  2XGL A;  3EB8 A;  1NO3 A;  2IMJ A;  4OK0 A;  1O7N B;  3GRD A;  3SXX A;  3GWR A;  2QIY A;  3SOY A;  3B4P A;  4KVH A;  5KP3 A;  4X2O A;  3EN1 B;  2CWU A;  2XF3 A;  5IEN A;  3AMO A;  3Q90 A;  3LZA A;  2OWP A;  2OOV A;  5JBS A;  1YVB I;  2WOH A;  5D83 A;  2JQ5 A;  1QAL A;  1KQS 2;  3KSP A;  1ULI B;  3BND A;  4WYK B;  3OX9 A;  1L5G B;  3T0U A;  3NBB A;  4PEJ A;  5A0O B;  3T8N A;  2BHM A;  5D82 A;  1QMA A;  2ML5 A;  1IVV A;  1R4C A;  2XSO B;  3WOF B;  4HKV B;  3CCL 3;  1TFO A;  4EYC A;  2W56 A;  4R4K A;  3LML A;  1O7M B;  1UUW B;  3NXJ A;  3CPO A;  2Z76 A;  1KWI A;  1IQX A;  1OHP A;  2CFG A;  2W03 A;  1IV7 A;  2BMQ B;  3Q1C A;  1N5H A;  1GY5 A;  3HI7 A;  1K41 A;  3G71 3;  3JUM A;  3I56 3;  1E3R A;  4R80 A;  3S29 A;  1JB5 A;  1A90 A;  1T5Y A;  3BNE A;  2XFT A;  5JPU A;  2M7O A;  1A2K A;  5IER A;  5IW9 A;  1O7P B;  1SQW A;  3X41 A;  3CNM A;  3MG3 A;  3FG1 A;  4KFE A;  3FSD A;  3GZR A;  4MMY B;  3LXU X;  2WGQ A;  1W4N A;  3JUP A;  1STD A;  3LT8 A;  2CG1 A;  2XRX B;  2INX A;  1EG9 B;  2CG0 A;  4LSO A;  3LYG A;  4HZB B;  3JUO A;  3CCM 3;  3BNC A;  4XBX A;  1RRL A;  2CWV A;  2MC8 A;  3F8H A;  1SPU A;  2B24 B;  1S72 3;  4WWU C;  1WNH A;  2GBW B;  3AMO B;  1ULJ B;  4HM2 B;  3UL6 A;  3CCS 3;  1N9E A;  3EX9 A;  3TDG A;  2E2V A;  2BT3 A;  4JRF A;  3NBR A;  4R1K A;  5AIH A;  3U97 A;  1IT7 A;  4HYZ A;  1GYB A;  1QJG A;  5KP4 A;  3MG1 A;  1IK3 A;  1RKY A;  1Q40 A;  4Q53 A;  3MHE A;  3DGO A;  1OGZ A;  5FW5 A;  3F7S A;  4MEI A;  2Z77 A;  2P09 A;  1ZX2 A;  4IPB A;  3OWU A;  1DMM A;  1WQL B;  5EVH A;  3WOE B;  1DMN A;  3KN4 A;  1JN5 A;  2RFR A;  3QRD A;  4HM0 B;  3DXO A;  3VF1 A;  1W6G A;  4XBY A;  1EKM A;  2GU1 A;  3OXA A;  2W56 B;  1VQP 3;  2Q07 A;  1N5P A;  1OUN A;  3DMC A;  4U13 A;  5LC7 A;  1M9G A;  5EEO A;  1OH0 A;  3QK9 A;  3WA3 A;  3DY5 A;  1IDP A;  2BMR B;  2QGU A;  3OV4 A;  2BMO B;  4LGQ A;  2P05 A;  5BXQ A;  1K73 4;  3A76 A;  4ORL A;  5DRV A;  3WA2 X;  2W0Q A;  3PGB A;  1DYU A;  2GU3 A;  1F8N A;  3EQQ B;  1VQ6 3;  4WHA A;  3CCU 3;  3KE7 A;  3BLZ A;  4HM3 B;  3CC7 3;  3M8C A;  2D42 A;  3FGY A;  3H3H A;  4HM5 B;  2CC3 A;  1AV4 A;  1KC8 4;  3I0Y A;  4AEQ A;  3HX8 A;  3IMA B;  4XBT A;  3RGR A;  3F40 A;  5IEO A;  4R9K A;  4N6T A;  2OCT A;  4K61 A;  4KZ1 A;  1J2B A;  5IG0 A;  5TGN A;  1IQY A;  4CCV A;  4O8S A;  2BO9 B;  1W01 A;  2L4V A;  1OHS A;  1YHQ 3;  2OQE A;  2HMM B;  1WMO A;  3X3Y A;  2HMJ B;  3MSO A;  5LC6 A;  1UI8 A;  2HMK B;  4N6M A;  3PZW A;  4OVM A;  3ROB A;  1VQK 3;  1JKG A;  2KCD A;  5G2G A;  2I9W A;  1VQ9 3;  1ASK A;  1PU4 A;  1CYU A;  3EF8 A;  1SIH A;  1MNL A;  4MJD A;  3EN8 A;  4R9L A;  1UW1 A;  2XEP A;  1MOL A;  3MPH A;  4FCJ A;  1Q40 B;  1KSI A;  1K28 A;  1ROA A;  2JDI H;  4HM7 B;  4N6N B;  4BTW A;  3VGN A;  5AEU B;  2OTL 3;  2P0M A;  2QEX 3;  2RCD A;  1JN5 B;  2P0X A;  1YI2 3;  1QAK A;  2CK3 H;  3F9S A;  5ELU A;  1AR0 A;  2KXG A;  5AYR B;  1A2V A;  4FCZ A;  4FMA A;  1NB3 I;  1IV9 A;  2Y74 A;  3N54 B;  4LZI A;  3CCJ 3;  1TIJ A;  3FLJ A;  4XM4 A;  3K63 A;  4L8P A;  1LVN A;  4FMD A;  4K1U A;  5EQL A;  3T8U A;  3DZL A;  3S5C A;  2D1W A;  2XH9 A;  4J9A A;  1DVD A;  4GB5 A;  3EJV A;  4HM6 B;  4IIA A;  2V1L A;  3MWZ A;  4N6U A;  3FG4 A;  3PXM A;  2OOV C;  1QVF 2;  8CHO A;  2Y73 A;  2CFD A;  3NV0 A;  4H61 A;  3I55 3;  1FA3 A;  3RGA A;  4K90 B;  5AIF A;  3NM7 A;  3UB1 A;  4HM1 B;  4KFD A;  2FXT A;  1TU5 A;  3V92 A;  5CF1 A;  3MG2 A;  3WDG B;  3LT9 A;  3NQZ A;  3OWS A;  3V98 A;  1W02 A;  3KKG A;  1Q42 A;  3GZX B;  4EV5 A;  1YJ9 3;  1JKG B;  2ML6 A;  3G4S 3;  3WMD A;  3U1W A;  3HIG A;  3CME 3;  1LNH A;  2WOF A;  4NHF A;  2LYX A;  2KRT A;  2CWT A;  3MYT A;  1NJI 4;  1O7W B;  1IQ8 A;  3E99 A;  5JPP A;  2XSH B;  5IF6 A;  3LTB A;  1WTH A;  3FZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...