3WHOA

X-ray-crystallographic structure of an rnase po1 exhibiting anti-tumor activity
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Crystallographic Structure of RNase Po1 That Exhibits Anti-tumor Activity
pubmed rcsb
source organism Pleurotus ostreatus
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Po1
total genus 21
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3whoA00
1BNJA 3WHOA 1X1UA 3RNTA 2KAAA 1FZUA 1GOUA 1B2SA 2SARA 1FW7A 1BNGA 1RNBA 3D5GA 1TRQA 1BSDA 1Q9EA 1RGKA 2HOHA 4GHOA 1B27A 1BNRA 3D4AA 1RGGA 1BGSA 1G02A 1BNSA 1I2FA 2KF6A 1X1XA 4HOHA 1I3IA 1PY3A 1CH0A 1BNIA 4GSPA 1RCKA 1BSAA 1X1YA 1RGCA 1FUSA 7RNTA 8RNTA 1RGLA 1HYFA 1PYLA 1B2XA 1B2UA 4BIRA 1DETA 1RNTA 5BU4A 1DE3A 1MGWA 3KCHA 3Q3FA 1RTUA 1B20A 1I0XA 2BIRA 2F5MA 3A5EA 4HAAA 2ZA4A 9RNTA 1RGEA 1BSEA 1BOXA 1UCKA 1ZGXA 3BIRA 3SYUA 1GOYA 1RGHA 1UCLA 4RNTA 1B2MA 1BRKA 1RGFA 1BRIA 1UCJA 2AADA 3AGOA 1B2ZA 1GMRA 1I8VA 6RNTA 1YVSA 6GSPA 1C54A 1T2HA 3HOHA 1RDSA 1TTOA 1BIRA 1RN1A 2KF5A 7GSPA 2KF3A 1SARA 5GSPA 1LOVA 1YNVX 1AY7A 1BRJA 1GSPA 1BRGA 1I2GA 1BU4A 1MGRA 3URPA 1BRSA 1BNEA 1JBSA 1UCIA 1BVIA 1RN4A 1BSBA 2RBIA 1GOVA 1RLSA 3AHSA 1BAOA 1RMSA 3BU4A 5RNTA 1FYSA 1BUJA 1GMQA 1BANA 1I0VA 2AAEA 3DH2A 4J5GA 2RNTA 2KF4A 1GMPA 1RHLA 1YGWA 1I3FA 1TRPA 1BRNL 3AGNA 2BU4A 1RCLA 1JBRA 1I70A 1R4YA 3GSPA 1BNFA 4J5KA 5BIRA 4BU4A 1B3SA 1T2IA 1B21A 1LNIA 1BRHA 2F5WA 1LOWA 3AHWA 5HOHA 1IYYA 1X1WA 1A2PA 1JBTA 1HZ1A 2GSPA 1FUTA 1BSCA 2C4BA 1I2EA 1LRAA 1RGAA 3D5IA 1RSNA 1LOYA 1AQZA 3WR2A 2F56A 3DGYA 2F4YA
chains in the Genus database with same CATH superfamily
1IT7A 3FSDA 3DM8A 1DVDA 3LTBA 4PEJA 3DGMA 3OWYA 1FZUA 2UGIA 2XR8B 5IF6A 3G6E3 4MJDA 3ECFA 4ZM8A 1K28A 1EEJA 1EUIC 1KWIA 2QA43 1QAFA 1TRQA 3L0RA 4WFOA 1RGKA 1VQO3 2FNQA 2C10A 4QWTA 1GY5A 4G1MB 5CF2A 5KP4A 1BGSA 1NU3A 1G02A 5STDA 1I2FA 3NBRA 3SVAA 1X1XA 3NQZA 4HOHA 4CJNA 1VQL3 3GZBA 5EQLA 3X3XA 5A0OB 3A76A 4GSPA 2CG1A 1NB3I 1BSAA 1OHPA 1QMAA 1X1YA 1RGLA 1FGMA 3EC9A 3WOEB 3FLJA 1PYLA 1B2XA 2GXFA 2BMRB 3D79A 1SPUA 1DETA 3SX1A 3NBJA 3FH1A 1MGWA 3KCHA 3HZPA 1LQMB 1M9GA 3Q3FA 4FMAA 4EV2A 1AR0A 2BMQB 1RTUA 1IQYA 2ZHXB 2MF7A 4BL3A 4LZIA 1RGEA 1FGTA 5EVHA 1JZDA 1IV9A 1BSEA 2STDA 4XB5A 3G4S3 1ZGXA 3OWSA 1NB5I 5BXQA 3VSYA 3V98A 3HIGA 4KFFA 3WMDA 2P0MA 2CX1A 4LYLB 2OTJ3 1W2B2 4LGQA 2W6JH 3ZG0A 1UDII 4N6OB 3JUPA 3F8HA 1RDSA 1Q824 2RCDA 3JUNA 3S27A 2CWVA 5CK6A 3F7XA 1TU5A 2OTL3 3EF8A 5GSPA 3ZFZA 2XEPA 4X2OA 3SOAA 1GSPA 3U97A 1BRGA 5LC6A 3URPA 2GEYA 4KZ1A 2GEXA 2Z76A 3H3HA 2CHCA 3HK4A 1BSBA 1AVKA 2WO0A 3HX8A 5AIGA 1UW1A 1MWSA 1O7WB 1CQSA 3AHSA 2L4VA 2J8XB 3CXC2 3GZRA 2YFLB 3BU4A 4FMDA 2CC3A 3PXMA 1TUHA 1BUJA 1E3RA 3LH4A 1N8R4 3F8XA 3OW22 1W00A 1JV2B 5IG5A 1OH0A 3I563 7STDA 2RNTA 1RHLA 1UUGB 1YGWA 1VQK3 1HKXA 1CYVA 1IVXA 3M8CA 3Q1CA 3SXXA 3PGBA 4OK0A 3EN8A 3EHCA 2P38A 1LOXA 4HM0B 3ROBA 5DRVA 1UI7A 3ZG5A 2W56B 3AGNA 5G2GA 2W9QA 5IEOA 3UB1A 4NPBA 2R4IA 4WYKB 3CPW2 3I0YA 3WODG 4RNZA 3E99A 1J2BA 4J5KA 4CPKA 3KSPA 1R4CA 4RNYA 1W2ZA 1EQKA 2B24B 2YFIB 1IVWA 1LOWA 3AHWA 1JB4A 1OUNA 2F98A 2WOFA 3CPOA 4O2HA 3DGOA 2OOVA 1IYYA 5FW5A 1X1WA 4HVNA 5IERA 2CG0A 3B4OA 3NBBA 1ASKA 4AKYA 1JBTA 4HM4B 2GSPA 2OWPA 4MMYB 1UUWB 2B1XB 4O8SA 1SJWA 2GBXB 3WA3A 3CD63 5LC7A 3S5CA 2C4BA 3X41A 2OQEA 2ZDJA 1RSNA 1GY7A 2IA7A 3T0UA 3OWUA 5CF1A 5IENA 3NUVA 4LEHA 1Q864 1UI8A 1BNJA 2UX0A 3WHOA 3RNTA 3FG3A 2KAAA 4RBNA 1TP6A 4EYCA 1GOUA 2JDIH 4J8TA 1RKYA 3BNDA 1BNGA 2ZL8A 3D5GA 4L7KA 3KN4A 3LTAA 4FR9A 4IPBA 1JNQA 4GHOA 1BNRA 2HMKB 3D4AA 1BNSA 3BNEA 3H51A 5G1KA 3Q2PA 3WDGB 3F9SA 5BVBA 3B7CA 2K54A 3G0KA 3OXAA 5IG3A 1BNIA 4N6MA 1W6CA 2CX0A 5CLKA 2CKFB 3UJMA 1V58A 2W9PA 3CME3 2XSOB 3ER7A 4BIRA 3NV0B 2QIYA 3KSED 2HMMB 4BTWA 3K5TA 1M1K4 2BNGA 4WP5A 3AMOA 1W01A 2XGNA 1VQN3 2F5MA 2GU1A 4HAAA 4J9AA 2Z6BA 1JKGA 1OACA 1ROVA 3FF2A 1TFOA 1V74A 4HBRA 2Z7AA 1WMNA 3NX0A 1IVVA 1O7PB 3BIRA 3QRDA 3SYUA 1GOYA 1IDPA 2JQ5A 1GD3A 3MYTA 4RNTA 4IIAA 1YI23 1RGFA 1LXEA 1S5AA 1GMRA 1YHQ3 1I8VA 3EBYA 6RNTA 1JN5B 1YVSA 4K90B 2XGLA 3EX9A 1JZOA 1Q40B 1QVG2 1M1XB 1UUVB 4BTYA 3HIIA 1RN1A 1DYUA 3SOYA 1JKGB 1ZX2A 4HZ9B 1BUQA 3JUOA 4HM3B 3X42A 1KC84 2ML5A 1YNVX 4LMIA 3K9MC 1AY7A 1Z1SA 1I2GA 3G8ZA 1W5ZA 3IMAB 1MGRA 2CWUA 2GU3A 1VQ83 3CMA3 1FUWA 4LSOA 3GZXB 1GD4A 5AEUB 2A15A 3CCS3 1RLSA 3SLUA 1BAOA 4XBTA 1M904 3K0ZA 3CC43 8CHOA 4FCMA 3D3LA 3STDA 2LYXA 1GMQA 1BANA 3ALAA 2RFRA 4HYZA 1I0VA 1VQ63 3DH2A 1GS3A 1RRHA 3FCSB 3N9HA 1VQM3 4DKIA 4WYKA 1ULIB 5EEOA 3NHXA 2W0QA 3DXOA 1A2KA 4XBYA 1FA3A 2KRTA 4H61A 2CWTA 3BNCA 1JB2A 3CCU3 1VQ43 3DGLA 1A67A 3G16A 2O3OA 5G1LA 1RCLA 3VGNA 3EQQB 1JBRA 3T8NA 1I70A 3MG3A 2Y74A 4KVHA 4X2HA 1EKMA 3U1WA 5BIRA 4BU4A 1OCVA 5D82A 2F5WA 1D6YA 1OPYA 1YIT3 1VQP3 4NREA 1ISKA 1JJ22 3CC73 5M1AA 3KKGA 2QGUA 1SQWA 1W6YA 1ULJB 2BT3A 4XDVA 1YJW3 2RSXA 3S28A 1IV7A 3FG1A 2INXA 1RGAA 3D5IA 4N3VA 2BMOB 2F56A 2IUJA 2E2UA 3EBTA 4R9LA 4EXRA 1E3VA 3LT8A 2YX9A 4R4KA 5AIIA 1O7GB 1KD14 3OX9A 1FGOA 1B2SA 4L8PA 1FW7A 1RNBA 2IY2A 1BSDA 1Q9EA 3CNXA 2HOHA 2LQVA 4HM7B 4HKVB 3FG4A 2FGTA 5JPUA 5M18A 2CH9A 1RGGA 1CYUA 2IMJA 2KF6A 3LTDA 2CFDA 2F99A 3UL6A 1I3IA 1PY3A 5CXOA 1TIJA 1A90A 1IVUA 1RCKA 1QAKA 4O02B 3V92A 1U5OA 1FUSA 4HM5B 3AMOB 3X3ZA 2HMJB 7RNTA 2OQEC 1IK3A 1HYFA 4Q53A 3F40A 2W2CA 3FGYA 3LYGA 1TJDA 1KSIA 2W03A 1DMMA 1FGRA 1OGXA 1RNTA 1LVNA 3IPTA 5BU4A 1Q814 1O7HB 4MEIA 1B20A 1I0XA 2BIRA 3CNMA 1IQ8A 2Y73A 3A5EA 3WA2X 1SIIA 9RNTA 5JPPA 1IT8A 1N9JA 3S29A 1RJOA 3PCSA 4CCVA 3NV0A 1YGEA 1OGZA 2HMNB 1BOXA 3DY5A 4N6TA 1OHOA 3NM2A 3RGRA 1RGHA 1UCLA 2XFSA 3PCRA 1B2MA 1DE3A 4FMCA 5D83A 1Q7HA 1BRIA 3AGOA 1B2ZA 5KP3A 1VQ73 3MG1A 4JRFA 5IG0A 6GSPA 1C54A 3HOHA 2YFJB 1BIRA 1RRLA 5DREA 1WMOA 4JF8A 3CCR3 3NQYA 4TX4A 1YVBI 3CCJ3 1UGHI 1SIHA 2KF3A 1SARA 4HM8B 3GZYB 1MWRA 2CK3H 2V1LA 3GWRA 1BRJA 1MNLA 1RN7A 1W4NA 3MKIA 4NHFA 3EB8A 1NWWA 1OF5B 2FXTA 1RN4A 2Z77A 4XM4A 3F7SA 1AV4A 2XH9A 3S67A 4BL2A 3UNLA 5RNTA 3PZWA 1FYSA 3JUQA 2D1WA 1F8NA 3RDEA 3CCQ3 3B4PA 2CFWA 4J5GA 1YIJ3 2KF4A 4KFDA 3CCV3 1I3FA 1TRPA 1BRNL 3FF0A 5IW9A 1EA2A 2R41A 3D9RA 5HOHA 4AEQA 1C7HA 3KIIA 3SEDA 1R4YA 1STDA 3LOYA 1KQS2 2K3DA 3GSPA 1BNFA 5AI1A 3CCL3 1YJ93 1WNHA 1B3SA 1T2IA 1B21A 1EG9B 2W04A 4N6LA 3X3YA 2L1SA 3QK9A 2XFTA 1WTHA 2WGQA 1PFPA 3LXUX 4K61A 2WGOA 3MHEA 4R80A 3J7Yd 3UL5A 1TFKA 2HMLB 1A2PA 1HZ1A 1W02A 4H3UA 5ELJA 1QVF2 5TGNA 1O7MB 2HMOB 2I9WA 3O8YA 4KT3B 4CDLA 4GB5A 3BB9A 1QALA 1BSCA 1AVLA 1I2EA 4ORLA 6STDA 3KFQC 1LOYA 3I553 5AEWB 3WR2A 3N8BA 1D6UA 4N6UA 3DGYA 4L8OA 1IU7A 3NM7A 2QEX3 5I97A 1VQ53 1DMQA 2CFGA 1X1UA 2M7OA 4HZBB 2Q07A 2KCDA 1NO3A 2GBWB 2SARA 3VF1A 1ZO2A 3IJEB 1T5YA 3LTCA 3CU3A 4O3VA 3MSOA 5KP1A 2P0XA 1B27A 1G96A 1Q42A 3CCE3 2E2VA 2XRXB 3KE7A 1YJN3 3G713 1CH0A 4K1VA 4EW5A 3DMCA 8RNTA 1RGCA 4I4KA 1GY6A 1LQGC 3F14A 4WWUC 1LNHA 1HU9A 2E2TA 2XSHB 4XDWA 1B2UA 4HJLB 2H0GA 1L5GB 1WQLB 1JN5A 2H0IA 2SBLA 1DMNA 3JUMA 1MWTA 2CFKA 5ELUA 2ZA4A 1Q7Y4 3PS8A 1K9M4 1A2VA 1ZS7A 2OCTA 3T8UA 1MOLA 1ROAA 3LMLA 1Y4KA 2P05A 1JRQA 1UCKA 3DGNA 4HM1B 4EC6A 2IUKA 4XBXA 1E97A 1MWUA 4WHAA 5D81A 4EBGA 1BRKA 1QJGA 1UCJA 5AIHA 1G0TA 2AADA 2CIUA 2PZVA 3GRDA 5AIFA 3DZLA 3NXJA 3HI7A 2RGQA 2IYJA 4OVMA 1T2HA 3EE1A 1OHSA 1TTOA 3K7CA 4U13A 2WOHA 2KF5A 3EJVA 1N5PA 7GSPA 4ILFA 1N8QA 1K734 1LOVA 3KZTA 5AYRB 2C11A 4R1KA 1US1A 2K0MA 2BHMA 1D6ZA 1BU4A 4HM6B 4IT7A 4AKZA 1BRSA 5FGOA 1BNEA 1U8CB 2ML6A 2OOVC 1JBSA 1UCIA 1BVIA 1WMPA 1T3BA 3FZWA 1W6GA 3TDGA 2RBIA 4N6V0 3X40A 1V57A 3MPHA 3JVCA 1FGQA 4GL6A 1STFI 1GOVA 3GAXA 1CEWI 1RMSA 4STDA 5IEPA 1Q40A 3CC23 1OF5A 3CCM3 1W7CA 4MMXB 3FKAA 3MG2A 3RGAA 2AAEA 1N9EA 2W56A 2O9UX 3LZAA 4FCZA 1JB5A 1IQXA 1GMPA 3EN1B 3DUKA 4RZMA 4EV5A 3WOFB 4K1UA 1NNVA 2BO9B 2H0HA 2F86B 3BLZA 1NDOB 5JBSA 2BU4A 4MMZB 1VZZA 1N5HA 2UUGC 1S723 4HM2B 4N6NB 2CFLA 5IG4A 2P09A 1LNIA 2MC8A 1K41A 1BRHA 2KXGA 3MWZA 3N54B 1K8A4 5M19A 4OUQA 3K63A 4BTXA 4FMBA 1PU4A 1GYBA 1VQQA 2XF3A 3Q90A 3BNBA 3OV4A 3PYJA 1UGIA 1DVCA 1O7NB 3LT9A 1FUTA 1VQ93 4R9KA 3V99A 2PNCA 5HGRA 4FCJA 1LRAA 4I5QA 1AQZA 5AYSC 4KFEA 1NJI4 3B8LA 2CW9A 2D42A 2F4YA
chains in the Genus database with same CATH topology
1BNJA 3WHOA 1X1UA 3RNTA 2KAAA 1FZUA 1GOUA 1B2SA 2SARA 1FW7A 1BNGA 1RNBA 3D5GA 1TRQA 1BSDA 1Q9EA 1RGKA 2HOHA 4GHOA 1B27A 1BNRA 3D4AA 1RGGA 1BGSA 1G02A 1BNSA 1I2FA 2KF6A 1X1XA 4HOHA 1I3IA 1PY3A 1CH0A 1BNIA 4GSPA 1RCKA 1BSAA 1X1YA 1RGCA 1FUSA 7RNTA 8RNTA 1RGLA 1HYFA 1PYLA 1B2XA 1B2UA 4BIRA 1DETA 1RNTA 5BU4A 1DE3A 1MGWA 3KCHA 3Q3FA 1RTUA 1B20A 1I0XA 2BIRA 2F5MA 3A5EA 4HAAA 2ZA4A 9RNTA 1RGEA 1BSEA 1BOXA 1UCKA 1ZGXA 3BIRA 3SYUA 1GOYA 1RGHA 1UCLA 4RNTA 1B2MA 1BRKA 1RGFA 1BRIA 1UCJA 2AADA 3AGOA 1B2ZA 1GMRA 1I8VA 6RNTA 1YVSA 6GSPA 1C54A 1T2HA 3HOHA 1RDSA 1TTOA 1BIRA 1RN1A 2KF5A 7GSPA 2KF3A 1SARA 5GSPA 1LOVA 1YNVX 1AY7A 1BRJA 1GSPA 1BRGA 1I2GA 1BU4A 1MGRA 3URPA 1BRSA 1BNEA 1JBSA 1UCIA 1BVIA 1RN4A 1BSBA 2RBIA 1GOVA 1RLSA 3AHSA 1BAOA 1RMSA 3BU4A 5RNTA 1FYSA 1BUJA 1GMQA 1BANA 1I0VA 2AAEA 3DH2A 4J5GA 2RNTA 2KF4A 1GMPA 1RHLA 1YGWA 1I3FA 1TRPA 1BRNL 3AGNA 2BU4A 1RCLA 1JBRA 1I70A 1R4YA 3GSPA 1BNFA 4J5KA 5BIRA 4BU4A 1B3SA 1T2IA 1B21A 1LNIA 1BRHA 2F5WA 1LOWA 3AHWA 5HOHA 1IYYA 1X1WA 1A2PA 1JBTA 1HZ1A 2GSPA 1FUTA 1BSCA 2C4BA 1I2EA 1LRAA 1RGAA 3D5IA 1RSNA 1LOYA 1AQZA 3WR2A 2F56A 3DGYA 2F4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNJ A;  3WHO A;  1X1U A;  3RNT A;  2KAA A;  1FZU A;  1GOU A;  1B2S A;  2SAR A;  1FW7 A;  1BNG A;  1RNB A;  3D5G A;  1TRQ A;  1BSD A;  1Q9E A;  1RGK A;  2HOH A;  4GHO A;  1B27 A;  1BNR A;  3D4A A;  1RGG A;  1BGS A;  1G02 A;  1BNS A;  1I2F A;  2KF6 A;  1X1X A;  4HOH A;  1I3I A;  1PY3 A;  1CH0 A;  1BNI A;  4GSP A;  1RCK A;  1BSA A;  1X1Y A;  1RGC A;  1FUS A;  7RNT A;  8RNT A;  1RGL A;  1HYF A;  1PYL A;  1B2X A;  1B2U A;  4BIR A;  1DET A;  1RNT A;  5BU4 A;  1DE3 A;  1MGW A;  3KCH A;  3Q3F A;  1RTU A;  1B20 A;  1I0X A;  2BIR A;  2F5M A;  3A5E A;  4HAA A;  2ZA4 A;  9RNT A;  1RGE A;  1BSE A;  1BOX A;  1UCK A;  1ZGX A;  3BIR A;  3SYU A;  1GOY A;  1RGH A;  1UCL A;  4RNT A;  1B2M A;  1BRK A;  1RGF A;  1BRI A;  1UCJ A;  2AAD A;  3AGO A;  1B2Z A;  1GMR A;  1I8V A;  6RNT A;  1YVS A;  6GSP A;  1C54 A;  1T2H A;  3HOH A;  1RDS A;  1TTO A;  1BIR A;  1RN1 A;  2KF5 A;  7GSP A;  2KF3 A;  1SAR A;  5GSP A;  1LOV A;  1YNV X;  1AY7 A;  1BRJ A;  1GSP A;  1BRG A;  1I2G A;  1BU4 A;  1MGR A;  3URP A;  1BRS A;  1BNE A;  1JBS A;  1UCI A;  1BVI A;  1RN4 A;  1BSB A;  2RBI A;  1GOV A;  1RLS A;  3AHS A;  1BAO A;  1RMS A;  3BU4 A;  5RNT A;  1FYS A;  1BUJ A;  1GMQ A;  1BAN A;  1I0V A;  2AAE A;  3DH2 A;  4J5G A;  2RNT A;  2KF4 A;  1GMP A;  1RHL A;  1YGW A;  1I3F A;  1TRP A;  1BRN L;  3AGN A;  2BU4 A;  1RCL A;  1JBR A;  1I70 A;  1R4Y A;  3GSP A;  1BNF A;  4J5K A;  5BIR A;  4BU4 A;  1B3S A;  1T2I A;  1B21 A;  1LNI A;  1BRH A;  2F5W A;  1LOW A;  3AHW A;  5HOH A;  1IYY A;  1X1W A;  1A2P A;  1JBT A;  1HZ1 A;  2GSP A;  1FUT A;  1BSC A;  2C4B A;  1I2E A;  1LRA A;  1RGA A;  3D5I A;  1RSN A;  1LOY A;  1AQZ A;  3WR2 A;  2F56 A;  3DGY A;  2F4Y A; 
#chains in the Genus database with same CATH topology
 1IT7 A;  3FSD A;  3DM8 A;  1DVD A;  3LTB A;  4PEJ A;  3DGM A;  3OWY A;  1FZU A;  2UGI A;  2XR8 B;  5IF6 A;  3G6E 3;  4MJD A;  3ECF A;  4ZM8 A;  1K28 A;  1EEJ A;  1EUI C;  1KWI A;  2QA4 3;  1QAF A;  1TRQ A;  3L0R A;  4WFO A;  1RGK A;  1VQO 3;  2FNQ A;  2C10 A;  4QWT A;  1GY5 A;  4G1M B;  5CF2 A;  5KP4 A;  1BGS A;  1NU3 A;  1G02 A;  5STD A;  1I2F A;  3NBR A;  3SVA A;  1X1X A;  3NQZ A;  4HOH A;  4CJN A;  1VQL 3;  3GZB A;  5EQL A;  3X3X A;  5A0O B;  3A76 A;  4GSP A;  2CG1 A;  1NB3 I;  1BSA A;  1OHP A;  1QMA A;  1X1Y A;  1RGL A;  1FGM A;  3EC9 A;  3WOE B;  3FLJ A;  1PYL A;  1B2X A;  2GXF A;  2BMR B;  3D79 A;  1SPU A;  1DET A;  3SX1 A;  3NBJ A;  3FH1 A;  1MGW A;  3KCH A;  3HZP A;  1LQM B;  1M9G A;  3Q3F A;  4FMA A;  4EV2 A;  1AR0 A;  2BMQ B;  1RTU A;  1IQY A;  2ZHX B;  2MF7 A;  4BL3 A;  4LZI A;  1RGE A;  1FGT A;  5EVH A;  1JZD A;  1IV9 A;  1BSE A;  2STD A;  4XB5 A;  3G4S 3;  1ZGX A;  3OWS A;  1NB5 I;  5BXQ A;  3VSY A;  3V98 A;  3HIG A;  4KFF A;  3WMD A;  2P0M A;  2CX1 A;  4LYL B;  2OTJ 3;  1W2B 2;  4LGQ A;  2W6J H;  3ZG0 A;  1UDI I;  4N6O B;  3JUP A;  3F8H A;  1RDS A;  1Q82 4;  2RCD A;  3JUN A;  3S27 A;  2CWV A;  5CK6 A;  3F7X A;  1TU5 A;  2OTL 3;  3EF8 A;  5GSP A;  3ZFZ A;  2XEP A;  4X2O A;  3SOA A;  1GSP A;  3U97 A;  1BRG A;  5LC6 A;  3URP A;  2GEY A;  4KZ1 A;  2GEX A;  2Z76 A;  3H3H A;  2CHC A;  3HK4 A;  1BSB A;  1AVK A;  2WO0 A;  3HX8 A;  5AIG A;  1UW1 A;  1MWS A;  1O7W B;  1CQS A;  3AHS A;  2L4V A;  2J8X B;  3CXC 2;  3GZR A;  2YFL B;  3BU4 A;  4FMD A;  2CC3 A;  3PXM A;  1TUH A;  1BUJ A;  1E3R A;  3LH4 A;  1N8R 4;  3F8X A;  3OW2 2;  1W00 A;  1JV2 B;  5IG5 A;  1OH0 A;  3I56 3;  7STD A;  2RNT A;  1RHL A;  1UUG B;  1YGW A;  1VQK 3;  1HKX A;  1CYV A;  1IVX A;  3M8C A;  3Q1C A;  3SXX A;  3PGB A;  4OK0 A;  3EN8 A;  3EHC A;  2P38 A;  1LOX A;  4HM0 B;  3ROB A;  5DRV A;  1UI7 A;  3ZG5 A;  2W56 B;  3AGN A;  5G2G A;  2W9Q A;  5IEO A;  3UB1 A;  4NPB A;  2R4I A;  4WYK B;  3CPW 2;  3I0Y A;  3WOD G;  4RNZ A;  3E99 A;  1J2B A;  4J5K A;  4CPK A;  3KSP A;  1R4C A;  4RNY A;  1W2Z A;  1EQK A;  2B24 B;  2YFI B;  1IVW A;  1LOW A;  3AHW A;  1JB4 A;  1OUN A;  2F98 A;  2WOF A;  3CPO A;  4O2H A;  3DGO A;  2OOV A;  1IYY A;  5FW5 A;  1X1W A;  4HVN A;  5IER A;  2CG0 A;  3B4O A;  3NBB A;  1ASK A;  4AKY A;  1JBT A;  4HM4 B;  2GSP A;  2OWP A;  4MMY B;  1UUW B;  2B1X B;  4O8S A;  1SJW A;  2GBX B;  3WA3 A;  3CD6 3;  5LC7 A;  3S5C A;  2C4B A;  3X41 A;  2OQE A;  2ZDJ A;  1RSN A;  1GY7 A;  2IA7 A;  3T0U A;  3OWU A;  5CF1 A;  5IEN A;  3NUV A;  4LEH A;  1Q86 4;  1UI8 A;  1BNJ A;  2UX0 A;  3WHO A;  3RNT A;  3FG3 A;  2KAA A;  4RBN A;  1TP6 A;  4EYC A;  1GOU A;  2JDI H;  4J8T A;  1RKY A;  3BND A;  1BNG A;  2ZL8 A;  3D5G A;  4L7K A;  3KN4 A;  3LTA A;  4FR9 A;  4IPB A;  1JNQ A;  4GHO A;  1BNR A;  2HMK B;  3D4A A;  1BNS A;  3BNE A;  3H51 A;  5G1K A;  3Q2P A;  3WDG B;  3F9S A;  5BVB A;  3B7C A;  2K54 A;  3G0K A;  3OXA A;  5IG3 A;  1BNI A;  4N6M A;  1W6C A;  2CX0 A;  5CLK A;  2CKF B;  3UJM A;  1V58 A;  2W9P A;  3CME 3;  2XSO B;  3ER7 A;  4BIR A;  3NV0 B;  2QIY A;  3KSE D;  2HMM B;  4BTW A;  3K5T A;  1M1K 4;  2BNG A;  4WP5 A;  3AMO A;  1W01 A;  2XGN A;  1VQN 3;  2F5M A;  2GU1 A;  4HAA A;  4J9A A;  2Z6B A;  1JKG A;  1OAC A;  1ROV A;  3FF2 A;  1TFO A;  1V74 A;  4HBR A;  2Z7A A;  1WMN A;  3NX0 A;  1IVV A;  1O7P B;  3BIR A;  3QRD A;  3SYU A;  1GOY A;  1IDP A;  2JQ5 A;  1GD3 A;  3MYT A;  4RNT A;  4IIA A;  1YI2 3;  1RGF A;  1LXE A;  1S5A A;  1GMR A;  1YHQ 3;  1I8V A;  3EBY A;  6RNT A;  1JN5 B;  1YVS A;  4K90 B;  2XGL A;  3EX9 A;  1JZO A;  1Q40 B;  1QVG 2;  1M1X B;  1UUV B;  4BTY A;  3HII A;  1RN1 A;  1DYU A;  3SOY A;  1JKG B;  1ZX2 A;  4HZ9 B;  1BUQ A;  3JUO A;  4HM3 B;  3X42 A;  1KC8 4;  2ML5 A;  1YNV X;  4LMI A;  3K9M C;  1AY7 A;  1Z1S A;  1I2G A;  3G8Z A;  1W5Z A;  3IMA B;  1MGR A;  2CWU A;  2GU3 A;  1VQ8 3;  3CMA 3;  1FUW A;  4LSO A;  3GZX B;  1GD4 A;  5AEU B;  2A15 A;  3CCS 3;  1RLS A;  3SLU A;  1BAO A;  4XBT A;  1M90 4;  3K0Z A;  3CC4 3;  8CHO A;  4FCM A;  3D3L A;  3STD A;  2LYX A;  1GMQ A;  1BAN A;  3ALA A;  2RFR A;  4HYZ A;  1I0V A;  1VQ6 3;  3DH2 A;  1GS3 A;  1RRH A;  3FCS B;  3N9H A;  1VQM 3;  4DKI A;  4WYK A;  1ULI B;  5EEO A;  3NHX A;  2W0Q A;  3DXO A;  1A2K A;  4XBY A;  1FA3 A;  2KRT A;  4H61 A;  2CWT A;  3BNC A;  1JB2 A;  3CCU 3;  1VQ4 3;  3DGL A;  1A67 A;  3G16 A;  2O3O A;  5G1L A;  1RCL A;  3VGN A;  3EQQ B;  1JBR A;  3T8N A;  1I70 A;  3MG3 A;  2Y74 A;  4KVH A;  4X2H A;  1EKM A;  3U1W A;  5BIR A;  4BU4 A;  1OCV A;  5D82 A;  2F5W A;  1D6Y A;  1OPY A;  1YIT 3;  1VQP 3;  4NRE A;  1ISK A;  1JJ2 2;  3CC7 3;  5M1A A;  3KKG A;  2QGU A;  1SQW A;  1W6Y A;  1ULJ B;  2BT3 A;  4XDV A;  1YJW 3;  2RSX A;  3S28 A;  1IV7 A;  3FG1 A;  2INX A;  1RGA A;  3D5I A;  4N3V A;  2BMO B;  2F56 A;  2IUJ A;  2E2U A;  3EBT A;  4R9L A;  4EXR A;  1E3V A;  3LT8 A;  2YX9 A;  4R4K A;  5AII A;  1O7G B;  1KD1 4;  3OX9 A;  1FGO A;  1B2S A;  4L8P A;  1FW7 A;  1RNB A;  2IY2 A;  1BSD A;  1Q9E A;  3CNX A;  2HOH A;  2LQV A;  4HM7 B;  4HKV B;  3FG4 A;  2FGT A;  5JPU A;  5M18 A;  2CH9 A;  1RGG A;  1CYU A;  2IMJ A;  2KF6 A;  3LTD A;  2CFD A;  2F99 A;  3UL6 A;  1I3I A;  1PY3 A;  5CXO A;  1TIJ A;  1A90 A;  1IVU A;  1RCK A;  1QAK A;  4O02 B;  3V92 A;  1U5O A;  1FUS A;  4HM5 B;  3AMO B;  3X3Z A;  2HMJ B;  7RNT A;  2OQE C;  1IK3 A;  1HYF A;  4Q53 A;  3F40 A;  2W2C A;  3FGY A;  3LYG A;  1TJD A;  1KSI A;  2W03 A;  1DMM A;  1FGR A;  1OGX A;  1RNT A;  1LVN A;  3IPT A;  5BU4 A;  1Q81 4;  1O7H B;  4MEI A;  1B20 A;  1I0X A;  2BIR A;  3CNM A;  1IQ8 A;  2Y73 A;  3A5E A;  3WA2 X;  1SII A;  9RNT A;  5JPP A;  1IT8 A;  1N9J A;  3S29 A;  1RJO A;  3PCS A;  4CCV A;  3NV0 A;  1YGE A;  1OGZ A;  2HMN B;  1BOX A;  3DY5 A;  4N6T A;  1OHO A;  3NM2 A;  3RGR A;  1RGH A;  1UCL A;  2XFS A;  3PCR A;  1B2M A;  1DE3 A;  4FMC A;  5D83 A;  1Q7H A;  1BRI A;  3AGO A;  1B2Z A;  5KP3 A;  1VQ7 3;  3MG1 A;  4JRF A;  5IG0 A;  6GSP A;  1C54 A;  3HOH A;  2YFJ B;  1BIR A;  1RRL A;  5DRE A;  1WMO A;  4JF8 A;  3CCR 3;  3NQY A;  4TX4 A;  1YVB I;  3CCJ 3;  1UGH I;  1SIH A;  2KF3 A;  1SAR A;  4HM8 B;  3GZY B;  1MWR A;  2CK3 H;  2V1L A;  3GWR A;  1BRJ A;  1MNL A;  1RN7 A;  1W4N A;  3MKI A;  4NHF A;  3EB8 A;  1NWW A;  1OF5 B;  2FXT A;  1RN4 A;  2Z77 A;  4XM4 A;  3F7S A;  1AV4 A;  2XH9 A;  3S67 A;  4BL2 A;  3UNL A;  5RNT A;  3PZW A;  1FYS A;  3JUQ A;  2D1W A;  1F8N A;  3RDE A;  3CCQ 3;  3B4P A;  2CFW A;  4J5G A;  1YIJ 3;  2KF4 A;  4KFD A;  3CCV 3;  1I3F A;  1TRP A;  1BRN L;  3FF0 A;  5IW9 A;  1EA2 A;  2R41 A;  3D9R A;  5HOH A;  4AEQ A;  1C7H A;  3KII A;  3SED A;  1R4Y A;  1STD A;  3LOY A;  1KQS 2;  2K3D A;  3GSP A;  1BNF A;  5AI1 A;  3CCL 3;  1YJ9 3;  1WNH A;  1B3S A;  1T2I A;  1B21 A;  1EG9 B;  2W04 A;  4N6L A;  3X3Y A;  2L1S A;  3QK9 A;  2XFT A;  1WTH A;  2WGQ A;  1PFP A;  3LXU X;  4K61 A;  2WGO A;  3MHE A;  4R80 A;  3J7Y d;  3UL5 A;  1TFK A;  2HML B;  1A2P A;  1HZ1 A;  1W02 A;  4H3U A;  5ELJ A;  1QVF 2;  5TGN A;  1O7M B;  2HMO B;  2I9W A;  3O8Y A;  4KT3 B;  4CDL A;  4GB5 A;  3BB9 A;  1QAL A;  1BSC A;  1AVL A;  1I2E A;  4ORL A;  6STD A;  3KFQ C;  1LOY A;  3I55 3;  5AEW B;  3WR2 A;  3N8B A;  1D6U A;  4N6U A;  3DGY A;  4L8O A;  1IU7 A;  3NM7 A;  2QEX 3;  5I97 A;  1VQ5 3;  1DMQ A;  2CFG A;  1X1U A;  2M7O A;  4HZB B;  2Q07 A;  2KCD A;  1NO3 A;  2GBW B;  2SAR A;  3VF1 A;  1ZO2 A;  3IJE B;  1T5Y A;  3LTC A;  3CU3 A;  4O3V A;  3MSO A;  5KP1 A;  2P0X A;  1B27 A;  1G96 A;  1Q42 A;  3CCE 3;  2E2V A;  2XRX B;  3KE7 A;  1YJN 3;  3G71 3;  1CH0 A;  4K1V A;  4EW5 A;  3DMC A;  8RNT A;  1RGC A;  4I4K A;  1GY6 A;  1LQG C;  3F14 A;  4WWU C;  1LNH A;  1HU9 A;  2E2T A;  2XSH B;  4XDW A;  1B2U A;  4HJL B;  2H0G A;  1L5G B;  1WQL B;  1JN5 A;  2H0I A;  2SBL A;  1DMN A;  3JUM A;  1MWT A;  2CFK A;  5ELU A;  2ZA4 A;  1Q7Y 4;  3PS8 A;  1K9M 4;  1A2V A;  1ZS7 A;  2OCT A;  3T8U A;  1MOL A;  1ROA A;  3LML A;  1Y4K A;  2P05 A;  1JRQ A;  1UCK A;  3DGN A;  4HM1 B;  4EC6 A;  2IUK A;  4XBX A;  1E97 A;  1MWU A;  4WHA A;  5D81 A;  4EBG A;  1BRK A;  1QJG A;  1UCJ A;  5AIH A;  1G0T A;  2AAD A;  2CIU A;  2PZV A;  3GRD A;  5AIF A;  3DZL A;  3NXJ A;  3HI7 A;  2RGQ A;  2IYJ A;  4OVM A;  1T2H A;  3EE1 A;  1OHS A;  1TTO A;  3K7C A;  4U13 A;  2WOH A;  2KF5 A;  3EJV A;  1N5P A;  7GSP A;  4ILF A;  1N8Q A;  1K73 4;  1LOV A;  3KZT A;  5AYR B;  2C11 A;  4R1K A;  1US1 A;  2K0M A;  2BHM A;  1D6Z A;  1BU4 A;  4HM6 B;  4IT7 A;  4AKZ A;  1BRS A;  5FGO A;  1BNE A;  1U8C B;  2ML6 A;  2OOV C;  1JBS A;  1UCI A;  1BVI A;  1WMP A;  1T3B A;  3FZW A;  1W6G A;  3TDG A;  2RBI A;  4N6V 0;  3X40 A;  1V57 A;  3MPH A;  3JVC A;  1FGQ A;  4GL6 A;  1STF I;  1GOV A;  3GAX A;  1CEW I;  1RMS A;  4STD A;  5IEP A;  1Q40 A;  3CC2 3;  1OF5 A;  3CCM 3;  1W7C A;  4MMX B;  3FKA A;  3MG2 A;  3RGA A;  2AAE A;  1N9E A;  2W56 A;  2O9U X;  3LZA A;  4FCZ A;  1JB5 A;  1IQX A;  1GMP A;  3EN1 B;  3DUK A;  4RZM A;  4EV5 A;  3WOF B;  4K1U A;  1NNV A;  2BO9 B;  2H0H A;  2F86 B;  3BLZ A;  1NDO B;  5JBS A;  2BU4 A;  4MMZ B;  1VZZ A;  1N5H A;  2UUG C;  1S72 3;  4HM2 B;  4N6N B;  2CFL A;  5IG4 A;  2P09 A;  1LNI A;  2MC8 A;  1K41 A;  1BRH A;  2KXG A;  3MWZ A;  3N54 B;  1K8A 4;  5M19 A;  4OUQ A;  3K63 A;  4BTX A;  4FMB A;  1PU4 A;  1GYB A;  1VQQ A;  2XF3 A;  3Q90 A;  3BNB A;  3OV4 A;  3PYJ A;  1UGI A;  1DVC A;  1O7N B;  3LT9 A;  1FUT A;  1VQ9 3;  4R9K A;  3V99 A;  2PNC A;  5HGR A;  4FCJ A;  1LRA A;  4I5Q A;  1AQZ A;  5AYS C;  4KFE A;  1NJI 4;  3B8L A;  2CW9 A;  2D42 A;  2F4Y A; 
#chains in the Genus database with same CATH homology
 1BNJ A;  3WHO A;  1X1U A;  3RNT A;  2KAA A;  1FZU A;  1GOU A;  1B2S A;  2SAR A;  1FW7 A;  1BNG A;  1RNB A;  3D5G A;  1TRQ A;  1BSD A;  1Q9E A;  1RGK A;  2HOH A;  4GHO A;  1B27 A;  1BNR A;  3D4A A;  1RGG A;  1BGS A;  1G02 A;  1BNS A;  1I2F A;  2KF6 A;  1X1X A;  4HOH A;  1I3I A;  1PY3 A;  1CH0 A;  1BNI A;  4GSP A;  1RCK A;  1BSA A;  1X1Y A;  1RGC A;  1FUS A;  7RNT A;  8RNT A;  1RGL A;  1HYF A;  1PYL A;  1B2X A;  1B2U A;  4BIR A;  1DET A;  1RNT A;  5BU4 A;  1DE3 A;  1MGW A;  3KCH A;  3Q3F A;  1RTU A;  1B20 A;  1I0X A;  2BIR A;  2F5M A;  3A5E A;  4HAA A;  2ZA4 A;  9RNT A;  1RGE A;  1BSE A;  1BOX A;  1UCK A;  1ZGX A;  3BIR A;  3SYU A;  1GOY A;  1RGH A;  1UCL A;  4RNT A;  1B2M A;  1BRK A;  1RGF A;  1BRI A;  1UCJ A;  2AAD A;  3AGO A;  1B2Z A;  1GMR A;  1I8V A;  6RNT A;  1YVS A;  6GSP A;  1C54 A;  1T2H A;  3HOH A;  1RDS A;  1TTO A;  1BIR A;  1RN1 A;  2KF5 A;  7GSP A;  2KF3 A;  1SAR A;  5GSP A;  1LOV A;  1YNV X;  1AY7 A;  1BRJ A;  1GSP A;  1BRG A;  1I2G A;  1BU4 A;  1MGR A;  3URP A;  1BRS A;  1BNE A;  1JBS A;  1UCI A;  1BVI A;  1RN4 A;  1BSB A;  2RBI A;  1GOV A;  1RLS A;  3AHS A;  1BAO A;  1RMS A;  3BU4 A;  5RNT A;  1FYS A;  1BUJ A;  1GMQ A;  1BAN A;  1I0V A;  2AAE A;  3DH2 A;  4J5G A;  2RNT A;  2KF4 A;  1GMP A;  1RHL A;  1YGW A;  1I3F A;  1TRP A;  1BRN L;  3AGN A;  2BU4 A;  1RCL A;  1JBR A;  1I70 A;  1R4Y A;  3GSP A;  1BNF A;  4J5K A;  5BIR A;  4BU4 A;  1B3S A;  1T2I A;  1B21 A;  1LNI A;  1BRH A;  2F5W A;  1LOW A;  3AHW A;  5HOH A;  1IYY A;  1X1W A;  1A2P A;  1JBT A;  1HZ1 A;  2GSP A;  1FUT A;  1BSC A;  2C4B A;  1I2E A;  1LRA A;  1RGA A;  3D5I A;  1RSN A;  1LOY A;  1AQZ A;  3WR2 A;  2F56 A;  3DGY A;  2F4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...