3WHOA

X-ray-crystallographic structure of an rnase po1 exhibiting anti-tumor activity
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Po1
publication title X-Ray Crystallographic Structure of RNase Po1 That Exhibits Anti-tumor Activity
pubmed rcsb
source organism Pleurotus ostreatus
total genus 21
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3whoA00
1T2IA 6GSPA 1UCKA 7GSPA 1UCLA 1RN4A 1GOUA 4RNTA 2BIRA 1DE3A 1G02A 1R4YA 2GSPA 3D5GA 2ZA4A 3DGYA 1BOXA 1BNFA 4GHOA 1ZGXA 3DH2A 3KCHA 1BRSA 1X1UA 3Q3FA 2KF6A 1BNJA 1I3FA 1FYSA 1RGFA 1I70A 1RDSA 1RGLA 3GSPA 1BNGA 1BU4A 1I0VA 2F5WA 3A5EA 1I2FA 1Q9EA 4GSPA 1BNIA 3D5IA 1B3SA 1RNBA 1GOYA 1RMSA 1LOYA 3RNTA 3AHWA 1CH0A 1PY3A 2RBIA 1I3IA 1BNSA 2KF4A 1BNEA 1TRPA 1LRAA 1AY7A 1LNIA 4BU4A 2KF3A 3BU4A 2F4YA 1PYLA 4HOHA 1SARA 4J5KA 2HOHA 1GMRA 1YVSA 1BRGA 1I0XA 2KF5A 3AGNA 4BIRA 1BRNL 1RHLA 1DETA 1HYFA 1JBTA 1A2PA 1UCJA 1MGWA 3D4AA 1B2XA 3AGOA 1IYYA 1B21A 7RNTA 5BIRA 1BIRA 1BUJA 1FUSA 1HZ1A 2AADA 2RNTA 1BNRA 5BU4A 4HAAA 1BRJA 4J5GA 3SYUA 1YNVX 1X1XA 3WHOA 1RSNA 1TTOA 1B2SA 1BANA 1RTUA 1JBSA 1RGCA 1BSEA 1BRIA 1T2HA 1RGEA 1GMQA 1BVIA 5GSPA 1GOVA 1RLSA 1AQZA 1FZUA 2F5MA 1BRKA 1C54A 1RCKA 1I2EA 1BGSA 1X1YA 1X1WA 1GMPA 1BAOA 1GSPA 1FW7A 1LOVA 1RGAA 1RGHA 1B27A 1B2ZA 1RGKA 1B2MA 1JBRA 1B2UA 1BRHA 1RCLA 3AHSA 9RNTA 1BSCA 1BSBA 1RGGA 2KAAA 1FUTA 1YGWA 1UCIA 3HOHA 1BSDA 1LOWA 6RNTA 2SARA 1TRQA 2C4BA 1B20A 1RN1A 3URPA 1MGRA 8RNTA 1BSAA 1I8VA 3BIRA 2F56A 2AAEA 5HOHA 3WR2A 1RNTA 1I2GA 2BU4A 5RNTA
chains in the Genus database with same CATH superfamily
1T2IA 1VQ73 2CIUA 1E3VA 7GSPA 3VF1A 3S29A 2P09A 3LH4A 4O02B 1RN4A 2L1SA 1OACA 1DE3A 3CU3A 3X40A 1R4YA 5M19A 2GSPA 1YIT3 5A0OB 1HU9A 2HMLB 2J8XB 1TU5A 4TX4A 4GHOA 1ZGXA 2W9QA 2I9WA 3KCHA 1GY6A 4NPBA 4QWTA 1I3FA 2ML6A 1BU4A 5D83A 2JQ5A 3S5CA 3F8HA 3FF2A 1IK3A 5IG5A 3A5EA 4MEIA 3FG3A 5HGRA 1TP6A 5JPUA 2Y73A 3CMA3 2P38A 5D82A 6STDA 1QAKA 1U8CB 1UI8A 3F7SA 1EUIC 2GU1A 1VQM3 2IMJA 2BMRB 1OGZA 1BNSA 2OQEA 1BNEA 3GZXB 3CCE3 3CC73 1TRPA 3X42A 1IVXA 3MG1A 4BTWA 1A67A 4XDVA 3WDGB 2H0HA 2XH9A 3PZWA 3CCV3 1QJGA 4AEQA 3BU4A 4RZMA 1Q40B 3AMOB 3CNXA 3VSYA 1NB3I 2OOVA 1VQN3 4L8PA 1IT8A 1ULIB 1JB2A 1KWIA 1Q40A 3AMOA 1O7WB 1SIIA 1ZX2A 4J5KA 1QMAA 2WGOA 3H51A 1IT7A 1A90A 4U13A 2D1WA 1NB5I 5TGNA 3T8UA 3KIIA 1UUWB 1JBTA 4O3VA 1UCJA 2KXGA 1K28A 1IDPA 3WMDA 3A76A 2B1XB 3WOEB 5D81A 1Q42A 8CHOA 2KCDA 1Q814 1IYYA 3MKIA 3S27A 1BIRA 3KN4A 1BUJA 2FNQA 1FUSA 1Y4KA 1HZ1A 5JBSA 1NO3A 1OHPA 2RNTA 4KFDA 1BNRA 4LGQA 3FGYA 2PZVA 3RDEA 1CYVA 3HI7A 1O7HB 1ASKA 1ULJB 1US1A 1IQ8A 1E97A 1BANA 2LYXA 1JBSA 1BRIA 1GMQA 1IU7A 1BVIA 4WHAA 3B7CA 2CG1A 4KFEA 1A2VA 3EQQB 1RLSA 1FZUA 3LYGA 1V58A 2WOHA 3UL6A 1OCVA 3SOYA 2IYJA 3V98A 2M7OA 2XFSA 4OK0A 1STDA 3K9MC 3JVCA 1MWRA 1ZO2A 1BAOA 1JN5B 5AIIA 1YI23 1OGXA 4STDA 3NM2A 1JN5A 3DZLA 4XBTA 3JUPA 2W04A 4HM2B 3FSDA 2QA43 3D3LA 3BNBA 4Q53A 1RGGA 3OW22 4G1MB 2BNGA 3CCR3 3X41A 1UCIA 1UGHI 6RNTA 3LTBA 4FMCA 2C4BA 3WOFB 1B20A 1RN1A 3I563 3CME3 3F9SA 4CJNA 1BSAA 1UW1A 4FR9A 4MMXB 1I8VA 3SX1A 4WYKB 3OXAA 2RFRA 4J9AA 1OPYA 4WYKA 1DMMA 3N54B 1FGQA 1RNTA 3JUOA 4HM7B 3ECFA 1L5GB 4H61A 5RNTA 1W5ZA 3ER7A 4RNYA 1UCKA 3ZG5A 2ML5A 5KP3A 5LC6A 5I97A 2OTJ3 2C10A 2P0MA 4FCJA 1GOUA 1R4CA 4RNTA 1G02A 1M9GA 4R1KA 4HJLB 5JPPA 1ISKA 1TIJA 2ZA4A 5KP1A 3HIIA 1BNFA 4XBXA 3DH2A 1IQYA 4RBNA 4L8OA 3G4S3 1DMQA 2GEYA 1RDSA 1RGLA 2BMQB 3EB8A 4LYLB 1VQL3 1OHOA 4N6MA 1VQ93 1JNQA 3F8XA 2F5WA 2MF7A 1RNBA 1BNIA 7STDA 1B3SA 1RJOA 2RCDA 3NX0A 1RMSA 3GWRA 1LOYA 1W6YA 2CFGA 3K0ZA 1W02A 3FZWA 4MJDA 3MG3A 1JRQA 3RNTA 1T5YA 3KE7A 3HK4A 2YFLB 1WTHA 2O9UX 2P05A 1IV9A 2MC8A 3SVAA 2W0QA 3JUQA 3ZG0A 5CF2A 1QALA 3B4OA 4K1UA 3G8ZA 4HM0B 4FMDA 4BU4A 3Q90A 1EG9B 4FMBA 1IVWA 2F4YA 2P0XA 4BTXA 1SARA 2Z7AA 2FGTA 4LEHA 4L7KA 3EC9A 4HZBB 4O2HA 5G1LA 2CFLA 3CPOA 2Z77A 3BNCA 3OV4A 3AGNA 3NXJA 4BIRA 3NBRA 5AEWB 1BRNL 2CHCA 2CWUA 1O7MB 3X3XA 5CF1A 1LNHA 4AKYA 3G713 2R4IA 2HMJB 1EEJA 1W01A 3TDGA 1B2XA 1N5HA 2W2CA 7RNTA 1VQ43 2ZHXB 5BIRA 1E3RA 3CC23 4K90B 3CCM3 2C11A 1YGEA 3D79A 3QRDA 5LC7A 3PYJA 1M1K4 1AR0A 5BU4A 3MHEA 1T3BA 3DGNA 3HZPA 5AEUB 3NQYA 1SPUA 1KQS2 3U97A 1KD14 1YNVX 1YJ93 1ROVA 3K5TA 1X1XA 3ZFZA 2RGQA 1QVF2 1G0TA 3F40A 1RTUA 5IG0A 3FCSB 5AYRB 3EN1B 1DYUA 1RGCA 4GB5A 3VGNA 3HX8A 1S5AA 2BHMA 3N8BA 1AQZA 1C7HA 4LZIA 3S28A 5EVHA 3NQZA 2SBLA 1C54A 4O8SA 1RCKA 4EYCA 1LOXA 3FKAA 3SOAA 1AVLA 4CPKA 1D6YA 1JB4A 2CH9A 1X1YA 1O7PB 2B24B 2IA7A 1NDOB 3I553 3EHCA 3WA3A 1RN7A 4RNZA 4HM3B 1RGHA 1B27A 2H0IA 1B2ZA 3JUNA 2F98A 1V57A 3KKGA 1TJDA 2CX0A 5G2GA 1UUVB 3EBYA 4HYZA 5IW9A 1BSCA 1BSBA 2BT3A 3X3YA 5IG4A 2K0MA 2STDA 3QK9A 4N6UA 2K54A 1LOWA 1W6GA 2GU3A 2SARA 5STDA 1AV4A 3EX9A 2BMOB 3NHXA 5CXOA 1UI7A 1OUNA 1A2KA 1EKMA 8RNTA 5DREA 1N5PA 4XB5A 3B4PA 4XM4A 4AKZA 3IJEB 1Q7Y4 3OWYA 4N6OB 4DKIA 5HOHA 1D6ZA 2BO9B 2W56B 3U1WA 4EXRA 4ORLA 1JV2B 3GRDA 3MSOA 1YIJ3 1RRHA 2W56A 2XFTA 4JRFA 2XGLA 6GSPA 1MNLA 3EE1A 3PCSA 1ZS7A 5AYSC 4LMIA 2F86B 1QAFA 1YJN3 3L0RA 2BIRA 3DGOA 1N9JA 4KFFA 5G1KA 2IUJA 3FLJA 1VQP3 1STFI 5EQLA 3KSPA 2WGQA 1IVVA 2KF6A 3JUMA 1I70A 5ELUA 4HM5B 5EEOA 1BNGA 2E2VA 3LTDA 1WNHA 4I5QA 1JB5A 4EV2A 1I0VA 3D5IA 1MWTA 1K9M4 3I0YA 4FMAA 3AHWA 1YJW3 1WMNA 2RBIA 2KF4A 1JZDA 1VQ63 3GZYB 5M18A 4N3VA 2CWTA 4LSOA 5AIFA 5BVBA 1QVG2 1J2BA 3D9RA 3E99A 1S723 3CCQ3 1CEWI 3LTCA 1K8A4 4EV5A 2HMKB 3DMCA 3FH1A 4CDLA 1PYLA 4HOHA 2KRTA 3KFQC 3G6E3 4R9KA 1FGRA 3BB9A 2PNCA 1JKGB 4HM6B 1GMRA 2KF5A 3UJMA 1JKGA 2HMOB 2OCTA 2JDIH 3FG1A 4HM4B 1RHLA 4HM1B 4HKVB 2Z76A 3Q2PA 1MOLA 1PU4A 3EBTA 3AGOA 4IT7A 1B21A 1MWSA 4NREA 3UL5A 3CCS3 4R9LA 3EJVA 1EQKA 3CXC2 1ROAA 2W03A 2ZL8A 3DM8A 3N9HA 3WA2X 2AADA 1Q7HA 3NV0B 1CQSA 2ZDJA 4J5GA 5AIGA 3WODG 3SEDA 3NV0A 4CCVA 2CG0A 4X2OA 1EA2A 1IQXA 1TTOA 3RGAA 1B2SA 3LTAA 4IPBA 1O7NB 4XBYA 1UDII 1RRLA 1W7CA 1BSEA 1T2HA 1TFOA 1FGMA 1K41A 3MG2A 5BXQA 1M1XB 2F5MA 3OWUA 3F7XA 4MMZB 5IEOA 1SIHA 4I4KA 1WQLB 2CWVA 3ROBA 1X1WA 1CYUA 2YX9A 3O8YA 2XSOB 1SQWA 1FW7A 1NNVA 3UB1A 1BUQA 2LQVA 4XDWA 2XEPA 1B2MA 1JBRA 3GZBA 1BRHA 1TFKA 5AIHA 2WOFA 1RCLA 2UX0A 9RNTA 1RKYA 3CPW2 3DGLA 1GY7A 2HMNB 3V92A 4BTYA 3HOHA 1W6CA 3SXXA 1VQO3 1NWWA 4OVMA 3T0UA 2OTL3 3K7CA 3Q1CA 1IVUA 3MWZA 3G16A 4EC6A 2F56A 3F14A 4MMYB 1VQK3 4WP5A 4OUQA 5M1AA 1JZOA 2AAEA 5IERA 4BL2A 2UGIA 3BNDA 3WR2A 5FW5A 1OF5B 2W6JH 2XR8B 3CCU3 1I2GA 1KC84 1Q864 1N9EA 1FGOA 1OF5A 5IF6A 2UUGC 4WFOA 1MWUA 5AI1A 1DVCA 1UCLA 2GBXB 3T8NA 2CFDA 3NUVA 3OX9A 4N6NB 2GBWB 3DXOA 1OHSA 3D5GA 3FF0A 3K63A 4BL3A 1FA3A 3DGYA 1BOXA 2QGUA 3H3HA 1N8QA 4HZ9B 3EN8A 4KVHA 1F8NA 1BRSA 1X1UA 3Q3FA 4N6LA 1BNJA 1SJWA 1FYSA 1RGFA 2CFWA 1GYBA 3GSPA 5DRVA 1V74A 2HMMB 3PXMA 1I2FA 1Q9EA 4GSPA 3DUKA 3STDA 1UUGB 2GEXA 1GOYA 3DGMA 3LXUX 4HBRA 1YVBI 1CH0A 1PY3A 2XF3A 3LT9A 4KT3B 4WWUC 1I3IA 3HIGA 2QEX3 1Z1SA 3BLZA 3KSED 3GAXA 1U5OA 2IY2A 4NHFA 1LRAA 1WMOA 4KZ1A 5FGOA 3J7Yd 1K734 1NU3A 2FXTA 1YHQ3 1VQ53 1AY7A 1KSIA 3CCJ3 1LNIA 2K3DA 2KF3A 2A15A 3S67A 4FCMA 2Y74A 5KP4A 2XGNA 3DY5A 3ALAA 3GZRA 3LMLA 3RGRA 2HOHA 3CD63 3FG4A 3V99A 1DMNA 1YVSA 1BRGA 1I0XA 1W4NA 4J8TA 1DETA 1HYFA 4IIAA 1A2PA 3NBBA 1LXEA 1UGIA 1HKXA 1W2ZA 4ILFA 1MGWA 3D4AA 1N8R4 3IPTA 2F99A 5CK6A 5ELJA 3NM7A 4K61A 4X2HA 4PEJA 5IG3A 3UNLA 1W2B2 2INXA 3MYTA 2WO0A 2IUKA 4HAAA 4EBGA 1BRJA 3SYUA 4R80A 4N6V0 1IV7A 2GXFA 3WHOA 1RSNA 3PCRA 3PS8A 1GY5A 3LT8A 1RGEA 4FCZA 2O3OA 5GSPA 1DVDA 3EF8A 4R4KA 1OH0A 2V1LA 1GOVA 1FUWA 1GD4A 1BRKA 2D42A 4N6TA 5CLKA 4ZM8A 1AVKA 1Q824 1I2EA 1JJ22 1BGSA 1O7GB 2XRXB 3X3ZA 1TUHA 2L4VA 1GMPA 3KZTA 3CC43 1VQ83 1GSPA 2Z6BA 1LOVA 2YFIB 1LQGC 1D6UA 3B8LA 3MPHA 2CKFB 1RGAA 1WMPA 2CFKA 1RGKA 2QIYA 2CK3H 3G0KA 1NJI4 3BNEA 1B2UA 2XSHB 2H0GA 1PFPA 3AHSA 2YFJB 1G96A 2OQEC 1M904 5IEPA 2KAAA 1FUTA 3IMAB 2E2TA 2OWPA 3LOYA 3LZAA 4JF8A 1YGWA 1GS3A 2CC3A 1BSDA 1FGTA 4EW5A 2CW9A 5IENA 1TRQA 3M8CA 1LVNA 2W9PA 3OWSA 3PGBA 3URPA 1MGRA 2CX1A 2OOVC 3CCL3 1GD3A 4HVNA 1VZZA 2RSXA 3CNMA 4HM8B 1VQQA 3BIRA 1LQMB 3NBJA 4K1VA 2R41A 2E2UA 1W00A 4GL6A 3SLUA 2Q07A 2BU4A 4H3UA
chains in the Genus database with same CATH topology
1T2IA 6GSPA 1UCKA 7GSPA 1UCLA 1RN4A 1GOUA 4RNTA 2BIRA 1DE3A 1G02A 1R4YA 2GSPA 3D5GA 2ZA4A 3DGYA 1BOXA 1BNFA 4GHOA 1ZGXA 3DH2A 3KCHA 1BRSA 1X1UA 3Q3FA 2KF6A 1BNJA 1I3FA 1FYSA 1RGFA 1I70A 1RDSA 1RGLA 3GSPA 1BNGA 1BU4A 1I0VA 2F5WA 3A5EA 1I2FA 1Q9EA 4GSPA 1BNIA 3D5IA 1B3SA 1RNBA 1GOYA 1RMSA 1LOYA 3RNTA 3AHWA 1CH0A 1PY3A 2RBIA 1I3IA 1BNSA 2KF4A 1BNEA 1TRPA 1LRAA 1AY7A 1LNIA 4BU4A 2KF3A 3BU4A 2F4YA 1PYLA 4HOHA 1SARA 4J5KA 2HOHA 1GMRA 1YVSA 1BRGA 1I0XA 2KF5A 3AGNA 4BIRA 1BRNL 1RHLA 1DETA 1HYFA 1JBTA 1A2PA 1UCJA 1MGWA 3D4AA 1B2XA 3AGOA 1IYYA 1B21A 7RNTA 5BIRA 1BIRA 1BUJA 1FUSA 1HZ1A 2AADA 2RNTA 1BNRA 5BU4A 4HAAA 1BRJA 4J5GA 3SYUA 1YNVX 1X1XA 3WHOA 1RSNA 1TTOA 1B2SA 1BANA 1RTUA 1JBSA 1RGCA 1BSEA 1BRIA 1T2HA 1RGEA 1GMQA 1BVIA 5GSPA 1GOVA 1RLSA 1AQZA 1FZUA 2F5MA 1BRKA 1C54A 1RCKA 1I2EA 1BGSA 1X1YA 1X1WA 1GMPA 1BAOA 1GSPA 1FW7A 1LOVA 1RGAA 1RGHA 1B27A 1B2ZA 1RGKA 1B2MA 1JBRA 1B2UA 1BRHA 1RCLA 3AHSA 9RNTA 1BSCA 1BSBA 1RGGA 2KAAA 1FUTA 1YGWA 1UCIA 3HOHA 1BSDA 1LOWA 6RNTA 2SARA 1TRQA 2C4BA 1B20A 1RN1A 3URPA 1MGRA 8RNTA 1BSAA 1I8VA 3BIRA 2F56A 2AAEA 5HOHA 3WR2A 1RNTA 1I2GA 2BU4A 5RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2I A;  6GSP A;  1UCK A;  7GSP A;  1UCL A;  1RN4 A;  1GOU A;  4RNT A;  2BIR A;  1DE3 A;  1G02 A;  1R4Y A;  2GSP A;  3D5G A;  2ZA4 A;  3DGY A;  1BOX A;  1BNF A;  4GHO A;  1ZGX A;  3DH2 A;  3KCH A;  1BRS A;  1X1U A;  3Q3F A;  2KF6 A;  1BNJ A;  1I3F A;  1FYS A;  1RGF A;  1I70 A;  1RDS A;  1RGL A;  3GSP A;  1BNG A;  1BU4 A;  1I0V A;  2F5W A;  3A5E A;  1I2F A;  1Q9E A;  4GSP A;  1BNI A;  3D5I A;  1B3S A;  1RNB A;  1GOY A;  1RMS A;  1LOY A;  3RNT A;  3AHW A;  1CH0 A;  1PY3 A;  2RBI A;  1I3I A;  1BNS A;  2KF4 A;  1BNE A;  1TRP A;  1LRA A;  1AY7 A;  1LNI A;  4BU4 A;  2KF3 A;  3BU4 A;  2F4Y A;  1PYL A;  4HOH A;  1SAR A;  4J5K A;  2HOH A;  1GMR A;  1YVS A;  1BRG A;  1I0X A;  2KF5 A;  3AGN A;  4BIR A;  1BRN L;  1RHL A;  1DET A;  1HYF A;  1JBT A;  1A2P A;  1UCJ A;  1MGW A;  3D4A A;  1B2X A;  3AGO A;  1IYY A;  1B21 A;  7RNT A;  5BIR A;  1BIR A;  1BUJ A;  1FUS A;  1HZ1 A;  2AAD A;  2RNT A;  1BNR A;  5BU4 A;  4HAA A;  1BRJ A;  4J5G A;  3SYU A;  1YNV X;  1X1X A;  3WHO A;  1RSN A;  1TTO A;  1B2S A;  1BAN A;  1RTU A;  1JBS A;  1RGC A;  1BSE A;  1BRI A;  1T2H A;  1RGE A;  1GMQ A;  1BVI A;  5GSP A;  1GOV A;  1RLS A;  1AQZ A;  1FZU A;  2F5M A;  1BRK A;  1C54 A;  1RCK A;  1I2E A;  1BGS A;  1X1Y A;  1X1W A;  1GMP A;  1BAO A;  1GSP A;  1FW7 A;  1LOV A;  1RGA A;  1RGH A;  1B27 A;  1B2Z A;  1RGK A;  1B2M A;  1JBR A;  1B2U A;  1BRH A;  1RCL A;  3AHS A;  9RNT A;  1BSC A;  1BSB A;  1RGG A;  2KAA A;  1FUT A;  1YGW A;  1UCI A;  3HOH A;  1BSD A;  1LOW A;  6RNT A;  2SAR A;  1TRQ A;  2C4B A;  1B20 A;  1RN1 A;  3URP A;  1MGR A;  8RNT A;  1BSA A;  1I8V A;  3BIR A;  2F56 A;  2AAE A;  5HOH A;  3WR2 A;  1RNT A;  1I2G A;  2BU4 A;  5RNT A; 
#chains in the Genus database with same CATH topology
 1T2I A;  1VQ7 3;  2CIU A;  1E3V A;  7GSP A;  3VF1 A;  3S29 A;  2P09 A;  3LH4 A;  4O02 B;  1RN4 A;  2L1S A;  1OAC A;  1DE3 A;  3CU3 A;  3X40 A;  1R4Y A;  5M19 A;  2GSP A;  1YIT 3;  5A0O B;  1HU9 A;  2HML B;  2J8X B;  1TU5 A;  4TX4 A;  4GHO A;  1ZGX A;  2W9Q A;  2I9W A;  3KCH A;  1GY6 A;  4NPB A;  4QWT A;  1I3F A;  2ML6 A;  1BU4 A;  5D83 A;  2JQ5 A;  3S5C A;  3F8H A;  3FF2 A;  1IK3 A;  5IG5 A;  3A5E A;  4MEI A;  3FG3 A;  5HGR A;  1TP6 A;  5JPU A;  2Y73 A;  3CMA 3;  2P38 A;  5D82 A;  6STD A;  1QAK A;  1U8C B;  1UI8 A;  3F7S A;  1EUI C;  2GU1 A;  1VQM 3;  2IMJ A;  2BMR B;  1OGZ A;  1BNS A;  2OQE A;  1BNE A;  3GZX B;  3CCE 3;  3CC7 3;  1TRP A;  3X42 A;  1IVX A;  3MG1 A;  4BTW A;  1A67 A;  4XDV A;  3WDG B;  2H0H A;  2XH9 A;  3PZW A;  3CCV 3;  1QJG A;  4AEQ A;  3BU4 A;  4RZM A;  1Q40 B;  3AMO B;  3CNX A;  3VSY A;  1NB3 I;  2OOV A;  1VQN 3;  4L8P A;  1IT8 A;  1ULI B;  1JB2 A;  1KWI A;  1Q40 A;  3AMO A;  1O7W B;  1SII A;  1ZX2 A;  4J5K A;  1QMA A;  2WGO A;  3H51 A;  1IT7 A;  1A90 A;  4U13 A;  2D1W A;  1NB5 I;  5TGN A;  3T8U A;  3KII A;  1UUW B;  1JBT A;  4O3V A;  1UCJ A;  2KXG A;  1K28 A;  1IDP A;  3WMD A;  3A76 A;  2B1X B;  3WOE B;  5D81 A;  1Q42 A;  8CHO A;  2KCD A;  1Q81 4;  1IYY A;  3MKI A;  3S27 A;  1BIR A;  3KN4 A;  1BUJ A;  2FNQ A;  1FUS A;  1Y4K A;  1HZ1 A;  5JBS A;  1NO3 A;  1OHP A;  2RNT A;  4KFD A;  1BNR A;  4LGQ A;  3FGY A;  2PZV A;  3RDE A;  1CYV A;  3HI7 A;  1O7H B;  1ASK A;  1ULJ B;  1US1 A;  1IQ8 A;  1E97 A;  1BAN A;  2LYX A;  1JBS A;  1BRI A;  1GMQ A;  1IU7 A;  1BVI A;  4WHA A;  3B7C A;  2CG1 A;  4KFE A;  1A2V A;  3EQQ B;  1RLS A;  1FZU A;  3LYG A;  1V58 A;  2WOH A;  3UL6 A;  1OCV A;  3SOY A;  2IYJ A;  3V98 A;  2M7O A;  2XFS A;  4OK0 A;  1STD A;  3K9M C;  3JVC A;  1MWR A;  1ZO2 A;  1BAO A;  1JN5 B;  5AII A;  1YI2 3;  1OGX A;  4STD A;  3NM2 A;  1JN5 A;  3DZL A;  4XBT A;  3JUP A;  2W04 A;  4HM2 B;  3FSD A;  2QA4 3;  3D3L A;  3BNB A;  4Q53 A;  1RGG A;  3OW2 2;  4G1M B;  2BNG A;  3CCR 3;  3X41 A;  1UCI A;  1UGH I;  6RNT A;  3LTB A;  4FMC A;  2C4B A;  3WOF B;  1B20 A;  1RN1 A;  3I56 3;  3CME 3;  3F9S A;  4CJN A;  1BSA A;  1UW1 A;  4FR9 A;  4MMX B;  1I8V A;  3SX1 A;  4WYK B;  3OXA A;  2RFR A;  4J9A A;  1OPY A;  4WYK A;  1DMM A;  3N54 B;  1FGQ A;  1RNT A;  3JUO A;  4HM7 B;  3ECF A;  1L5G B;  4H61 A;  5RNT A;  1W5Z A;  3ER7 A;  4RNY A;  1UCK A;  3ZG5 A;  2ML5 A;  5KP3 A;  5LC6 A;  5I97 A;  2OTJ 3;  2C10 A;  2P0M A;  4FCJ A;  1GOU A;  1R4C A;  4RNT A;  1G02 A;  1M9G A;  4R1K A;  4HJL B;  5JPP A;  1ISK A;  1TIJ A;  2ZA4 A;  5KP1 A;  3HII A;  1BNF A;  4XBX A;  3DH2 A;  1IQY A;  4RBN A;  4L8O A;  3G4S 3;  1DMQ A;  2GEY A;  1RDS A;  1RGL A;  2BMQ B;  3EB8 A;  4LYL B;  1VQL 3;  1OHO A;  4N6M A;  1VQ9 3;  1JNQ A;  3F8X A;  2F5W A;  2MF7 A;  1RNB A;  1BNI A;  7STD A;  1B3S A;  1RJO A;  2RCD A;  3NX0 A;  1RMS A;  3GWR A;  1LOY A;  1W6Y A;  2CFG A;  3K0Z A;  1W02 A;  3FZW A;  4MJD A;  3MG3 A;  1JRQ A;  3RNT A;  1T5Y A;  3KE7 A;  3HK4 A;  2YFL B;  1WTH A;  2O9U X;  2P05 A;  1IV9 A;  2MC8 A;  3SVA A;  2W0Q A;  3JUQ A;  3ZG0 A;  5CF2 A;  1QAL A;  3B4O A;  4K1U A;  3G8Z A;  4HM0 B;  4FMD A;  4BU4 A;  3Q90 A;  1EG9 B;  4FMB A;  1IVW A;  2F4Y A;  2P0X A;  4BTX A;  1SAR A;  2Z7A A;  2FGT A;  4LEH A;  4L7K A;  3EC9 A;  4HZB B;  4O2H A;  5G1L A;  2CFL A;  3CPO A;  2Z77 A;  3BNC A;  3OV4 A;  3AGN A;  3NXJ A;  4BIR A;  3NBR A;  5AEW B;  1BRN L;  2CHC A;  2CWU A;  1O7M B;  3X3X A;  5CF1 A;  1LNH A;  4AKY A;  3G71 3;  2R4I A;  2HMJ B;  1EEJ A;  1W01 A;  3TDG A;  1B2X A;  1N5H A;  2W2C A;  7RNT A;  1VQ4 3;  2ZHX B;  5BIR A;  1E3R A;  3CC2 3;  4K90 B;  3CCM 3;  2C11 A;  1YGE A;  3D79 A;  3QRD A;  5LC7 A;  3PYJ A;  1M1K 4;  1AR0 A;  5BU4 A;  3MHE A;  1T3B A;  3DGN A;  3HZP A;  5AEU B;  3NQY A;  1SPU A;  1KQS 2;  3U97 A;  1KD1 4;  1YNV X;  1YJ9 3;  1ROV A;  3K5T A;  1X1X A;  3ZFZ A;  2RGQ A;  1QVF 2;  1G0T A;  3F40 A;  1RTU A;  5IG0 A;  3FCS B;  5AYR B;  3EN1 B;  1DYU A;  1RGC A;  4GB5 A;  3VGN A;  3HX8 A;  1S5A A;  2BHM A;  3N8B A;  1AQZ A;  1C7H A;  4LZI A;  3S28 A;  5EVH A;  3NQZ A;  2SBL A;  1C54 A;  4O8S A;  1RCK A;  4EYC A;  1LOX A;  3FKA A;  3SOA A;  1AVL A;  4CPK A;  1D6Y A;  1JB4 A;  2CH9 A;  1X1Y A;  1O7P B;  2B24 B;  2IA7 A;  1NDO B;  3I55 3;  3EHC A;  3WA3 A;  1RN7 A;  4RNZ A;  4HM3 B;  1RGH A;  1B27 A;  2H0I A;  1B2Z A;  3JUN A;  2F98 A;  1V57 A;  3KKG A;  1TJD A;  2CX0 A;  5G2G A;  1UUV B;  3EBY A;  4HYZ A;  5IW9 A;  1BSC A;  1BSB A;  2BT3 A;  3X3Y A;  5IG4 A;  2K0M A;  2STD A;  3QK9 A;  4N6U A;  2K54 A;  1LOW A;  1W6G A;  2GU3 A;  2SAR A;  5STD A;  1AV4 A;  3EX9 A;  2BMO B;  3NHX A;  5CXO A;  1UI7 A;  1OUN A;  1A2K A;  1EKM A;  8RNT A;  5DRE A;  1N5P A;  4XB5 A;  3B4P A;  4XM4 A;  4AKZ A;  3IJE B;  1Q7Y 4;  3OWY A;  4N6O B;  4DKI A;  5HOH A;  1D6Z A;  2BO9 B;  2W56 B;  3U1W A;  4EXR A;  4ORL A;  1JV2 B;  3GRD A;  3MSO A;  1YIJ 3;  1RRH A;  2W56 A;  2XFT A;  4JRF A;  2XGL A;  6GSP A;  1MNL A;  3EE1 A;  3PCS A;  1ZS7 A;  5AYS C;  4LMI A;  2F86 B;  1QAF A;  1YJN 3;  3L0R A;  2BIR A;  3DGO A;  1N9J A;  4KFF A;  5G1K A;  2IUJ A;  3FLJ A;  1VQP 3;  1STF I;  5EQL A;  3KSP A;  2WGQ A;  1IVV A;  2KF6 A;  3JUM A;  1I70 A;  5ELU A;  4HM5 B;  5EEO A;  1BNG A;  2E2V A;  3LTD A;  1WNH A;  4I5Q A;  1JB5 A;  4EV2 A;  1I0V A;  3D5I A;  1MWT A;  1K9M 4;  3I0Y A;  4FMA A;  3AHW A;  1YJW 3;  1WMN A;  2RBI A;  2KF4 A;  1JZD A;  1VQ6 3;  3GZY B;  5M18 A;  4N3V A;  2CWT A;  4LSO A;  5AIF A;  5BVB A;  1QVG 2;  1J2B A;  3D9R A;  3E99 A;  1S72 3;  3CCQ 3;  1CEW I;  3LTC A;  1K8A 4;  4EV5 A;  2HMK B;  3DMC A;  3FH1 A;  4CDL A;  1PYL A;  4HOH A;  2KRT A;  3KFQ C;  3G6E 3;  4R9K A;  1FGR A;  3BB9 A;  2PNC A;  1JKG B;  4HM6 B;  1GMR A;  2KF5 A;  3UJM A;  1JKG A;  2HMO B;  2OCT A;  2JDI H;  3FG1 A;  4HM4 B;  1RHL A;  4HM1 B;  4HKV B;  2Z76 A;  3Q2P A;  1MOL A;  1PU4 A;  3EBT A;  3AGO A;  4IT7 A;  1B21 A;  1MWS A;  4NRE A;  3UL5 A;  3CCS 3;  4R9L A;  3EJV A;  1EQK A;  3CXC 2;  1ROA A;  2W03 A;  2ZL8 A;  3DM8 A;  3N9H A;  3WA2 X;  2AAD A;  1Q7H A;  3NV0 B;  1CQS A;  2ZDJ A;  4J5G A;  5AIG A;  3WOD G;  3SED A;  3NV0 A;  4CCV A;  2CG0 A;  4X2O A;  1EA2 A;  1IQX A;  1TTO A;  3RGA A;  1B2S A;  3LTA A;  4IPB A;  1O7N B;  4XBY A;  1UDI I;  1RRL A;  1W7C A;  1BSE A;  1T2H A;  1TFO A;  1FGM A;  1K41 A;  3MG2 A;  5BXQ A;  1M1X B;  2F5M A;  3OWU A;  3F7X A;  4MMZ B;  5IEO A;  1SIH A;  4I4K A;  1WQL B;  2CWV A;  3ROB A;  1X1W A;  1CYU A;  2YX9 A;  3O8Y A;  2XSO B;  1SQW A;  1FW7 A;  1NNV A;  3UB1 A;  1BUQ A;  2LQV A;  4XDW A;  2XEP A;  1B2M A;  1JBR A;  3GZB A;  1BRH A;  1TFK A;  5AIH A;  2WOF A;  1RCL A;  2UX0 A;  9RNT A;  1RKY A;  3CPW 2;  3DGL A;  1GY7 A;  2HMN B;  3V92 A;  4BTY A;  3HOH A;  1W6C A;  3SXX A;  1VQO 3;  1NWW A;  4OVM A;  3T0U A;  2OTL 3;  3K7C A;  3Q1C A;  1IVU A;  3MWZ A;  3G16 A;  4EC6 A;  2F56 A;  3F14 A;  4MMY B;  1VQK 3;  4WP5 A;  4OUQ A;  5M1A A;  1JZO A;  2AAE A;  5IER A;  4BL2 A;  2UGI A;  3BND A;  3WR2 A;  5FW5 A;  1OF5 B;  2W6J H;  2XR8 B;  3CCU 3;  1I2G A;  1KC8 4;  1Q86 4;  1N9E A;  1FGO A;  1OF5 A;  5IF6 A;  2UUG C;  4WFO A;  1MWU A;  5AI1 A;  1DVC A;  1UCL A;  2GBX B;  3T8N A;  2CFD A;  3NUV A;  3OX9 A;  4N6N B;  2GBW B;  3DXO A;  1OHS A;  3D5G A;  3FF0 A;  3K63 A;  4BL3 A;  1FA3 A;  3DGY A;  1BOX A;  2QGU A;  3H3H A;  1N8Q A;  4HZ9 B;  3EN8 A;  4KVH A;  1F8N A;  1BRS A;  1X1U A;  3Q3F A;  4N6L A;  1BNJ A;  1SJW A;  1FYS A;  1RGF A;  2CFW A;  1GYB A;  3GSP A;  5DRV A;  1V74 A;  2HMM B;  3PXM A;  1I2F A;  1Q9E A;  4GSP A;  3DUK A;  3STD A;  1UUG B;  2GEX A;  1GOY A;  3DGM A;  3LXU X;  4HBR A;  1YVB I;  1CH0 A;  1PY3 A;  2XF3 A;  3LT9 A;  4KT3 B;  4WWU C;  1I3I A;  3HIG A;  2QEX 3;  1Z1S A;  3BLZ A;  3KSE D;  3GAX A;  1U5O A;  2IY2 A;  4NHF A;  1LRA A;  1WMO A;  4KZ1 A;  5FGO A;  3J7Y d;  1K73 4;  1NU3 A;  2FXT A;  1YHQ 3;  1VQ5 3;  1AY7 A;  1KSI A;  3CCJ 3;  1LNI A;  2K3D A;  2KF3 A;  2A15 A;  3S67 A;  4FCM A;  2Y74 A;  5KP4 A;  2XGN A;  3DY5 A;  3ALA A;  3GZR A;  3LML A;  3RGR A;  2HOH A;  3CD6 3;  3FG4 A;  3V99 A;  1DMN A;  1YVS A;  1BRG A;  1I0X A;  1W4N A;  4J8T A;  1DET A;  1HYF A;  4IIA A;  1A2P A;  3NBB A;  1LXE A;  1UGI A;  1HKX A;  1W2Z A;  4ILF A;  1MGW A;  3D4A A;  1N8R 4;  3IPT A;  2F99 A;  5CK6 A;  5ELJ A;  3NM7 A;  4K61 A;  4X2H A;  4PEJ A;  5IG3 A;  3UNL A;  1W2B 2;  2INX A;  3MYT A;  2WO0 A;  2IUK A;  4HAA A;  4EBG A;  1BRJ A;  3SYU A;  4R80 A;  4N6V 0;  1IV7 A;  2GXF A;  3WHO A;  1RSN A;  3PCR A;  3PS8 A;  1GY5 A;  3LT8 A;  1RGE A;  4FCZ A;  2O3O A;  5GSP A;  1DVD A;  3EF8 A;  4R4K A;  1OH0 A;  2V1L A;  1GOV A;  1FUW A;  1GD4 A;  1BRK A;  2D42 A;  4N6T A;  5CLK A;  4ZM8 A;  1AVK A;  1Q82 4;  1I2E A;  1JJ2 2;  1BGS A;  1O7G B;  2XRX B;  3X3Z A;  1TUH A;  2L4V A;  1GMP A;  3KZT A;  3CC4 3;  1VQ8 3;  1GSP A;  2Z6B A;  1LOV A;  2YFI B;  1LQG C;  1D6U A;  3B8L A;  3MPH A;  2CKF B;  1RGA A;  1WMP A;  2CFK A;  1RGK A;  2QIY A;  2CK3 H;  3G0K A;  1NJI 4;  3BNE A;  1B2U A;  2XSH B;  2H0G A;  1PFP A;  3AHS A;  2YFJ B;  1G96 A;  2OQE C;  1M90 4;  5IEP A;  2KAA A;  1FUT A;  3IMA B;  2E2T A;  2OWP A;  3LOY A;  3LZA A;  4JF8 A;  1YGW A;  1GS3 A;  2CC3 A;  1BSD A;  1FGT A;  4EW5 A;  2CW9 A;  5IEN A;  1TRQ A;  3M8C A;  1LVN A;  2W9P A;  3OWS A;  3PGB A;  3URP A;  1MGR A;  2CX1 A;  2OOV C;  3CCL 3;  1GD3 A;  4HVN A;  1VZZ A;  2RSX A;  3CNM A;  4HM8 B;  1VQQ A;  3BIR A;  1LQM B;  3NBJ A;  4K1V A;  2R41 A;  2E2U A;  1W00 A;  4GL6 A;  3SLU A;  2Q07 A;  2BU4 A;  4H3U A; 
#chains in the Genus database with same CATH homology
 1T2I A;  6GSP A;  1UCK A;  7GSP A;  1UCL A;  1RN4 A;  1GOU A;  4RNT A;  2BIR A;  1DE3 A;  1G02 A;  1R4Y A;  2GSP A;  3D5G A;  2ZA4 A;  3DGY A;  1BOX A;  1BNF A;  4GHO A;  1ZGX A;  3DH2 A;  3KCH A;  1BRS A;  1X1U A;  3Q3F A;  2KF6 A;  1BNJ A;  1I3F A;  1FYS A;  1RGF A;  1I70 A;  1RDS A;  1RGL A;  3GSP A;  1BNG A;  1BU4 A;  1I0V A;  2F5W A;  3A5E A;  1I2F A;  1Q9E A;  4GSP A;  1BNI A;  3D5I A;  1B3S A;  1RNB A;  1GOY A;  1RMS A;  1LOY A;  3RNT A;  3AHW A;  1CH0 A;  1PY3 A;  2RBI A;  1I3I A;  1BNS A;  2KF4 A;  1BNE A;  1TRP A;  1LRA A;  1AY7 A;  1LNI A;  4BU4 A;  2KF3 A;  3BU4 A;  2F4Y A;  1PYL A;  4HOH A;  1SAR A;  4J5K A;  2HOH A;  1GMR A;  1YVS A;  1BRG A;  1I0X A;  2KF5 A;  3AGN A;  4BIR A;  1BRN L;  1RHL A;  1DET A;  1HYF A;  1JBT A;  1A2P A;  1UCJ A;  1MGW A;  3D4A A;  1B2X A;  3AGO A;  1IYY A;  1B21 A;  7RNT A;  5BIR A;  1BIR A;  1BUJ A;  1FUS A;  1HZ1 A;  2AAD A;  2RNT A;  1BNR A;  5BU4 A;  4HAA A;  1BRJ A;  4J5G A;  3SYU A;  1YNV X;  1X1X A;  3WHO A;  1RSN A;  1TTO A;  1B2S A;  1BAN A;  1RTU A;  1JBS A;  1RGC A;  1BSE A;  1BRI A;  1T2H A;  1RGE A;  1GMQ A;  1BVI A;  5GSP A;  1GOV A;  1RLS A;  1AQZ A;  1FZU A;  2F5M A;  1BRK A;  1C54 A;  1RCK A;  1I2E A;  1BGS A;  1X1Y A;  1X1W A;  1GMP A;  1BAO A;  1GSP A;  1FW7 A;  1LOV A;  1RGA A;  1RGH A;  1B27 A;  1B2Z A;  1RGK A;  1B2M A;  1JBR A;  1B2U A;  1BRH A;  1RCL A;  3AHS A;  9RNT A;  1BSC A;  1BSB A;  1RGG A;  2KAA A;  1FUT A;  1YGW A;  1UCI A;  3HOH A;  1BSD A;  1LOW A;  6RNT A;  2SAR A;  1TRQ A;  2C4B A;  1B20 A;  1RN1 A;  3URP A;  1MGR A;  8RNT A;  1BSA A;  1I8V A;  3BIR A;  2F56 A;  2AAE A;  5HOH A;  3WR2 A;  1RNT A;  1I2G A;  2BU4 A;  5RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...