3WHOA

X-ray-crystallographic structure of an rnase po1 exhibiting anti-tumor activity
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Po1
publication title X-Ray Crystallographic Structure of RNase Po1 That Exhibits Anti-tumor Activity
pubmed rcsb
source organism Pleurotus ostreatus
molecule tags Hydrolase
total genus 21
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3whoA00
1GOUA 3D5IA 3DGYA 1I8VA 1BSBA 1RGKA 1LOVA 2RBIA 1BANA 2F4YA 1B2MA 1I3FA 3Q3FA 1BNFA 1RLSA 1BNIA 2KF4A 1T2HA 2BU4A 1LRAA 3AHWA 1BRHA 1RGHA 3URPA 1BNSA 1SARA 1ZGXA 1BAOA 1BNEA 2F5MA 1BRNL 4BU4A 1RGLA 1GMPA 7RNTA 1AY7A 1CH0A 1BUJA 1BU4A 1MGWA 1B2UA 1LOYA 2KF3A 4GSPA 1RN1A 2KF5A 1RTUA 1I70A 1DETA 1BSAA 3KCHA 1TRPA 2KAAA 5GSPA 1B3SA 2C4BA 9RNTA 1GMQA 1RDSA 1JBTA 3A5EA 1BRGA 1UCKA 2F5WA 3GSPA 6RNTA 3AGOA 5BU4A 1RMSA 3D4AA 1I0XA 1GMRA 3AHSA 4HOHA 1FUSA 5HOHA 2SARA 1BVIA 1Q9EA 1B2SA 1I2GA 1R4YA 1FW7A 1T2IA 2GSPA 1RCLA 3AGNA 1BNJA 1JBRA 1LOWA 1TRQA 1FZUA 2ZA4A 1BIRA 2AADA 1RGEA 1UCJA 3HOHA 4HAAA 4BIRA 5BIRA 1MGRA 1B21A 1AQZA 3WHOA 1BSDA 2RNTA 3RNTA 1B20A 6GSPA 1TTOA 1RNBA 3SYUA 1HZ1A 1B2ZA 1PY3A 1BNRA 1BRIA 1BSCA 1RGAA 1X1YA 4J5KA 8RNTA 2HOHA 3BU4A 1B2XA 1BSEA 1GOYA 3D5GA 1JBSA 1RGFA 1BRKA 5RNTA 3BIRA 1RNTA 1GOVA 1RN4A 1FUTA 1X1WA 3DH2A 1B27A 1RHLA 1RGCA 1A2PA 1HYFA 1UCLA 1I0VA 1X1XA 1I3IA 1G02A 1X1UA 1BRSA 1UCIA 1BOXA 1BNGA 1YGWA 1BRJA 1RSNA 1C54A 1IYYA 1PYLA 1BGSA 3WR2A 2F56A 1YNVX 1RGGA 1YVSA 2KF6A 1DE3A 1LNIA 2BIRA 1FYSA 2AAEA 4RNTA 1I2FA 7GSPA 1GSPA 1RCKA 4GHOA 4J5GA 1I2EA
chains in the Genus database with same CATH superfamily
1MWUA 1EA2A 2H0HA 4WYKA 3DGYA 3STDA 1WQLB 2WOHA 1G96A 2K0MA 3BNCA 4RNZA 3CC23 1JJ22 1J2BA 2J8XB 2L1SA 2CC3A 3GZRA 1OHPA 1IQ8A 2IUJA 2F4YA 5HGRA 2BNGA 4N6MA 4N6LA 3Q3FA 1BNFA 1N9EA 2BMQB 1O7WB 5EQLA 1PFPA 5IEOA 1W5ZA 2W56B 2LYXA 3CNXA 3SXXA 2CW9A 4IIAA 1SIHA 3NX0A 3D79A 1ZGXA 1BAOA 2IYJA 3FG3A 1BRNL 2RGQA 4GL6A 4K1UA 1SQWA 1OF5A 3Q1CA 3CCV3 1VQ73 3T8UA 2HMNB 2WGQA 1DMQA 1MGWA 8CHOA 4XDVA 3MPHA 4WHAA 3NXJA 5M1AA 1RTUA 1TJDA 2D42A 3EX9A 2PNCA 3NV0B 2GBWB 3F14A 3X3YA 3HIGA 1ULIB 4KT3B 2GXFA 3PXMA 2H0GA 3BNEA 4LSOA 3X3ZA 2GU3A 1RDSA 1EKMA 3A5EA 4N6OB 3M8CA 1UCKA 1NB3I 3GSPA 1NDOB 1STDA 3JVCA 5STDA 5JPPA 1VQK3 4WWUC 1ZS7A 2OTJ3 4HOHA 3GAXA 4GB5A 3JUQA 5HOHA 3N54B 5AEUB 3DGLA 1I2GA 2YX9A 2SBLA 2BHMA 4EV2A 3OW22 1JBRA 1LOWA 1QJGA 1WMOA 1AVLA 2XEPA 4LGQA 2Z6BA 1BIRA 1GYBA 3LYGA 1C7HA 4ILFA 1SJWA 4I4KA 4BIRA 1UUWB 2MF7A 4AKYA 3HK4A 1AQZA 1W01A 1BSDA 1ROAA 1CQSA 1M1XB 2CFLA 3FGYA 3B4PA 5DRVA 4R80A 2H0IA 3MG1A 1FUWA 3SYUA 2CG0A 1Y4KA 4K1VA 1IT8A 1B2ZA 3D9RA 3WODG 3H3HA 4HZBB 1JZDA 1RGAA 3BLZA 3EHCA 1B2XA 1BSEA 3KIIA 1JBSA 3K9MC 1A90A 2JQ5A 4LYLB 3DMCA 3PYJA 1BRKA 3BNBA 2V1LA 1JNQA 5TGNA 1B27A 1RHLA 4R9KA 1JB2A 1RGCA 1LQGC 1X1XA 1I3IA 2P05A 2UUGC 4N6NB 1NU3A 1BRSA 4K90B 3CCL3 1YGWA 4EW5A 4HM5B 1IYYA 3EN8A 1PYLA 2W2CA 3EBTA 1BGSA 3ECFA 4HM8B 2BMRB 1GY6A 4JF8A 2F56A 3CCM3 3CCU3 1NNVA 2XSHB 3QRDA 2GEYA 2KXGA 1VQO3 3DXOA 1Q814 3LTCA 1OHOA 1UW1A 1NO3A 2GU1A 3CPW2 3X40A 1Q40A 1I2FA 4CCVA 1GSPA 4HM6B 1RCKA 1W2B2 5IERA 3FCSB 3FZWA 3VF1A 1W6CA 5FW5A 1AVKA 3ZG5A 1PU4A 3ROBA 3LMLA 4NPBA 1V58A 3V99A 1M904 4R9LA 1UDII 5KP3A 1D6ZA 4RNYA 3H51A 1FGRA 1B2MA 2RCDA 2HMMB 1RLSA 4HM4B 1JB4A 2FNQA 4MMZB 1GD4A 2IA7A 3G6E3 1LRAA 5ELJA 1KWIA 3N8BA 4AKZA 4NREA 4N6UA 5CF2A 1A2KA 3LT9A 1VQQA 4IT7A 1IQXA 3CCR3 5EEOA 3FSDA 5LC7A 3J7Yd 1BNEA 1E3VA 1GY7A 2F5MA 1VQ53 1VQN3 1AY7A 1CH0A 2Y74A 3TDGA 3F7SA 1LOYA 3EB8A 4OVMA 4GSPA 2ZDJA 3UL6A 4IPBA 1W00A 1L5GB 1KD14 1QVG2 1T5YA 1DETA 1OGXA 4CDLA 3B8LA 3UL5A 3KCHA 2ZL8A 3CCS3 3MG2A 3NHXA 5GSPA 5IG0A 2CWTA 3G713 2ML5A 2RSXA 4RZMA 1Q7Y4 3CC73 2FXTA 3LTBA 1JBTA 1BRGA 1O7HB 2F5WA 3OX9A 3S27A 4BL3A 1YHQ3 3CC43 5AYRB 4XDWA 3CMA3 1EG9B 1RN7A 2INXA 4Q53A 1RJOA 2CFKA 2YFIB 1FGMA 3A76A 4I5QA 4QWTA 1D6UA 4U13A 7STDA 3RGAA 4XBYA 2M7OA 1IV7A 2SARA 3OV4A 1VQ43 5D81A 1FW7A 3LXUX 3CXC2 1T2IA 2GSPA 3AGNA 3AMOA 1LNHA 1AR0A 3NQYA 1TRQA 3NM2A 3S29A 1IVWA 3CD63 2CKFB 2AADA 1QALA 1JN5A 3HI7A 1K734 3KFQC 1UCJA 4HM7B 1W2ZA 3EQQB 5BIRA 1B21A 1DMMA 2XFSA 3EN1B 3CCJ3 1VQ83 1Z1SA 2K3DA 2W0QA 3MHEA 1OHSA 4HVNA 3Q2PA 2CFGA 6GSPA 1BUQA 1N8R4 4AEQA 1K9M4 1RNBA 1MNLA 4JRFA 4CJNA 4EBGA 4EV5A 2F86B 4BTWA 1JZOA 1PY3A 1BNRA 1BRIA 3DY5A 3MG3A 2BMOB 2HOHA 2CX1A 1GOYA 2Q07A 1RGFA 3VSYA 3LOYA 1LOXA 4FMBA 5G1KA 1RN4A 1FUTA 3DH2A 4DKIA 2W9PA 4O02B 1UGIA 4J8TA 4XBTA 3T0UA 1UCLA 1I0VA 3PCRA 3Q90A 4ZM8A 2YFJB 2P09A 3DZLA 1UCIA 3LH4A 1BNGA 2XF3A 1BRJA 1N9JA 4FCZA 4HM3B 1Q824 2K54A 5M19A 2QIYA 3WR2A 5IEPA 5CXOA 1YNVX 5AIGA 1CEWI 1RGGA 1YVSA 3OWUA 2KF6A 2CX0A 1E97A 1LQMB 2CG1A 2QA43 5CF1A 1LNIA 1W4NA 4WYKB 4RNTA 3HIIA 1EQKA 4HM1B 1IV9A 2IY2A 4O8SA 3F7XA 3I0YA 4GHOA 4J5GA 1I2EA 1Q42A 1MWTA 1GOUA 2IUKA 1BSBA 4BL2A 1RGKA 3UB1A 2XGNA 3GWRA 2BO9B 2W03A 1TU5A 1LOVA 2ZHXB 1OACA 2RBIA 3NUVA 5IENA 5AI1A 1BANA 3OWYA 2Z77A 4KFFA 3GZBA 3SLUA 3G16A 5G2GA 1JKGA 1T2HA 3GRDA 5IF6A 1FGTA 1YVBI 4FMDA 4BTYA 4NHFA 3DGMA 3AHWA 4LEHA 1D6YA 3NBJA 1BRHA 3N9HA 3G4S3 3SVAA 1OF5B 3FF2A 3WMDA 1DMNA 2UX0A 3CU3A 4BU4A 1RGLA 2HMOB 1ISKA 1GMPA 3LT8A 7RNTA 3SEDA 2P0MA 2Z7AA 1IVUA 4EYCA 3I553 2CIUA 2W9QA 3IMAB 1Q7HA 2O9UX 4FMCA 4O3VA 1BUJA 2KF3A 1JN5B 2B24B 1DVCA 2LQVA 4HBRA 1RN1A 1QAFA 2KF5A 4STDA 3T8NA 4H61A 4K61A 3FG4A 1F8NA 1YJ93 2CHCA 3WA3A 1ULJB 1BSAA 1TRPA 1NWWA 2KAAA 1B3SA 2JDIH 2C4BA 1GY5A 3S28A 3QK9A 3F8HA 1N5HA 3JUOA 1GMQA 5CLKA 1JB5A 3PZWA 1W6YA 1ASKA 3SOYA 1YGEA 3K0ZA 3LTDA 6RNTA 2KRTA 1YIJ3 4X2OA 1IQYA 3AGOA 3PS8A 4ORLA 3RDEA 3CME3 1QAKA 3NQZA 2Y73A 1O7NB 2W04A 1FUSA 3FLJA 3MWZA 3EBYA 4FCJA 4O2HA 1UUGB 1BVIA 1Q9EA 3EE1A 4R1KA 5I97A 1B2SA 4HM0B 3S67A 1ZO2A 4HJLB 1NB5I 1K28A 3PGBA 1BNJA 1FGOA 1FZUA 2ZA4A 1IK3A 1OGZA 3GZYB 3MYTA 3JUMA 2O3OA 5DREA 3CCQ3 3HOHA 3O8YA 3V98A 2GBXB 3V92A 4WFOA 1VQP3 2OTL3 3S5CA 4BTXA 2GEXA 1SPUA 3BNDA 5AIFA 3WHOA 2RNTA 6STDA 1GD3A 4XBXA 2HMLB 3KZTA 3WOEB 1TTOA 3CNMA 3B7CA 3X3XA 1HZ1A 4RBNA 3KKGA 3KE7A 2XRXB 2E2UA 5JBSA 5JPUA 1X1YA 3MKIA 3OXAA 4XB5A 1STFI 2A15A 2F99A 3D5GA 3SX1A 3ALAA 3U1WA 5KP4A 4EC6A 1MWSA 1V74A 1EEJA 1GOVA 1TFKA 2XFTA 4L8PA 1M1K4 1JKGB 1E3RA 2R4IA 1HYFA 2OOVC 4EXRA 1CYVA 3B4OA 1T3BA 4HYZA 3RGRA 2ML6A 1YJW3 1FA3A 1M9GA 1U8CB 4CPKA 1C54A 4N3VA 4XM4A 3LTAA 2WO0A 2FGTA 3E99A 1Q40B 2OWPA 1DE3A 3K7CA 3WOFB 1DYUA 3DUKA 2OQEC 1OPYA 7GSPA 2E2TA 2HMKB 4FR9A 3F9SA 1KSIA 1RRLA 3D5IA 2STDA 1I8VA 3L0RA 4FCMA 4OK0A 3JUNA 1N5PA 1VZZA 2Z76A 3LZAA 1S5AA 3EC9A 5G1LA 5IG4A 3UNLA 4PEJA 2C11A 1IVVA 3F8XA 4HZ9B 3MSOA 1VQ93 1UI8A 1I3FA 1O7GB 5BVBA 2KF4A 1UI7A 1BNIA 1MWRA 2QGUA 5AIHA 1RKYA 2BU4A 1UGHI 2KCDA 1TFOA 2MC8A 1ZX2A 2CH9A 2IMJA 1MOLA 1FGQA 4HM2B 1RGHA 4H3UA 4N6V0 1W7CA 3URPA 1BNSA 1QMAA 1V57A 1SARA 2XH9A 3FF0A 4FMAA 5M18A 4MMYB 1ROVA 2HMJB 4KFEA 1R4CA 2L4VA 5ELUA 1LXEA 1NJI4 1US1A 1YIT3 5D83A 2CFDA 1KC84 1BU4A 1UUVB 1N8QA 4KFDA 1B2UA 2XGLA 2PZVA 1HKXA 4WP5A 2UGIA 3FG1A 1W02A 3D3LA 4LMIA 5AEWB 2RFRA 1I70A 3HZPA 2CWVA 3NM7A 1VQ63 1A67A 1YI23 5BXQA 3FKAA 3F40A 3PCSA 4L7KA 1OCVA 3WA2X 9RNTA 1Q864 3DGNA 3IJEB 1IDPA 1HU9A 1TIJA 2W6JH 1OUNA 1TP6A 2QEX3 2CK3H 3DGOA 1K41A 4MJDA 1VQM3 2W56A 3OWSA 1A2VA 5AYSC 3BB9A 5BU4A 1RMSA 5IW9A 3D4AA 1I0XA 1GMRA 3AHSA 4LZIA 2E2VA 1VQL3 3AMOB 3KSED 4G1MB 3JUPA 3ZFZA 1S723 1W6GA 1RRHA 1R4YA 2F98A 2WGOA 1IVXA 1RCLA 3FH1A 3KSPA 1WMPA 2OCTA 3ZG0A 3DM8A 3EJVA 1RGEA 3NBBA 5A0OB 1IT7A 4HAAA 5LC6A 5KP1A 1MGRA 1WMNA 5AIIA 5FGOA 3G0KA 3NBRA 3VGNA 3U97A 3NV0A 4KZ1A 1GS3A 3RNTA 1B20A 4L8OA 1IU7A 2P38A 3G8ZA 5IG5A 1G0TA 4J9AA 4TX4A 1OH0A 1AV4A 1O7PB 2OOVA 5CK6A 1LVNA 1O7MB 3IPTA 1BSCA 4J5KA 3K63A 3WDGB 4R4KA 2WOFA 3BU4A 8RNTA 1CYUA 4OUQA 3SOAA 3X41A 5RNTA 2D1WA 3KN4A 3BIRA 5IG3A 1RNTA 1SIIA 2CWUA 1X1WA 1U5OA 2I9WA 2XR8B 5D82A 3I563 1A2PA 3GZXB 5EVHA 1DVDA 4X2HA 1G02A 1X1UA 1BOXA 1WNHA 2XSOB 1RSNA 2YFLB 3EF8A 3ER7A 2OQEA 4N6TA 2CFWA 1TUHA 3UJMA 1YJN3 2B1XB 3CPOA 4MMXB 1WTHA 1K8A4 1KQS2 4HKVB 1EUIC 2R41A 3CCE3 4KVHA 2BIRA 1FYSA 2AAEA 2BT3A 3HX8A 2C10A 3K5TA 1QVF2 1JRQA 4MEIA 2P0XA 1JV2B 3X42A
chains in the Genus database with same CATH topology
1GOUA 3D5IA 3DGYA 1I8VA 1BSBA 1RGKA 1LOVA 2RBIA 1BANA 2F4YA 1B2MA 1I3FA 3Q3FA 1BNFA 1RLSA 1BNIA 2KF4A 1T2HA 2BU4A 1LRAA 3AHWA 1BRHA 1RGHA 3URPA 1BNSA 1SARA 1ZGXA 1BAOA 1BNEA 2F5MA 1BRNL 4BU4A 1RGLA 1GMPA 7RNTA 1AY7A 1CH0A 1BUJA 1BU4A 1MGWA 1B2UA 1LOYA 2KF3A 4GSPA 1RN1A 2KF5A 1RTUA 1I70A 1DETA 1BSAA 3KCHA 1TRPA 2KAAA 5GSPA 1B3SA 2C4BA 9RNTA 1GMQA 1RDSA 1JBTA 3A5EA 1BRGA 1UCKA 2F5WA 3GSPA 6RNTA 3AGOA 5BU4A 1RMSA 3D4AA 1I0XA 1GMRA 3AHSA 4HOHA 1FUSA 5HOHA 2SARA 1BVIA 1Q9EA 1B2SA 1I2GA 1R4YA 1FW7A 1T2IA 2GSPA 1RCLA 3AGNA 1BNJA 1JBRA 1LOWA 1TRQA 1FZUA 2ZA4A 1BIRA 2AADA 1RGEA 1UCJA 3HOHA 4HAAA 4BIRA 5BIRA 1MGRA 1B21A 1AQZA 3WHOA 1BSDA 2RNTA 3RNTA 1B20A 6GSPA 1TTOA 1RNBA 3SYUA 1HZ1A 1B2ZA 1PY3A 1BNRA 1BRIA 1BSCA 1RGAA 1X1YA 4J5KA 8RNTA 2HOHA 3BU4A 1B2XA 1BSEA 1GOYA 3D5GA 1JBSA 1RGFA 1BRKA 5RNTA 3BIRA 1RNTA 1GOVA 1RN4A 1FUTA 1X1WA 3DH2A 1B27A 1RHLA 1RGCA 1A2PA 1HYFA 1UCLA 1I0VA 1X1XA 1I3IA 1G02A 1X1UA 1BRSA 1UCIA 1BOXA 1BNGA 1YGWA 1BRJA 1RSNA 1C54A 1IYYA 1PYLA 1BGSA 3WR2A 2F56A 1YNVX 1RGGA 1YVSA 2KF6A 1DE3A 1LNIA 2BIRA 1FYSA 2AAEA 4RNTA 1I2FA 7GSPA 1GSPA 1RCKA 4GHOA 4J5GA 1I2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOU A;  3D5I A;  3DGY A;  1I8V A;  1BSB A;  1RGK A;  1LOV A;  2RBI A;  1BAN A;  2F4Y A;  1B2M A;  1I3F A;  3Q3F A;  1BNF A;  1RLS A;  1BNI A;  2KF4 A;  1T2H A;  2BU4 A;  1LRA A;  3AHW A;  1BRH A;  1RGH A;  3URP A;  1BNS A;  1SAR A;  1ZGX A;  1BAO A;  1BNE A;  2F5M A;  1BRN L;  4BU4 A;  1RGL A;  1GMP A;  7RNT A;  1AY7 A;  1CH0 A;  1BUJ A;  1BU4 A;  1MGW A;  1B2U A;  1LOY A;  2KF3 A;  4GSP A;  1RN1 A;  2KF5 A;  1RTU A;  1I70 A;  1DET A;  1BSA A;  3KCH A;  1TRP A;  2KAA A;  5GSP A;  1B3S A;  2C4B A;  9RNT A;  1GMQ A;  1RDS A;  1JBT A;  3A5E A;  1BRG A;  1UCK A;  2F5W A;  3GSP A;  6RNT A;  3AGO A;  5BU4 A;  1RMS A;  3D4A A;  1I0X A;  1GMR A;  3AHS A;  4HOH A;  1FUS A;  5HOH A;  2SAR A;  1BVI A;  1Q9E A;  1B2S A;  1I2G A;  1R4Y A;  1FW7 A;  1T2I A;  2GSP A;  1RCL A;  3AGN A;  1BNJ A;  1JBR A;  1LOW A;  1TRQ A;  1FZU A;  2ZA4 A;  1BIR A;  2AAD A;  1RGE A;  1UCJ A;  3HOH A;  4HAA A;  4BIR A;  5BIR A;  1MGR A;  1B21 A;  1AQZ A;  3WHO A;  1BSD A;  2RNT A;  3RNT A;  1B20 A;  6GSP A;  1TTO A;  1RNB A;  3SYU A;  1HZ1 A;  1B2Z A;  1PY3 A;  1BNR A;  1BRI A;  1BSC A;  1RGA A;  1X1Y A;  4J5K A;  8RNT A;  2HOH A;  3BU4 A;  1B2X A;  1BSE A;  1GOY A;  3D5G A;  1JBS A;  1RGF A;  1BRK A;  5RNT A;  3BIR A;  1RNT A;  1GOV A;  1RN4 A;  1FUT A;  1X1W A;  3DH2 A;  1B27 A;  1RHL A;  1RGC A;  1A2P A;  1HYF A;  1UCL A;  1I0V A;  1X1X A;  1I3I A;  1G02 A;  1X1U A;  1BRS A;  1UCI A;  1BOX A;  1BNG A;  1YGW A;  1BRJ A;  1RSN A;  1C54 A;  1IYY A;  1PYL A;  1BGS A;  3WR2 A;  2F56 A;  1YNV X;  1RGG A;  1YVS A;  2KF6 A;  1DE3 A;  1LNI A;  2BIR A;  1FYS A;  2AAE A;  4RNT A;  1I2F A;  7GSP A;  1GSP A;  1RCK A;  4GHO A;  4J5G A;  1I2E A; 
#chains in the Genus database with same CATH topology
 1MWU A;  1EA2 A;  2H0H A;  4WYK A;  3DGY A;  3STD A;  1WQL B;  2WOH A;  1G96 A;  2K0M A;  3BNC A;  4RNZ A;  3CC2 3;  1JJ2 2;  1J2B A;  2J8X B;  2L1S A;  2CC3 A;  3GZR A;  1OHP A;  1IQ8 A;  2IUJ A;  2F4Y A;  5HGR A;  2BNG A;  4N6M A;  4N6L A;  3Q3F A;  1BNF A;  1N9E A;  2BMQ B;  1O7W B;  5EQL A;  1PFP A;  5IEO A;  1W5Z A;  2W56 B;  2LYX A;  3CNX A;  3SXX A;  2CW9 A;  4IIA A;  1SIH A;  3NX0 A;  3D79 A;  1ZGX A;  1BAO A;  2IYJ A;  3FG3 A;  1BRN L;  2RGQ A;  4GL6 A;  4K1U A;  1SQW A;  1OF5 A;  3Q1C A;  3CCV 3;  1VQ7 3;  3T8U A;  2HMN B;  2WGQ A;  1DMQ A;  1MGW A;  8CHO A;  4XDV A;  3MPH A;  4WHA A;  3NXJ A;  5M1A A;  1RTU A;  1TJD A;  2D42 A;  3EX9 A;  2PNC A;  3NV0 B;  2GBW B;  3F14 A;  3X3Y A;  3HIG A;  1ULI B;  4KT3 B;  2GXF A;  3PXM A;  2H0G A;  3BNE A;  4LSO A;  3X3Z A;  2GU3 A;  1RDS A;  1EKM A;  3A5E A;  4N6O B;  3M8C A;  1UCK A;  1NB3 I;  3GSP A;  1NDO B;  1STD A;  3JVC A;  5STD A;  5JPP A;  1VQK 3;  4WWU C;  1ZS7 A;  2OTJ 3;  4HOH A;  3GAX A;  4GB5 A;  3JUQ A;  5HOH A;  3N54 B;  5AEU B;  3DGL A;  1I2G A;  2YX9 A;  2SBL A;  2BHM A;  4EV2 A;  3OW2 2;  1JBR A;  1LOW A;  1QJG A;  1WMO A;  1AVL A;  2XEP A;  4LGQ A;  2Z6B A;  1BIR A;  1GYB A;  3LYG A;  1C7H A;  4ILF A;  1SJW A;  4I4K A;  4BIR A;  1UUW B;  2MF7 A;  4AKY A;  3HK4 A;  1AQZ A;  1W01 A;  1BSD A;  1ROA A;  1CQS A;  1M1X B;  2CFL A;  3FGY A;  3B4P A;  5DRV A;  4R80 A;  2H0I A;  3MG1 A;  1FUW A;  3SYU A;  2CG0 A;  1Y4K A;  4K1V A;  1IT8 A;  1B2Z A;  3D9R A;  3WOD G;  3H3H A;  4HZB B;  1JZD A;  1RGA A;  3BLZ A;  3EHC A;  1B2X A;  1BSE A;  3KII A;  1JBS A;  3K9M C;  1A90 A;  2JQ5 A;  4LYL B;  3DMC A;  3PYJ A;  1BRK A;  3BNB A;  2V1L A;  1JNQ A;  5TGN A;  1B27 A;  1RHL A;  4R9K A;  1JB2 A;  1RGC A;  1LQG C;  1X1X A;  1I3I A;  2P05 A;  2UUG C;  4N6N B;  1NU3 A;  1BRS A;  4K90 B;  3CCL 3;  1YGW A;  4EW5 A;  4HM5 B;  1IYY A;  3EN8 A;  1PYL A;  2W2C A;  3EBT A;  1BGS A;  3ECF A;  4HM8 B;  2BMR B;  1GY6 A;  4JF8 A;  2F56 A;  3CCM 3;  3CCU 3;  1NNV A;  2XSH B;  3QRD A;  2GEY A;  2KXG A;  1VQO 3;  3DXO A;  1Q81 4;  3LTC A;  1OHO A;  1UW1 A;  1NO3 A;  2GU1 A;  3CPW 2;  3X40 A;  1Q40 A;  1I2F A;  4CCV A;  1GSP A;  4HM6 B;  1RCK A;  1W2B 2;  5IER A;  3FCS B;  3FZW A;  3VF1 A;  1W6C A;  5FW5 A;  1AVK A;  3ZG5 A;  1PU4 A;  3ROB A;  3LML A;  4NPB A;  1V58 A;  3V99 A;  1M90 4;  4R9L A;  1UDI I;  5KP3 A;  1D6Z A;  4RNY A;  3H51 A;  1FGR A;  1B2M A;  2RCD A;  2HMM B;  1RLS A;  4HM4 B;  1JB4 A;  2FNQ A;  4MMZ B;  1GD4 A;  2IA7 A;  3G6E 3;  1LRA A;  5ELJ A;  1KWI A;  3N8B A;  4AKZ A;  4NRE A;  4N6U A;  5CF2 A;  1A2K A;  3LT9 A;  1VQQ A;  4IT7 A;  1IQX A;  3CCR 3;  5EEO A;  3FSD A;  5LC7 A;  3J7Y d;  1BNE A;  1E3V A;  1GY7 A;  2F5M A;  1VQ5 3;  1VQN 3;  1AY7 A;  1CH0 A;  2Y74 A;  3TDG A;  3F7S A;  1LOY A;  3EB8 A;  4OVM A;  4GSP A;  2ZDJ A;  3UL6 A;  4IPB A;  1W00 A;  1L5G B;  1KD1 4;  1QVG 2;  1T5Y A;  1DET A;  1OGX A;  4CDL A;  3B8L A;  3UL5 A;  3KCH A;  2ZL8 A;  3CCS 3;  3MG2 A;  3NHX A;  5GSP A;  5IG0 A;  2CWT A;  3G71 3;  2ML5 A;  2RSX A;  4RZM A;  1Q7Y 4;  3CC7 3;  2FXT A;  3LTB A;  1JBT A;  1BRG A;  1O7H B;  2F5W A;  3OX9 A;  3S27 A;  4BL3 A;  1YHQ 3;  3CC4 3;  5AYR B;  4XDW A;  3CMA 3;  1EG9 B;  1RN7 A;  2INX A;  4Q53 A;  1RJO A;  2CFK A;  2YFI B;  1FGM A;  3A76 A;  4I5Q A;  4QWT A;  1D6U A;  4U13 A;  7STD A;  3RGA A;  4XBY A;  2M7O A;  1IV7 A;  2SAR A;  3OV4 A;  1VQ4 3;  5D81 A;  1FW7 A;  3LXU X;  3CXC 2;  1T2I A;  2GSP A;  3AGN A;  3AMO A;  1LNH A;  1AR0 A;  3NQY A;  1TRQ A;  3NM2 A;  3S29 A;  1IVW A;  3CD6 3;  2CKF B;  2AAD A;  1QAL A;  1JN5 A;  3HI7 A;  1K73 4;  3KFQ C;  1UCJ A;  4HM7 B;  1W2Z A;  3EQQ B;  5BIR A;  1B21 A;  1DMM A;  2XFS A;  3EN1 B;  3CCJ 3;  1VQ8 3;  1Z1S A;  2K3D A;  2W0Q A;  3MHE A;  1OHS A;  4HVN A;  3Q2P A;  2CFG A;  6GSP A;  1BUQ A;  1N8R 4;  4AEQ A;  1K9M 4;  1RNB A;  1MNL A;  4JRF A;  4CJN A;  4EBG A;  4EV5 A;  2F86 B;  4BTW A;  1JZO A;  1PY3 A;  1BNR A;  1BRI A;  3DY5 A;  3MG3 A;  2BMO B;  2HOH A;  2CX1 A;  1GOY A;  2Q07 A;  1RGF A;  3VSY A;  3LOY A;  1LOX A;  4FMB A;  5G1K A;  1RN4 A;  1FUT A;  3DH2 A;  4DKI A;  2W9P A;  4O02 B;  1UGI A;  4J8T A;  4XBT A;  3T0U A;  1UCL A;  1I0V A;  3PCR A;  3Q90 A;  4ZM8 A;  2YFJ B;  2P09 A;  3DZL A;  1UCI A;  3LH4 A;  1BNG A;  2XF3 A;  1BRJ A;  1N9J A;  4FCZ A;  4HM3 B;  1Q82 4;  2K54 A;  5M19 A;  2QIY A;  3WR2 A;  5IEP A;  5CXO A;  1YNV X;  5AIG A;  1CEW I;  1RGG A;  1YVS A;  3OWU A;  2KF6 A;  2CX0 A;  1E97 A;  1LQM B;  2CG1 A;  2QA4 3;  5CF1 A;  1LNI A;  1W4N A;  4WYK B;  4RNT A;  3HII A;  1EQK A;  4HM1 B;  1IV9 A;  2IY2 A;  4O8S A;  3F7X A;  3I0Y A;  4GHO A;  4J5G A;  1I2E A;  1Q42 A;  1MWT A;  1GOU A;  2IUK A;  1BSB A;  4BL2 A;  1RGK A;  3UB1 A;  2XGN A;  3GWR A;  2BO9 B;  2W03 A;  1TU5 A;  1LOV A;  2ZHX B;  1OAC A;  2RBI A;  3NUV A;  5IEN A;  5AI1 A;  1BAN A;  3OWY A;  2Z77 A;  4KFF A;  3GZB A;  3SLU A;  3G16 A;  5G2G A;  1JKG A;  1T2H A;  3GRD A;  5IF6 A;  1FGT A;  1YVB I;  4FMD A;  4BTY A;  4NHF A;  3DGM A;  3AHW A;  4LEH A;  1D6Y A;  3NBJ A;  1BRH A;  3N9H A;  3G4S 3;  3SVA A;  1OF5 B;  3FF2 A;  3WMD A;  1DMN A;  2UX0 A;  3CU3 A;  4BU4 A;  1RGL A;  2HMO B;  1ISK A;  1GMP A;  3LT8 A;  7RNT A;  3SED A;  2P0M A;  2Z7A A;  1IVU A;  4EYC A;  3I55 3;  2CIU A;  2W9Q A;  3IMA B;  1Q7H A;  2O9U X;  4FMC A;  4O3V A;  1BUJ A;  2KF3 A;  1JN5 B;  2B24 B;  1DVC A;  2LQV A;  4HBR A;  1RN1 A;  1QAF A;  2KF5 A;  4STD A;  3T8N A;  4H61 A;  4K61 A;  3FG4 A;  1F8N A;  1YJ9 3;  2CHC A;  3WA3 A;  1ULJ B;  1BSA A;  1TRP A;  1NWW A;  2KAA A;  1B3S A;  2JDI H;  2C4B A;  1GY5 A;  3S28 A;  3QK9 A;  3F8H A;  1N5H A;  3JUO A;  1GMQ A;  5CLK A;  1JB5 A;  3PZW A;  1W6Y A;  1ASK A;  3SOY A;  1YGE A;  3K0Z A;  3LTD A;  6RNT A;  2KRT A;  1YIJ 3;  4X2O A;  1IQY A;  3AGO A;  3PS8 A;  4ORL A;  3RDE A;  3CME 3;  1QAK A;  3NQZ A;  2Y73 A;  1O7N B;  2W04 A;  1FUS A;  3FLJ A;  3MWZ A;  3EBY A;  4FCJ A;  4O2H A;  1UUG B;  1BVI A;  1Q9E A;  3EE1 A;  4R1K A;  5I97 A;  1B2S A;  4HM0 B;  3S67 A;  1ZO2 A;  4HJL B;  1NB5 I;  1K28 A;  3PGB A;  1BNJ A;  1FGO A;  1FZU A;  2ZA4 A;  1IK3 A;  1OGZ A;  3GZY B;  3MYT A;  3JUM A;  2O3O A;  5DRE A;  3CCQ 3;  3HOH A;  3O8Y A;  3V98 A;  2GBX B;  3V92 A;  4WFO A;  1VQP 3;  2OTL 3;  3S5C A;  4BTX A;  2GEX A;  1SPU A;  3BND A;  5AIF A;  3WHO A;  2RNT A;  6STD A;  1GD3 A;  4XBX A;  2HML B;  3KZT A;  3WOE B;  1TTO A;  3CNM A;  3B7C A;  3X3X A;  1HZ1 A;  4RBN A;  3KKG A;  3KE7 A;  2XRX B;  2E2U A;  5JBS A;  5JPU A;  1X1Y A;  3MKI A;  3OXA A;  4XB5 A;  1STF I;  2A15 A;  2F99 A;  3D5G A;  3SX1 A;  3ALA A;  3U1W A;  5KP4 A;  4EC6 A;  1MWS A;  1V74 A;  1EEJ A;  1GOV A;  1TFK A;  2XFT A;  4L8P A;  1M1K 4;  1JKG B;  1E3R A;  2R4I A;  1HYF A;  2OOV C;  4EXR A;  1CYV A;  3B4O A;  1T3B A;  4HYZ A;  3RGR A;  2ML6 A;  1YJW 3;  1FA3 A;  1M9G A;  1U8C B;  4CPK A;  1C54 A;  4N3V A;  4XM4 A;  3LTA A;  2WO0 A;  2FGT A;  3E99 A;  1Q40 B;  2OWP A;  1DE3 A;  3K7C A;  3WOF B;  1DYU A;  3DUK A;  2OQE C;  1OPY A;  7GSP A;  2E2T A;  2HMK B;  4FR9 A;  3F9S A;  1KSI A;  1RRL A;  3D5I A;  2STD A;  1I8V A;  3L0R A;  4FCM A;  4OK0 A;  3JUN A;  1N5P A;  1VZZ A;  2Z76 A;  3LZA A;  1S5A A;  3EC9 A;  5G1L A;  5IG4 A;  3UNL A;  4PEJ A;  2C11 A;  1IVV A;  3F8X A;  4HZ9 B;  3MSO A;  1VQ9 3;  1UI8 A;  1I3F A;  1O7G B;  5BVB A;  2KF4 A;  1UI7 A;  1BNI A;  1MWR A;  2QGU A;  5AIH A;  1RKY A;  2BU4 A;  1UGH I;  2KCD A;  1TFO A;  2MC8 A;  1ZX2 A;  2CH9 A;  2IMJ A;  1MOL A;  1FGQ A;  4HM2 B;  1RGH A;  4H3U A;  4N6V 0;  1W7C A;  3URP A;  1BNS A;  1QMA A;  1V57 A;  1SAR A;  2XH9 A;  3FF0 A;  4FMA A;  5M18 A;  4MMY B;  1ROV A;  2HMJ B;  4KFE A;  1R4C A;  2L4V A;  5ELU A;  1LXE A;  1NJI 4;  1US1 A;  1YIT 3;  5D83 A;  2CFD A;  1KC8 4;  1BU4 A;  1UUV B;  1N8Q A;  4KFD A;  1B2U A;  2XGL A;  2PZV A;  1HKX A;  4WP5 A;  2UGI A;  3FG1 A;  1W02 A;  3D3L A;  4LMI A;  5AEW B;  2RFR A;  1I70 A;  3HZP A;  2CWV A;  3NM7 A;  1VQ6 3;  1A67 A;  1YI2 3;  5BXQ A;  3FKA A;  3F40 A;  3PCS A;  4L7K A;  1OCV A;  3WA2 X;  9RNT A;  1Q86 4;  3DGN A;  3IJE B;  1IDP A;  1HU9 A;  1TIJ A;  2W6J H;  1OUN A;  1TP6 A;  2QEX 3;  2CK3 H;  3DGO A;  1K41 A;  4MJD A;  1VQM 3;  2W56 A;  3OWS A;  1A2V A;  5AYS C;  3BB9 A;  5BU4 A;  1RMS A;  5IW9 A;  3D4A A;  1I0X A;  1GMR A;  3AHS A;  4LZI A;  2E2V A;  1VQL 3;  3AMO B;  3KSE D;  4G1M B;  3JUP A;  3ZFZ A;  1S72 3;  1W6G A;  1RRH A;  1R4Y A;  2F98 A;  2WGO A;  1IVX A;  1RCL A;  3FH1 A;  3KSP A;  1WMP A;  2OCT A;  3ZG0 A;  3DM8 A;  3EJV A;  1RGE A;  3NBB A;  5A0O B;  1IT7 A;  4HAA A;  5LC6 A;  5KP1 A;  1MGR A;  1WMN A;  5AII A;  5FGO A;  3G0K A;  3NBR A;  3VGN A;  3U97 A;  3NV0 A;  4KZ1 A;  1GS3 A;  3RNT A;  1B20 A;  4L8O A;  1IU7 A;  2P38 A;  3G8Z A;  5IG5 A;  1G0T A;  4J9A A;  4TX4 A;  1OH0 A;  1AV4 A;  1O7P B;  2OOV A;  5CK6 A;  1LVN A;  1O7M B;  3IPT A;  1BSC A;  4J5K A;  3K63 A;  3WDG B;  4R4K A;  2WOF A;  3BU4 A;  8RNT A;  1CYU A;  4OUQ A;  3SOA A;  3X41 A;  5RNT A;  2D1W A;  3KN4 A;  3BIR A;  5IG3 A;  1RNT A;  1SII A;  2CWU A;  1X1W A;  1U5O A;  2I9W A;  2XR8 B;  5D82 A;  3I56 3;  1A2P A;  3GZX B;  5EVH A;  1DVD A;  4X2H A;  1G02 A;  1X1U A;  1BOX A;  1WNH A;  2XSO B;  1RSN A;  2YFL B;  3EF8 A;  3ER7 A;  2OQE A;  4N6T A;  2CFW A;  1TUH A;  3UJM A;  1YJN 3;  2B1X B;  3CPO A;  4MMX B;  1WTH A;  1K8A 4;  1KQS 2;  4HKV B;  1EUI C;  2R41 A;  3CCE 3;  4KVH A;  2BIR A;  1FYS A;  2AAE A;  2BT3 A;  3HX8 A;  2C10 A;  3K5T A;  1QVF 2;  1JRQ A;  4MEI A;  2P0X A;  1JV2 B;  3X42 A; 
#chains in the Genus database with same CATH homology
 1GOU A;  3D5I A;  3DGY A;  1I8V A;  1BSB A;  1RGK A;  1LOV A;  2RBI A;  1BAN A;  2F4Y A;  1B2M A;  1I3F A;  3Q3F A;  1BNF A;  1RLS A;  1BNI A;  2KF4 A;  1T2H A;  2BU4 A;  1LRA A;  3AHW A;  1BRH A;  1RGH A;  3URP A;  1BNS A;  1SAR A;  1ZGX A;  1BAO A;  1BNE A;  2F5M A;  1BRN L;  4BU4 A;  1RGL A;  1GMP A;  7RNT A;  1AY7 A;  1CH0 A;  1BUJ A;  1BU4 A;  1MGW A;  1B2U A;  1LOY A;  2KF3 A;  4GSP A;  1RN1 A;  2KF5 A;  1RTU A;  1I70 A;  1DET A;  1BSA A;  3KCH A;  1TRP A;  2KAA A;  5GSP A;  1B3S A;  2C4B A;  9RNT A;  1GMQ A;  1RDS A;  1JBT A;  3A5E A;  1BRG A;  1UCK A;  2F5W A;  3GSP A;  6RNT A;  3AGO A;  5BU4 A;  1RMS A;  3D4A A;  1I0X A;  1GMR A;  3AHS A;  4HOH A;  1FUS A;  5HOH A;  2SAR A;  1BVI A;  1Q9E A;  1B2S A;  1I2G A;  1R4Y A;  1FW7 A;  1T2I A;  2GSP A;  1RCL A;  3AGN A;  1BNJ A;  1JBR A;  1LOW A;  1TRQ A;  1FZU A;  2ZA4 A;  1BIR A;  2AAD A;  1RGE A;  1UCJ A;  3HOH A;  4HAA A;  4BIR A;  5BIR A;  1MGR A;  1B21 A;  1AQZ A;  3WHO A;  1BSD A;  2RNT A;  3RNT A;  1B20 A;  6GSP A;  1TTO A;  1RNB A;  3SYU A;  1HZ1 A;  1B2Z A;  1PY3 A;  1BNR A;  1BRI A;  1BSC A;  1RGA A;  1X1Y A;  4J5K A;  8RNT A;  2HOH A;  3BU4 A;  1B2X A;  1BSE A;  1GOY A;  3D5G A;  1JBS A;  1RGF A;  1BRK A;  5RNT A;  3BIR A;  1RNT A;  1GOV A;  1RN4 A;  1FUT A;  1X1W A;  3DH2 A;  1B27 A;  1RHL A;  1RGC A;  1A2P A;  1HYF A;  1UCL A;  1I0V A;  1X1X A;  1I3I A;  1G02 A;  1X1U A;  1BRS A;  1UCI A;  1BOX A;  1BNG A;  1YGW A;  1BRJ A;  1RSN A;  1C54 A;  1IYY A;  1PYL A;  1BGS A;  3WR2 A;  2F56 A;  1YNV X;  1RGG A;  1YVS A;  2KF6 A;  1DE3 A;  1LNI A;  2BIR A;  1FYS A;  2AAE A;  4RNT A;  1I2F A;  7GSP A;  1GSP A;  1RCK A;  4GHO A;  4J5G A;  1I2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...