3WHOA

X-ray-crystallographic structure of an rnase po1 exhibiting anti-tumor activity
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Po1
publication title X-Ray Crystallographic Structure of RNase Po1 That Exhibits Anti-tumor Activity
pubmed rcsb
source organism Pleurotus ostreatus
molecule tags Hydrolase
total genus 21
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3whoA00
2KF4A 5HOHA 1BOXA 2KF6A 4J5GA 1I2EA 1BGSA 3KCHA 1I0XA 1TRPA 1T2HA 1B20A 1HYFA 4BU4A 1AQZA 1YNVX 3AGNA 1GSPA 2F5MA 1UCJA 3URPA 1FUSA 1RGGA 1I70A 1I3FA 1RSNA 1B2MA 1RCLA 1FUTA 1RDSA 1RGHA 1IYYA 1TRQA 1BRGA 1GOUA 1LNIA 2ZA4A 2AADA 1LRAA 1RTUA 5GSPA 1BNGA 1BSDA 1CH0A 1RNBA 1PYLA 1RHLA 2RNTA 3WR2A 5RNTA 1RGCA 1X1YA 1BSEA 2KAAA 1BRHA 1B2XA 1BSBA 1PY3A 1JBRA 1RN1A 4RNTA 1B2UA 1I3IA 1BVIA 2KF5A 1RN4A 1RLSA 1BIRA 1T2IA 2BU4A 1GOVA 3BIRA 4HOHA 1X1WA 2F56A 3WHOA 1RNTA 1B2ZA 7RNTA 1JBSA 3A5EA 1RMSA 1BRJA 2RBIA 7GSPA 3GSPA 3AHSA 4J5KA 1B3SA 1JBTA 1LOVA 2BIRA 1HZ1A 1MGWA 3BU4A 1BSCA 1I8VA 1BAOA 3DH2A 2F5WA 2AAEA 1BANA 1RCKA 4BIRA 3AGOA 1BNFA 1FYSA 1YGWA 2SARA 3DGYA 3Q3FA 1RGAA 1BNRA 1BNJA 1YVSA 4HAAA 3SYUA 1G02A 1GOYA 8RNTA 1GMRA 1DETA 1I2FA 1LOYA 1BRNL 1C54A 4GHOA 1UCLA 1Q9EA 1DE3A 3AHWA 1AY7A 6GSPA 1FW7A 1BSAA 1BNEA 1BRKA 2F4YA 1BUJA 1MGRA 1UCIA 1I0VA 1FZUA 1X1UA 1RGLA 1BRIA 3D4AA 1B2SA 1BU4A 1A2PA 1R4YA 1BNSA 1B27A 1I2GA 3HOHA 1ZGXA 3D5GA 4GSPA 2HOHA 5BU4A 1SARA 2KF3A 6RNTA 1GMPA 3RNTA 1RGEA 1UCKA 1BNIA 1BRSA 1RGFA 2GSPA 3D5IA 1RGKA 1TTOA 1GMQA 1B21A 1LOWA 5BIRA 1X1XA 9RNTA 2C4BA
chains in the Genus database with same CATH superfamily
4GB5A 3S5CA 1VQ53 1HU9A 5LC7A 4J5GA 1WTHA 2F98A 1N8QA 3BNBA 4MMZB 3D79A 1I0XA 3BNCA 1O7GB 4WP5A 3AMOB 2W9QA 4K1VA 2O9UX 2XF3A 1W6GA 3CC73 4MEIA 2ML6A 1RNBA 4BU4A 3ALAA 3ECFA 2F5MA 3UB1A 3V92A 1QAFA 1WNHA 3H51A 3V99A 1UUVB 3URPA 3U1WA 2MC8A 3CCS3 1IV9A 1EG9B 1DVDA 1ZX2A 1I70A 1OPYA 4WHAA 4HBRA 3B4OA 2I9WA 4XBYA 4EV5A 1IYYA 4RNZA 1LQMB 2V1LA 1TRQA 4RBNA 2ZL8A 1KWIA 1GY5A 1NU3A 1N5PA 1IT8A 2RGQA 1CQSA 3E99A 1ULJB 1VQ73 1CH0A 1GD4A 1O7WB 4HM0B 4KVHA 5JPUA 1PYLA 1RHLA 1N9JA 3KFQC 4MJDA 4WYKA 4XDWA 5KP1A 1IK3A 5IEOA 1EKMA 3NUVA 5RNTA 3FSDA 1X1YA 1BSEA 3NX0A 3ROBA 3CPW2 1B2XA 2FGTA 1JBRA 3CCR3 3JUNA 1PFPA 3DGLA 2OTJ3 1NB5I 1HKXA 4XB5A 1EUIC 3EE1A 5I97A 4R1KA 1C7HA 2BHMA 2W9PA 4L7KA 1Q40B 3SOYA 5M18A 1DMNA 3FZWA 3H3HA 4HZBB 4RZMA 3FF0A 2CC3A 1BRJA 3CCU3 2UX0A 1NB3I 2WGOA 1IVVA 4L8OA 2D42A 1B3SA 2OCTA 1UI7A 1LOXA 1OHOA 1YHQ3 1BSCA 3FCSB 4ILFA 3NV0A 1OHPA 4OK0A 3DH2A 4R9KA 5IG0A 2BMQB 2W0QA 2AAEA 4KT3B 3JUQA 4EV2A 4BIRA 5A0OB 3AGOA 1BNFA 1W5ZA 1FYSA 2Y73A 4HM7B 1LQGC 4ORLA 3DGYA 3OWYA 3Q3FA 4R9LA 3BNEA 4BL2A 3LTCA 3WDGB 4QWTA 3HX8A 1Q864 1GMRA 3CMA3 1FGTA 1VQ63 3CCQ3 2OQEA 5JBSA 3LTDA 1LXEA 2YFIB 1M904 2YFJB 1EA2A 1MNLA 3AHWA 3NHXA 3ZG5A 1KC84 3GWRA 3SEDA 3ER7A 5DRVA 2BO9B 4O8SA 3T0UA 1Q7HA 1BUJA 1D6YA 1J2BA 3U97A 2GBXB 1FZUA 2H0HA 1A2PA 4J8TA 2P09A 1IVWA 1BNSA 2Y74A 3JUMA 1YGEA 3J7Yd 3F8HA 4EBGA 2HMNB 3CU3A 3K9MC 1W02A 3KSPA 3D5GA 4GSPA 1TU5A 1G0TA 1SARA 3N8BA 1ZS7A 1OHSA 2RCDA 3LXUX 1N5HA 1O7HB 2CFLA 1GMPA 4FCMA 6RNTA 3EJVA 4O02B 1QALA 1RGEA 1ROAA 1BNIA 5IW9A 3KZTA 3GZBA 1O7NB 1AVKA 1WMNA 2ZHXB 4EYCA 3ZFZA 3D5IA 1RGKA 3GAXA 1GMQA 3WOEB 2OOVC 1R4CA 1STFI 1X1XA 3D3LA 2BMRB 3D9RA 2C4BA 3F14A 3OX9A 5AYSC 1QMAA 3G0KA 3WOFB 3PS8A 1VQQA 3IJEB 4LSOA 7STDA 2KF6A 5AIFA 3DZLA 4N6LA 1I2EA 4O2HA 3KCHA 2YFLB 3HZPA 3KKGA 3HIIA 1B20A 2WOHA 2GBWB 5IG5A 3QRDA 5IEPA 3MYTA 3SX1A 4LZIA 3WODG 3CCJ3 3CCM3 2GEXA 1VQP3 1UCJA 2W03A 1RRHA 3IMAB 3HI7A 1JNQA 4FMBA 1K734 4CDLA 1JN5A 3MKIA 1RCLA 1RDSA 1RGHA 4FMAA 1E3RA 1LNIA 5ELUA 2ZA4A 1M9GA 2AADA 2ML5A 2CHCA 1KSIA 3KE7A 4H61A 1IQYA 1LRAA 3WA2X 1TFKA 1JB4A 3CCE3 4BL3A 4JRFA 3UNLA 1GYBA 2LQVA 3PGBA 1NJI4 2F99A 4LYLB 3MSOA 2XFTA 3JUOA 3WR2A 1US1A 2K3DA 5AI1A 3SLUA 2CWUA 4XBXA 3X42A 3G6E3 1IDPA 1W6YA 1BRHA 1BSBA 1PY3A 3FH1A 1RN1A 4RNTA 1B2UA 4HM2B 3EC9A 2Z7AA 3CPOA 1QAKA 2H0GA 1JKGB 3STDA 1I3IA 1MOLA 3A76A 5IG3A 1BVIA 3S28A 1OF5A 1RN4A 1BIRA 2BU4A 3X40A 3EBYA 4AKYA 1GOVA 1YI23 1WMOA 2F56A 4J9AA 4O3VA 1M1K4 1RNTA 3NM2A 2CG1A 1ROVA 3SOAA 3S67A 4HJLB 1NNVA 3NQZA 3AHSA 4I5QA 3X41A 2IUJA 2L1SA 4J5KA 3WA3A 1NO3A 1HZ1A 1YIJ3 3BU4A 1I8VA 2K0MA 2KXGA 4HKVB 1STDA 1RCKA 3MG1A 4MMYB 3AMOA 4N6NB 2IMJA 2SARA 3DUKA 1VQK3 3TDGA 1UDII 1RGAA 3SXXA 1BNJA 1Z1SA 2E2UA 2R41A 1I2FA 3GZYB 2STDA 4JF8A 3DXOA 1UCLA 3F9SA 5IERA 2CW9A 6GSPA 3GZRA 3K7CA 2A15A 3VF1A 1A2VA 1MGRA 4LGQA 1JB5A 5KP4A 3LT9A 1RGLA 1K28A 3I553 5AIIA 2E2TA 1R4YA 3NBRA 1OH0A 3NM7A 4BTYA 3I563 1B27A 2WGQA 8CHOA 1ZGXA 1JV2B 2HOHA 1UGIA 1OACA 2W04A 4KFEA 1CYVA 5FW5A 1E97A 4MMXB 1DMQA 2CFWA 2XSOB 1BUQA 1VQ83 1UCKA 1W4NA 3DY5A 3RGRA 1GY6A 5CLKA 4U13A 1FGQA 1Q40A 1TTOA 3ZG0A 3CME3 4HZ9B 1LOWA 3PYJA 5BIRA 2GXFA 3CC43 4HM3B 2KF4A 1T5YA 5HOHA 1OCVA 1BOXA 3M8CA 3BLZA 1K9M4 1W00A 1BGSA 1CYUA 3LTBA 1UI8A 2IA7A 3NBBA 3F7SA 2GEYA 4XM4A 1TRPA 1Y4KA 2W2CA 1T2HA 1ULIB 2JDIH 2XH9A 3FKAA 1HYFA 3G8ZA 2MF7A 3I0YA 5BXQA 1Q7Y4 1N8R4 1AQZA 3CCL3 3AGNA 2IYJA 1UUGB 3PCSA 1RKYA 1OUNA 3FG3A 5G2GA 2HMKB 1W2B2 1RSNA 5D83A 1FUTA 1IT7A 3HK4A 2CH9A 4OUQA 1O7MB 1GOUA 2XGNA 2XFSA 1WMPA 2HMOB 4N6V0 3EN1B 4X2OA 2HMLB 1YVBI 1SPUA 2GU1A 4FCZA 3FG1A 2OWPA 4WFOA 5GSPA 4AEQA 2LYXA 2J8XB 3K0ZA 3CXC2 2F86B 1FGRA 2FNQA 2RNTA 1DVCA 4HM5B 1W01A 2IUKA 2YX9A 2OOVA 1IVXA 1NDOB 2KAAA 1GD3A 1V57A 3Q2PA 2WO0A 1D6ZA 4XDVA 3MG3A 1CEWI 3K5TA 3GRDA 1OGZA 5M19A 3RGAA 2QGUA 5KP3A 1JZDA 1SIIA 2KF5A 1RLSA 1QVF2 1TFOA 1TIJA 2CFDA 2W56B 3BIRA 1S723 4N3VA 3MWZA 5TGNA 3Q1CA 1B2ZA 7RNTA 2UGIA 5EQLA 1JBSA 2BMOB 2P0XA 3BB9A 2QA43 2HMMB 1O7PB 2XRXB 4L8PA 1QJGA 2CG0A 3OW22 3EX9A 1LOVA 2BIRA 1JBTA 2W6JH 1QVG2 4HM6B 2BT3A 2JQ5A 2XEPA 3WMDA 5FGOA 2QEX3 3K63A 1UW1A 3DM8A 2CWVA 4FR9A 2P05A 3LOYA 3CC23 2FXTA 1NWWA 2UUGC 4X2HA 2M7OA 1IU7A 1YGWA 2Z76A 3KN4A 4NREA 5AEUB 1WQLB 1KD14 4HYZA 1BNRA 2C10A 3Q90A 3S27A 1GOYA 5G1LA 1BRNL 1DETA 1IV7A 1K41A 1MWTA 4GHOA 2CFKA 4RNYA 3SVAA 4N6OB 3KIIA 1LVNA 4BTWA 1W7CA 4WYKB 4CJNA 1BSAA 1FGOA 1BRKA 2PNCA 1RRLA 1S5AA 4H3UA 3IPTA 1A2KA 1JRQA 1X1UA 4AKZA 3FGYA 1Q824 1JZOA 1BU4A 4IPBA 4K61A 4WWUC 3T8UA 1ASKA 3B4PA 4Q53A 3G4S3 1I2GA 3HOHA 1IVUA 1MWUA 2KCDA 4LEHA 5BU4A 3T8NA 2KF3A 3EF8A 3B8LA 3L0RA 3NQYA 3UL5A 5CK6A 3G713 3F7XA 1JKGA 3OWUA 4FMCA 3RNTA 2OTL3 3FG4A 1BRSA 1RGFA 3F8XA 5IG4A 5ELJA 2GSPA 2Z6BA 1MWRA 3EN8A 2C11A 3N9HA 3OXAA 4GL6A 1TUHA 3CD63 4HM4B 2CK3H 2CKFB 3DGMA 4K90B 3X3YA 3HIGA 3JUPA 3NV0B 3DGOA 3VGNA 2QIYA 3LYGA 5M1AA 1TJDA 1V58A 2IY2A 2ZDJA 3MPHA 1TP6A 3G16A 1E3VA 1IQXA 4I4KA 5CXOA 1YNVX 3X3XA 1GSPA 2SBLA 1AVLA 4N6UA 2CX1A 3PZWA 2O3OA 1FUSA 4G1MB 1RGGA 4N6TA 4CCVA 5D81A 1I3FA 1B2MA 1GS3A 3GZXB 1BRGA 1F8NA 1DYUA 2P0MA 3EB8A 2CIUA 5EEOA 4NPBA 4LMIA 4IT7A 4FMDA 1K8A4 4R80A 1EQKA 1OGXA 1V74A 1RTUA 2L4VA 1BNGA 1BSDA 3QK9A 3V98A 3NBJA 3CNXA 3DGNA 4ZM8A 2CX0A 2H0IA 1T3BA 3MHEA 5LC6A 1IQ8A 2RFRA 3LH4A 5AIHA 1Q42A 1SQWA 4R4KA 1M1XB 1RGCA 1YIT3 1KQS2 1AR0A 4EXRA 1JJ22 1FUWA 1LNHA 4TX4A 2B24B 2OQEC 4IIAA 1FGMA 3OWSA 3CNMA 3VSYA 5IENA 3JVCA 3DMCA 1T2IA 4NHFA 2XSHB 5EVHA 3RDEA 4HOHA 1X1WA 2HMJB 1Q814 1N9EA 3NXJA 1L5GB 3CCV3 3FLJA 3X3ZA 3WHOA 4CPKA 2WOFA 2BNGA 1RMSA 2RBIA 3A5EA 1SIHA 7GSPA 6STDA 3GSPA 4HVNA 2GU3A 2XGLA 1VQL3 5STDA 3UL6A 5AYRB 1PU4A 1YJN3 2Z77A 2CFGA 1MGWA 4BTXA 4OVMA 5DREA 1BAOA 1W2ZA 4STDA 1EEJA 2F5WA 5BVBA 3N54B 2B1XB 1BANA 5JPPA 3PCRA 1YJW3 1JN5B 2E2VA 5IF6A 1ISKA 3PXMA 1VQN3 5CF2A 1YVSA 4HAAA 3SYUA 1RJOA 1G02A 1SJWA 1UUWB 4FCJA 1LOYA 2XR8B 8RNTA 1A67A 1C54A 3EBTA 2CWTA 1Q9EA 1ZO2A 2D1WA 2INXA 2KRTA 4HM1B 1RN7A 1DE3A 1AY7A 3LMLA 1FW7A 4KFDA 1BNEA 1G96A 2F4YA 4PEJA 5AEWB 1W6CA 3EHCA 4XBTA 1JB2A 1YJ93 1UCIA 1I0VA 2R4IA 1U5OA 4HM8B 4N6MA 5G1KA 1VQM3 4KZ1A 1BRIA 1GY7A 3F40A 2RSXA 3D4AA 1B2SA 4DKIA 2K54A 3LZAA 3O8YA 2PZVA 3B7CA 1OF5B 1A90A 4EC6A 2P38A 1U8CB 3FF2A 1VZZA 1FA3A 5HGRA 1VQ93 1UGHI 3MG2A 3LTAA 4EW5A 5CF1A 1VQO3 3LT8A 3BNDA 2Q07A 1VQ43 3OV4A 1AV4A 4KFFA 3S29A 1DMMA 3KSED 1D6UA 3EQQB 5D82A 1B21A 4K1UA 9RNTA 2W56A 1MWSA 3UJMA 5AIGA
chains in the Genus database with same CATH topology
2KF4A 5HOHA 1BOXA 2KF6A 4J5GA 1I2EA 1BGSA 3KCHA 1I0XA 1TRPA 1T2HA 1B20A 1HYFA 4BU4A 1AQZA 1YNVX 3AGNA 1GSPA 2F5MA 1UCJA 3URPA 1FUSA 1RGGA 1I70A 1I3FA 1RSNA 1B2MA 1RCLA 1FUTA 1RDSA 1RGHA 1IYYA 1TRQA 1BRGA 1GOUA 1LNIA 2ZA4A 2AADA 1LRAA 1RTUA 5GSPA 1BNGA 1BSDA 1CH0A 1RNBA 1PYLA 1RHLA 2RNTA 3WR2A 5RNTA 1RGCA 1X1YA 1BSEA 2KAAA 1BRHA 1B2XA 1BSBA 1PY3A 1JBRA 1RN1A 4RNTA 1B2UA 1I3IA 1BVIA 2KF5A 1RN4A 1RLSA 1BIRA 1T2IA 2BU4A 1GOVA 3BIRA 4HOHA 1X1WA 2F56A 3WHOA 1RNTA 1B2ZA 7RNTA 1JBSA 3A5EA 1RMSA 1BRJA 2RBIA 7GSPA 3GSPA 3AHSA 4J5KA 1B3SA 1JBTA 1LOVA 2BIRA 1HZ1A 1MGWA 3BU4A 1BSCA 1I8VA 1BAOA 3DH2A 2F5WA 2AAEA 1BANA 1RCKA 4BIRA 3AGOA 1BNFA 1FYSA 1YGWA 2SARA 3DGYA 3Q3FA 1RGAA 1BNRA 1BNJA 1YVSA 4HAAA 3SYUA 1G02A 1GOYA 8RNTA 1GMRA 1DETA 1I2FA 1LOYA 1BRNL 1C54A 4GHOA 1UCLA 1Q9EA 1DE3A 3AHWA 1AY7A 6GSPA 1FW7A 1BSAA 1BNEA 1BRKA 2F4YA 1BUJA 1MGRA 1UCIA 1I0VA 1FZUA 1X1UA 1RGLA 1BRIA 3D4AA 1B2SA 1BU4A 1A2PA 1R4YA 1BNSA 1B27A 1I2GA 3HOHA 1ZGXA 3D5GA 4GSPA 2HOHA 5BU4A 1SARA 2KF3A 6RNTA 1GMPA 3RNTA 1RGEA 1UCKA 1BNIA 1BRSA 1RGFA 2GSPA 3D5IA 1RGKA 1TTOA 1GMQA 1B21A 1LOWA 5BIRA 1X1XA 9RNTA 2C4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KF4 A;  5HOH A;  1BOX A;  2KF6 A;  4J5G A;  1I2E A;  1BGS A;  3KCH A;  1I0X A;  1TRP A;  1T2H A;  1B20 A;  1HYF A;  4BU4 A;  1AQZ A;  1YNV X;  3AGN A;  1GSP A;  2F5M A;  1UCJ A;  3URP A;  1FUS A;  1RGG A;  1I70 A;  1I3F A;  1RSN A;  1B2M A;  1RCL A;  1FUT A;  1RDS A;  1RGH A;  1IYY A;  1TRQ A;  1BRG A;  1GOU A;  1LNI A;  2ZA4 A;  2AAD A;  1LRA A;  1RTU A;  5GSP A;  1BNG A;  1BSD A;  1CH0 A;  1RNB A;  1PYL A;  1RHL A;  2RNT A;  3WR2 A;  5RNT A;  1RGC A;  1X1Y A;  1BSE A;  2KAA A;  1BRH A;  1B2X A;  1BSB A;  1PY3 A;  1JBR A;  1RN1 A;  4RNT A;  1B2U A;  1I3I A;  1BVI A;  2KF5 A;  1RN4 A;  1RLS A;  1BIR A;  1T2I A;  2BU4 A;  1GOV A;  3BIR A;  4HOH A;  1X1W A;  2F56 A;  3WHO A;  1RNT A;  1B2Z A;  7RNT A;  1JBS A;  3A5E A;  1RMS A;  1BRJ A;  2RBI A;  7GSP A;  3GSP A;  3AHS A;  4J5K A;  1B3S A;  1JBT A;  1LOV A;  2BIR A;  1HZ1 A;  1MGW A;  3BU4 A;  1BSC A;  1I8V A;  1BAO A;  3DH2 A;  2F5W A;  2AAE A;  1BAN A;  1RCK A;  4BIR A;  3AGO A;  1BNF A;  1FYS A;  1YGW A;  2SAR A;  3DGY A;  3Q3F A;  1RGA A;  1BNR A;  1BNJ A;  1YVS A;  4HAA A;  3SYU A;  1G02 A;  1GOY A;  8RNT A;  1GMR A;  1DET A;  1I2F A;  1LOY A;  1BRN L;  1C54 A;  4GHO A;  1UCL A;  1Q9E A;  1DE3 A;  3AHW A;  1AY7 A;  6GSP A;  1FW7 A;  1BSA A;  1BNE A;  1BRK A;  2F4Y A;  1BUJ A;  1MGR A;  1UCI A;  1I0V A;  1FZU A;  1X1U A;  1RGL A;  1BRI A;  3D4A A;  1B2S A;  1BU4 A;  1A2P A;  1R4Y A;  1BNS A;  1B27 A;  1I2G A;  3HOH A;  1ZGX A;  3D5G A;  4GSP A;  2HOH A;  5BU4 A;  1SAR A;  2KF3 A;  6RNT A;  1GMP A;  3RNT A;  1RGE A;  1UCK A;  1BNI A;  1BRS A;  1RGF A;  2GSP A;  3D5I A;  1RGK A;  1TTO A;  1GMQ A;  1B21 A;  1LOW A;  5BIR A;  1X1X A;  9RNT A;  2C4B A; 
#chains in the Genus database with same CATH topology
 4GB5 A;  3S5C A;  1VQ5 3;  1HU9 A;  5LC7 A;  4J5G A;  1WTH A;  2F98 A;  1N8Q A;  3BNB A;  4MMZ B;  3D79 A;  1I0X A;  3BNC A;  1O7G B;  4WP5 A;  3AMO B;  2W9Q A;  4K1V A;  2O9U X;  2XF3 A;  1W6G A;  3CC7 3;  4MEI A;  2ML6 A;  1RNB A;  4BU4 A;  3ALA A;  3ECF A;  2F5M A;  3UB1 A;  3V92 A;  1QAF A;  1WNH A;  3H51 A;  3V99 A;  1UUV B;  3URP A;  3U1W A;  2MC8 A;  3CCS 3;  1IV9 A;  1EG9 B;  1DVD A;  1ZX2 A;  1I70 A;  1OPY A;  4WHA A;  4HBR A;  3B4O A;  2I9W A;  4XBY A;  4EV5 A;  1IYY A;  4RNZ A;  1LQM B;  2V1L A;  1TRQ A;  4RBN A;  2ZL8 A;  1KWI A;  1GY5 A;  1NU3 A;  1N5P A;  1IT8 A;  2RGQ A;  1CQS A;  3E99 A;  1ULJ B;  1VQ7 3;  1CH0 A;  1GD4 A;  1O7W B;  4HM0 B;  4KVH A;  5JPU A;  1PYL A;  1RHL A;  1N9J A;  3KFQ C;  4MJD A;  4WYK A;  4XDW A;  5KP1 A;  1IK3 A;  5IEO A;  1EKM A;  3NUV A;  5RNT A;  3FSD A;  1X1Y A;  1BSE A;  3NX0 A;  3ROB A;  3CPW 2;  1B2X A;  2FGT A;  1JBR A;  3CCR 3;  3JUN A;  1PFP A;  3DGL A;  2OTJ 3;  1NB5 I;  1HKX A;  4XB5 A;  1EUI C;  3EE1 A;  5I97 A;  4R1K A;  1C7H A;  2BHM A;  2W9P A;  4L7K A;  1Q40 B;  3SOY A;  5M18 A;  1DMN A;  3FZW A;  3H3H A;  4HZB B;  4RZM A;  3FF0 A;  2CC3 A;  1BRJ A;  3CCU 3;  2UX0 A;  1NB3 I;  2WGO A;  1IVV A;  4L8O A;  2D42 A;  1B3S A;  2OCT A;  1UI7 A;  1LOX A;  1OHO A;  1YHQ 3;  1BSC A;  3FCS B;  4ILF A;  3NV0 A;  1OHP A;  4OK0 A;  3DH2 A;  4R9K A;  5IG0 A;  2BMQ B;  2W0Q A;  2AAE A;  4KT3 B;  3JUQ A;  4EV2 A;  4BIR A;  5A0O B;  3AGO A;  1BNF A;  1W5Z A;  1FYS A;  2Y73 A;  4HM7 B;  1LQG C;  4ORL A;  3DGY A;  3OWY A;  3Q3F A;  4R9L A;  3BNE A;  4BL2 A;  3LTC A;  3WDG B;  4QWT A;  3HX8 A;  1Q86 4;  1GMR A;  3CMA 3;  1FGT A;  1VQ6 3;  3CCQ 3;  2OQE A;  5JBS A;  3LTD A;  1LXE A;  2YFI B;  1M90 4;  2YFJ B;  1EA2 A;  1MNL A;  3AHW A;  3NHX A;  3ZG5 A;  1KC8 4;  3GWR A;  3SED A;  3ER7 A;  5DRV A;  2BO9 B;  4O8S A;  3T0U A;  1Q7H A;  1BUJ A;  1D6Y A;  1J2B A;  3U97 A;  2GBX B;  1FZU A;  2H0H A;  1A2P A;  4J8T A;  2P09 A;  1IVW A;  1BNS A;  2Y74 A;  3JUM A;  1YGE A;  3J7Y d;  3F8H A;  4EBG A;  2HMN B;  3CU3 A;  3K9M C;  1W02 A;  3KSP A;  3D5G A;  4GSP A;  1TU5 A;  1G0T A;  1SAR A;  3N8B A;  1ZS7 A;  1OHS A;  2RCD A;  3LXU X;  1N5H A;  1O7H B;  2CFL A;  1GMP A;  4FCM A;  6RNT A;  3EJV A;  4O02 B;  1QAL A;  1RGE A;  1ROA A;  1BNI A;  5IW9 A;  3KZT A;  3GZB A;  1O7N B;  1AVK A;  1WMN A;  2ZHX B;  4EYC A;  3ZFZ A;  3D5I A;  1RGK A;  3GAX A;  1GMQ A;  3WOE B;  2OOV C;  1R4C A;  1STF I;  1X1X A;  3D3L A;  2BMR B;  3D9R A;  2C4B A;  3F14 A;  3OX9 A;  5AYS C;  1QMA A;  3G0K A;  3WOF B;  3PS8 A;  1VQQ A;  3IJE B;  4LSO A;  7STD A;  2KF6 A;  5AIF A;  3DZL A;  4N6L A;  1I2E A;  4O2H A;  3KCH A;  2YFL B;  3HZP A;  3KKG A;  3HII A;  1B20 A;  2WOH A;  2GBW B;  5IG5 A;  3QRD A;  5IEP A;  3MYT A;  3SX1 A;  4LZI A;  3WOD G;  3CCJ 3;  3CCM 3;  2GEX A;  1VQP 3;  1UCJ A;  2W03 A;  1RRH A;  3IMA B;  3HI7 A;  1JNQ A;  4FMB A;  1K73 4;  4CDL A;  1JN5 A;  3MKI A;  1RCL A;  1RDS A;  1RGH A;  4FMA A;  1E3R A;  1LNI A;  5ELU A;  2ZA4 A;  1M9G A;  2AAD A;  2ML5 A;  2CHC A;  1KSI A;  3KE7 A;  4H61 A;  1IQY A;  1LRA A;  3WA2 X;  1TFK A;  1JB4 A;  3CCE 3;  4BL3 A;  4JRF A;  3UNL A;  1GYB A;  2LQV A;  3PGB A;  1NJI 4;  2F99 A;  4LYL B;  3MSO A;  2XFT A;  3JUO A;  3WR2 A;  1US1 A;  2K3D A;  5AI1 A;  3SLU A;  2CWU A;  4XBX A;  3X42 A;  3G6E 3;  1IDP A;  1W6Y A;  1BRH A;  1BSB A;  1PY3 A;  3FH1 A;  1RN1 A;  4RNT A;  1B2U A;  4HM2 B;  3EC9 A;  2Z7A A;  3CPO A;  1QAK A;  2H0G A;  1JKG B;  3STD A;  1I3I A;  1MOL A;  3A76 A;  5IG3 A;  1BVI A;  3S28 A;  1OF5 A;  1RN4 A;  1BIR A;  2BU4 A;  3X40 A;  3EBY A;  4AKY A;  1GOV A;  1YI2 3;  1WMO A;  2F56 A;  4J9A A;  4O3V A;  1M1K 4;  1RNT A;  3NM2 A;  2CG1 A;  1ROV A;  3SOA A;  3S67 A;  4HJL B;  1NNV A;  3NQZ A;  3AHS A;  4I5Q A;  3X41 A;  2IUJ A;  2L1S A;  4J5K A;  3WA3 A;  1NO3 A;  1HZ1 A;  1YIJ 3;  3BU4 A;  1I8V A;  2K0M A;  2KXG A;  4HKV B;  1STD A;  1RCK A;  3MG1 A;  4MMY B;  3AMO A;  4N6N B;  2IMJ A;  2SAR A;  3DUK A;  1VQK 3;  3TDG A;  1UDI I;  1RGA A;  3SXX A;  1BNJ A;  1Z1S A;  2E2U A;  2R41 A;  1I2F A;  3GZY B;  2STD A;  4JF8 A;  3DXO A;  1UCL A;  3F9S A;  5IER A;  2CW9 A;  6GSP A;  3GZR A;  3K7C A;  2A15 A;  3VF1 A;  1A2V A;  1MGR A;  4LGQ A;  1JB5 A;  5KP4 A;  3LT9 A;  1RGL A;  1K28 A;  3I55 3;  5AII A;  2E2T A;  1R4Y A;  3NBR A;  1OH0 A;  3NM7 A;  4BTY A;  3I56 3;  1B27 A;  2WGQ A;  8CHO A;  1ZGX A;  1JV2 B;  2HOH A;  1UGI A;  1OAC A;  2W04 A;  4KFE A;  1CYV A;  5FW5 A;  1E97 A;  4MMX B;  1DMQ A;  2CFW A;  2XSO B;  1BUQ A;  1VQ8 3;  1UCK A;  1W4N A;  3DY5 A;  3RGR A;  1GY6 A;  5CLK A;  4U13 A;  1FGQ A;  1Q40 A;  1TTO A;  3ZG0 A;  3CME 3;  4HZ9 B;  1LOW A;  3PYJ A;  5BIR A;  2GXF A;  3CC4 3;  4HM3 B;  2KF4 A;  1T5Y A;  5HOH A;  1OCV A;  1BOX A;  3M8C A;  3BLZ A;  1K9M 4;  1W00 A;  1BGS A;  1CYU A;  3LTB A;  1UI8 A;  2IA7 A;  3NBB A;  3F7S A;  2GEY A;  4XM4 A;  1TRP A;  1Y4K A;  2W2C A;  1T2H A;  1ULI B;  2JDI H;  2XH9 A;  3FKA A;  1HYF A;  3G8Z A;  2MF7 A;  3I0Y A;  5BXQ A;  1Q7Y 4;  1N8R 4;  1AQZ A;  3CCL 3;  3AGN A;  2IYJ A;  1UUG B;  3PCS A;  1RKY A;  1OUN A;  3FG3 A;  5G2G A;  2HMK B;  1W2B 2;  1RSN A;  5D83 A;  1FUT A;  1IT7 A;  3HK4 A;  2CH9 A;  4OUQ A;  1O7M B;  1GOU A;  2XGN A;  2XFS A;  1WMP A;  2HMO B;  4N6V 0;  3EN1 B;  4X2O A;  2HML B;  1YVB I;  1SPU A;  2GU1 A;  4FCZ A;  3FG1 A;  2OWP A;  4WFO A;  5GSP A;  4AEQ A;  2LYX A;  2J8X B;  3K0Z A;  3CXC 2;  2F86 B;  1FGR A;  2FNQ A;  2RNT A;  1DVC A;  4HM5 B;  1W01 A;  2IUK A;  2YX9 A;  2OOV A;  1IVX A;  1NDO B;  2KAA A;  1GD3 A;  1V57 A;  3Q2P A;  2WO0 A;  1D6Z A;  4XDV A;  3MG3 A;  1CEW I;  3K5T A;  3GRD A;  1OGZ A;  5M19 A;  3RGA A;  2QGU A;  5KP3 A;  1JZD A;  1SII A;  2KF5 A;  1RLS A;  1QVF 2;  1TFO A;  1TIJ A;  2CFD A;  2W56 B;  3BIR A;  1S72 3;  4N3V A;  3MWZ A;  5TGN A;  3Q1C A;  1B2Z A;  7RNT A;  2UGI A;  5EQL A;  1JBS A;  2BMO B;  2P0X A;  3BB9 A;  2QA4 3;  2HMM B;  1O7P B;  2XRX B;  4L8P A;  1QJG A;  2CG0 A;  3OW2 2;  3EX9 A;  1LOV A;  2BIR A;  1JBT A;  2W6J H;  1QVG 2;  4HM6 B;  2BT3 A;  2JQ5 A;  2XEP A;  3WMD A;  5FGO A;  2QEX 3;  3K63 A;  1UW1 A;  3DM8 A;  2CWV A;  4FR9 A;  2P05 A;  3LOY A;  3CC2 3;  2FXT A;  1NWW A;  2UUG C;  4X2H A;  2M7O A;  1IU7 A;  1YGW A;  2Z76 A;  3KN4 A;  4NRE A;  5AEU B;  1WQL B;  1KD1 4;  4HYZ A;  1BNR A;  2C10 A;  3Q90 A;  3S27 A;  1GOY A;  5G1L A;  1BRN L;  1DET A;  1IV7 A;  1K41 A;  1MWT A;  4GHO A;  2CFK A;  4RNY A;  3SVA A;  4N6O B;  3KII A;  1LVN A;  4BTW A;  1W7C A;  4WYK B;  4CJN A;  1BSA A;  1FGO A;  1BRK A;  2PNC A;  1RRL A;  1S5A A;  4H3U A;  3IPT A;  1A2K A;  1JRQ A;  1X1U A;  4AKZ A;  3FGY A;  1Q82 4;  1JZO A;  1BU4 A;  4IPB A;  4K61 A;  4WWU C;  3T8U A;  1ASK A;  3B4P A;  4Q53 A;  3G4S 3;  1I2G A;  3HOH A;  1IVU A;  1MWU A;  2KCD A;  4LEH A;  5BU4 A;  3T8N A;  2KF3 A;  3EF8 A;  3B8L A;  3L0R A;  3NQY A;  3UL5 A;  5CK6 A;  3G71 3;  3F7X A;  1JKG A;  3OWU A;  4FMC A;  3RNT A;  2OTL 3;  3FG4 A;  1BRS A;  1RGF A;  3F8X A;  5IG4 A;  5ELJ A;  2GSP A;  2Z6B A;  1MWR A;  3EN8 A;  2C11 A;  3N9H A;  3OXA A;  4GL6 A;  1TUH A;  3CD6 3;  4HM4 B;  2CK3 H;  2CKF B;  3DGM A;  4K90 B;  3X3Y A;  3HIG A;  3JUP A;  3NV0 B;  3DGO A;  3VGN A;  2QIY A;  3LYG A;  5M1A A;  1TJD A;  1V58 A;  2IY2 A;  2ZDJ A;  3MPH A;  1TP6 A;  3G16 A;  1E3V A;  1IQX A;  4I4K A;  5CXO A;  1YNV X;  3X3X A;  1GSP A;  2SBL A;  1AVL A;  4N6U A;  2CX1 A;  3PZW A;  2O3O A;  1FUS A;  4G1M B;  1RGG A;  4N6T A;  4CCV A;  5D81 A;  1I3F A;  1B2M A;  1GS3 A;  3GZX B;  1BRG A;  1F8N A;  1DYU A;  2P0M A;  3EB8 A;  2CIU A;  5EEO A;  4NPB A;  4LMI A;  4IT7 A;  4FMD A;  1K8A 4;  4R80 A;  1EQK A;  1OGX A;  1V74 A;  1RTU A;  2L4V A;  1BNG A;  1BSD A;  3QK9 A;  3V98 A;  3NBJ A;  3CNX A;  3DGN A;  4ZM8 A;  2CX0 A;  2H0I A;  1T3B A;  3MHE A;  5LC6 A;  1IQ8 A;  2RFR A;  3LH4 A;  5AIH A;  1Q42 A;  1SQW A;  4R4K A;  1M1X B;  1RGC A;  1YIT 3;  1KQS 2;  1AR0 A;  4EXR A;  1JJ2 2;  1FUW A;  1LNH A;  4TX4 A;  2B24 B;  2OQE C;  4IIA A;  1FGM A;  3OWS A;  3CNM A;  3VSY A;  5IEN A;  3JVC A;  3DMC A;  1T2I A;  4NHF A;  2XSH B;  5EVH A;  3RDE A;  4HOH A;  1X1W A;  2HMJ B;  1Q81 4;  1N9E A;  3NXJ A;  1L5G B;  3CCV 3;  3FLJ A;  3X3Z A;  3WHO A;  4CPK A;  2WOF A;  2BNG A;  1RMS A;  2RBI A;  3A5E A;  1SIH A;  7GSP A;  6STD A;  3GSP A;  4HVN A;  2GU3 A;  2XGL A;  1VQL 3;  5STD A;  3UL6 A;  5AYR B;  1PU4 A;  1YJN 3;  2Z77 A;  2CFG A;  1MGW A;  4BTX A;  4OVM A;  5DRE A;  1BAO A;  1W2Z A;  4STD A;  1EEJ A;  2F5W A;  5BVB A;  3N54 B;  2B1X B;  1BAN A;  5JPP A;  3PCR A;  1YJW 3;  1JN5 B;  2E2V A;  5IF6 A;  1ISK A;  3PXM A;  1VQN 3;  5CF2 A;  1YVS A;  4HAA A;  3SYU A;  1RJO A;  1G02 A;  1SJW A;  1UUW B;  4FCJ A;  1LOY A;  2XR8 B;  8RNT A;  1A67 A;  1C54 A;  3EBT A;  2CWT A;  1Q9E A;  1ZO2 A;  2D1W A;  2INX A;  2KRT A;  4HM1 B;  1RN7 A;  1DE3 A;  1AY7 A;  3LML A;  1FW7 A;  4KFD A;  1BNE A;  1G96 A;  2F4Y A;  4PEJ A;  5AEW B;  1W6C A;  3EHC A;  4XBT A;  1JB2 A;  1YJ9 3;  1UCI A;  1I0V A;  2R4I A;  1U5O A;  4HM8 B;  4N6M A;  5G1K A;  1VQM 3;  4KZ1 A;  1BRI A;  1GY7 A;  3F40 A;  2RSX A;  3D4A A;  1B2S A;  4DKI A;  2K54 A;  3LZA A;  3O8Y A;  2PZV A;  3B7C A;  1OF5 B;  1A90 A;  4EC6 A;  2P38 A;  1U8C B;  3FF2 A;  1VZZ A;  1FA3 A;  5HGR A;  1VQ9 3;  1UGH I;  3MG2 A;  3LTA A;  4EW5 A;  5CF1 A;  1VQO 3;  3LT8 A;  3BND A;  2Q07 A;  1VQ4 3;  3OV4 A;  1AV4 A;  4KFF A;  3S29 A;  1DMM A;  3KSE D;  1D6U A;  3EQQ B;  5D82 A;  1B21 A;  4K1U A;  9RNT A;  2W56 A;  1MWS A;  3UJM A;  5AIG A; 
#chains in the Genus database with same CATH homology
 2KF4 A;  5HOH A;  1BOX A;  2KF6 A;  4J5G A;  1I2E A;  1BGS A;  3KCH A;  1I0X A;  1TRP A;  1T2H A;  1B20 A;  1HYF A;  4BU4 A;  1AQZ A;  1YNV X;  3AGN A;  1GSP A;  2F5M A;  1UCJ A;  3URP A;  1FUS A;  1RGG A;  1I70 A;  1I3F A;  1RSN A;  1B2M A;  1RCL A;  1FUT A;  1RDS A;  1RGH A;  1IYY A;  1TRQ A;  1BRG A;  1GOU A;  1LNI A;  2ZA4 A;  2AAD A;  1LRA A;  1RTU A;  5GSP A;  1BNG A;  1BSD A;  1CH0 A;  1RNB A;  1PYL A;  1RHL A;  2RNT A;  3WR2 A;  5RNT A;  1RGC A;  1X1Y A;  1BSE A;  2KAA A;  1BRH A;  1B2X A;  1BSB A;  1PY3 A;  1JBR A;  1RN1 A;  4RNT A;  1B2U A;  1I3I A;  1BVI A;  2KF5 A;  1RN4 A;  1RLS A;  1BIR A;  1T2I A;  2BU4 A;  1GOV A;  3BIR A;  4HOH A;  1X1W A;  2F56 A;  3WHO A;  1RNT A;  1B2Z A;  7RNT A;  1JBS A;  3A5E A;  1RMS A;  1BRJ A;  2RBI A;  7GSP A;  3GSP A;  3AHS A;  4J5K A;  1B3S A;  1JBT A;  1LOV A;  2BIR A;  1HZ1 A;  1MGW A;  3BU4 A;  1BSC A;  1I8V A;  1BAO A;  3DH2 A;  2F5W A;  2AAE A;  1BAN A;  1RCK A;  4BIR A;  3AGO A;  1BNF A;  1FYS A;  1YGW A;  2SAR A;  3DGY A;  3Q3F A;  1RGA A;  1BNR A;  1BNJ A;  1YVS A;  4HAA A;  3SYU A;  1G02 A;  1GOY A;  8RNT A;  1GMR A;  1DET A;  1I2F A;  1LOY A;  1BRN L;  1C54 A;  4GHO A;  1UCL A;  1Q9E A;  1DE3 A;  3AHW A;  1AY7 A;  6GSP A;  1FW7 A;  1BSA A;  1BNE A;  1BRK A;  2F4Y A;  1BUJ A;  1MGR A;  1UCI A;  1I0V A;  1FZU A;  1X1U A;  1RGL A;  1BRI A;  3D4A A;  1B2S A;  1BU4 A;  1A2P A;  1R4Y A;  1BNS A;  1B27 A;  1I2G A;  3HOH A;  1ZGX A;  3D5G A;  4GSP A;  2HOH A;  5BU4 A;  1SAR A;  2KF3 A;  6RNT A;  1GMP A;  3RNT A;  1RGE A;  1UCK A;  1BNI A;  1BRS A;  1RGF A;  2GSP A;  3D5I A;  1RGK A;  1TTO A;  1GMQ A;  1B21 A;  1LOW A;  5BIR A;  1X1X A;  9RNT A;  2C4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...