2MF7A

Solution structure of the ims domain of the mitochondrial import protein tim21 from s. cerevisiae
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
GAMGSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM2
publication title Molecular Basis of the Dynamic Structure of the TIM23 Complex in the Mitochondrial Intermembrane Space.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.320 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2mf7A00
2CIUA 2MF7A
chains in the Genus database with same CATH superfamily
1W02A 1GD4A 1B20A 1GMPA 5D83A 1J2BA 2HMJB 4JRFA 5DREA 3CPW2 1JKGA 1WTHA 2UUGC 3TDGA 1WMPA 4XDVA 1I0VA 5TGNA 1D6UA 1N8QA 3LYGA 3JUNA 1FGQA 4QWTA 5G1KA 3RDEA 2SBLA 1TJDA 2W56B 2HMNB 4N6UA 1YI23 3FGYA 2P0MA 1UUVB 4TX4A 4H61A 3WOFB 1M1K4 3LT8A 2IA7A 5D82A 3D9RA 1BOXA 2F98A 1WNHA 1X1YA 4RBNA 1MWSA 4KVHA 1UW1A 5IG0A 1FA3A 4STDA 1NB3I 1YIJ3 1VQ63 1BRHA 3JUOA 2LYXA 1JV2B 1RN1A 3BNCA 1OHPA 1MNLA 3UB1A 1BAOA 2JQ5A 5STDA 1NNVA 1W00A 2KF4A 4HAAA 1TFOA 4H3UA 2F86B 1AV4A 1DVDA 2FXTA 2F5MA 4BU4A 1Q7Y4 1NWWA 5AIFA 5AIGA 2PZVA 5I97A 3ZG5A 5ELJA 6STDA 3KN4A 2ML6A 4NHFA 1GD3A 3AGOA 2UX0A 1MWTA 3EB8A 3WODG 3SXXA 1FW7A 5BIRA 1QMAA 4KT3B 2ZHXB 4X2OA 8RNTA 1GOVA 3EBTA 5AIIA 1KWIA 1WQLB 4U13A 3S5CA 3G713 3CCV3 1BNJA 1NO3A 2CKFB 3N8BA 2MC8A 2YFIB 4LEHA 3H51A 4L8OA 1I8VA 3MPHA 1TTOA 2BMRB 3F8XA 3AHWA 4EW5A 3F7XA 3FCSB 1VQ73 1YGEA 3QK9A 1IU7A 1O7WB 3J7Yd 1VQ93 1EA2A 1PFPA 4X2HA 3G4S3 3EF8A 1SQWA 3EHCA 2CFGA 4LSOA 4WHAA 4J5GA 3JUMA 1QVG2 1JBRA 3CC43 4EBGA 1GY7A 2P05A 1HU9A 1JKGB 5CK6A 3HOHA 4BTXA 1WMNA 4HJLB 1YVSA 2HMKB 4MJDA 1OHOA 3V99A 3X40A 2H0IA 2ZDJA 2R41A 1FUTA 3NM7A 2W9QA 1BGSA 4BTYA 2KXGA 3EX9A 3IPTA 5CLKA 1IDPA 5A0OB 1YHQ3 1RNBA 1O7HB 3GWRA 3ZG0A 3UNLA 2AADA 4KZ1A 1KD14 1YVBI 3D79A 5JPUA 5IG5A 1UGIA 3DGLA 4HM2B 4KFDA 5IW9A 4LGQA 2F99A 2ZA4A 4NPBA 4XBYA 5AIHA 5M1AA 2YX9A 2XGNA 3ZFZA 4EYCA 2OTJ3 1JZDA 1STFI 3KIIA 4N6V0 1LRAA 3G8ZA 4HZ9B 1UDII 2F56A 2QGUA 2LQVA 1IVUA 4HKVB 1T2IA 1CH0A 3GZRA 4J5KA 1BU4A 4RNYA 6RNTA 3FF2A 1K41A 1OCVA 1VQ53 2L4VA 3RGRA 1RRHA 3NBRA 4K1VA 3DGMA 1EQKA 3NBBA 1FUSA 3M8CA 3VSYA 3BNBA 1IQ8A 3DGOA 2OOVA 1Q864 1DMMA 4HM6B 3X42A 5AI1A 1T3BA 5BXQA 1VQ43 2SARA 3SOYA 5BVBA 3MHEA 2BMOB 4N6TA 5HGRA 1W6YA 3NHXA 1RGFA 1E3RA 2XGLA 3D4AA 4HYZA 2KCDA 3FKAA 2KF5A 2CH9A 3F9SA 1US1A 3STDA 4AKYA 2XSOB 1VQM3 1G02A 5G2GA 2YFLB 3KSPA 4HM1B 2V1LA 1VZZA 1I2EA 1YJ93 3LTDA 1Q40A 3FG3A 1B2SA 2CWTA 3GZBA 5IERA 1Q814 4OVMA 2CX1A 2GBWB 3NM2A 4R4KA 5LC7A 3CC23 2XH9A 4KFEA 3VGNA 5IG3A 1KQS2 1FGTA 4HM8B 1JB5A 1BVIA 2OWPA 1C7HA 1K28A 1OUNA 1E97A 3BU4A 4MEIA 4N6NB 1O7GB 3CCS3 1M1XB 2BT3A 5DRVA 5EQLA 3CXC2 2WGQA 1MWUA 2MF7A 4ILFA 5IENA 3K63A 2B1XB 3RGAA 3LTBA 2WO0A 4OUQA 5M19A 1D6YA 1TFKA 2CC3A 4R9LA 1OGZA 3PCSA 3F14A 2CFLA 1RGEA 1RGLA 1LOVA 3HI7A 3EC9A 2GU3A 2E2UA 3UL5A 5KP4A 1X1UA 5RNTA 3HK4A 3DZLA 4EV5A 2W6JH 3CME3 3S67A 2RFRA 2Z6BA 1IQXA 1RRLA 2KF3A 4J9AA 3CCR3 3NQYA 1W6GA 1IVVA 4KFFA 4HZBB 2HMMB 1ULIB 4GL6A 3FG1A 1I0XA 4FMDA 1SARA 2Z76A 3T8UA 3BNDA 3MYTA 2CW9A 3QRDA 3CCU3 1R4YA 4HM3B 1O7NB 1UCKA 1Y4KA 1BUQA 3GRDA 3CNMA 1DETA 1F8NA 3WA3A 1I2GA 3EN8A 4MMYB 4RNZA 2RGQA 3B4OA 5KP1A 3CC73 3MSOA 4PEJA 1SIIA 3SYUA 1BSBA 5AEUB 3PGBA 1DMNA 2B24B 3NBJA 3FZWA 2IUKA 1IT7A 1AR0A 1Z1SA 2HMLB 3MWZA 1PYLA 1QAFA 1Q7HA 2A15A 5JPPA 1ZX2A 2Z7AA 2QEX3 3CU3A 3U1WA 3LOYA 1R4CA 1I3IA 3GAXA 1VQO3 4MMXB 1E3VA 9RNTA 4AEQA 1DMQA 2C11A 2GSPA 2O9UX 3X3XA 1BNFA 1V57A 3SOAA 1OH0A 3CCL3 1M904 1ASKA 1JNQA 3F8HA 2OQEA 1YJW3 1VQP3 1Q40B 1EEJA 1MGWA 1RHLA 2KRTA 4IIAA 4HM5B 4RZMA 1PU4A 3I563 1UI7A 5D81A 2K54A 2K3DA 2CG0A 3IMAB 5AEWB 4CJNA 3CCQ3 1W4NA 1QJGA 1RKYA 3DMCA 1U8CB 4N6MA 4EV2A 1I2FA 1I3FA 1RDSA 3ROBA 3JUQA 3WMDA 3S28A 3KCHA 3GZYB 2C4BA 2RBIA 4FR9A 2RNTA 1N8R4 1W6CA 1N9JA 2CHCA 4ZM8A 1RNTA 2Y74A 1BSEA 1IV9A 1FGOA 2INXA 2IYJA 1FUWA 1BSDA 1UCJA 1RLSA 1VQQA 2GU1A 2XEPA 4CDLA 4LMIA 1RGCA 1LOXA 2D42A 2WOHA 3EBYA 3NQZA 4FCMA 1GOUA 1W01A 4FMAA 1GMQA 2KAAA 1BRNL 1B21A 4R80A 3CD63 1ZO2A 1T5YA 1TIJA 1RMSA 2CFDA 1TP6A 1BRGA 3RNTA 2YFJB 2Y73A 3EE1A 3HX8A 3JVCA 3KSED 3PXMA 1CYUA 3OWSA 2I9WA 5CXOA 2F5WA 1L5GB 1GY6A 2XSHB 3URPA 4XB5A 2P09A 5AYRB 1BRIA 4WYKA 3OWYA 4FMBA 1OGXA 4LYLB 3E99A 4BIRA 1B2XA 4GB5A 4WFOA 3DGYA 3FF0A 3LMLA 3N54B 3CCJ3 4HM0B 2Q07A 1Q824 4RNTA 2CFKA 1A2PA 1IK3A 1LNIA 3OV4A 2QIYA 7RNTA 1ROVA 1JJ22 3EQQB 2H0HA 2O3OA 1BNEA 1RGGA 4N6OB 1UUGB 3NUVA 1W7CA 2GEXA 3BNEA 3F40A 1G96A 3K0ZA 2CWVA 1GS3A 4CCVA 1KC84 2GBXB 4O02B 4OK0A 4L7KA 1MGRA 3SLUA 1W2B2 4N6LA 4WWUC 4BL3A 1TU5A 1QVF2 1OF5A 1QALA 1GYBA 3FH1A 3GSPA 3LT9A 3B8LA 2CX0A 1GMRA 3F7SA 2XR8B 5ELUA 1GSPA 2XRXB 1BRJA 4LZIA 1NDOB 5AYSC 2AAEA 1A2KA 3DXOA 2K0MA 5IEOA 1NU3A 1B27A 1Q42A 1X1XA 2PNCA 3OWUA 4XBXA 3T0UA 1SJWA 2CIUA 3DGNA 4K1UA 4R9KA 2IUJA 4O2HA 3FLJA 1IVXA 3MG3A 2QA43 5KP3A 2XFSA 3NX0A 2WOFA 3D3LA 4BL2A 3OW22 4XM4A 5LC6A 2CFWA 2F4YA 2GXFA 3AMOA 3G6E3 1VQL3 3SEDA 3S29A 3PYJA 2Z77A 2W03A 4DKIA 7GSPA 4CPKA 2OOVC 1YGWA 3AHSA 5IEPA 1V58A 2XFTA 3CCM3 1WMOA 1RJOA 1JBTA 1JB2A 3NXJA 3VF1A 1LVNA 5CF1A 2HMOB 3KKGA 5GSPA 1ROAA 3WA2X 1HKXA 1JZOA 5G1LA 1GOYA 1EKMA 4WYKB 2R4IA 3GZXB 4XBTA 4FCZA 2E2TA 1RCLA 5BU4A 2BNGA 5IG4A 1EUIC 2W04A 3BIRA 1RGHA 4HOHA 2ZL8A 3K9MC 3HZPA 1JN5A 1S5AA 4GSPA 3OX9A 2KF6A 1JRQA 4FMCA 2P38A 1IV7A 1FGMA 3ALAA 3LTAA 1G0TA 3O8YA 3PS8A 3ECFA 2FNQA 4R1KA 3D5GA 3V92A 1OHSA 2RSXA 1K9M4 1STDA 1M9GA 1VQK3 3JUPA 1A90A 2CK3H 1YNVX 4I5QA 3KFQC 2HOHA 1X1WA 1SPUA 2M7OA 2WGOA 3LTCA 3B7CA 3CPOA 1NB5I 1RN7A 2BIRA 1U5OA 2XF3A 4ORLA 1BRKA 1CEWI 1V74A 3DY5A 3NV0A 1C54A 7STDA 4HVNA 3PZWA 1QAKA 3Q90A 4L8PA 4HM7B 1AQZA 4Q53A 2W2CA 3SVAA 1OF5B 1LOYA 3FSDA 3OXAA 4EXRA 3N9HA 4O3VA 1DYUA 2P0XA 3G16A 2J8XB 3L0RA 1MOLA 4XDWA 1ISKA 3SX1A 1K734 3V98A 3WHOA 1RGKA 1AVLA 1RN4A 3KZTA 3WR2A 5CF2A 3U97A 2BMQB 2ML5A 1D6ZA 1OPYA 1T2HA 1IQYA 3H3HA 1FGRA 2IY2A 2L1SA 4G1MB 1DVCA 3CMA3 3Q1CA 2CG1A 3K7CA 2JDIH 3MG1A 1IYYA 1ZS7A 1KSIA 3EJVA 1LQMB 3UL6A 5FGOA 1UCLA 2GEYA 1BNGA 3AGNA 3Q2PA 1OACA 3AMOB 2FGTA 4O8SA 1BNIA 5HOHA 3WOEB 1NJI4 4MMZB 1UGHI 2IMJA 1TRQA 1I70A 1LOWA 5IF6A 1AVKA 1BUJA 3X3YA 4IPBA 1B2UA 2C10A 3MG2A 1YIT3 1TRPA 2W0QA 3B4PA 5EVHA 2W56A 4GHOA 2W9PA 1UI8A 2D1WA 1LQGC 2UGIA 3FG4A 3LXUX 2E2VA 3HIIA 3S27A 4I4KA 1W2ZA 3KE7A 4EC6A 3IJEB 1IVWA 1FZUA 4HM4B 5JBSA 1RTUA 1BIRA 1AY7A 1JN5B 1CYVA 2OQEC 3BB9A 3CNXA 3D5IA 1K8A4 1BNRA 1BRSA 1VQN3 1BSAA 1N9EA 3UJMA 4N3VA 4JF8A 2OCTA 2OTL3 1BSCA 1CQSA 3X41A 1BNSA 3T8NA 6GSPA 1JBSA 3PCRA 2CWUA 1YJN3 3X3ZA 1TUHA 1A2VA 1S723 5FW5A 3I553 3K5TA 3NV0B 2RCDA 1ULJB 1LXEA 1N5PA 2STDA 3I0YA 3DM8A 1UCIA 4AKZA 1DE3A 1FYSA 1O7MB 1O7PB 1BANA 2BU4A 1N5HA 4J8TA 3A76A 1Q9EA 1SIHA 2BO9B 3G0KA 4HBRA 1VQ83 2BHMA 1IT8A 5EEOA 1B2MA 1RCKA 1A67A 1RGAA 1GY5A 1JB4A 3HIGA 3MKIA 4K61A 5M18A 3LH4A 1PY3A 4IT7A 3DUKA 3A5EA 1LNHA 3WDGB 4WP5A 1B2ZA 4NREA 1EG9B 1B3SA 1HZ1A 1MWRA 1RSNA 1UUWB 3LZAA 1HYFA 3EN1B 4K90B 3DH2A 4FCJA 2H0GA 3BLZA 3Q3FA 4BTWA 3CCE3 1ZGXA 3ER7A 8CHOA 1W5ZA
chains in the Genus database with same CATH topology
1W02A 1GD4A 5D83A 1J2BA 2HMJB 4JRFA 5DREA 3CPW2 1JKGA 1WTHA 3TDGA 1WMPA 4XDVA 5TGNA 1D6UA 1N8QA 3LYGA 3JUNA 1FGQA 4QWTA 3RDEA 2SBLA 2W56B 2HMNB 4N6UA 1YI23 3FGYA 2P0MA 1UUVB 4TX4A 4H61A 3WOFB 1M1K4 3LT8A 2IA7A 5D82A 3D9RA 2F98A 1WNHA 4RBNA 4KVHA 1FA3A 1UW1A 5IG0A 4STDA 1NB3I 1YIJ3 1VQ63 3JUOA 2LYXA 1JV2B 3BNCA 1OHPA 1MNLA 3UB1A 2JQ5A 5STDA 1W00A 1TFOA 4H3UA 2F86B 1AV4A 1DVDA 2FXTA 1Q7Y4 1NWWA 5AIFA 5AIGA 2PZVA 5I97A 5ELJA 6STDA 3KN4A 2ML6A 4NHFA 1GD3A 2UX0A 3EB8A 3WODG 3SXXA 1QMAA 4X2OA 5AIIA 3EBTA 3G713 1KWIA 1WQLB 4U13A 3S5CA 3CCV3 1NO3A 2CKFB 3N8BA 2MC8A 2YFIB 4LEHA 3H51A 4L8OA 3MPHA 2BMRB 3F8XA 3F7XA 3FCSB 1VQ73 1YGEA 3QK9A 1IU7A 1O7WB 3J7Yd 1VQ93 1EA2A 1PFPA 4X2HA 3G4S3 3EF8A 1SQWA 3EHCA 2CFGA 4LSOA 4WHAA 3JUMA 1QVG2 3CC43 4EBGA 1GY7A 2P05A 1HU9A 1JKGB 5CK6A 4BTXA 1WMNA 4HJLB 2HMKB 4MJDA 1OHOA 3V99A 3X40A 2ZDJA 3NM7A 2W9QA 4BTYA 2KXGA 3EX9A 3IPTA 5CLKA 1IDPA 5A0OB 1YHQ3 1O7HB 3GWRA 3UNLA 4KZ1A 1KD14 1YVBI 5JPUA 5IG5A 3DGLA 4HM2B 4KFDA 5IW9A 4LGQA 2F99A 4XBYA 5AIHA 2YX9A 2XGNA 4EYCA 2OTJ3 1STFI 3KIIA 4N6V0 3G8ZA 4HZ9B 2QGUA 4HKVB 2LQVA 1IVUA 3GZRA 4RNYA 3FF2A 1K41A 1OCVA 1VQ53 2L4VA 3RGRA 1RRHA 3NBRA 4K1VA 3DGMA 1EQKA 3NBBA 3M8CA 3VSYA 3BNBA 1IQ8A 3DGOA 2OOVA 1Q864 1DMMA 4HM6B 3X42A 5AI1A 5BXQA 1VQ43 3SOYA 5BVBA 3MHEA 2BMOB 4N6TA 5HGRA 1W6YA 3NHXA 1E3RA 2XGLA 4HYZA 2KCDA 3FKAA 2CH9A 3F9SA 1US1A 3STDA 4AKYA 2XSOB 1VQM3 5G2GA 2YFLB 3KSPA 4HM1B 2V1LA 1VZZA 1YJ93 3LTDA 1Q40A 3FG3A 2CWTA 3GZBA 5IERA 1Q814 4OVMA 4R4KA 2GBWB 3NM2A 5LC7A 3CC23 1KQS2 2XH9A 4KFEA 3VGNA 5IG3A 1FGTA 4HM8B 1JB5A 2OWPA 4N6NB 1C7HA 1K28A 1OUNA 1E97A 4MEIA 3CCS3 1O7GB 1M1XB 2BT3A 5DRVA 5EQLA 3CXC2 2WGQA 2MF7A 5IENA 3K63A 2B1XB 3RGAA 3LTBA 2WO0A 4OUQA 1D6YA 1TFKA 2CC3A 4R9LA 1OGZA 3PCSA 3F14A 2CFLA 3HI7A 3EC9A 2GU3A 2E2UA 3UL5A 5KP4A 3HK4A 3DZLA 4EV5A 2W6JH 3CME3 3S67A 2RFRA 2Z6BA 1IQXA 1RRLA 4J9AA 3CCR3 3NQYA 1W6GA 1IVVA 4HZBB 2HMMB 1ULIB 4GL6A 3FG1A 3T8UA 4FMDA 2Z76A 3BNDA 3MYTA 2CW9A 3QRDA 3CCU3 4HM3B 1O7NB 1Y4KA 1BUQA 3GRDA 3CNMA 3WA3A 1F8NA 3EN8A 4RNZA 4MMYB 5KP1A 2RGQA 3B4OA 3CC73 3MSOA 4PEJA 1SIIA 5AEUB 3PGBA 1DMNA 2B24B 3NBJA 3FZWA 2IUKA 1IT7A 1AR0A 1Z1SA 2HMLB 3MWZA 1QAFA 2A15A 5JPPA 1ZX2A 2Z7AA 2QEX3 3CU3A 3U1WA 3LOYA 1R4CA 3GAXA 1VQO3 4MMXB 1E3VA 4AEQA 1DMQA 2C11A 2O9UX 3X3XA 3SOAA 1OH0A 3CCL3 1M904 1ASKA 1JNQA 3F8HA 2OQEA 1YJW3 1VQP3 1Q40B 2KRTA 4IIAA 4RZMA 4HM5B 1PU4A 3I563 1UI7A 5D81A 2K54A 3IMAB 2CG0A 5AEWB 3CCQ3 1W4NA 1QJGA 1RKYA 3DMCA 1U8CB 4N6MA 4EV2A 3ROBA 3JUQA 3WMDA 3S28A 3GZYB 4FR9A 1N8R4 1W6CA 1N9JA 2CHCA 4ZM8A 2Y74A 1IV9A 1FGOA 2INXA 1FUWA 2XEPA 2GU1A 4CDLA 4LMIA 2D42A 1LOXA 3EBYA 2WOHA 3NQZA 4FCMA 4FMAA 3CD63 1W01A 4R80A 1ZO2A 1T5YA 1TIJA 2CFDA 1TP6A 2YFJB 2Y73A 3EE1A 3HX8A 3JVCA 3KSED 3PXMA 1CYUA 3OWSA 2I9WA 5CXOA 1L5GB 1GY6A 2XSHB 4XB5A 2P09A 5AYRB 4WYKA 3OWYA 4FMBA 1OGXA 3E99A 4GB5A 4WFOA 3FF0A 3LMLA 3N54B 3CCJ3 4HM0B 2Q07A 1Q824 2CFKA 1IK3A 3OV4A 2QIYA 1ROVA 1JJ22 3EQQB 2O3OA 4N6OB 3NUVA 1W7CA 2GEXA 3BNEA 3F40A 1G96A 3K0ZA 2CWVA 1GS3A 4CCVA 1KC84 2GBXB 4O02B 4OK0A 4L7KA 3SLUA 1W2B2 4N6LA 4WWUC 1TU5A 1QVF2 1OF5A 1QALA 1GYBA 3FH1A 3LT9A 3B8LA 3F7SA 2XR8B 5ELUA 2XRXB 4LZIA 1NDOB 5AYSC 5IEOA 1A2KA 3DXOA 2K0MA 3T0UA 1NU3A 1Q42A 2PNCA 3OWUA 4XBXA 1SJWA 2CIUA 3DGNA 4K1UA 4R9KA 2IUJA 4O2HA 3FLJA 1IVXA 3MG3A 2QA43 5KP3A 2XFSA 3NX0A 2WOFA 3D3LA 3OW22 4XM4A 5LC6A 2CFWA 3AMOA 2GXFA 3G6E3 1VQL3 3SEDA 3S29A 3PYJA 2Z77A 2W03A 2OOVC 5IEPA 2XFTA 3CCM3 1WMOA 1RJOA 1JB2A 3NXJA 3VF1A 1LVNA 5CF1A 2HMOB 3KKGA 1ROAA 3WA2X 1HKXA 4WYKB 1EKMA 2R4IA 3GZXB 4XBTA 4FCZA 2E2TA 2BNGA 5IG4A 2W04A 2ZL8A 3K9MC 3HZPA 1JN5A 1S5AA 3OX9A 1JRQA 4FMCA 2P38A 1IV7A 3ALAA 1FGMA 3LTAA 3O8YA 3PS8A 3ECFA 2FNQA 4R1KA 1K9M4 3V92A 1OHSA 2RSXA 1A90A 1STDA 1M9GA 1VQK3 3JUPA 2CK3H 3KFQC 2M7OA 1SPUA 2WGOA 3LTCA 1NB5I 3B7CA 3CPOA 1RN7A 1U5OA 2XF3A 4ORLA 1CEWI 1V74A 3DY5A 3NV0A 7STDA 4HVNA 3PZWA 1QAKA 3Q90A 4L8PA 4HM7B 4Q53A 2W2CA 3SVAA 1OF5B 3FSDA 4EXRA 3OXAA 3N9HA 4O3VA 1DYUA 2P0XA 3G16A 3L0RA 1MOLA 4XDWA 1ISKA 3SX1A 1K734 3V98A 3KZTA 1AVLA 5CF2A 3U97A 2BMQB 2ML5A 1D6ZA 1OPYA 3H3HA 1IQYA 4G1MB 1FGRA 4KFFA 1DVCA 3CMA3 3Q1CA 2CG1A 3K7CA 2JDIH 3MG1A 1KSIA 3EJVA 3UL6A 5FGOA 2GEYA 3Q2PA 1OACA 3AMOB 2FGTA 4O8SA 1NJI4 3WOEB 4MMZB 2IMJA 5IF6A 1AVKA 3X3YA 4IPBA 2C10A 3MG2A 1YIT3 2W0QA 3B4PA 5EVHA 2W56A 2W9PA 1UI8A 2D1WA 3FG4A 3LXUX 2E2VA 3HIIA 3S27A 4I4KA 1W2ZA 3KE7A 4EC6A 3IJEB 1IVWA 5JBSA 4HM4B 1JN5B 1CYVA 2OQEC 3BB9A 3CNXA 1K8A4 1VQN3 1N9EA 3UJMA 4N3VA 4JF8A 2OCTA 2OTL3 1CQSA 3X41A 3T8NA 3PCRA 2CWUA 1YJN3 3X3ZA 1TUHA 1A2VA 1S723 5FW5A 3I553 3K5TA 3NV0B 2RCDA 1ULJB 1LXEA 1N5PA 2STDA 3I0YA 3DM8A 4AKZA 1O7MB 1O7PB 4J8TA 1N5HA 3A76A 1SIHA 2BO9B 3G0KA 4HBRA 1VQ83 2BHMA 1IT8A 5EEOA 1A67A 1GY5A 1JB4A 3HIGA 3MKIA 4K61A 3LH4A 4IT7A 3DUKA 1LNHA 3WDGB 4WP5A 4NREA 1EG9B 1UUWB 3LZAA 3EN1B 4K90B 4FCJA 3BLZA 3CCE3 4BTWA 3ER7A 8CHOA 1W5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CIU A;  2MF7 A; 
#chains in the Genus database with same CATH topology
 1W02 A;  1GD4 A;  1B20 A;  1GMP A;  5D83 A;  1J2B A;  2HMJ B;  4JRF A;  5DRE A;  3CPW 2;  1JKG A;  1WTH A;  2UUG C;  3TDG A;  1WMP A;  4XDV A;  1I0V A;  5TGN A;  1D6U A;  1N8Q A;  3LYG A;  3JUN A;  1FGQ A;  4QWT A;  5G1K A;  3RDE A;  2SBL A;  1TJD A;  2W56 B;  2HMN B;  4N6U A;  1YI2 3;  3FGY A;  2P0M A;  1UUV B;  4TX4 A;  4H61 A;  3WOF B;  1M1K 4;  3LT8 A;  2IA7 A;  5D82 A;  3D9R A;  1BOX A;  2F98 A;  1WNH A;  1X1Y A;  4RBN A;  1MWS A;  4KVH A;  1UW1 A;  5IG0 A;  1FA3 A;  4STD A;  1NB3 I;  1YIJ 3;  1VQ6 3;  1BRH A;  3JUO A;  2LYX A;  1JV2 B;  1RN1 A;  3BNC A;  1OHP A;  1MNL A;  3UB1 A;  1BAO A;  2JQ5 A;  5STD A;  1NNV A;  1W00 A;  2KF4 A;  4HAA A;  1TFO A;  4H3U A;  2F86 B;  1AV4 A;  1DVD A;  2FXT A;  2F5M A;  4BU4 A;  1Q7Y 4;  1NWW A;  5AIF A;  5AIG A;  2PZV A;  5I97 A;  3ZG5 A;  5ELJ A;  6STD A;  3KN4 A;  2ML6 A;  4NHF A;  1GD3 A;  3AGO A;  2UX0 A;  1MWT A;  3EB8 A;  3WOD G;  3SXX A;  1FW7 A;  5BIR A;  1QMA A;  4KT3 B;  2ZHX B;  4X2O A;  8RNT A;  1GOV A;  3EBT A;  5AII A;  1KWI A;  1WQL B;  4U13 A;  3S5C A;  3G71 3;  3CCV 3;  1BNJ A;  1NO3 A;  2CKF B;  3N8B A;  2MC8 A;  2YFI B;  4LEH A;  3H51 A;  4L8O A;  1I8V A;  3MPH A;  1TTO A;  2BMR B;  3F8X A;  3AHW A;  4EW5 A;  3F7X A;  3FCS B;  1VQ7 3;  1YGE A;  3QK9 A;  1IU7 A;  1O7W B;  3J7Y d;  1VQ9 3;  1EA2 A;  1PFP A;  4X2H A;  3G4S 3;  3EF8 A;  1SQW A;  3EHC A;  2CFG A;  4LSO A;  4WHA A;  4J5G A;  3JUM A;  1QVG 2;  1JBR A;  3CC4 3;  4EBG A;  1GY7 A;  2P05 A;  1HU9 A;  1JKG B;  5CK6 A;  3HOH A;  4BTX A;  1WMN A;  4HJL B;  1YVS A;  2HMK B;  4MJD A;  1OHO A;  3V99 A;  3X40 A;  2H0I A;  2ZDJ A;  2R41 A;  1FUT A;  3NM7 A;  2W9Q A;  1BGS A;  4BTY A;  2KXG A;  3EX9 A;  3IPT A;  5CLK A;  1IDP A;  5A0O B;  1YHQ 3;  1RNB A;  1O7H B;  3GWR A;  3ZG0 A;  3UNL A;  2AAD A;  4KZ1 A;  1KD1 4;  1YVB I;  3D79 A;  5JPU A;  5IG5 A;  1UGI A;  3DGL A;  4HM2 B;  4KFD A;  5IW9 A;  4LGQ A;  2F99 A;  2ZA4 A;  4NPB A;  4XBY A;  5AIH A;  5M1A A;  2YX9 A;  2XGN A;  3ZFZ A;  4EYC A;  2OTJ 3;  1JZD A;  1STF I;  3KII A;  4N6V 0;  1LRA A;  3G8Z A;  4HZ9 B;  1UDI I;  2F56 A;  2QGU A;  2LQV A;  1IVU A;  4HKV B;  1T2I A;  1CH0 A;  3GZR A;  4J5K A;  1BU4 A;  4RNY A;  6RNT A;  3FF2 A;  1K41 A;  1OCV A;  1VQ5 3;  2L4V A;  3RGR A;  1RRH A;  3NBR A;  4K1V A;  3DGM A;  1EQK A;  3NBB A;  1FUS A;  3M8C A;  3VSY A;  3BNB A;  1IQ8 A;  3DGO A;  2OOV A;  1Q86 4;  1DMM A;  4HM6 B;  3X42 A;  5AI1 A;  1T3B A;  5BXQ A;  1VQ4 3;  2SAR A;  3SOY A;  5BVB A;  3MHE A;  2BMO B;  4N6T A;  5HGR A;  1W6Y A;  3NHX A;  1RGF A;  1E3R A;  2XGL A;  3D4A A;  4HYZ A;  2KCD A;  3FKA A;  2KF5 A;  2CH9 A;  3F9S A;  1US1 A;  3STD A;  4AKY A;  2XSO B;  1VQM 3;  1G02 A;  5G2G A;  2YFL B;  3KSP A;  4HM1 B;  2V1L A;  1VZZ A;  1I2E A;  1YJ9 3;  3LTD A;  1Q40 A;  3FG3 A;  1B2S A;  2CWT A;  3GZB A;  5IER A;  1Q81 4;  4OVM A;  2CX1 A;  2GBW B;  3NM2 A;  4R4K A;  5LC7 A;  3CC2 3;  2XH9 A;  4KFE A;  3VGN A;  5IG3 A;  1KQS 2;  1FGT A;  4HM8 B;  1JB5 A;  1BVI A;  2OWP A;  1C7H A;  1K28 A;  1OUN A;  1E97 A;  3BU4 A;  4MEI A;  4N6N B;  1O7G B;  3CCS 3;  1M1X B;  2BT3 A;  5DRV A;  5EQL A;  3CXC 2;  2WGQ A;  1MWU A;  2MF7 A;  4ILF A;  5IEN A;  3K63 A;  2B1X B;  3RGA A;  3LTB A;  2WO0 A;  4OUQ A;  5M19 A;  1D6Y A;  1TFK A;  2CC3 A;  4R9L A;  1OGZ A;  3PCS A;  3F14 A;  2CFL A;  1RGE A;  1RGL A;  1LOV A;  3HI7 A;  3EC9 A;  2GU3 A;  2E2U A;  3UL5 A;  5KP4 A;  1X1U A;  5RNT A;  3HK4 A;  3DZL A;  4EV5 A;  2W6J H;  3CME 3;  3S67 A;  2RFR A;  2Z6B A;  1IQX A;  1RRL A;  2KF3 A;  4J9A A;  3CCR 3;  3NQY A;  1W6G A;  1IVV A;  4KFF A;  4HZB B;  2HMM B;  1ULI B;  4GL6 A;  3FG1 A;  1I0X A;  4FMD A;  1SAR A;  2Z76 A;  3T8U A;  3BND A;  3MYT A;  2CW9 A;  3QRD A;  3CCU 3;  1R4Y A;  4HM3 B;  1O7N B;  1UCK A;  1Y4K A;  1BUQ A;  3GRD A;  3CNM A;  1DET A;  1F8N A;  3WA3 A;  1I2G A;  3EN8 A;  4MMY B;  4RNZ A;  2RGQ A;  3B4O A;  5KP1 A;  3CC7 3;  3MSO A;  4PEJ A;  1SII A;  3SYU A;  1BSB A;  5AEU B;  3PGB A;  1DMN A;  2B24 B;  3NBJ A;  3FZW A;  2IUK A;  1IT7 A;  1AR0 A;  1Z1S A;  2HML B;  3MWZ A;  1PYL A;  1QAF A;  1Q7H A;  2A15 A;  5JPP A;  1ZX2 A;  2Z7A A;  2QEX 3;  3CU3 A;  3U1W A;  3LOY A;  1R4C A;  1I3I A;  3GAX A;  1VQO 3;  4MMX B;  1E3V A;  9RNT A;  4AEQ A;  1DMQ A;  2C11 A;  2GSP A;  2O9U X;  3X3X A;  1BNF A;  1V57 A;  3SOA A;  1OH0 A;  3CCL 3;  1M90 4;  1ASK A;  1JNQ A;  3F8H A;  2OQE A;  1YJW 3;  1VQP 3;  1Q40 B;  1EEJ A;  1MGW A;  1RHL A;  2KRT A;  4IIA A;  4HM5 B;  4RZM A;  1PU4 A;  3I56 3;  1UI7 A;  5D81 A;  2K54 A;  2K3D A;  2CG0 A;  3IMA B;  5AEW B;  4CJN A;  3CCQ 3;  1W4N A;  1QJG A;  1RKY A;  3DMC A;  1U8C B;  4N6M A;  4EV2 A;  1I2F A;  1I3F A;  1RDS A;  3ROB A;  3JUQ A;  3WMD A;  3S28 A;  3KCH A;  3GZY B;  2C4B A;  2RBI A;  4FR9 A;  2RNT A;  1N8R 4;  1W6C A;  1N9J A;  2CHC A;  4ZM8 A;  1RNT A;  2Y74 A;  1BSE A;  1IV9 A;  1FGO A;  2INX A;  2IYJ A;  1FUW A;  1BSD A;  1UCJ A;  1RLS A;  1VQQ A;  2GU1 A;  2XEP A;  4CDL A;  4LMI A;  1RGC A;  1LOX A;  2D42 A;  2WOH A;  3EBY A;  3NQZ A;  4FCM A;  1GOU A;  1W01 A;  4FMA A;  1GMQ A;  2KAA A;  1BRN L;  1B21 A;  4R80 A;  3CD6 3;  1ZO2 A;  1T5Y A;  1TIJ A;  1RMS A;  2CFD A;  1TP6 A;  1BRG A;  3RNT A;  2YFJ B;  2Y73 A;  3EE1 A;  3HX8 A;  3JVC A;  3KSE D;  3PXM A;  1CYU A;  3OWS A;  2I9W A;  5CXO A;  2F5W A;  1L5G B;  1GY6 A;  2XSH B;  3URP A;  4XB5 A;  2P09 A;  5AYR B;  1BRI A;  4WYK A;  3OWY A;  4FMB A;  1OGX A;  4LYL B;  3E99 A;  4BIR A;  1B2X A;  4GB5 A;  4WFO A;  3DGY A;  3FF0 A;  3LML A;  3N54 B;  3CCJ 3;  4HM0 B;  2Q07 A;  1Q82 4;  4RNT A;  2CFK A;  1A2P A;  1IK3 A;  1LNI A;  3OV4 A;  2QIY A;  7RNT A;  1ROV A;  1JJ2 2;  3EQQ B;  2H0H A;  2O3O A;  1BNE A;  1RGG A;  4N6O B;  1UUG B;  3NUV A;  1W7C A;  2GEX A;  3BNE A;  3F40 A;  1G96 A;  3K0Z A;  2CWV A;  1GS3 A;  4CCV A;  1KC8 4;  2GBX B;  4O02 B;  4OK0 A;  4L7K A;  1MGR A;  3SLU A;  1W2B 2;  4N6L A;  4WWU C;  4BL3 A;  1TU5 A;  1QVF 2;  1OF5 A;  1QAL A;  1GYB A;  3FH1 A;  3GSP A;  3LT9 A;  3B8L A;  2CX0 A;  1GMR A;  3F7S A;  2XR8 B;  5ELU A;  1GSP A;  2XRX B;  1BRJ A;  4LZI A;  1NDO B;  5AYS C;  2AAE A;  1A2K A;  3DXO A;  2K0M A;  5IEO A;  1NU3 A;  1B27 A;  1Q42 A;  1X1X A;  2PNC A;  3OWU A;  4XBX A;  3T0U A;  1SJW A;  2CIU A;  3DGN A;  4K1U A;  4R9K A;  2IUJ A;  4O2H A;  3FLJ A;  1IVX A;  3MG3 A;  2QA4 3;  5KP3 A;  2XFS A;  3NX0 A;  2WOF A;  3D3L A;  4BL2 A;  3OW2 2;  4XM4 A;  5LC6 A;  2CFW A;  2F4Y A;  2GXF A;  3AMO A;  3G6E 3;  1VQL 3;  3SED A;  3S29 A;  3PYJ A;  2Z77 A;  2W03 A;  4DKI A;  7GSP A;  4CPK A;  2OOV C;  1YGW A;  3AHS A;  5IEP A;  1V58 A;  2XFT A;  3CCM 3;  1WMO A;  1RJO A;  1JBT A;  1JB2 A;  3NXJ A;  3VF1 A;  1LVN A;  5CF1 A;  2HMO B;  3KKG A;  5GSP A;  1ROA A;  3WA2 X;  1HKX A;  1JZO A;  5G1L A;  1GOY A;  1EKM A;  4WYK B;  2R4I A;  3GZX B;  4XBT A;  4FCZ A;  2E2T A;  1RCL A;  5BU4 A;  2BNG A;  5IG4 A;  1EUI C;  2W04 A;  3BIR A;  1RGH A;  4HOH A;  2ZL8 A;  3K9M C;  3HZP A;  1JN5 A;  1S5A A;  4GSP A;  3OX9 A;  2KF6 A;  1JRQ A;  4FMC A;  2P38 A;  1IV7 A;  1FGM A;  3ALA A;  3LTA A;  1G0T A;  3O8Y A;  3PS8 A;  3ECF A;  2FNQ A;  4R1K A;  3D5G A;  3V92 A;  1OHS A;  2RSX A;  1K9M 4;  1STD A;  1M9G A;  1VQK 3;  3JUP A;  1A90 A;  2CK3 H;  1YNV X;  4I5Q A;  3KFQ C;  2HOH A;  1X1W A;  1SPU A;  2M7O A;  2WGO A;  3LTC A;  3B7C A;  3CPO A;  1NB5 I;  1RN7 A;  2BIR A;  1U5O A;  2XF3 A;  4ORL A;  1BRK A;  1CEW I;  1V74 A;  3DY5 A;  3NV0 A;  1C54 A;  7STD A;  4HVN A;  3PZW A;  1QAK A;  3Q90 A;  4L8P A;  4HM7 B;  1AQZ A;  4Q53 A;  2W2C A;  3SVA A;  1OF5 B;  1LOY A;  3FSD A;  3OXA A;  4EXR A;  3N9H A;  4O3V A;  1DYU A;  2P0X A;  3G16 A;  2J8X B;  3L0R A;  1MOL A;  4XDW A;  1ISK A;  3SX1 A;  1K73 4;  3V98 A;  3WHO A;  1RGK A;  1AVL A;  1RN4 A;  3KZT A;  3WR2 A;  5CF2 A;  3U97 A;  2BMQ B;  2ML5 A;  1D6Z A;  1OPY A;  1T2H A;  1IQY A;  3H3H A;  1FGR A;  2IY2 A;  2L1S A;  4G1M B;  1DVC A;  3CMA 3;  3Q1C A;  2CG1 A;  3K7C A;  2JDI H;  3MG1 A;  1IYY A;  1ZS7 A;  1KSI A;  3EJV A;  1LQM B;  3UL6 A;  5FGO A;  1UCL A;  2GEY A;  1BNG A;  3AGN A;  3Q2P A;  1OAC A;  3AMO B;  2FGT A;  4O8S A;  1BNI A;  5HOH A;  3WOE B;  1NJI 4;  4MMZ B;  1UGH I;  2IMJ A;  1TRQ A;  1I70 A;  1LOW A;  5IF6 A;  1AVK A;  1BUJ A;  3X3Y A;  4IPB A;  1B2U A;  2C10 A;  3MG2 A;  1YIT 3;  1TRP A;  2W0Q A;  3B4P A;  5EVH A;  2W56 A;  4GHO A;  2W9P A;  1UI8 A;  2D1W A;  1LQG C;  2UGI A;  3FG4 A;  3LXU X;  2E2V A;  3HII A;  3S27 A;  4I4K A;  1W2Z A;  3KE7 A;  4EC6 A;  3IJE B;  1IVW A;  1FZU A;  4HM4 B;  5JBS A;  1RTU A;  1BIR A;  1AY7 A;  1JN5 B;  1CYV A;  2OQE C;  3BB9 A;  3CNX A;  3D5I A;  1K8A 4;  1BNR A;  1BRS A;  1VQN 3;  1BSA A;  1N9E A;  3UJM A;  4N3V A;  4JF8 A;  2OCT A;  2OTL 3;  1BSC A;  1CQS A;  3X41 A;  1BNS A;  3T8N A;  6GSP A;  1JBS A;  3PCR A;  2CWU A;  1YJN 3;  3X3Z A;  1TUH A;  1A2V A;  1S72 3;  5FW5 A;  3I55 3;  3K5T A;  3NV0 B;  2RCD A;  1ULJ B;  1LXE A;  1N5P A;  2STD A;  3I0Y A;  3DM8 A;  1UCI A;  4AKZ A;  1DE3 A;  1FYS A;  1O7M B;  1O7P B;  1BAN A;  2BU4 A;  1N5H A;  4J8T A;  3A76 A;  1Q9E A;  1SIH A;  2BO9 B;  3G0K A;  4HBR A;  1VQ8 3;  2BHM A;  1IT8 A;  5EEO A;  1B2M A;  1RCK A;  1A67 A;  1RGA A;  1GY5 A;  1JB4 A;  3HIG A;  3MKI A;  4K61 A;  5M18 A;  3LH4 A;  1PY3 A;  4IT7 A;  3DUK A;  3A5E A;  1LNH A;  3WDG B;  4WP5 A;  1B2Z A;  4NRE A;  1EG9 B;  1B3S A;  1HZ1 A;  1MWR A;  1RSN A;  1UUW B;  3LZA A;  1HYF A;  3EN1 B;  4K90 B;  3DH2 A;  4FCJ A;  2H0G A;  3BLZ A;  3Q3F A;  4BTW A;  3CCE 3;  1ZGX A;  3ER7 A;  8CHO A;  1W5Z A; 
#chains in the Genus database with same CATH homology
 1W02 A;  1GD4 A;  5D83 A;  1J2B A;  2HMJ B;  4JRF A;  5DRE A;  3CPW 2;  1JKG A;  1WTH A;  3TDG A;  1WMP A;  4XDV A;  5TGN A;  1D6U A;  1N8Q A;  3LYG A;  3JUN A;  1FGQ A;  4QWT A;  3RDE A;  2SBL A;  2W56 B;  2HMN B;  4N6U A;  1YI2 3;  3FGY A;  2P0M A;  1UUV B;  4TX4 A;  4H61 A;  3WOF B;  1M1K 4;  3LT8 A;  2IA7 A;  5D82 A;  3D9R A;  2F98 A;  1WNH A;  4RBN A;  4KVH A;  1FA3 A;  1UW1 A;  5IG0 A;  4STD A;  1NB3 I;  1YIJ 3;  1VQ6 3;  3JUO A;  2LYX A;  1JV2 B;  3BNC A;  1OHP A;  1MNL A;  3UB1 A;  2JQ5 A;  5STD A;  1W00 A;  1TFO A;  4H3U A;  2F86 B;  1AV4 A;  1DVD A;  2FXT A;  1Q7Y 4;  1NWW A;  5AIF A;  5AIG A;  2PZV A;  5I97 A;  5ELJ A;  6STD A;  3KN4 A;  2ML6 A;  4NHF A;  1GD3 A;  2UX0 A;  3EB8 A;  3WOD G;  3SXX A;  1QMA A;  4X2O A;  5AII A;  3EBT A;  3G71 3;  1KWI A;  1WQL B;  4U13 A;  3S5C A;  3CCV 3;  1NO3 A;  2CKF B;  3N8B A;  2MC8 A;  2YFI B;  4LEH A;  3H51 A;  4L8O A;  3MPH A;  2BMR B;  3F8X A;  3F7X A;  3FCS B;  1VQ7 3;  1YGE A;  3QK9 A;  1IU7 A;  1O7W B;  3J7Y d;  1VQ9 3;  1EA2 A;  1PFP A;  4X2H A;  3G4S 3;  3EF8 A;  1SQW A;  3EHC A;  2CFG A;  4LSO A;  4WHA A;  3JUM A;  1QVG 2;  3CC4 3;  4EBG A;  1GY7 A;  2P05 A;  1HU9 A;  1JKG B;  5CK6 A;  4BTX A;  1WMN A;  4HJL B;  2HMK B;  4MJD A;  1OHO A;  3V99 A;  3X40 A;  2ZDJ A;  3NM7 A;  2W9Q A;  4BTY A;  2KXG A;  3EX9 A;  3IPT A;  5CLK A;  1IDP A;  5A0O B;  1YHQ 3;  1O7H B;  3GWR A;  3UNL A;  4KZ1 A;  1KD1 4;  1YVB I;  5JPU A;  5IG5 A;  3DGL A;  4HM2 B;  4KFD A;  5IW9 A;  4LGQ A;  2F99 A;  4XBY A;  5AIH A;  2YX9 A;  2XGN A;  4EYC A;  2OTJ 3;  1STF I;  3KII A;  4N6V 0;  3G8Z A;  4HZ9 B;  2QGU A;  4HKV B;  2LQV A;  1IVU A;  3GZR A;  4RNY A;  3FF2 A;  1K41 A;  1OCV A;  1VQ5 3;  2L4V A;  3RGR A;  1RRH A;  3NBR A;  4K1V A;  3DGM A;  1EQK A;  3NBB A;  3M8C A;  3VSY A;  3BNB A;  1IQ8 A;  3DGO A;  2OOV A;  1Q86 4;  1DMM A;  4HM6 B;  3X42 A;  5AI1 A;  5BXQ A;  1VQ4 3;  3SOY A;  5BVB A;  3MHE A;  2BMO B;  4N6T A;  5HGR A;  1W6Y A;  3NHX A;  1E3R A;  2XGL A;  4HYZ A;  2KCD A;  3FKA A;  2CH9 A;  3F9S A;  1US1 A;  3STD A;  4AKY A;  2XSO B;  1VQM 3;  5G2G A;  2YFL B;  3KSP A;  4HM1 B;  2V1L A;  1VZZ A;  1YJ9 3;  3LTD A;  1Q40 A;  3FG3 A;  2CWT A;  3GZB A;  5IER A;  1Q81 4;  4OVM A;  4R4K A;  2GBW B;  3NM2 A;  5LC7 A;  3CC2 3;  1KQS 2;  2XH9 A;  4KFE A;  3VGN A;  5IG3 A;  1FGT A;  4HM8 B;  1JB5 A;  2OWP A;  4N6N B;  1C7H A;  1K28 A;  1OUN A;  1E97 A;  4MEI A;  3CCS 3;  1O7G B;  1M1X B;  2BT3 A;  5DRV A;  5EQL A;  3CXC 2;  2WGQ A;  2MF7 A;  5IEN A;  3K63 A;  2B1X B;  3RGA A;  3LTB A;  2WO0 A;  4OUQ A;  1D6Y A;  1TFK A;  2CC3 A;  4R9L A;  1OGZ A;  3PCS A;  3F14 A;  2CFL A;  3HI7 A;  3EC9 A;  2GU3 A;  2E2U A;  3UL5 A;  5KP4 A;  3HK4 A;  3DZL A;  4EV5 A;  2W6J H;  3CME 3;  3S67 A;  2RFR A;  2Z6B A;  1IQX A;  1RRL A;  4J9A A;  3CCR 3;  3NQY A;  1W6G A;  1IVV A;  4HZB B;  2HMM B;  1ULI B;  4GL6 A;  3FG1 A;  3T8U A;  4FMD A;  2Z76 A;  3BND A;  3MYT A;  2CW9 A;  3QRD A;  3CCU 3;  4HM3 B;  1O7N B;  1Y4K A;  1BUQ A;  3GRD A;  3CNM A;  3WA3 A;  1F8N A;  3EN8 A;  4RNZ A;  4MMY B;  5KP1 A;  2RGQ A;  3B4O A;  3CC7 3;  3MSO A;  4PEJ A;  1SII A;  5AEU B;  3PGB A;  1DMN A;  2B24 B;  3NBJ A;  3FZW A;  2IUK A;  1IT7 A;  1AR0 A;  1Z1S A;  2HML B;  3MWZ A;  1QAF A;  2A15 A;  5JPP A;  1ZX2 A;  2Z7A A;  2QEX 3;  3CU3 A;  3U1W A;  3LOY A;  1R4C A;  3GAX A;  1VQO 3;  4MMX B;  1E3V A;  4AEQ A;  1DMQ A;  2C11 A;  2O9U X;  3X3X A;  3SOA A;  1OH0 A;  3CCL 3;  1M90 4;  1ASK A;  1JNQ A;  3F8H A;  2OQE A;  1YJW 3;  1VQP 3;  1Q40 B;  2KRT A;  4IIA A;  4RZM A;  4HM5 B;  1PU4 A;  3I56 3;  1UI7 A;  5D81 A;  2K54 A;  3IMA B;  2CG0 A;  5AEW B;  3CCQ 3;  1W4N A;  1QJG A;  1RKY A;  3DMC A;  1U8C B;  4N6M A;  4EV2 A;  3ROB A;  3JUQ A;  3WMD A;  3S28 A;  3GZY B;  4FR9 A;  1N8R 4;  1W6C A;  1N9J A;  2CHC A;  4ZM8 A;  2Y74 A;  1IV9 A;  1FGO A;  2INX A;  1FUW A;  2XEP A;  2GU1 A;  4CDL A;  4LMI A;  2D42 A;  1LOX A;  3EBY A;  2WOH A;  3NQZ A;  4FCM A;  4FMA A;  3CD6 3;  1W01 A;  4R80 A;  1ZO2 A;  1T5Y A;  1TIJ A;  2CFD A;  1TP6 A;  2YFJ B;  2Y73 A;  3EE1 A;  3HX8 A;  3JVC A;  3KSE D;  3PXM A;  1CYU A;  3OWS A;  2I9W A;  5CXO A;  1L5G B;  1GY6 A;  2XSH B;  4XB5 A;  2P09 A;  5AYR B;  4WYK A;  3OWY A;  4FMB A;  1OGX A;  3E99 A;  4GB5 A;  4WFO A;  3FF0 A;  3LML A;  3N54 B;  3CCJ 3;  4HM0 B;  2Q07 A;  1Q82 4;  2CFK A;  1IK3 A;  3OV4 A;  2QIY A;  1ROV A;  1JJ2 2;  3EQQ B;  2O3O A;  4N6O B;  3NUV A;  1W7C A;  2GEX A;  3BNE A;  3F40 A;  1G96 A;  3K0Z A;  2CWV A;  1GS3 A;  4CCV A;  1KC8 4;  2GBX B;  4O02 B;  4OK0 A;  4L7K A;  3SLU A;  1W2B 2;  4N6L A;  4WWU C;  1TU5 A;  1QVF 2;  1OF5 A;  1QAL A;  1GYB A;  3FH1 A;  3LT9 A;  3B8L A;  3F7S A;  2XR8 B;  5ELU A;  2XRX B;  4LZI A;  1NDO B;  5AYS C;  5IEO A;  1A2K A;  3DXO A;  2K0M A;  3T0U A;  1NU3 A;  1Q42 A;  2PNC A;  3OWU A;  4XBX A;  1SJW A;  2CIU A;  3DGN A;  4K1U A;  4R9K A;  2IUJ A;  4O2H A;  3FLJ A;  1IVX A;  3MG3 A;  2QA4 3;  5KP3 A;  2XFS A;  3NX0 A;  2WOF A;  3D3L A;  3OW2 2;  4XM4 A;  5LC6 A;  2CFW A;  3AMO A;  2GXF A;  3G6E 3;  1VQL 3;  3SED A;  3S29 A;  3PYJ A;  2Z77 A;  2W03 A;  2OOV C;  5IEP A;  2XFT A;  3CCM 3;  1WMO A;  1RJO A;  1JB2 A;  3NXJ A;  3VF1 A;  1LVN A;  5CF1 A;  2HMO B;  3KKG A;  1ROA A;  3WA2 X;  1HKX A;  4WYK B;  1EKM A;  2R4I A;  3GZX B;  4XBT A;  4FCZ A;  2E2T A;  2BNG A;  5IG4 A;  2W04 A;  2ZL8 A;  3K9M C;  3HZP A;  1JN5 A;  1S5A A;  3OX9 A;  1JRQ A;  4FMC A;  2P38 A;  1IV7 A;  3ALA A;  1FGM A;  3LTA A;  3O8Y A;  3PS8 A;  3ECF A;  2FNQ A;  4R1K A;  1K9M 4;  3V92 A;  1OHS A;  2RSX A;  1A90 A;  1STD A;  1M9G A;  1VQK 3;  3JUP A;  2CK3 H;  3KFQ C;  2M7O A;  1SPU A;  2WGO A;  3LTC A;  1NB5 I;  3B7C A;  3CPO A;  1RN7 A;  1U5O A;  2XF3 A;  4ORL A;  1CEW I;  1V74 A;  3DY5 A;  3NV0 A;  7STD A;  4HVN A;  3PZW A;  1QAK A;  3Q90 A;  4L8P A;  4HM7 B;  4Q53 A;  2W2C A;  3SVA A;  1OF5 B;  3FSD A;  4EXR A;  3OXA A;  3N9H A;  4O3V A;  1DYU A;  2P0X A;  3G16 A;  3L0R A;  1MOL A;  4XDW A;  1ISK A;  3SX1 A;  1K73 4;  3V98 A;  3KZT A;  1AVL A;  5CF2 A;  3U97 A;  2BMQ B;  2ML5 A;  1D6Z A;  1OPY A;  3H3H A;  1IQY A;  4G1M B;  1FGR A;  4KFF A;  1DVC A;  3CMA 3;  3Q1C A;  2CG1 A;  3K7C A;  2JDI H;  3MG1 A;  1KSI A;  3EJV A;  3UL6 A;  5FGO A;  2GEY A;  3Q2P A;  1OAC A;  3AMO B;  2FGT A;  4O8S A;  1NJI 4;  3WOE B;  4MMZ B;  2IMJ A;  5IF6 A;  1AVK A;  3X3Y A;  4IPB A;  2C10 A;  3MG2 A;  1YIT 3;  2W0Q A;  3B4P A;  5EVH A;  2W56 A;  2W9P A;  1UI8 A;  2D1W A;  3FG4 A;  3LXU X;  2E2V A;  3HII A;  3S27 A;  4I4K A;  1W2Z A;  3KE7 A;  4EC6 A;  3IJE B;  1IVW A;  5JBS A;  4HM4 B;  1JN5 B;  1CYV A;  2OQE C;  3BB9 A;  3CNX A;  1K8A 4;  1VQN 3;  1N9E A;  3UJM A;  4N3V A;  4JF8 A;  2OCT A;  2OTL 3;  1CQS A;  3X41 A;  3T8N A;  3PCR A;  2CWU A;  1YJN 3;  3X3Z A;  1TUH A;  1A2V A;  1S72 3;  5FW5 A;  3I55 3;  3K5T A;  3NV0 B;  2RCD A;  1ULJ B;  1LXE A;  1N5P A;  2STD A;  3I0Y A;  3DM8 A;  4AKZ A;  1O7M B;  1O7P B;  4J8T A;  1N5H A;  3A76 A;  1SIH A;  2BO9 B;  3G0K A;  4HBR A;  1VQ8 3;  2BHM A;  1IT8 A;  5EEO A;  1A67 A;  1GY5 A;  1JB4 A;  3HIG A;  3MKI A;  4K61 A;  3LH4 A;  4IT7 A;  3DUK A;  1LNH A;  3WDG B;  4WP5 A;  4NRE A;  1EG9 B;  1UUW B;  3LZA A;  3EN1 B;  4K90 B;  4FCJ A;  3BLZ A;  3CCE 3;  4BTW A;  3ER7 A;  8CHO A;  1W5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...