2MF7A

Solution structure of the ims domain of the mitochondrial import protein tim21 from s. cerevisiae
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
GAMGSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Mitochondrial import inner membrane translocase subunit TIM2
publication title Molecular Basis of the Dynamic Structure of the TIM23 Complex in the Mitochondrial Intermembrane Space.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.320 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2mf7A00
2CIUA 2MF7A
chains in the Genus database with same CATH superfamily
3F40A 3F9SA 3BIRA 2HOHA 4HM8B 2H0GA 1B2SA 3F14A 1AQZA 3S67A 4BL2A 1LRAA 3EN1B 6RNTA 3CCU3 2BMQB 2GBWB 1NB5I 1RTUA 1JKGB 1LXEA 1FZUA 5KP3A 4PEJA 3HIIA 1OGZA 3GZXB 1IVUA 3DH2A 3K0ZA 4HM6B 1RNBA 1BRSA 1NJI4 1KSIA 1UI8A 3Q1CA 5IG3A 1FA3A 1RJOA 1LNHA 1AV4A 2YFLB 3STDA 1QVF2 1WMNA 1OHPA 1A2KA 2IA7A 4GL6A 3MG1A 3BNBA 1IDPA 2KF3A 1G02A 3EQQB 1RGKA 1STFI 3SOYA 1EQKA 4O02B 3UB1A 1E3RA 5D81A 4FMCA 4AKZA 1RGFA 3LYGA 1N5PA 3OWYA 2IYJA 7RNTA 2WGQA 2D42A 1BGSA 1NDOB 3F8XA 8CHOA 3V92A 3N9HA 4CJNA 3CCL3 1STDA 4XBXA 3PXMA 1YJ93 1F8NA 2BMOB 1B2UA 5D82A 1OPYA 4HM3B 4KVHA 3LTBA 4XBTA 2SARA 1IK3A 1UCJA 1OH0A 2KF6A 3DXOA 1MNLA 2CK3H 3TDGA 1GMQA 3D5GA 1GS3A 2FGTA 1NU3A 4TX4A 5HOHA 1D6ZA 2WOFA 1VQ93 2BMRB 1I8VA 4HVNA 1X1XA 4BIRA 5JPPA 3CCE3 3EHCA 8RNTA 2IUKA 5G1LA 3N54B 1DETA 2D1WA 3CC73 2CWUA 4MEIA 3K9MC 3HOHA 1VQ63 1EA2A 2STDA 2CX1A 3PZWA 4HJLB 4QWTA 3SXXA 3CD63 1Q824 3KFQC 1BANA 2F99A 3CPW2 1SIHA 4RZMA 2AADA 1RDSA 4CDLA 2RCDA 3G16A 2Z6BA 2OOVA 4J5KA 3X3ZA 1IQYA 1T2IA 2P38A 4OK0A 4ORLA 3X40A 4MJDA 3H51A 1HU9A 1X1UA 2CG0A 4HAAA 4NHFA 1UUWB 5EVHA 4MMXB 2UUGC 1RKYA 2XR8B 3F8HA 2KF4A 1WTHA 2CX0A 2RFRA 5IG0A 3FZWA 4XDWA 3BU4A 3AGOA 4XM4A 4N6UA 4WYKA 1K9M4 3ECFA 3CCS3 4J5GA 1W4NA 1ZO2A 4HM5B 1Q42A 4N6TA 2SBLA 3OXAA 4X2HA 1QJGA 1UCIA 3RNTA 3FLJA 2XEPA 1BSEA 2F5WA 1RLSA 4FCZA 2CFLA 4WYKB 3KCHA 1GD3A 4N3VA 5GSPA 4ZM8A 1UGHI 2Z77A 2YFIB 1YVSA 3FG4A 3ZFZA 2E2VA 2P05A 1TRQA 3PYJA 4BL3A 3WA2X 4CPKA 2LYXA 3V98A 2BT3A 2GBXB 1BAOA 3MSOA 2KXGA 3FGYA 1UW1A 1MGWA 2GEYA 1HYFA 3JUOA 4FR9A 4WWUC 2B24B 3MG3A 3BB9A 4KZ1A 5TGNA 3CC23 1SPUA 1CEWI 3LTAA 3X42A 1BSCA 1YIT3 5RNTA 2CG1A 3ZG0A 1I70A 1W00A 2RSXA 2ZHXB 2CHCA 1VQP3 2GXFA 3Q3FA 3CNXA 1W02A 4Q53A 1M1XB 1OF5A 3MKIA 1Z1SA 4GSPA 1RN4A 4JF8A 3S27A 1LOVA 1B20A 2CFDA 3K5TA 5JBSA 1AVKA 4IPBA 3OW22 4AEQA 5AYRB 4MMZB 5CLKA 1YHQ3 2BNGA 1FW7A 1UGIA 2Y73A 1OF5B 2WGOA 5BVBA 1GD4A 1W5ZA 3JUPA 1PU4A 3FSDA 3B7CA 7STDA 3CU3A 3GZYB 3AHWA 4HZBB 3LH4A 3PS8A 1D6UA 3A5EA 3BNDA 1O7NB 1TRPA 3CNMA 4R4KA 1LOXA 1UI7A 4BU4A 5AEWB 1JBTA 1N8QA 2W56A 2GU3A 3NBBA 1V57A 4NPBA 3KSED 2GEXA 3EX9A 1O7PB 2INXA 2ZL8A 5CXOA 1V58A 1VQQA 2RGQA 1Q7HA 2WO0A 2BU4A 4HZ9B 4O3VA 1TIJA 3DZLA 1BRHA 1RGAA 1N9EA 2W56B 5EQLA 1W6GA 3FF2A 1TJDA 4HM7B 4LEHA 3AMOA 1A2PA 4XBYA 1RGLA 5AIFA 3HZPA 3ALAA 1RHLA 2GU1A 2UGIA 1RRLA 4RNTA 5FGOA 4KFDA 1CQSA 3B8LA 1TUHA 2CW9A 1KQS2 2CFKA 3AMOB 2HMNB 3NV0A 5DRVA 1DMMA 4O8SA 4R1KA 3HX8A 3I0YA 3I563 1I2FA 5IF6A 3ER7A 1ULIB 5I97A 1IV7A 2K54A 3HI7A 3NUVA 1RGHA 2F4YA 3G6E3 3KKGA 1T3BA 2J8XB 1C54A 1UUVB 2KRTA 2HMMB 3SYUA 3NV0B 2CIUA 3E99A 1RN7A 3LTCA 1ISKA 4RNZA 1JNQA 2MF7A 1W6YA 3WR2A 3D3LA 3RDEA 4HBRA 2ZDJA 5AEUB 1ZX2A 1RCLA 1TFKA 2M7OA 1E3VA 1NB3I 1UDII 1C7HA 1VQN3 1JB4A 1NNVA 3T8UA 5AIHA 3GZRA 1Q814 3FF0A 4CCVA 2PZVA 4EW5A 2A15A 1BRJA 1FUSA 1W7CA 3D4AA 3IPTA 3EBYA 4BTYA 1BSBA 3LOYA 4EYCA 2W9PA 1RGCA 5G2GA 1DVCA 5BU4A 4J8TA 1BNJA 4IIAA 4GB5A 1VQL3 2W03A 1IYYA 1JZDA 3FKAA 3SLUA 1N5HA 4HOHA 3D5IA 1YGWA 3CCJ3 1BNFA 1YI23 5CF1A 3L0RA 5IG4A 1O7WB 2Y74A 1RN1A 1JB5A 3DM8A 3O8YA 1L5GB 2ML6A 3GSPA 4HKVB 1T2HA 2I9WA 3GAXA 4K90B 4RNYA 3S29A 1BVIA 1MGRA 3WHOA 2OTJ3 3SVAA 4BTXA 2CWTA 3K7CA 2R4IA 2H0IA 1RGGA 1IQXA 2XSOB 2XF3A 3F7SA 1A2VA 1O7GB 2XFSA 3ROBA 4HM2B 3DY5A 4FCMA 2JQ5A 1BUJA 4KT3B 1UUGB 3DUKA 4HM4B 4AKYA 2W6JH 5JPUA 1MWTA 3CCV3 1U5OA 1ROAA 3LT8A 2W0QA 2UX0A 1W6CA 3FG1A 3AGNA 2BO9B 2HMJB 1S723 3CCM3 1X1WA 4WHAA 3EJVA 3B4PA 3G713 1BRIA 5DREA 1DVDA 3LMLA 1UCLA 1IV9A 1BNEA 3FG3A 3Q90A 1RSNA 3PCRA 1DMQA 2K0MA 1FGOA 1MWRA 4N6LA 1W2ZA 3VGNA 1LOWA 4LMIA 3MG2A 4U13A 2C10A 3A76A 1BSDA 3WOFB 4EC6A 3CMA3 3CCR3 3JUMA 1GY5A 1NO3A 4IT7A 4JRFA 3S5CA 1LOYA 1TP6A 3DMCA 3NX0A 1VQ43 1LNIA 1AR0A 1R4CA 1BRKA 2KAAA 3BLZA 3U1WA 1PY3A 4K1UA 3FH1A 3SX1A 1BRGA 3UNLA 2FXTA 5M18A 1VQ73 3RGRA 2RNTA 3DGLA 4EBGA 1BNGA 1GMPA 1M9GA 5AI1A 2C4BA 5M19A 1WNHA 4XB5A 3G8ZA 2L4VA 3URPA 1GSPA 1JN5A 4STDA 3H3HA 1YVBI 4RBNA 1DYUA 1ZGXA 2Q07A 3IMAB 3DGOA 3NM7A 1KWIA 4BTWA 3GWRA 4L8PA 3EC9A 6STDA 1BIRA 1EG9B 2WOHA 2P0XA 4G1MB 1B2XA 1JN5B 3NBRA 1TFOA 1QAFA 2HMLB 2OQEA 1ASKA 4ILFA 3UJMA 1IU7A 3UL6A 1ULJB 5IEPA 5LC7A 4LGQA 3EN8A 1BU4A 3QK9A 1Q40A 1I0VA 5AYSC 3KZTA 2L1SA 3BNCA 5A0OB 1EEJA 2O3OA 4H61A 2QEX3 3BNEA 1MWUA 1AVLA 1W2B2 3PCSA 3MPHA 1JBSA 4R9LA 3D9RA 1YNVX 5ELUA 1Q40B 2F56A 5D83A 3KE7A 1JKGA 2OQEC 3IJEB 5STDA 1QAKA 3CXC2 1VZZA 3EE1A 3QRDA 4H3UA 4R9KA 2IY2A 3AHSA 1YJN3 1ROVA 4O2HA 3DGYA 3LTDA 5AIIA 1B3SA 3EBTA 1NWWA 1OACA 3PGBA 4EXRA 5KP4A 1B2ZA 4HM1B 5M1AA 3NXJA 1CYUA 2W9QA 1FGRA 3WOEB 1GOUA 3I553 4OVMA 1JJ22 1IVWA 2ZA4A 2C11A 1I0XA 4EV2A 1EUIC 5KP1A 5G1KA 4N6OB 2OTL3 1OGXA 1FUWA 1RRHA 1B21A 2RBIA 1I2EA 4K61A 3V99A 3LT9A 1HZ1A 3F7XA 3HIGA 4K1VA 2BIRA 4GHOA 3VSYA 2P09A 3WODG 5BXQA 1TU5A 2XSHB 2KCDA 3D79A 1DE3A 1JBRA 2OWPA 5BIRA 3CC43 4MMYB 1I3IA 1MWSA 1I3FA 3JUNA 2YX9A 2MC8A 3FCSB 3X3XA 1SIIA 3NHXA 5IERA 1YJW3 1KC84 1RCKA 1CYVA 1Q9EA 3GRDA 1K734 1FUTA 1JRQA 5IW9A 3NBJA 1FGQA 1JV2B 3VF1A 4L7KA 3JVCA 3EB8A 4LZIA 3CME3 2QIYA 6GSPA 1O7HB 5CF2A 1GY6A 4FMAA 1VQK3 4KFFA 1OHOA 1BRNL 3T8NA 2YFJB 1IT7A 2GSPA 2ML5A 3OWUA 1BUQA 3G4S3 2QA43 2XGNA 4L8OA 4DKIA 1I2GA 2XGLA 1CH0A 1JB2A 1N8R4 1Q7Y4 2BHMA 3KIIA 1R4YA 2CFWA 3HK4A 2CH9A 3WA3A 1A90A 4HM0B 5LC6A 1WMOA 7GSPA 1FGMA 1QMAA 5ELJA 1RMSA 2PNCA 9RNTA 2Z7AA 1TTOA 3CCQ3 1GMRA 3MWZA 1K41A 3X41A 5CK6A 1OHSA 3RGAA 1V74A 3X3YA 3ZG5A 1QALA 1IVXA 2B1XB 2XFTA 5AIGA 3J7Yd 2F86B 4HYZA 3M8CA 2P0MA 1HKXA 2V1LA 5EEOA 4I4KA 1W01A 3U97A 3DGMA 3NQYA 5IG5A 1AY7A 1PYLA 4KFEA 1PFPA 1B27A 2CC3A 1DMNA 1BNSA 2CFGA 2OOVC 1GOVA 1S5AA 4LSOA 1K28A 1BNRA 1US1A 1X1YA 1J2BA 1LVNA 1IQ8A 1Q864 1OUNA 2F98A 4R80A 3SEDA 3N8BA 1UCKA 2KF5A 1MOLA 1OCVA 4FMBA 1KD14 1K8A4 1IVVA 1U8CB 1A67A 2W04A 1D6YA 2E2TA 3KSPA 1G96A 2OCTA 3MYTA 4EV5A 2CWVA 5IENA 1FGTA 1LQMB 3SOAA 3LXUX 2W2CA 3WDGB 1M904 1VQ83 1QVG2 1GOYA 4N6V0 1B2MA 4I5QA 1VQO3 1T5YA 1EKMA 1VQ53 2F5MA 2CKFB 3EF8A 1E97A 2QGUA 2H0HA 5IEOA 2K3DA 4NREA 1GYBA 1RGEA 1Y4KA 2JDIH 3NM2A 3OWSA 4WP5A 4X2OA 3G0KA 1BSAA 1LQGC 3Q2PA 2FNQA 2XRXB 2AAEA 3LZAA 1VQM3 2LQVA 2E2UA 2R41A 4FCJA 4J9AA 3T0UA 2XH9A 2HMOB 1G0TA 1JZOA 4LYLB 2HMKB 3DGNA 4OUQA 1SQWA 1IT8A 1RNTA 3OV4A 1BOXA 1N9JA 3GZBA 4N6MA 1WQLB 1ZS7A 1YIJ3 3JUQA 3K63A 1M1K4 3CPOA 1O7MB 4N6NB 1YGEA 2O9UX 1SARA 3S28A 1WMPA 5HGRA 3UL5A 4FMDA 4XDVA 1GY7A 1SJWA 3MHEA 1FYSA 3OX9A 2IUJA 3B4OA 3NQZA 3KN4A 3WMDA 2Z76A 1BNIA 5FW5A 2IMJA 4WFOA
chains in the Genus database with same CATH topology
3F40A 3F9SA 4HM8B 3F14A 3S67A 3EN1B 3CCU3 2BMQB 2GBWB 1NB5I 1JKGB 1LXEA 5KP3A 4PEJA 3HIIA 1OGZA 3GZXB 1IVUA 3K0ZA 4HM6B 1NJI4 1KSIA 1UI8A 3Q1CA 5IG3A 1FA3A 1RJOA 1LNHA 1AV4A 2YFLB 3STDA 1QVF2 1WMNA 1OHPA 1A2KA 2IA7A 4GL6A 3MG1A 3BNBA 1IDPA 3EQQB 1STFI 3SOYA 1EQKA 4O02B 3UB1A 1E3RA 5D81A 4FMCA 4AKZA 3LYGA 3OWYA 1N5PA 2WGQA 2D42A 1NDOB 3F8XA 8CHOA 3V92A 3N9HA 3CCL3 1STDA 4XBXA 3PXMA 1YJ93 1F8NA 2BMOB 5D82A 1OPYA 4HM3B 4KVHA 3LTBA 4XBTA 1IK3A 1OH0A 3DXOA 1MNLA 2CK3H 3TDGA 1GS3A 2FGTA 1NU3A 4TX4A 1D6ZA 2WOFA 1VQ93 2BMRB 4HVNA 5JPPA 3CCE3 3EHCA 2IUKA 3N54B 2D1WA 3CC73 2CWUA 4MEIA 3K9MC 1VQ63 1EA2A 2STDA 3PZWA 4QWTA 4HJLB 3SXXA 3CD63 1Q824 3KFQC 2F99A 3CPW2 1SIHA 4RZMA 4CDLA 2RCDA 3G16A 2Z6BA 2OOVA 3X3ZA 1IQYA 2P38A 4OK0A 4ORLA 3X40A 4MJDA 3H51A 1HU9A 2CG0A 4NHFA 1UUWB 5EVHA 4MMXB 1RKYA 2XR8B 3F8HA 1WTHA 2RFRA 5IG0A 3FZWA 4XDWA 4XM4A 4N6UA 4WYKA 1K9M4 3ECFA 3CCS3 1W4NA 1ZO2A 4HM5B 1Q42A 4N6TA 2SBLA 3OXAA 4X2HA 1QJGA 3FLJA 2XEPA 4FCZA 2CFLA 4WYKB 4N3VA 1GD3A 4ZM8A 2Z77A 2YFIB 3FG4A 2E2VA 2P05A 3PYJA 3WA2X 2LYXA 3V98A 2BT3A 2GBXB 3MSOA 2KXGA 3FGYA 1UW1A 2GEYA 3JUOA 4FR9A 4WWUC 2B24B 3MG3A 3BB9A 4KZ1A 5TGNA 3CC23 1SPUA 1CEWI 3LTAA 3X42A 1YIT3 2CG1A 1W00A 2RSXA 2CHCA 1VQP3 2GXFA 3CNXA 1W02A 4Q53A 1M1XB 1OF5A 3MKIA 1Z1SA 4JF8A 3S27A 2CFDA 5JBSA 3K5TA 1AVKA 4IPBA 3OW22 4AEQA 4MMZB 5CLKA 1YHQ3 2BNGA 2Y73A 1OF5B 2WGOA 5BVBA 1GD4A 1W5ZA 3JUPA 1PU4A 3FSDA 3B7CA 7STDA 3CU3A 3GZYB 4HZBB 3LH4A 3PS8A 1D6UA 3BNDA 3CNMA 1O7NB 4R4KA 1LOXA 1UI7A 5AEWB 1N8QA 2W56A 2GU3A 3NBBA 3KSED 2GEXA 3EX9A 1O7PB 2INXA 2ZL8A 5CXOA 2RGQA 4HZ9B 2WO0A 4O3VA 1TIJA 3DZLA 1N9EA 2W56B 5EQLA 1W6GA 3FF2A 4HM7B 4LEHA 3AMOA 4XBYA 5AIFA 3HZPA 3ALAA 2GU1A 1RRLA 5FGOA 4KFDA 1CQSA 3B8LA 1TUHA 2CW9A 1KQS2 2CFKA 3AMOB 2HMNB 3NV0A 5DRVA 1DMMA 4O8SA 4R1KA 3HX8A 3I0YA 3I563 5IF6A 3ER7A 1ULIB 1IV7A 2K54A 3HI7A 3NUVA 3G6E3 3KKGA 1UUVB 2KRTA 2HMMB 3NV0B 2CIUA 3E99A 1RN7A 3LTCA 1ISKA 4RNZA 1JNQA 2MF7A 1W6YA 3D3LA 3RDEA 4HBRA 2ZDJA 5AEUB 1ZX2A 2M7OA 1TFKA 1E3VA 1NB3I 1C7HA 1VQN3 1JB4A 3T8UA 5AIHA 3GZRA 1Q814 3FF0A 4CCVA 2PZVA 2A15A 1W7CA 3IPTA 3EBYA 4BTYA 4EYCA 3LOYA 5I97A 2W9PA 3WA3A 5G2GA 1DVCA 4J8TA 4IIAA 1VQL3 4GB5A 2W03A 3FKAA 3SLUA 1N5HA 3CCJ3 1YI23 5CF1A 3L0RA 5IG4A 1O7WB 2Y74A 3DM8A 1JB5A 1L5GB 3O8YA 2ML6A 4HKVB 4K90B 2I9WA 3GAXA 4RNYA 3S29A 2OTJ3 3SVAA 4BTXA 2CWTA 3K7CA 2R4IA 1IQXA 2XSOB 2XF3A 3F7SA 1A2VA 1O7GB 2XFSA 3ROBA 4HM2B 3DY5A 4FCMA 2JQ5A 3DUKA 4HM4B 4AKYA 2W6JH 5JPUA 3CCV3 1U5OA 1ROAA 3LT8A 2W0QA 2UX0A 1W6CA 3FG1A 2BO9B 2HMJB 1S723 3CCM3 4WHAA 3EJVA 3B4PA 3G713 5DREA 1DVDA 3LMLA 1IV9A 3FG3A 3Q90A 3PCRA 1DMQA 2K0MA 1FGOA 4N6LA 1W2ZA 3VGNA 4LMIA 3MG2A 4U13A 2C10A 3A76A 3WOFB 4EC6A 3CMA3 3CCR3 3JUMA 1GY5A 1NO3A 4IT7A 4JRFA 3S5CA 1TP6A 3DMCA 3NX0A 1VQ43 1AR0A 1R4CA 3BLZA 3U1WA 3SX1A 4K1UA 3FH1A 3UNLA 1VQ73 2FXTA 3RGRA 3DGLA 4EBGA 5AI1A 1M9GA 1WNHA 4XB5A 3G8ZA 2L4VA 1JN5A 4STDA 3H3HA 1YVBI 4RBNA 1DYUA 2Q07A 3IMAB 3NM7A 3DGOA 4BTWA 1KWIA 6STDA 3GWRA 4L8PA 3EC9A 1EG9B 2WOHA 2P0XA 4G1MB 1JN5B 3NBRA 1TFOA 1QAFA 2HMLB 2OQEA 1ASKA 3UJMA 1IU7A 3UL6A 1ULJB 5IEPA 5LC7A 4LGQA 3EN8A 3QK9A 1Q40A 5AYSC 3KZTA 3BNCA 5A0OB 2O3OA 4H61A 2QEX3 3BNEA 1AVLA 1W2B2 3PCSA 3MPHA 4R9LA 3D9RA 5ELUA 1Q40B 5D83A 5STDA 3KE7A 1JKGA 2OQEC 3IJEB 3CXC2 1QAKA 1VZZA 3EE1A 3QRDA 4H3UA 4R9KA 1YJN3 1ROVA 4O2HA 3LTDA 5AIIA 3EBTA 1NWWA 1OACA 3PGBA 4EXRA 5KP4A 4HM1B 3NXJA 1CYUA 2W9QA 1FGRA 3WOEB 3I553 4OVMA 1JJ22 1IVWA 2C11A 4EV2A 5KP1A 4N6OB 1OGXA 1FUWA 1RRHA 4K61A 3V99A 3LT9A 3F7XA 3HIGA 4K1VA 3WODG 3VSYA 1TU5A 2P09A 5BXQA 2XSHB 2KCDA 2OWPA 3CC43 4MMYB 2MC8A 3JUNA 2YX9A 3FCSB 3X3XA 1SIIA 3NHXA 5IERA 1YJW3 1KC84 3GRDA 1CYVA 1K734 5IW9A 1JRQA 3NBJA 1FGQA 1JV2B 3VF1A 4L7KA 3JVCA 3EB8A 4LZIA 3CME3 2QIYA 1O7HB 5CF2A 1GY6A 4FMAA 1VQK3 4KFFA 1OHOA 3T8NA 2YFJB 1IT7A 2ML5A 3OWUA 1BUQA 3G4S3 2QA43 2XGNA 4L8OA 2XGLA 1JB2A 1N8R4 1Q7Y4 2BHMA 3KIIA 2CFWA 3HK4A 2CH9A 1A90A 4HM0B 5LC6A 1WMOA 1FGMA 1QMAA 5ELJA 2PNCA 2Z7AA 3CCQ3 3MWZA 3X41A 1K41A 5CK6A 1OHSA 3RGAA 1V74A 3X3YA 1QALA 1IVXA 2B1XB 2XFTA 5AIGA 3J7Yd 2F86B 4HYZA 3M8CA 2P0MA 1HKXA 2V1LA 5EEOA 4I4KA 1W01A 3U97A 3DGMA 3NQYA 5IG5A 4KFEA 1PFPA 2CC3A 1DMNA 2CFGA 2OOVC 1S5AA 4LSOA 1K28A 1US1A 1J2BA 1LVNA 1IQ8A 1Q864 1OUNA 2F98A 4R80A 3SEDA 3N8BA 1MOLA 1OCVA 4FMBA 1KD14 1K8A4 1IVVA 1U8CB 1A67A 2W04A 1D6YA 2E2TA 3KSPA 1G96A 2OCTA 3MYTA 4EV5A 2CWVA 5IENA 1FGTA 3SOAA 3WDGB 3LXUX 2W2CA 1M904 1VQ83 1QVG2 4N6V0 1VQO3 1T5YA 1EKMA 1VQ53 2CKFB 3EF8A 1E97A 2QGUA 5IEOA 2OTL3 4NREA 1GYBA 1Y4KA 2JDIH 3NM2A 3OWSA 4WP5A 4X2OA 3G0KA 3Q2PA 2FNQA 2XRXB 3LZAA 1VQM3 2LQVA 2E2UA 4FCJA 4J9AA 3T0UA 2XH9A 2HMOB 2HMKB 3DGNA 4OUQA 1SQWA 1IT8A 3OV4A 1N9JA 4N6MA 3GZBA 1WQLB 1YIJ3 3JUQA 3K63A 1M1K4 3CPOA 1O7MB 4N6NB 1YGEA 2O9UX 3S28A 1WMPA 5HGRA 3UL5A 4FMDA 4XDVA 1GY7A 1SJWA 3MHEA 3OX9A 2IUJA 3B4OA 3NQZA 3KN4A 3WMDA 2Z76A 5AYRB 5FW5A 2IMJA 4WFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CIU A;  2MF7 A; 
#chains in the Genus database with same CATH topology
 3F40 A;  3F9S A;  3BIR A;  2HOH A;  4HM8 B;  2H0G A;  1B2S A;  3F14 A;  1AQZ A;  3S67 A;  4BL2 A;  1LRA A;  3EN1 B;  6RNT A;  3CCU 3;  2BMQ B;  2GBW B;  1NB5 I;  1RTU A;  1JKG B;  1LXE A;  1FZU A;  5KP3 A;  4PEJ A;  3HII A;  1OGZ A;  3GZX B;  1IVU A;  3DH2 A;  3K0Z A;  4HM6 B;  1RNB A;  1BRS A;  1NJI 4;  1KSI A;  1UI8 A;  3Q1C A;  5IG3 A;  1FA3 A;  1RJO A;  1LNH A;  1AV4 A;  2YFL B;  3STD A;  1QVF 2;  1WMN A;  1OHP A;  1A2K A;  2IA7 A;  4GL6 A;  3MG1 A;  3BNB A;  1IDP A;  2KF3 A;  1G02 A;  3EQQ B;  1RGK A;  1STF I;  3SOY A;  1EQK A;  4O02 B;  3UB1 A;  1E3R A;  5D81 A;  4FMC A;  4AKZ A;  1RGF A;  3LYG A;  1N5P A;  3OWY A;  2IYJ A;  7RNT A;  2WGQ A;  2D42 A;  1BGS A;  1NDO B;  3F8X A;  8CHO A;  3V92 A;  3N9H A;  4CJN A;  3CCL 3;  1STD A;  4XBX A;  3PXM A;  1YJ9 3;  1F8N A;  2BMO B;  1B2U A;  5D82 A;  1OPY A;  4HM3 B;  4KVH A;  3LTB A;  4XBT A;  2SAR A;  1IK3 A;  1UCJ A;  1OH0 A;  2KF6 A;  3DXO A;  1MNL A;  2CK3 H;  3TDG A;  1GMQ A;  3D5G A;  1GS3 A;  2FGT A;  1NU3 A;  4TX4 A;  5HOH A;  1D6Z A;  2WOF A;  1VQ9 3;  2BMR B;  1I8V A;  4HVN A;  1X1X A;  4BIR A;  5JPP A;  3CCE 3;  3EHC A;  8RNT A;  2IUK A;  5G1L A;  3N54 B;  1DET A;  2D1W A;  3CC7 3;  2CWU A;  4MEI A;  3K9M C;  3HOH A;  1VQ6 3;  1EA2 A;  2STD A;  2CX1 A;  3PZW A;  4HJL B;  4QWT A;  3SXX A;  3CD6 3;  1Q82 4;  3KFQ C;  1BAN A;  2F99 A;  3CPW 2;  1SIH A;  4RZM A;  2AAD A;  1RDS A;  4CDL A;  2RCD A;  3G16 A;  2Z6B A;  2OOV A;  4J5K A;  3X3Z A;  1IQY A;  1T2I A;  2P38 A;  4OK0 A;  4ORL A;  3X40 A;  4MJD A;  3H51 A;  1HU9 A;  1X1U A;  2CG0 A;  4HAA A;  4NHF A;  1UUW B;  5EVH A;  4MMX B;  2UUG C;  1RKY A;  2XR8 B;  3F8H A;  2KF4 A;  1WTH A;  2CX0 A;  2RFR A;  5IG0 A;  3FZW A;  4XDW A;  3BU4 A;  3AGO A;  4XM4 A;  4N6U A;  4WYK A;  1K9M 4;  3ECF A;  3CCS 3;  4J5G A;  1W4N A;  1ZO2 A;  4HM5 B;  1Q42 A;  4N6T A;  2SBL A;  3OXA A;  4X2H A;  1QJG A;  1UCI A;  3RNT A;  3FLJ A;  2XEP A;  1BSE A;  2F5W A;  1RLS A;  4FCZ A;  2CFL A;  4WYK B;  3KCH A;  1GD3 A;  4N3V A;  5GSP A;  4ZM8 A;  1UGH I;  2Z77 A;  2YFI B;  1YVS A;  3FG4 A;  3ZFZ A;  2E2V A;  2P05 A;  1TRQ A;  3PYJ A;  4BL3 A;  3WA2 X;  4CPK A;  2LYX A;  3V98 A;  2BT3 A;  2GBX B;  1BAO A;  3MSO A;  2KXG A;  3FGY A;  1UW1 A;  1MGW A;  2GEY A;  1HYF A;  3JUO A;  4FR9 A;  4WWU C;  2B24 B;  3MG3 A;  3BB9 A;  4KZ1 A;  5TGN A;  3CC2 3;  1SPU A;  1CEW I;  3LTA A;  3X42 A;  1BSC A;  1YIT 3;  5RNT A;  2CG1 A;  3ZG0 A;  1I70 A;  1W00 A;  2RSX A;  2ZHX B;  2CHC A;  1VQP 3;  2GXF A;  3Q3F A;  3CNX A;  1W02 A;  4Q53 A;  1M1X B;  1OF5 A;  3MKI A;  1Z1S A;  4GSP A;  1RN4 A;  4JF8 A;  3S27 A;  1LOV A;  1B20 A;  2CFD A;  3K5T A;  5JBS A;  1AVK A;  4IPB A;  3OW2 2;  4AEQ A;  5AYR B;  4MMZ B;  5CLK A;  1YHQ 3;  2BNG A;  1FW7 A;  1UGI A;  2Y73 A;  1OF5 B;  2WGO A;  5BVB A;  1GD4 A;  1W5Z A;  3JUP A;  1PU4 A;  3FSD A;  3B7C A;  7STD A;  3CU3 A;  3GZY B;  3AHW A;  4HZB B;  3LH4 A;  3PS8 A;  1D6U A;  3A5E A;  3BND A;  1O7N B;  1TRP A;  3CNM A;  4R4K A;  1LOX A;  1UI7 A;  4BU4 A;  5AEW B;  1JBT A;  1N8Q A;  2W56 A;  2GU3 A;  3NBB A;  1V57 A;  4NPB A;  3KSE D;  2GEX A;  3EX9 A;  1O7P B;  2INX A;  2ZL8 A;  5CXO A;  1V58 A;  1VQQ A;  2RGQ A;  1Q7H A;  2WO0 A;  2BU4 A;  4HZ9 B;  4O3V A;  1TIJ A;  3DZL A;  1BRH A;  1RGA A;  1N9E A;  2W56 B;  5EQL A;  1W6G A;  3FF2 A;  1TJD A;  4HM7 B;  4LEH A;  3AMO A;  1A2P A;  4XBY A;  1RGL A;  5AIF A;  3HZP A;  3ALA A;  1RHL A;  2GU1 A;  2UGI A;  1RRL A;  4RNT A;  5FGO A;  4KFD A;  1CQS A;  3B8L A;  1TUH A;  2CW9 A;  1KQS 2;  2CFK A;  3AMO B;  2HMN B;  3NV0 A;  5DRV A;  1DMM A;  4O8S A;  4R1K A;  3HX8 A;  3I0Y A;  3I56 3;  1I2F A;  5IF6 A;  3ER7 A;  1ULI B;  5I97 A;  1IV7 A;  2K54 A;  3HI7 A;  3NUV A;  1RGH A;  2F4Y A;  3G6E 3;  3KKG A;  1T3B A;  2J8X B;  1C54 A;  1UUV B;  2KRT A;  2HMM B;  3SYU A;  3NV0 B;  2CIU A;  3E99 A;  1RN7 A;  3LTC A;  1ISK A;  4RNZ A;  1JNQ A;  2MF7 A;  1W6Y A;  3WR2 A;  3D3L A;  3RDE A;  4HBR A;  2ZDJ A;  5AEU B;  1ZX2 A;  1RCL A;  1TFK A;  2M7O A;  1E3V A;  1NB3 I;  1UDI I;  1C7H A;  1VQN 3;  1JB4 A;  1NNV A;  3T8U A;  5AIH A;  3GZR A;  1Q81 4;  3FF0 A;  4CCV A;  2PZV A;  4EW5 A;  2A15 A;  1BRJ A;  1FUS A;  1W7C A;  3D4A A;  3IPT A;  3EBY A;  4BTY A;  1BSB A;  3LOY A;  4EYC A;  2W9P A;  1RGC A;  5G2G A;  1DVC A;  5BU4 A;  4J8T A;  1BNJ A;  4IIA A;  4GB5 A;  1VQL 3;  2W03 A;  1IYY A;  1JZD A;  3FKA A;  3SLU A;  1N5H A;  4HOH A;  3D5I A;  1YGW A;  3CCJ 3;  1BNF A;  1YI2 3;  5CF1 A;  3L0R A;  5IG4 A;  1O7W B;  2Y74 A;  1RN1 A;  1JB5 A;  3DM8 A;  3O8Y A;  1L5G B;  2ML6 A;  3GSP A;  4HKV B;  1T2H A;  2I9W A;  3GAX A;  4K90 B;  4RNY A;  3S29 A;  1BVI A;  1MGR A;  3WHO A;  2OTJ 3;  3SVA A;  4BTX A;  2CWT A;  3K7C A;  2R4I A;  2H0I A;  1RGG A;  1IQX A;  2XSO B;  2XF3 A;  3F7S A;  1A2V A;  1O7G B;  2XFS A;  3ROB A;  4HM2 B;  3DY5 A;  4FCM A;  2JQ5 A;  1BUJ A;  4KT3 B;  1UUG B;  3DUK A;  4HM4 B;  4AKY A;  2W6J H;  5JPU A;  1MWT A;  3CCV 3;  1U5O A;  1ROA A;  3LT8 A;  2W0Q A;  2UX0 A;  1W6C A;  3FG1 A;  3AGN A;  2BO9 B;  2HMJ B;  1S72 3;  3CCM 3;  1X1W A;  4WHA A;  3EJV A;  3B4P A;  3G71 3;  1BRI A;  5DRE A;  1DVD A;  3LML A;  1UCL A;  1IV9 A;  1BNE A;  3FG3 A;  3Q90 A;  1RSN A;  3PCR A;  1DMQ A;  2K0M A;  1FGO A;  1MWR A;  4N6L A;  1W2Z A;  3VGN A;  1LOW A;  4LMI A;  3MG2 A;  4U13 A;  2C10 A;  3A76 A;  1BSD A;  3WOF B;  4EC6 A;  3CMA 3;  3CCR 3;  3JUM A;  1GY5 A;  1NO3 A;  4IT7 A;  4JRF A;  3S5C A;  1LOY A;  1TP6 A;  3DMC A;  3NX0 A;  1VQ4 3;  1LNI A;  1AR0 A;  1R4C A;  1BRK A;  2KAA A;  3BLZ A;  3U1W A;  1PY3 A;  4K1U A;  3FH1 A;  3SX1 A;  1BRG A;  3UNL A;  2FXT A;  5M18 A;  1VQ7 3;  3RGR A;  2RNT A;  3DGL A;  4EBG A;  1BNG A;  1GMP A;  1M9G A;  5AI1 A;  2C4B A;  5M19 A;  1WNH A;  4XB5 A;  3G8Z A;  2L4V A;  3URP A;  1GSP A;  1JN5 A;  4STD A;  3H3H A;  1YVB I;  4RBN A;  1DYU A;  1ZGX A;  2Q07 A;  3IMA B;  3DGO A;  3NM7 A;  1KWI A;  4BTW A;  3GWR A;  4L8P A;  3EC9 A;  6STD A;  1BIR A;  1EG9 B;  2WOH A;  2P0X A;  4G1M B;  1B2X A;  1JN5 B;  3NBR A;  1TFO A;  1QAF A;  2HML B;  2OQE A;  1ASK A;  4ILF A;  3UJM A;  1IU7 A;  3UL6 A;  1ULJ B;  5IEP A;  5LC7 A;  4LGQ A;  3EN8 A;  1BU4 A;  3QK9 A;  1Q40 A;  1I0V A;  5AYS C;  3KZT A;  2L1S A;  3BNC A;  5A0O B;  1EEJ A;  2O3O A;  4H61 A;  2QEX 3;  3BNE A;  1MWU A;  1AVL A;  1W2B 2;  3PCS A;  3MPH A;  1JBS A;  4R9L A;  3D9R A;  1YNV X;  5ELU A;  1Q40 B;  2F56 A;  5D83 A;  3KE7 A;  1JKG A;  2OQE C;  3IJE B;  5STD A;  1QAK A;  3CXC 2;  1VZZ A;  3EE1 A;  3QRD A;  4H3U A;  4R9K A;  2IY2 A;  3AHS A;  1YJN 3;  1ROV A;  4O2H A;  3DGY A;  3LTD A;  5AII A;  1B3S A;  3EBT A;  1NWW A;  1OAC A;  3PGB A;  4EXR A;  5KP4 A;  1B2Z A;  4HM1 B;  5M1A A;  3NXJ A;  1CYU A;  2W9Q A;  1FGR A;  3WOE B;  1GOU A;  3I55 3;  4OVM A;  1JJ2 2;  1IVW A;  2ZA4 A;  2C11 A;  1I0X A;  4EV2 A;  1EUI C;  5KP1 A;  5G1K A;  4N6O B;  2OTL 3;  1OGX A;  1FUW A;  1RRH A;  1B21 A;  2RBI A;  1I2E A;  4K61 A;  3V99 A;  3LT9 A;  1HZ1 A;  3F7X A;  3HIG A;  4K1V A;  2BIR A;  4GHO A;  3VSY A;  2P09 A;  3WOD G;  5BXQ A;  1TU5 A;  2XSH B;  2KCD A;  3D79 A;  1DE3 A;  1JBR A;  2OWP A;  5BIR A;  3CC4 3;  4MMY B;  1I3I A;  1MWS A;  1I3F A;  3JUN A;  2YX9 A;  2MC8 A;  3FCS B;  3X3X A;  1SII A;  3NHX A;  5IER A;  1YJW 3;  1KC8 4;  1RCK A;  1CYV A;  1Q9E A;  3GRD A;  1K73 4;  1FUT A;  1JRQ A;  5IW9 A;  3NBJ A;  1FGQ A;  1JV2 B;  3VF1 A;  4L7K A;  3JVC A;  3EB8 A;  4LZI A;  3CME 3;  2QIY A;  6GSP A;  1O7H B;  5CF2 A;  1GY6 A;  4FMA A;  1VQK 3;  4KFF A;  1OHO A;  1BRN L;  3T8N A;  2YFJ B;  1IT7 A;  2GSP A;  2ML5 A;  3OWU A;  1BUQ A;  3G4S 3;  2QA4 3;  2XGN A;  4L8O A;  4DKI A;  1I2G A;  2XGL A;  1CH0 A;  1JB2 A;  1N8R 4;  1Q7Y 4;  2BHM A;  3KII A;  1R4Y A;  2CFW A;  3HK4 A;  2CH9 A;  3WA3 A;  1A90 A;  4HM0 B;  5LC6 A;  1WMO A;  7GSP A;  1FGM A;  1QMA A;  5ELJ A;  1RMS A;  2PNC A;  9RNT A;  2Z7A A;  1TTO A;  3CCQ 3;  1GMR A;  3MWZ A;  1K41 A;  3X41 A;  5CK6 A;  1OHS A;  3RGA A;  1V74 A;  3X3Y A;  3ZG5 A;  1QAL A;  1IVX A;  2B1X B;  2XFT A;  5AIG A;  3J7Y d;  2F86 B;  4HYZ A;  3M8C A;  2P0M A;  1HKX A;  2V1L A;  5EEO A;  4I4K A;  1W01 A;  3U97 A;  3DGM A;  3NQY A;  5IG5 A;  1AY7 A;  1PYL A;  4KFE A;  1PFP A;  1B27 A;  2CC3 A;  1DMN A;  1BNS A;  2CFG A;  2OOV C;  1GOV A;  1S5A A;  4LSO A;  1K28 A;  1BNR A;  1US1 A;  1X1Y A;  1J2B A;  1LVN A;  1IQ8 A;  1Q86 4;  1OUN A;  2F98 A;  4R80 A;  3SED A;  3N8B A;  1UCK A;  2KF5 A;  1MOL A;  1OCV A;  4FMB A;  1KD1 4;  1K8A 4;  1IVV A;  1U8C B;  1A67 A;  2W04 A;  1D6Y A;  2E2T A;  3KSP A;  1G96 A;  2OCT A;  3MYT A;  4EV5 A;  2CWV A;  5IEN A;  1FGT A;  1LQM B;  3SOA A;  3LXU X;  2W2C A;  3WDG B;  1M90 4;  1VQ8 3;  1QVG 2;  1GOY A;  4N6V 0;  1B2M A;  4I5Q A;  1VQO 3;  1T5Y A;  1EKM A;  1VQ5 3;  2F5M A;  2CKF B;  3EF8 A;  1E97 A;  2QGU A;  2H0H A;  5IEO A;  2K3D A;  4NRE A;  1GYB A;  1RGE A;  1Y4K A;  2JDI H;  3NM2 A;  3OWS A;  4WP5 A;  4X2O A;  3G0K A;  1BSA A;  1LQG C;  3Q2P A;  2FNQ A;  2XRX B;  2AAE A;  3LZA A;  1VQM 3;  2LQV A;  2E2U A;  2R41 A;  4FCJ A;  4J9A A;  3T0U A;  2XH9 A;  2HMO B;  1G0T A;  1JZO A;  4LYL B;  2HMK B;  3DGN A;  4OUQ A;  1SQW A;  1IT8 A;  1RNT A;  3OV4 A;  1BOX A;  1N9J A;  3GZB A;  4N6M A;  1WQL B;  1ZS7 A;  1YIJ 3;  3JUQ A;  3K63 A;  1M1K 4;  3CPO A;  1O7M B;  4N6N B;  1YGE A;  2O9U X;  1SAR A;  3S28 A;  1WMP A;  5HGR A;  3UL5 A;  4FMD A;  4XDV A;  1GY7 A;  1SJW A;  3MHE A;  1FYS A;  3OX9 A;  2IUJ A;  3B4O A;  3NQZ A;  3KN4 A;  3WMD A;  2Z76 A;  1BNI A;  5FW5 A;  2IMJ A;  4WFO A; 
#chains in the Genus database with same CATH homology
 3F40 A;  3F9S A;  4HM8 B;  3F14 A;  3S67 A;  3EN1 B;  3CCU 3;  2BMQ B;  2GBW B;  1NB5 I;  1JKG B;  1LXE A;  5KP3 A;  4PEJ A;  3HII A;  1OGZ A;  3GZX B;  1IVU A;  3K0Z A;  4HM6 B;  1NJI 4;  1KSI A;  1UI8 A;  3Q1C A;  5IG3 A;  1FA3 A;  1RJO A;  1LNH A;  1AV4 A;  2YFL B;  3STD A;  1QVF 2;  1WMN A;  1OHP A;  1A2K A;  2IA7 A;  4GL6 A;  3MG1 A;  3BNB A;  1IDP A;  3EQQ B;  1STF I;  3SOY A;  1EQK A;  4O02 B;  3UB1 A;  1E3R A;  5D81 A;  4FMC A;  4AKZ A;  3LYG A;  3OWY A;  1N5P A;  2WGQ A;  2D42 A;  1NDO B;  3F8X A;  8CHO A;  3V92 A;  3N9H A;  3CCL 3;  1STD A;  4XBX A;  3PXM A;  1YJ9 3;  1F8N A;  2BMO B;  5D82 A;  1OPY A;  4HM3 B;  4KVH A;  3LTB A;  4XBT A;  1IK3 A;  1OH0 A;  3DXO A;  1MNL A;  2CK3 H;  3TDG A;  1GS3 A;  2FGT A;  1NU3 A;  4TX4 A;  1D6Z A;  2WOF A;  1VQ9 3;  2BMR B;  4HVN A;  5JPP A;  3CCE 3;  3EHC A;  2IUK A;  3N54 B;  2D1W A;  3CC7 3;  2CWU A;  4MEI A;  3K9M C;  1VQ6 3;  1EA2 A;  2STD A;  3PZW A;  4QWT A;  4HJL B;  3SXX A;  3CD6 3;  1Q82 4;  3KFQ C;  2F99 A;  3CPW 2;  1SIH A;  4RZM A;  4CDL A;  2RCD A;  3G16 A;  2Z6B A;  2OOV A;  3X3Z A;  1IQY A;  2P38 A;  4OK0 A;  4ORL A;  3X40 A;  4MJD A;  3H51 A;  1HU9 A;  2CG0 A;  4NHF A;  1UUW B;  5EVH A;  4MMX B;  1RKY A;  2XR8 B;  3F8H A;  1WTH A;  2RFR A;  5IG0 A;  3FZW A;  4XDW A;  4XM4 A;  4N6U A;  4WYK A;  1K9M 4;  3ECF A;  3CCS 3;  1W4N A;  1ZO2 A;  4HM5 B;  1Q42 A;  4N6T A;  2SBL A;  3OXA A;  4X2H A;  1QJG A;  3FLJ A;  2XEP A;  4FCZ A;  2CFL A;  4WYK B;  4N3V A;  1GD3 A;  4ZM8 A;  2Z77 A;  2YFI B;  3FG4 A;  2E2V A;  2P05 A;  3PYJ A;  3WA2 X;  2LYX A;  3V98 A;  2BT3 A;  2GBX B;  3MSO A;  2KXG A;  3FGY A;  1UW1 A;  2GEY A;  3JUO A;  4FR9 A;  4WWU C;  2B24 B;  3MG3 A;  3BB9 A;  4KZ1 A;  5TGN A;  3CC2 3;  1SPU A;  1CEW I;  3LTA A;  3X42 A;  1YIT 3;  2CG1 A;  1W00 A;  2RSX A;  2CHC A;  1VQP 3;  2GXF A;  3CNX A;  1W02 A;  4Q53 A;  1M1X B;  1OF5 A;  3MKI A;  1Z1S A;  4JF8 A;  3S27 A;  2CFD A;  5JBS A;  3K5T A;  1AVK A;  4IPB A;  3OW2 2;  4AEQ A;  4MMZ B;  5CLK A;  1YHQ 3;  2BNG A;  2Y73 A;  1OF5 B;  2WGO A;  5BVB A;  1GD4 A;  1W5Z A;  3JUP A;  1PU4 A;  3FSD A;  3B7C A;  7STD A;  3CU3 A;  3GZY B;  4HZB B;  3LH4 A;  3PS8 A;  1D6U A;  3BND A;  3CNM A;  1O7N B;  4R4K A;  1LOX A;  1UI7 A;  5AEW B;  1N8Q A;  2W56 A;  2GU3 A;  3NBB A;  3KSE D;  2GEX A;  3EX9 A;  1O7P B;  2INX A;  2ZL8 A;  5CXO A;  2RGQ A;  4HZ9 B;  2WO0 A;  4O3V A;  1TIJ A;  3DZL A;  1N9E A;  2W56 B;  5EQL A;  1W6G A;  3FF2 A;  4HM7 B;  4LEH A;  3AMO A;  4XBY A;  5AIF A;  3HZP A;  3ALA A;  2GU1 A;  1RRL A;  5FGO A;  4KFD A;  1CQS A;  3B8L A;  1TUH A;  2CW9 A;  1KQS 2;  2CFK A;  3AMO B;  2HMN B;  3NV0 A;  5DRV A;  1DMM A;  4O8S A;  4R1K A;  3HX8 A;  3I0Y A;  3I56 3;  5IF6 A;  3ER7 A;  1ULI B;  1IV7 A;  2K54 A;  3HI7 A;  3NUV A;  3G6E 3;  3KKG A;  1UUV B;  2KRT A;  2HMM B;  3NV0 B;  2CIU A;  3E99 A;  1RN7 A;  3LTC A;  1ISK A;  4RNZ A;  1JNQ A;  2MF7 A;  1W6Y A;  3D3L A;  3RDE A;  4HBR A;  2ZDJ A;  5AEU B;  1ZX2 A;  2M7O A;  1TFK A;  1E3V A;  1NB3 I;  1C7H A;  1VQN 3;  1JB4 A;  3T8U A;  5AIH A;  3GZR A;  1Q81 4;  3FF0 A;  4CCV A;  2PZV A;  2A15 A;  1W7C A;  3IPT A;  3EBY A;  4BTY A;  4EYC A;  3LOY A;  5I97 A;  2W9P A;  3WA3 A;  5G2G A;  1DVC A;  4J8T A;  4IIA A;  1VQL 3;  4GB5 A;  2W03 A;  3FKA A;  3SLU A;  1N5H A;  3CCJ 3;  1YI2 3;  5CF1 A;  3L0R A;  5IG4 A;  1O7W B;  2Y74 A;  3DM8 A;  1JB5 A;  1L5G B;  3O8Y A;  2ML6 A;  4HKV B;  4K90 B;  2I9W A;  3GAX A;  4RNY A;  3S29 A;  2OTJ 3;  3SVA A;  4BTX A;  2CWT A;  3K7C A;  2R4I A;  1IQX A;  2XSO B;  2XF3 A;  3F7S A;  1A2V A;  1O7G B;  2XFS A;  3ROB A;  4HM2 B;  3DY5 A;  4FCM A;  2JQ5 A;  3DUK A;  4HM4 B;  4AKY A;  2W6J H;  5JPU A;  3CCV 3;  1U5O A;  1ROA A;  3LT8 A;  2W0Q A;  2UX0 A;  1W6C A;  3FG1 A;  2BO9 B;  2HMJ B;  1S72 3;  3CCM 3;  4WHA A;  3EJV A;  3B4P A;  3G71 3;  5DRE A;  1DVD A;  3LML A;  1IV9 A;  3FG3 A;  3Q90 A;  3PCR A;  1DMQ A;  2K0M A;  1FGO A;  4N6L A;  1W2Z A;  3VGN A;  4LMI A;  3MG2 A;  4U13 A;  2C10 A;  3A76 A;  3WOF B;  4EC6 A;  3CMA 3;  3CCR 3;  3JUM A;  1GY5 A;  1NO3 A;  4IT7 A;  4JRF A;  3S5C A;  1TP6 A;  3DMC A;  3NX0 A;  1VQ4 3;  1AR0 A;  1R4C A;  3BLZ A;  3U1W A;  3SX1 A;  4K1U A;  3FH1 A;  3UNL A;  1VQ7 3;  2FXT A;  3RGR A;  3DGL A;  4EBG A;  5AI1 A;  1M9G A;  1WNH A;  4XB5 A;  3G8Z A;  2L4V A;  1JN5 A;  4STD A;  3H3H A;  1YVB I;  4RBN A;  1DYU A;  2Q07 A;  3IMA B;  3NM7 A;  3DGO A;  4BTW A;  1KWI A;  6STD A;  3GWR A;  4L8P A;  3EC9 A;  1EG9 B;  2WOH A;  2P0X A;  4G1M B;  1JN5 B;  3NBR A;  1TFO A;  1QAF A;  2HML B;  2OQE A;  1ASK A;  3UJM A;  1IU7 A;  3UL6 A;  1ULJ B;  5IEP A;  5LC7 A;  4LGQ A;  3EN8 A;  3QK9 A;  1Q40 A;  5AYS C;  3KZT A;  3BNC A;  5A0O B;  2O3O A;  4H61 A;  2QEX 3;  3BNE A;  1AVL A;  1W2B 2;  3PCS A;  3MPH A;  4R9L A;  3D9R A;  5ELU A;  1Q40 B;  5D83 A;  5STD A;  3KE7 A;  1JKG A;  2OQE C;  3IJE B;  3CXC 2;  1QAK A;  1VZZ A;  3EE1 A;  3QRD A;  4H3U A;  4R9K A;  1YJN 3;  1ROV A;  4O2H A;  3LTD A;  5AII A;  3EBT A;  1NWW A;  1OAC A;  3PGB A;  4EXR A;  5KP4 A;  4HM1 B;  3NXJ A;  1CYU A;  2W9Q A;  1FGR A;  3WOE B;  3I55 3;  4OVM A;  1JJ2 2;  1IVW A;  2C11 A;  4EV2 A;  5KP1 A;  4N6O B;  1OGX A;  1FUW A;  1RRH A;  4K61 A;  3V99 A;  3LT9 A;  3F7X A;  3HIG A;  4K1V A;  3WOD G;  3VSY A;  1TU5 A;  2P09 A;  5BXQ A;  2XSH B;  2KCD A;  2OWP A;  3CC4 3;  4MMY B;  2MC8 A;  3JUN A;  2YX9 A;  3FCS B;  3X3X A;  1SII A;  3NHX A;  5IER A;  1YJW 3;  1KC8 4;  3GRD A;  1CYV A;  1K73 4;  5IW9 A;  1JRQ A;  3NBJ A;  1FGQ A;  1JV2 B;  3VF1 A;  4L7K A;  3JVC A;  3EB8 A;  4LZI A;  3CME 3;  2QIY A;  1O7H B;  5CF2 A;  1GY6 A;  4FMA A;  1VQK 3;  4KFF A;  1OHO A;  3T8N A;  2YFJ B;  1IT7 A;  2ML5 A;  3OWU A;  1BUQ A;  3G4S 3;  2QA4 3;  2XGN A;  4L8O A;  2XGL A;  1JB2 A;  1N8R 4;  1Q7Y 4;  2BHM A;  3KII A;  2CFW A;  3HK4 A;  2CH9 A;  1A90 A;  4HM0 B;  5LC6 A;  1WMO A;  1FGM A;  1QMA A;  5ELJ A;  2PNC A;  2Z7A A;  3CCQ 3;  3MWZ A;  3X41 A;  1K41 A;  5CK6 A;  1OHS A;  3RGA A;  1V74 A;  3X3Y A;  1QAL A;  1IVX A;  2B1X B;  2XFT A;  5AIG A;  3J7Y d;  2F86 B;  4HYZ A;  3M8C A;  2P0M A;  1HKX A;  2V1L A;  5EEO A;  4I4K A;  1W01 A;  3U97 A;  3DGM A;  3NQY A;  5IG5 A;  4KFE A;  1PFP A;  2CC3 A;  1DMN A;  2CFG A;  2OOV C;  1S5A A;  4LSO A;  1K28 A;  1US1 A;  1J2B A;  1LVN A;  1IQ8 A;  1Q86 4;  1OUN A;  2F98 A;  4R80 A;  3SED A;  3N8B A;  1MOL A;  1OCV A;  4FMB A;  1KD1 4;  1K8A 4;  1IVV A;  1U8C B;  1A67 A;  2W04 A;  1D6Y A;  2E2T A;  3KSP A;  1G96 A;  2OCT A;  3MYT A;  4EV5 A;  2CWV A;  5IEN A;  1FGT A;  3SOA A;  3WDG B;  3LXU X;  2W2C A;  1M90 4;  1VQ8 3;  1QVG 2;  4N6V 0;  1VQO 3;  1T5Y A;  1EKM A;  1VQ5 3;  2CKF B;  3EF8 A;  1E97 A;  2QGU A;  5IEO A;  2OTL 3;  4NRE A;  1GYB A;  1Y4K A;  2JDI H;  3NM2 A;  3OWS A;  4WP5 A;  4X2O A;  3G0K A;  3Q2P A;  2FNQ A;  2XRX B;  3LZA A;  1VQM 3;  2LQV A;  2E2U A;  4FCJ A;  4J9A A;  3T0U A;  2XH9 A;  2HMO B;  2HMK B;  3DGN A;  4OUQ A;  1SQW A;  1IT8 A;  3OV4 A;  1N9J A;  4N6M A;  3GZB A;  1WQL B;  1YIJ 3;  3JUQ A;  3K63 A;  1M1K 4;  3CPO A;  1O7M B;  4N6N B;  1YGE A;  2O9U X;  3S28 A;  1WMP A;  5HGR A;  3UL5 A;  4FMD A;  4XDV A;  1GY7 A;  1SJW A;  3MHE A;  3OX9 A;  2IUJ A;  3B4O A;  3NQZ A;  3KN4 A;  3WMD A;  2Z76 A;  5AYR B;  5FW5 A;  2IMJ A;  4WFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...