2MF7A

Solution structure of the ims domain of the mitochondrial import protein tim21 from s. cerevisiae
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
GAMGSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM2
publication title Molecular Basis of the Dynamic Structure of the TIM23 Complex in the Mitochondrial Intermembrane Space.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.320 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2mf7A00
2MF7A 2CIUA
chains in the Genus database with same CATH superfamily
1S723 1N8QA 2FXTA 1NDOB 2ZDJA 5EEOA 1JKGB 5EVHA 1MOLA 1GY5A 2XGLA 4GL6A 1D6ZA 3OWUA 2HOHA 2OQEC 2GXFA 1HYFA 2L1SA 3NV0B 1O7HB 4I5QA 3V99A 4LZIA 3CCV3 1IV9A 1RKYA 1DVDA 5IEOA 1LOXA 2HMKB 3FLJA 2GEXA 2XSOB 4J8TA 2C10A 2E2TA 3CNMA 3FG1A 1GSPA 4PEJA 4KFDA 5LC7A 2IA7A 3S5CA 2BU4A 4CCVA 4ZM8A 3EHCA 4EXRA 1C54A 1W6CA 2STDA 1BU4A 3CU3A 3G713 3N54B 5AYSC 1YIT3 1B2MA 1TJDA 1RLSA 1JKGA 1WNHA 3STDA 3F8XA 5LC6A 2Y73A 2D42A 1NU3A 2K54A 1LNHA 3WOFB 1PU4A 5KP1A 1N8R4 1G96A 1VQ83 4GB5A 3WMDA 1LOWA 2LYXA 1K28A 1NO3A 2GU1A 4GSPA 2CFDA 4FMBA 3GZXB 3AHSA 2RCDA 1RCLA 1YJN3 1B21A 3VF1A 1DETA 1A90A 5ELUA 2HMOB 1BANA 1JN5A 3RGAA 3CC23 1TFOA 3SEDA 1RSNA 1JNQA 3G8ZA 1W2ZA 3U97A 3F9SA 5DREA 3WA3A 1IVWA 2YX9A 2IY2A 1BRJA 3SYUA 1IVXA 4XM4A 3K7CA 4EYCA 1IV7A 1TP6A 3I0YA 1B2ZA 1Q7HA 2YFJB 3CCJ3 1EG9B 5BXQA 3ZFZA 3DZLA 3NQZA 1X1UA 5D81A 3PCRA 1STDA 1ISKA 4N6UA 1W7CA 4AKZA 2LQVA 2W6JH 1FA3A 3F40A 2OCTA 5ELJA 2L4VA 1I0VA 2MF7A 2RGQA 1WMNA 2XR8B 2BMOB 2CC3A 2ML6A 5HGRA 2I9WA 2OWPA 1HKXA 4CPKA 5CF1A 5KP4A 3JVCA 5IERA 2JDIH 3GSPA 1V57A 3NBJA 4K90B 1I8VA 3EJVA 1LOYA 3FGYA 1UUVB 1BSBA 3S29A 1N5PA 1IT7A 1GD4A 1BUQA 3HIIA 4RNYA 1O7MB 1BSAA 2H0GA 1BRKA 2BT3A 4IT7A 1VQ63 1AVLA 3D4AA 1F8NA 1GY6A 3MG2A 1UCJA 2BHMA 3WDGB 1ASKA 1JB5A 2PZVA 4HM7B 3UL6A 2XSHB 4R9KA 1VQ93 5BIRA 2W56B 1OF5A 1RGAA 1O7WB 1UCIA 1GMRA 3D9RA 5IG3A 3CD63 5D82A 1YJW3 2CHCA 3UJMA 1MWTA 3MYTA 4QWTA 3RDEA 1JRQA 1UCLA 3CC73 2E2UA 3IMAB 1BRHA 2CX0A 4N6MA 1UUGB 3LTBA 1LXEA 2W03A 4EC6A 1B2UA 1X1WA 3GZYB 2CFGA 1VQP3 4NPBA 1FGMA 3G6E3 1NB3I 3LYGA 2XF3A 2QEX3 3CCE3 3DGYA 2IUKA 1E3VA 3KSPA 1WMOA 1BNIA 4EV2A 5D83A 1R4CA 4MMZB 1DE3A 1N9JA 3SXXA 4HM4B 4HOHA 4KT3B 1BGSA 5TGNA 3BB9A 4K1UA 4XBYA 4LYLB 4ILFA 9RNTA 5RNTA 3GWRA 1BNJA 4KZ1A 4O8SA 2KXGA 1VZZA 1I0XA 4AKYA 1VQM3 2Z76A 1BUJA 1G02A 3DGLA 3JUMA 1HU9A 4L8PA 4LGQA 2OOVC 1FGOA 1W5ZA 3HOHA 2RFRA 1I2EA 3OWYA 3IJEB 4X2HA 2CFLA 3FCSB 1BNFA 4R80A 1GYBA 2W9PA 4N6LA 3ALAA 1K8A4 1GOUA 1RHLA 2B24B 3T0UA 2GBXB 2CKFB 3NUVA 3RNTA 3B7CA 1JBTA 1KQS2 1LNIA 4N6V0 3CCR3 3FH1A 1W2B2 1DMNA 3PS8A 2K3DA 2UUGC 3QRDA 3D79A 1I3IA 1J2BA 3OWSA 2KCDA 2W9QA 1MWUA 3H3HA 5CLKA 2F86B 3SX1A 4N6OB 1M9GA 1UUWB 1KD14 2XGNA 3KFQC 4JF8A 1YHQ3 1QAKA 2ZA4A 3EE1A 2O3OA 3FF0A 3L0RA 4IIAA 1NJI4 2GSPA 1TIJA 2CW9A 3X42A 1IDPA 1QVF2 1PY3A 2RNTA 3UB1A 2CH9A 4L8OA 1US1A 3BNDA 3DUKA 4BIRA 1OGZA 1CYUA 3URPA 5A0OB 1HZ1A 1IT8A 4N6NB 1BNSA 1V58A 2CK3H 2XEPA 3BLZA 3LMLA 4DKIA 2F5WA 5IG5A 1RN4A 2Y74A 1QALA 2GU3A 1BIRA 1GD3A 2AAEA 3NV0A 1VQO3 1TTOA 4R1KA 1ZO2A 2P05A 3CCL3 1T5YA 5AIIA 3X3ZA 1IVUA 1FYSA 1WQLB 1UW1A 2MC8A 4MMXB 1JZDA 4EW5A 4MJDA 3MKIA 2CG0A 4J5GA 1ULJB 4NREA 1Z1SA 2HMMB 1AVKA 2RBIA 3PXMA 4LEHA 5BVBA 1NNVA 3F7SA 4J5KA 3AHWA 3O8YA 1VQQA 1VQN3 1GOVA 2V1LA 2J8XB 3CNXA 1I3FA 1ULIB 1Q824 2BIRA 3HX8A 1A2VA 1N5HA 3BIRA 1YGEA 1I2FA 4AEQA 1KWIA 1SARA 1DMMA 3FG4A 1MGRA 1OH0A 1W4NA 1BNEA 1K9M4 1OGXA 3FKAA 5FW5A 5G2GA 4HBRA 1PFPA 5BU4A 1GMQA 2QA43 3MG1A 1M904 3KZTA 1SIHA 1QVG2 4HYZA 4BL3A 1SJWA 1S5AA 3K9MC 1R4YA 3I563 3NQYA 2PNCA 1JBSA 4KFFA 1BSEA 3HIGA 3JUQA 2OOVA 4WP5A 5M19A 1K734 3ER7A 4G1MB 1UI7A 1WTHA 3X41A 5AIGA 2F99A 4N3VA 5FGOA 1DMQA 4BTWA 3EQQB 8RNTA 1RTUA 3DY5A 1VQK3 1QJGA 4WWUC 3Q1CA 3NHXA 5IG0A 3LXUX 1Y4KA 2BO9B 3K5TA 3WOEB 1A2KA 3AMOB 3N8BA 2WOHA 3T8UA 1FUSA 3EBYA 3N9HA 3NBBA 3MSOA 2H0HA 3CPOA 1E97A 3KN4A 4JRFA 3GZBA 3DXOA 1O7NB 1YVBI 4L7KA 2C11A 4LMIA 4HM8B 4WFOA 2P0XA 4K1VA 1VQ73 5JPUA 3SLUA 1OACA 1QAFA 3LT8A 3S27A 1TU5A 3FG3A 5AYRB 1LOVA 5M1AA 1OHOA 5KP3A 2A15A 4N6TA 1UDII 4HM5B 3HI7A 3ROBA 1OHSA 1U8CB 1IVVA 2CWTA 3AMOA 3QK9A 3PGBA 2Z6BA 3B4PA 3NM7A 4HM1B 4KVHA 4HM0B 2K0MA 2BMRB 2WGQA 3FF2A 2W56A 2YFLB 3DGNA 1EKMA 2W2CA 3LT9A 3EBTA 5CF2A 2FGTA 1Q40B 3JUPA 4FMCA 1E3RA 2QIYA 3Q3FA 4O02B 2QGUA 3WA2X 3LTCA 1IYYA 2WO0A 1RDSA 1BSCA 1D6UA 1W6YA 1KC84 3SVAA 3DMCA 5STDA 3NBRA 2CG1A 2W04A 3F14A 1X1XA 1FZUA 1C7HA 1SIIA 2KAAA 4CJNA 5IEPA 4BU4A 1V74A 1FGTA 2F4YA 1JZOA 3PZWA 1JJ22 1IQYA 1W01A 1RGHA 1MGWA 2KRTA 3KE7A 4BL2A 4KFEA 1CH0A 1W00A 3EF8A 3LTDA 3OX9A 3DM8A 3WR2A 2HMNB 3B4OA 2F98A 6GSPA 1NB5I 3BNEA 2HMLB 1UGHI 1GMPA 4HM3B 2CFWA 4WYKB 1RRLA 3SOYA 3UL5A 1RJOA 1O7GB 1WMPA 3U1WA 1UGIA 1T2HA 3F8HA 4HKVB 1RGCA 4GHOA 5G1LA 1BNRA 3VSYA 5HOHA 1JB4A 2HMJB 1LRAA 1FUWA 3CCQ3 2O9UX 4O3VA 1IK3A 7STDA 4OK0A 4HAAA 2B1XB 1BSDA 1AV4A 3CPW2 1N9EA 2F56A 3K0ZA 1T3BA 4STDA 1YVSA 1SPUA 3G0KA 1B3SA 4J9AA 1RGEA 3D5IA 4BTYA 4FMAA 3CCU3 4OVMA 3WODG 2M7OA 3MG3A 3CME3 1I70A 1IQ8A 1O7PB 3EB8A 1CQSA 5EQLA 5AEWB 1RMSA 2KF6A 4FCZA 1YI23 2XH9A 1MNLA 3E99A 3IPTA 3GAXA 3LH4A 1OCVA 1W6GA 4XBXA 1OPYA 5G1KA 1BVIA 3S67A 1JB2A 1JV2B 4HZ9B 3J7Yd 4O2HA 1GY7A 3X3YA 5CK6A 1TRPA 7GSPA 3D3LA 1RNTA 1JN5B 4HM6B 1G0TA 4MMYB 3I553 3VGNA 1B2XA 4OUQA 4FCMA 1B27A 1Q7Y4 1MWSA 1AQZA 2XRXB 5M18A 1DVCA 3X3XA 1B20A 1LQMB 3CMA3 1RGGA 6RNTA 2CWUA 4R4KA 1UI8A 4EBGA 2Q07A 3MWZA 3CXC2 1PYLA 3S28A 5CXOA 1FUTA 1VQ53 2XFTA 1ROAA 1VQ43 2IYJA 3OXAA 3V98A 1LQGC 1EA2A 1BRGA 1B2SA 1K41A 1EEJA 3MPHA 3OV4A 4XB5A 1BRNL 1W02A 1YGWA 1ZX2A 3A5EA 3EX9A 4XDVA 1QMAA 5AIFA 2CWVA 2F5MA 3G16A 3HK4A 3MHEA 4HM2B 1Q42A 3FSDA 6STDA 4H3UA 4XDWA 3ECFA 3A76A 4X2OA 3ZG0A 1SQWA 3EN1B 3H51A 1RGLA 5GSPA 3ZG5A 3DH2A 3BNCA 5IG4A 1A2PA 2XFSA 1RNBA 5JPPA 3FZWA 3JUNA 4RZMA 5DRVA 1TRQA 3TDGA 2INXA 1NWWA 1KSIA 1RGKA 4XBTA 5AI1A 3RGRA 1OHPA 5IENA 4HVNA 1RGFA 2CX1A 2E2VA 1FGQA 1D6YA 2UGIA 2W0QA 4FCJA 1OF5B 4FR9A 3K63A 3D5GA 4NHFA 1Q814 4TX4A 5AEUB 1X1YA 1DYUA 3CCM3 1LVNA 2FNQA 1L5GB 3CC43 1BOXA 2OTJ3 1AR0A 2R4IA 2P09A 1FGRA 1RCKA 2CIUA 2Z7AA 1A67A 1CYVA 2SARA 3JUOA 2ML5A 4RNZA 3NX0A 1ROVA 4ORLA 4H61A 1RN7A 2D1WA 1GOYA 2ZHXB 1IU7A 1OUNA 2JQ5A 3KIIA 3KKGA 4IPBA 4HJLB 1TFKA 3GZRA 1BRSA 3NM2A 4I4KA 1UCKA 2CFKA 3DGMA 1Q9EA 2OQEA 2IUJA 1YNVX 4HZBB 5I97A 1RN1A 3Q2PA 5AIHA 2R41A 3KSED 3OW22 1VQL3 2KF5A 4R9LA 1T2IA 3WHOA 2P38A 1RRHA 3LOYA 4K61A 2ZL8A 3BU4A 3CCS3 1GS3A 1EUIC 1ZGXA 2AADA 2KF4A 3V92A 5JBSA 2OTL3 2RSXA 2WGOA 2KF3A 1M1XB 3UNLA 4BTXA 2WOFA 2Z77A 3AGNA 4WHAA 8CHOA 5IF6A 3EC9A 2IMJA 2SBLA 3EN8A 3LTAA 3Q90A 3DGOA 3KCHA 7RNTA 3PCSA 3PYJA 4MEIA 1IQXA 1YJ93 1BNGA 1Q40A 2BMQB 4RBNA 4LSOA 1EQKA 1FW7A 3LZAA 1Q864 1BAOA 1MWRA 1BRIA 1YIJ3 4Q53A 3T8NA 2BNGA 3B8LA 4RNTA 3GRDA 2C4BA 1AY7A 2GBWB 1JBRA 2YFIB 4EV5A 3M8CA 1M1K4 3F7XA 1I2GA 1TUHA 2P0MA 1STFI 4U13A 3G4S3 3X40A 1U5OA 2H0IA 2UX0A 5IW9A 3BNBA 4CDLA 3HZPA 3SOAA 2GEYA 3AGOA 4FMDA 4WYKA 3NXJA 1ZS7A 1CEWI
chains in the Genus database with same CATH topology
1S723 1N8QA 2FXTA 1NDOB 2ZDJA 5EEOA 1JKGB 5EVHA 1MOLA 1GY5A 2XGLA 4GL6A 1D6ZA 3OWUA 2OQEC 2GXFA 3NV0B 1O7HB 3V99A 4LZIA 3CCV3 1IV9A 1RKYA 1DVDA 5IEOA 1LOXA 2HMKB 3FLJA 2GEXA 2XSOB 4J8TA 2C10A 2E2TA 3CNMA 3FG1A 3S5CA 4PEJA 4KFDA 5LC7A 2IA7A 4CCVA 4ZM8A 3EHCA 4EXRA 1W6CA 2STDA 3CU3A 3G713 3N54B 5AYSC 1YIT3 1JKGA 1WNHA 3STDA 3F8XA 5LC6A 2Y73A 2D42A 1NU3A 2K54A 1LNHA 3WOFB 1PU4A 5KP1A 1N8R4 1G96A 1VQ83 4GB5A 3WMDA 2LYXA 1K28A 1NO3A 2GU1A 2CFDA 4FMBA 3GZXB 2RCDA 1YJN3 3VF1A 1A90A 5ELUA 2HMOB 1JN5A 3RGAA 3CC23 1TFOA 3SEDA 1JNQA 3G8ZA 1W2ZA 3U97A 3F9SA 5DREA 3WA3A 1IVWA 2YX9A 1IVXA 4XM4A 3K7CA 4EYCA 1IV7A 1TP6A 3I0YA 3CCJ3 2YFJB 1EG9B 5BXQA 3DZLA 3NQZA 5D81A 3PCRA 1STDA 1ISKA 4N6UA 1W7CA 4AKZA 2LQVA 2W6JH 1FA3A 3F40A 2OCTA 5ELJA 2L4VA 2MF7A 2RGQA 2XR8B 1WMNA 5IG4A 2BMOB 2CC3A 2ML6A 5HGRA 2I9WA 2OWPA 1HKXA 5CF1A 5KP4A 3JVCA 5IERA 2JDIH 3NBJA 4K90B 3EJVA 3FGYA 1UUVB 3S29A 1N5PA 1IT7A 1GD4A 1BUQA 3HIIA 4RNYA 1O7MB 4IT7A 2BT3A 1VQ63 1AVLA 1F8NA 1GY6A 3MG2A 2BHMA 3WDGB 1ASKA 1JB5A 2PZVA 4HM7B 3UL6A 2XSHB 4R9KA 1VQ93 2W56B 1OF5A 1O7WB 3D9RA 5IG3A 3CD63 5D82A 1YJW3 2CHCA 3UJMA 3MYTA 4QWTA 3RDEA 1JRQA 3CC73 2E2UA 3IMAB 4N6MA 3LTBA 1LXEA 2W03A 4EC6A 3GZYB 2CFGA 1VQP3 1FGMA 3G6E3 1NB3I 3LYGA 2XF3A 2QEX3 3CCE3 2IUKA 1E3VA 3KSPA 1WMOA 4EV2A 5D83A 1R4CA 4MMZB 1N9JA 3SXXA 4HM4B 5TGNA 3BB9A 4K1UA 4XBYA 3GWRA 4KZ1A 4O8SA 2KXGA 1VZZA 4AKYA 1VQM3 2Z76A 4L8PA 3DGLA 3JUMA 1HU9A 4LGQA 2OOVC 1FGOA 1W5ZA 2RFRA 3OWYA 3IJEB 4X2HA 2CFLA 3FCSB 4R80A 1GYBA 2W9PA 4N6LA 3ALAA 1K8A4 2B24B 3T0UA 2GBXB 2CKFB 3NUVA 1KQS2 3B7CA 4N6V0 3CCR3 3FH1A 1W2B2 1DMNA 3PS8A 3QRDA 1J2BA 3OWSA 2KCDA 2W9QA 3H3HA 5CLKA 2F86B 3SX1A 4N6OB 1M9GA 1UUWB 1KD14 2XGNA 3KFQC 4JF8A 1YHQ3 1QAKA 3FF0A 3EE1A 2O3OA 3L0RA 4IIAA 1NJI4 3X42A 1TIJA 2CW9A 1IDPA 1QVF2 3UB1A 2CH9A 4L8OA 1US1A 3BNDA 3DUKA 1OGZA 1CYUA 5A0OB 1IT8A 4N6NB 3BLZA 2CK3H 2XEPA 3LMLA 5IG5A 2Y74A 1QALA 2GU3A 1GD3A 3NV0A 1VQO3 4R1KA 1ZO2A 2P05A 3CCL3 1T5YA 5AIIA 3X3ZA 1IVUA 1WQLB 1UW1A 2MC8A 4MMXB 4MJDA 3MKIA 2CG0A 4NREA 1ULJB 1Z1SA 2HMMB 1AVKA 3PXMA 4LEHA 5BVBA 3F7SA 3O8YA 1VQN3 2V1LA 3CNXA 1ULIB 1Q824 3HX8A 1A2VA 1N5HA 1YGEA 4AEQA 1KWIA 1DMMA 3FG4A 1OH0A 1W4NA 1K9M4 1OGXA 3FKAA 5FW5A 5G2GA 4HBRA 1PFPA 2QA43 3MG1A 1M904 3KZTA 1SIHA 1QVG2 4HYZA 1SJWA 1S5AA 3K9MC 3I563 3NQYA 2PNCA 4KFFA 3HIGA 3JUQA 2OOVA 4WP5A 1K734 3ER7A 4G1MB 1UI7A 1WTHA 3X41A 5AIGA 2F99A 4N3VA 5FGOA 1DMQA 4BTWA 3EQQB 3DY5A 1VQK3 1QJGA 4WWUC 3Q1CA 3NHXA 5IG0A 3LXUX 1Y4KA 2BO9B 3K5TA 3WOEB 1A2KA 3AMOB 3N8BA 2WOHA 3T8UA 3EBYA 3N9HA 3NBBA 3MSOA 3CPOA 1E97A 3KN4A 4JRFA 3GZBA 3DXOA 1O7NB 1YVBI 4L7KA 2C11A 4LMIA 4HM8B 4WFOA 2P0XA 4K1VA 1VQ73 5JPUA 3SLUA 1OACA 1QAFA 3LT8A 3S27A 1TU5A 3FG3A 5AYRB 1OHOA 5KP3A 2A15A 4N6TA 4HM5B 3ROBA 3HI7A 1OHSA 1U8CB 1IVVA 2CWTA 3AMOA 3QK9A 3PGBA 2Z6BA 3B4PA 3NM7A 4HM1B 4KVHA 4HM0B 2K0MA 2BMRB 2WGQA 3FF2A 2W56A 2YFLB 3DGNA 1EKMA 2W2CA 3LT9A 3EBTA 5CF2A 2FGTA 1Q40B 3JUPA 4FMCA 1E3RA 2QIYA 4O02B 2QGUA 3WA2X 3LTCA 2WO0A 1D6UA 1W6YA 1KC84 3SVAA 3DMCA 5STDA 3NBRA 2CG1A 2W04A 3F14A 1C7HA 1SIIA 5IEPA 1V74A 1FGTA 3PZWA 1JJ22 1IQYA 1W01A 2KRTA 3KE7A 4KFEA 1W00A 3EF8A 3LTDA 3OX9A 3DM8A 2HMNB 3B4OA 2F98A 1NB5I 3BNEA 2HMLB 4HM3B 2CFWA 4WYKB 1RRLA 3SOYA 3UL5A 1RJOA 1O7GB 1WMPA 3U1WA 3F8HA 4HKVB 3VSYA 1JB4A 2HMJB 1FUWA 3CCQ3 2O9UX 4O3VA 1IK3A 7STDA 4OK0A 2B1XB 1AV4A 3CPW2 1N9EA 3K0ZA 4STDA 1SPUA 3G0KA 4J9AA 4BTYA 4FMAA 3CCU3 4OVMA 3WODG 2M7OA 3MG3A 3CME3 1IQ8A 1O7PB 3EB8A 1CQSA 5EQLA 5AEWB 4FCZA 1YI23 2XH9A 1MNLA 3E99A 3IPTA 3GAXA 3LH4A 1OCVA 1W6GA 4XBXA 1OPYA 3S67A 1JB2A 1JV2B 4HZ9B 3J7Yd 4O2HA 1GY7A 3X3YA 5CK6A 3D3LA 4HM6B 1JN5B 4MMYB 3I553 3VGNA 4OUQA 4FCMA 1Q7Y4 2XRXB 1DVCA 3X3XA 3CMA3 2CWUA 4R4KA 1UI8A 4EBGA 2Q07A 3MWZA 3CXC2 3S28A 5CXOA 1VQ53 2XFTA 1ROAA 1VQ43 3OXAA 3V98A 1EA2A 1K41A 3MPHA 3OV4A 4XB5A 1W02A 1ZX2A 3EX9A 4XDVA 1QMAA 5AIFA 2CWVA 3G16A 3HK4A 3MHEA 4HM2B 6STDA 1Q42A 3FSDA 4H3UA 4XDWA 3ECFA 3A76A 4X2OA 1SQWA 3EN1B 3H51A 3BNCA 2XFSA 5JPPA 3FZWA 3JUNA 4RZMA 5DRVA 3TDGA 2INXA 1NWWA 1KSIA 4XBTA 5AI1A 3RGRA 1OHPA 5IENA 4HVNA 2E2VA 1FGQA 1D6YA 2W0QA 4FR9A 4FCJA 1OF5B 1Q814 3K63A 4NHFA 4TX4A 5AEUB 1DYUA 3CCM3 1LVNA 2FNQA 1L5GB 3CC43 2OTJ3 1AR0A 2R4IA 2P09A 1FGRA 2CIUA 2Z7AA 1A67A 1CYVA 3JUOA 2ML5A 4RNZA 3NX0A 1ROVA 4ORLA 4H61A 1RN7A 2D1WA 1IU7A 1OUNA 2JQ5A 3KIIA 3KKGA 4IPBA 4HJLB 1TFKA 3GZRA 3NM2A 4I4KA 2CFKA 3DGMA 2IUJA 2OQEA 5I97A 4HZBB 3Q2PA 5AIHA 3KSED 3OW22 1VQL3 4R9LA 2P38A 1RRHA 3LOYA 4K61A 2ZL8A 3CCS3 1GS3A 5JBSA 3V92A 2OTL3 2RSXA 2WGOA 3UNLA 1M1XB 4BTXA 2WOFA 2Z77A 4WHAA 8CHOA 5IF6A 3EC9A 2IMJA 2SBLA 3EN8A 3LTAA 3Q90A 3DGOA 3PCSA 3PYJA 4MEIA 1IQXA 1YJ93 1Q40A 2BMQB 4RBNA 4LSOA 1EQKA 3LZAA 1Q864 1YIJ3 4Q53A 3T8NA 2BNGA 3B8LA 3GRDA 2GBWB 2YFIB 4EV5A 3M8CA 1M1K4 3F7XA 1TUHA 2P0MA 1STFI 4U13A 3G4S3 3X40A 1U5OA 2UX0A 5IW9A 3BNBA 4CDLA 3HZPA 3SOAA 2GEYA 4FMDA 4WYKA 3NXJA 1CEWI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF7 A;  2CIU A; 
#chains in the Genus database with same CATH topology
 1S72 3;  1N8Q A;  2FXT A;  1NDO B;  2ZDJ A;  5EEO A;  1JKG B;  5EVH A;  1MOL A;  1GY5 A;  2XGL A;  4GL6 A;  1D6Z A;  3OWU A;  2HOH A;  2OQE C;  2GXF A;  1HYF A;  2L1S A;  3NV0 B;  1O7H B;  4I5Q A;  3V99 A;  4LZI A;  3CCV 3;  1IV9 A;  1RKY A;  1DVD A;  5IEO A;  1LOX A;  2HMK B;  3FLJ A;  2GEX A;  2XSO B;  4J8T A;  2C10 A;  2E2T A;  3CNM A;  3FG1 A;  1GSP A;  4PEJ A;  4KFD A;  5LC7 A;  2IA7 A;  3S5C A;  2BU4 A;  4CCV A;  4ZM8 A;  3EHC A;  4EXR A;  1C54 A;  1W6C A;  2STD A;  1BU4 A;  3CU3 A;  3G71 3;  3N54 B;  5AYS C;  1YIT 3;  1B2M A;  1TJD A;  1RLS A;  1JKG A;  1WNH A;  3STD A;  3F8X A;  5LC6 A;  2Y73 A;  2D42 A;  1NU3 A;  2K54 A;  1LNH A;  3WOF B;  1PU4 A;  5KP1 A;  1N8R 4;  1G96 A;  1VQ8 3;  4GB5 A;  3WMD A;  1LOW A;  2LYX A;  1K28 A;  1NO3 A;  2GU1 A;  4GSP A;  2CFD A;  4FMB A;  3GZX B;  3AHS A;  2RCD A;  1RCL A;  1YJN 3;  1B21 A;  3VF1 A;  1DET A;  1A90 A;  5ELU A;  2HMO B;  1BAN A;  1JN5 A;  3RGA A;  3CC2 3;  1TFO A;  3SED A;  1RSN A;  1JNQ A;  3G8Z A;  1W2Z A;  3U97 A;  3F9S A;  5DRE A;  3WA3 A;  1IVW A;  2YX9 A;  2IY2 A;  1BRJ A;  3SYU A;  1IVX A;  4XM4 A;  3K7C A;  4EYC A;  1IV7 A;  1TP6 A;  3I0Y A;  1B2Z A;  1Q7H A;  2YFJ B;  3CCJ 3;  1EG9 B;  5BXQ A;  3ZFZ A;  3DZL A;  3NQZ A;  1X1U A;  5D81 A;  3PCR A;  1STD A;  1ISK A;  4N6U A;  1W7C A;  4AKZ A;  2LQV A;  2W6J H;  1FA3 A;  3F40 A;  2OCT A;  5ELJ A;  2L4V A;  1I0V A;  2MF7 A;  2RGQ A;  1WMN A;  2XR8 B;  2BMO B;  2CC3 A;  2ML6 A;  5HGR A;  2I9W A;  2OWP A;  1HKX A;  4CPK A;  5CF1 A;  5KP4 A;  3JVC A;  5IER A;  2JDI H;  3GSP A;  1V57 A;  3NBJ A;  4K90 B;  1I8V A;  3EJV A;  1LOY A;  3FGY A;  1UUV B;  1BSB A;  3S29 A;  1N5P A;  1IT7 A;  1GD4 A;  1BUQ A;  3HII A;  4RNY A;  1O7M B;  1BSA A;  2H0G A;  1BRK A;  2BT3 A;  4IT7 A;  1VQ6 3;  1AVL A;  3D4A A;  1F8N A;  1GY6 A;  3MG2 A;  1UCJ A;  2BHM A;  3WDG B;  1ASK A;  1JB5 A;  2PZV A;  4HM7 B;  3UL6 A;  2XSH B;  4R9K A;  1VQ9 3;  5BIR A;  2W56 B;  1OF5 A;  1RGA A;  1O7W B;  1UCI A;  1GMR A;  3D9R A;  5IG3 A;  3CD6 3;  5D82 A;  1YJW 3;  2CHC A;  3UJM A;  1MWT A;  3MYT A;  4QWT A;  3RDE A;  1JRQ A;  1UCL A;  3CC7 3;  2E2U A;  3IMA B;  1BRH A;  2CX0 A;  4N6M A;  1UUG B;  3LTB A;  1LXE A;  2W03 A;  4EC6 A;  1B2U A;  1X1W A;  3GZY B;  2CFG A;  1VQP 3;  4NPB A;  1FGM A;  3G6E 3;  1NB3 I;  3LYG A;  2XF3 A;  2QEX 3;  3CCE 3;  3DGY A;  2IUK A;  1E3V A;  3KSP A;  1WMO A;  1BNI A;  4EV2 A;  5D83 A;  1R4C A;  4MMZ B;  1DE3 A;  1N9J A;  3SXX A;  4HM4 B;  4HOH A;  4KT3 B;  1BGS A;  5TGN A;  3BB9 A;  4K1U A;  4XBY A;  4LYL B;  4ILF A;  9RNT A;  5RNT A;  3GWR A;  1BNJ A;  4KZ1 A;  4O8S A;  2KXG A;  1VZZ A;  1I0X A;  4AKY A;  1VQM 3;  2Z76 A;  1BUJ A;  1G02 A;  3DGL A;  3JUM A;  1HU9 A;  4L8P A;  4LGQ A;  2OOV C;  1FGO A;  1W5Z A;  3HOH A;  2RFR A;  1I2E A;  3OWY A;  3IJE B;  4X2H A;  2CFL A;  3FCS B;  1BNF A;  4R80 A;  1GYB A;  2W9P A;  4N6L A;  3ALA A;  1K8A 4;  1GOU A;  1RHL A;  2B24 B;  3T0U A;  2GBX B;  2CKF B;  3NUV A;  3RNT A;  3B7C A;  1JBT A;  1KQS 2;  1LNI A;  4N6V 0;  3CCR 3;  3FH1 A;  1W2B 2;  1DMN A;  3PS8 A;  2K3D A;  2UUG C;  3QRD A;  3D79 A;  1I3I A;  1J2B A;  3OWS A;  2KCD A;  2W9Q A;  1MWU A;  3H3H A;  5CLK A;  2F86 B;  3SX1 A;  4N6O B;  1M9G A;  1UUW B;  1KD1 4;  2XGN A;  3KFQ C;  4JF8 A;  1YHQ 3;  1QAK A;  2ZA4 A;  3EE1 A;  2O3O A;  3FF0 A;  3L0R A;  4IIA A;  1NJI 4;  2GSP A;  1TIJ A;  2CW9 A;  3X42 A;  1IDP A;  1QVF 2;  1PY3 A;  2RNT A;  3UB1 A;  2CH9 A;  4L8O A;  1US1 A;  3BND A;  3DUK A;  4BIR A;  1OGZ A;  1CYU A;  3URP A;  5A0O B;  1HZ1 A;  1IT8 A;  4N6N B;  1BNS A;  1V58 A;  2CK3 H;  2XEP A;  3BLZ A;  3LML A;  4DKI A;  2F5W A;  5IG5 A;  1RN4 A;  2Y74 A;  1QAL A;  2GU3 A;  1BIR A;  1GD3 A;  2AAE A;  3NV0 A;  1VQO 3;  1TTO A;  4R1K A;  1ZO2 A;  2P05 A;  3CCL 3;  1T5Y A;  5AII A;  3X3Z A;  1IVU A;  1FYS A;  1WQL B;  1UW1 A;  2MC8 A;  4MMX B;  1JZD A;  4EW5 A;  4MJD A;  3MKI A;  2CG0 A;  4J5G A;  1ULJ B;  4NRE A;  1Z1S A;  2HMM B;  1AVK A;  2RBI A;  3PXM A;  4LEH A;  5BVB A;  1NNV A;  3F7S A;  4J5K A;  3AHW A;  3O8Y A;  1VQQ A;  1VQN 3;  1GOV A;  2V1L A;  2J8X B;  3CNX A;  1I3F A;  1ULI B;  1Q82 4;  2BIR A;  3HX8 A;  1A2V A;  1N5H A;  3BIR A;  1YGE A;  1I2F A;  4AEQ A;  1KWI A;  1SAR A;  1DMM A;  3FG4 A;  1MGR A;  1OH0 A;  1W4N A;  1BNE A;  1K9M 4;  1OGX A;  3FKA A;  5FW5 A;  5G2G A;  4HBR A;  1PFP A;  5BU4 A;  1GMQ A;  2QA4 3;  3MG1 A;  1M90 4;  3KZT A;  1SIH A;  1QVG 2;  4HYZ A;  4BL3 A;  1SJW A;  1S5A A;  3K9M C;  1R4Y A;  3I56 3;  3NQY A;  2PNC A;  1JBS A;  4KFF A;  1BSE A;  3HIG A;  3JUQ A;  2OOV A;  4WP5 A;  5M19 A;  1K73 4;  3ER7 A;  4G1M B;  1UI7 A;  1WTH A;  3X41 A;  5AIG A;  2F99 A;  4N3V A;  5FGO A;  1DMQ A;  4BTW A;  3EQQ B;  8RNT A;  1RTU A;  3DY5 A;  1VQK 3;  1QJG A;  4WWU C;  3Q1C A;  3NHX A;  5IG0 A;  3LXU X;  1Y4K A;  2BO9 B;  3K5T A;  3WOE B;  1A2K A;  3AMO B;  3N8B A;  2WOH A;  3T8U A;  1FUS A;  3EBY A;  3N9H A;  3NBB A;  3MSO A;  2H0H A;  3CPO A;  1E97 A;  3KN4 A;  4JRF A;  3GZB A;  3DXO A;  1O7N B;  1YVB I;  4L7K A;  2C11 A;  4LMI A;  4HM8 B;  4WFO A;  2P0X A;  4K1V A;  1VQ7 3;  5JPU A;  3SLU A;  1OAC A;  1QAF A;  3LT8 A;  3S27 A;  1TU5 A;  3FG3 A;  5AYR B;  1LOV A;  5M1A A;  1OHO A;  5KP3 A;  2A15 A;  4N6T A;  1UDI I;  4HM5 B;  3HI7 A;  3ROB A;  1OHS A;  1U8C B;  1IVV A;  2CWT A;  3AMO A;  3QK9 A;  3PGB A;  2Z6B A;  3B4P A;  3NM7 A;  4HM1 B;  4KVH A;  4HM0 B;  2K0M A;  2BMR B;  2WGQ A;  3FF2 A;  2W56 A;  2YFL B;  3DGN A;  1EKM A;  2W2C A;  3LT9 A;  3EBT A;  5CF2 A;  2FGT A;  1Q40 B;  3JUP A;  4FMC A;  1E3R A;  2QIY A;  3Q3F A;  4O02 B;  2QGU A;  3WA2 X;  3LTC A;  1IYY A;  2WO0 A;  1RDS A;  1BSC A;  1D6U A;  1W6Y A;  1KC8 4;  3SVA A;  3DMC A;  5STD A;  3NBR A;  2CG1 A;  2W04 A;  3F14 A;  1X1X A;  1FZU A;  1C7H A;  1SII A;  2KAA A;  4CJN A;  5IEP A;  4BU4 A;  1V74 A;  1FGT A;  2F4Y A;  1JZO A;  3PZW A;  1JJ2 2;  1IQY A;  1W01 A;  1RGH A;  1MGW A;  2KRT A;  3KE7 A;  4BL2 A;  4KFE A;  1CH0 A;  1W00 A;  3EF8 A;  3LTD A;  3OX9 A;  3DM8 A;  3WR2 A;  2HMN B;  3B4O A;  2F98 A;  6GSP A;  1NB5 I;  3BNE A;  2HML B;  1UGH I;  1GMP A;  4HM3 B;  2CFW A;  4WYK B;  1RRL A;  3SOY A;  3UL5 A;  1RJO A;  1O7G B;  1WMP A;  3U1W A;  1UGI A;  1T2H A;  3F8H A;  4HKV B;  1RGC A;  4GHO A;  5G1L A;  1BNR A;  3VSY A;  5HOH A;  1JB4 A;  2HMJ B;  1LRA A;  1FUW A;  3CCQ 3;  2O9U X;  4O3V A;  1IK3 A;  7STD A;  4OK0 A;  4HAA A;  2B1X B;  1BSD A;  1AV4 A;  3CPW 2;  1N9E A;  2F56 A;  3K0Z A;  1T3B A;  4STD A;  1YVS A;  1SPU A;  3G0K A;  1B3S A;  4J9A A;  1RGE A;  3D5I A;  4BTY A;  4FMA A;  3CCU 3;  4OVM A;  3WOD G;  2M7O A;  3MG3 A;  3CME 3;  1I70 A;  1IQ8 A;  1O7P B;  3EB8 A;  1CQS A;  5EQL A;  5AEW B;  1RMS A;  2KF6 A;  4FCZ A;  1YI2 3;  2XH9 A;  1MNL A;  3E99 A;  3IPT A;  3GAX A;  3LH4 A;  1OCV A;  1W6G A;  4XBX A;  1OPY A;  5G1K A;  1BVI A;  3S67 A;  1JB2 A;  1JV2 B;  4HZ9 B;  3J7Y d;  4O2H A;  1GY7 A;  3X3Y A;  5CK6 A;  1TRP A;  7GSP A;  3D3L A;  1RNT A;  1JN5 B;  4HM6 B;  1G0T A;  4MMY B;  3I55 3;  3VGN A;  1B2X A;  4OUQ A;  4FCM A;  1B27 A;  1Q7Y 4;  1MWS A;  1AQZ A;  2XRX B;  5M18 A;  1DVC A;  3X3X A;  1B20 A;  1LQM B;  3CMA 3;  1RGG A;  6RNT A;  2CWU A;  4R4K A;  1UI8 A;  4EBG A;  2Q07 A;  3MWZ A;  3CXC 2;  1PYL A;  3S28 A;  5CXO A;  1FUT A;  1VQ5 3;  2XFT A;  1ROA A;  1VQ4 3;  2IYJ A;  3OXA A;  3V98 A;  1LQG C;  1EA2 A;  1BRG A;  1B2S A;  1K41 A;  1EEJ A;  3MPH A;  3OV4 A;  4XB5 A;  1BRN L;  1W02 A;  1YGW A;  1ZX2 A;  3A5E A;  3EX9 A;  4XDV A;  1QMA A;  5AIF A;  2CWV A;  2F5M A;  3G16 A;  3HK4 A;  3MHE A;  4HM2 B;  1Q42 A;  3FSD A;  6STD A;  4H3U A;  4XDW A;  3ECF A;  3A76 A;  4X2O A;  3ZG0 A;  1SQW A;  3EN1 B;  3H51 A;  1RGL A;  5GSP A;  3ZG5 A;  3DH2 A;  3BNC A;  5IG4 A;  1A2P A;  2XFS A;  1RNB A;  5JPP A;  3FZW A;  3JUN A;  4RZM A;  5DRV A;  1TRQ A;  3TDG A;  2INX A;  1NWW A;  1KSI A;  1RGK A;  4XBT A;  5AI1 A;  3RGR A;  1OHP A;  5IEN A;  4HVN A;  1RGF A;  2CX1 A;  2E2V A;  1FGQ A;  1D6Y A;  2UGI A;  2W0Q A;  4FCJ A;  1OF5 B;  4FR9 A;  3K63 A;  3D5G A;  4NHF A;  1Q81 4;  4TX4 A;  5AEU B;  1X1Y A;  1DYU A;  3CCM 3;  1LVN A;  2FNQ A;  1L5G B;  3CC4 3;  1BOX A;  2OTJ 3;  1AR0 A;  2R4I A;  2P09 A;  1FGR A;  1RCK A;  2CIU A;  2Z7A A;  1A67 A;  1CYV A;  2SAR A;  3JUO A;  2ML5 A;  4RNZ A;  3NX0 A;  1ROV A;  4ORL A;  4H61 A;  1RN7 A;  2D1W A;  1GOY A;  2ZHX B;  1IU7 A;  1OUN A;  2JQ5 A;  3KII A;  3KKG A;  4IPB A;  4HJL B;  1TFK A;  3GZR A;  1BRS A;  3NM2 A;  4I4K A;  1UCK A;  2CFK A;  3DGM A;  1Q9E A;  2OQE A;  2IUJ A;  1YNV X;  4HZB B;  5I97 A;  1RN1 A;  3Q2P A;  5AIH A;  2R41 A;  3KSE D;  3OW2 2;  1VQL 3;  2KF5 A;  4R9L A;  1T2I A;  3WHO A;  2P38 A;  1RRH A;  3LOY A;  4K61 A;  2ZL8 A;  3BU4 A;  3CCS 3;  1GS3 A;  1EUI C;  1ZGX A;  2AAD A;  2KF4 A;  3V92 A;  5JBS A;  2OTL 3;  2RSX A;  2WGO A;  2KF3 A;  1M1X B;  3UNL A;  4BTX A;  2WOF A;  2Z77 A;  3AGN A;  4WHA A;  8CHO A;  5IF6 A;  3EC9 A;  2IMJ A;  2SBL A;  3EN8 A;  3LTA A;  3Q90 A;  3DGO A;  3KCH A;  7RNT A;  3PCS A;  3PYJ A;  4MEI A;  1IQX A;  1YJ9 3;  1BNG A;  1Q40 A;  2BMQ B;  4RBN A;  4LSO A;  1EQK A;  1FW7 A;  3LZA A;  1Q86 4;  1BAO A;  1MWR A;  1BRI A;  1YIJ 3;  4Q53 A;  3T8N A;  2BNG A;  3B8L A;  4RNT A;  3GRD A;  2C4B A;  1AY7 A;  2GBW B;  1JBR A;  2YFI B;  4EV5 A;  3M8C A;  1M1K 4;  3F7X A;  1I2G A;  1TUH A;  2P0M A;  1STF I;  4U13 A;  3G4S 3;  3X40 A;  1U5O A;  2H0I A;  2UX0 A;  5IW9 A;  3BNB A;  4CDL A;  3HZP A;  3SOA A;  2GEY A;  3AGO A;  4FMD A;  4WYK A;  3NXJ A;  1ZS7 A;  1CEW I; 
#chains in the Genus database with same CATH homology
 1S72 3;  1N8Q A;  2FXT A;  1NDO B;  2ZDJ A;  5EEO A;  1JKG B;  5EVH A;  1MOL A;  1GY5 A;  2XGL A;  4GL6 A;  1D6Z A;  3OWU A;  2OQE C;  2GXF A;  3NV0 B;  1O7H B;  3V99 A;  4LZI A;  3CCV 3;  1IV9 A;  1RKY A;  1DVD A;  5IEO A;  1LOX A;  2HMK B;  3FLJ A;  2GEX A;  2XSO B;  4J8T A;  2C10 A;  2E2T A;  3CNM A;  3FG1 A;  3S5C A;  4PEJ A;  4KFD A;  5LC7 A;  2IA7 A;  4CCV A;  4ZM8 A;  3EHC A;  4EXR A;  1W6C A;  2STD A;  3CU3 A;  3G71 3;  3N54 B;  5AYS C;  1YIT 3;  1JKG A;  1WNH A;  3STD A;  3F8X A;  5LC6 A;  2Y73 A;  2D42 A;  1NU3 A;  2K54 A;  1LNH A;  3WOF B;  1PU4 A;  5KP1 A;  1N8R 4;  1G96 A;  1VQ8 3;  4GB5 A;  3WMD A;  2LYX A;  1K28 A;  1NO3 A;  2GU1 A;  2CFD A;  4FMB A;  3GZX B;  2RCD A;  1YJN 3;  3VF1 A;  1A90 A;  5ELU A;  2HMO B;  1JN5 A;  3RGA A;  3CC2 3;  1TFO A;  3SED A;  1JNQ A;  3G8Z A;  1W2Z A;  3U97 A;  3F9S A;  5DRE A;  3WA3 A;  1IVW A;  2YX9 A;  1IVX A;  4XM4 A;  3K7C A;  4EYC A;  1IV7 A;  1TP6 A;  3I0Y A;  3CCJ 3;  2YFJ B;  1EG9 B;  5BXQ A;  3DZL A;  3NQZ A;  5D81 A;  3PCR A;  1STD A;  1ISK A;  4N6U A;  1W7C A;  4AKZ A;  2LQV A;  2W6J H;  1FA3 A;  3F40 A;  2OCT A;  5ELJ A;  2L4V A;  2MF7 A;  2RGQ A;  2XR8 B;  1WMN A;  5IG4 A;  2BMO B;  2CC3 A;  2ML6 A;  5HGR A;  2I9W A;  2OWP A;  1HKX A;  5CF1 A;  5KP4 A;  3JVC A;  5IER A;  2JDI H;  3NBJ A;  4K90 B;  3EJV A;  3FGY A;  1UUV B;  3S29 A;  1N5P A;  1IT7 A;  1GD4 A;  1BUQ A;  3HII A;  4RNY A;  1O7M B;  4IT7 A;  2BT3 A;  1VQ6 3;  1AVL A;  1F8N A;  1GY6 A;  3MG2 A;  2BHM A;  3WDG B;  1ASK A;  1JB5 A;  2PZV A;  4HM7 B;  3UL6 A;  2XSH B;  4R9K A;  1VQ9 3;  2W56 B;  1OF5 A;  1O7W B;  3D9R A;  5IG3 A;  3CD6 3;  5D82 A;  1YJW 3;  2CHC A;  3UJM A;  3MYT A;  4QWT A;  3RDE A;  1JRQ A;  3CC7 3;  2E2U A;  3IMA B;  4N6M A;  3LTB A;  1LXE A;  2W03 A;  4EC6 A;  3GZY B;  2CFG A;  1VQP 3;  1FGM A;  3G6E 3;  1NB3 I;  3LYG A;  2XF3 A;  2QEX 3;  3CCE 3;  2IUK A;  1E3V A;  3KSP A;  1WMO A;  4EV2 A;  5D83 A;  1R4C A;  4MMZ B;  1N9J A;  3SXX A;  4HM4 B;  5TGN A;  3BB9 A;  4K1U A;  4XBY A;  3GWR A;  4KZ1 A;  4O8S A;  2KXG A;  1VZZ A;  4AKY A;  1VQM 3;  2Z76 A;  4L8P A;  3DGL A;  3JUM A;  1HU9 A;  4LGQ A;  2OOV C;  1FGO A;  1W5Z A;  2RFR A;  3OWY A;  3IJE B;  4X2H A;  2CFL A;  3FCS B;  4R80 A;  1GYB A;  2W9P A;  4N6L A;  3ALA A;  1K8A 4;  2B24 B;  3T0U A;  2GBX B;  2CKF B;  3NUV A;  1KQS 2;  3B7C A;  4N6V 0;  3CCR 3;  3FH1 A;  1W2B 2;  1DMN A;  3PS8 A;  3QRD A;  1J2B A;  3OWS A;  2KCD A;  2W9Q A;  3H3H A;  5CLK A;  2F86 B;  3SX1 A;  4N6O B;  1M9G A;  1UUW B;  1KD1 4;  2XGN A;  3KFQ C;  4JF8 A;  1YHQ 3;  1QAK A;  3FF0 A;  3EE1 A;  2O3O A;  3L0R A;  4IIA A;  1NJI 4;  3X42 A;  1TIJ A;  2CW9 A;  1IDP A;  1QVF 2;  3UB1 A;  2CH9 A;  4L8O A;  1US1 A;  3BND A;  3DUK A;  1OGZ A;  1CYU A;  5A0O B;  1IT8 A;  4N6N B;  3BLZ A;  2CK3 H;  2XEP A;  3LML A;  5IG5 A;  2Y74 A;  1QAL A;  2GU3 A;  1GD3 A;  3NV0 A;  1VQO 3;  4R1K A;  1ZO2 A;  2P05 A;  3CCL 3;  1T5Y A;  5AII A;  3X3Z A;  1IVU A;  1WQL B;  1UW1 A;  2MC8 A;  4MMX B;  4MJD A;  3MKI A;  2CG0 A;  4NRE A;  1ULJ B;  1Z1S A;  2HMM B;  1AVK A;  3PXM A;  4LEH A;  5BVB A;  3F7S A;  3O8Y A;  1VQN 3;  2V1L A;  3CNX A;  1ULI B;  1Q82 4;  3HX8 A;  1A2V A;  1N5H A;  1YGE A;  4AEQ A;  1KWI A;  1DMM A;  3FG4 A;  1OH0 A;  1W4N A;  1K9M 4;  1OGX A;  3FKA A;  5FW5 A;  5G2G A;  4HBR A;  1PFP A;  2QA4 3;  3MG1 A;  1M90 4;  3KZT A;  1SIH A;  1QVG 2;  4HYZ A;  1SJW A;  1S5A A;  3K9M C;  3I56 3;  3NQY A;  2PNC A;  4KFF A;  3HIG A;  3JUQ A;  2OOV A;  4WP5 A;  1K73 4;  3ER7 A;  4G1M B;  1UI7 A;  1WTH A;  3X41 A;  5AIG A;  2F99 A;  4N3V A;  5FGO A;  1DMQ A;  4BTW A;  3EQQ B;  3DY5 A;  1VQK 3;  1QJG A;  4WWU C;  3Q1C A;  3NHX A;  5IG0 A;  3LXU X;  1Y4K A;  2BO9 B;  3K5T A;  3WOE B;  1A2K A;  3AMO B;  3N8B A;  2WOH A;  3T8U A;  3EBY A;  3N9H A;  3NBB A;  3MSO A;  3CPO A;  1E97 A;  3KN4 A;  4JRF A;  3GZB A;  3DXO A;  1O7N B;  1YVB I;  4L7K A;  2C11 A;  4LMI A;  4HM8 B;  4WFO A;  2P0X A;  4K1V A;  1VQ7 3;  5JPU A;  3SLU A;  1OAC A;  1QAF A;  3LT8 A;  3S27 A;  1TU5 A;  3FG3 A;  5AYR B;  1OHO A;  5KP3 A;  2A15 A;  4N6T A;  4HM5 B;  3ROB A;  3HI7 A;  1OHS A;  1U8C B;  1IVV A;  2CWT A;  3AMO A;  3QK9 A;  3PGB A;  2Z6B A;  3B4P A;  3NM7 A;  4HM1 B;  4KVH A;  4HM0 B;  2K0M A;  2BMR B;  2WGQ A;  3FF2 A;  2W56 A;  2YFL B;  3DGN A;  1EKM A;  2W2C A;  3LT9 A;  3EBT A;  5CF2 A;  2FGT A;  1Q40 B;  3JUP A;  4FMC A;  1E3R A;  2QIY A;  4O02 B;  2QGU A;  3WA2 X;  3LTC A;  2WO0 A;  1D6U A;  1W6Y A;  1KC8 4;  3SVA A;  3DMC A;  5STD A;  3NBR A;  2CG1 A;  2W04 A;  3F14 A;  1C7H A;  1SII A;  5IEP A;  1V74 A;  1FGT A;  3PZW A;  1JJ2 2;  1IQY A;  1W01 A;  2KRT A;  3KE7 A;  4KFE A;  1W00 A;  3EF8 A;  3LTD A;  3OX9 A;  3DM8 A;  2HMN B;  3B4O A;  2F98 A;  1NB5 I;  3BNE A;  2HML B;  4HM3 B;  2CFW A;  4WYK B;  1RRL A;  3SOY A;  3UL5 A;  1RJO A;  1O7G B;  1WMP A;  3U1W A;  3F8H A;  4HKV B;  3VSY A;  1JB4 A;  2HMJ B;  1FUW A;  3CCQ 3;  2O9U X;  4O3V A;  1IK3 A;  7STD A;  4OK0 A;  2B1X B;  1AV4 A;  3CPW 2;  1N9E A;  3K0Z A;  4STD A;  1SPU A;  3G0K A;  4J9A A;  4BTY A;  4FMA A;  3CCU 3;  4OVM A;  3WOD G;  2M7O A;  3MG3 A;  3CME 3;  1IQ8 A;  1O7P B;  3EB8 A;  1CQS A;  5EQL A;  5AEW B;  4FCZ A;  1YI2 3;  2XH9 A;  1MNL A;  3E99 A;  3IPT A;  3GAX A;  3LH4 A;  1OCV A;  1W6G A;  4XBX A;  1OPY A;  3S67 A;  1JB2 A;  1JV2 B;  4HZ9 B;  3J7Y d;  4O2H A;  1GY7 A;  3X3Y A;  5CK6 A;  3D3L A;  4HM6 B;  1JN5 B;  4MMY B;  3I55 3;  3VGN A;  4OUQ A;  4FCM A;  1Q7Y 4;  2XRX B;  1DVC A;  3X3X A;  3CMA 3;  2CWU A;  4R4K A;  1UI8 A;  4EBG A;  2Q07 A;  3MWZ A;  3CXC 2;  3S28 A;  5CXO A;  1VQ5 3;  2XFT A;  1ROA A;  1VQ4 3;  3OXA A;  3V98 A;  1EA2 A;  1K41 A;  3MPH A;  3OV4 A;  4XB5 A;  1W02 A;  1ZX2 A;  3EX9 A;  4XDV A;  1QMA A;  5AIF A;  2CWV A;  3G16 A;  3HK4 A;  3MHE A;  4HM2 B;  6STD A;  1Q42 A;  3FSD A;  4H3U A;  4XDW A;  3ECF A;  3A76 A;  4X2O A;  1SQW A;  3EN1 B;  3H51 A;  3BNC A;  2XFS A;  5JPP A;  3FZW A;  3JUN A;  4RZM A;  5DRV A;  3TDG A;  2INX A;  1NWW A;  1KSI A;  4XBT A;  5AI1 A;  3RGR A;  1OHP A;  5IEN A;  4HVN A;  2E2V A;  1FGQ A;  1D6Y A;  2W0Q A;  4FR9 A;  4FCJ A;  1OF5 B;  1Q81 4;  3K63 A;  4NHF A;  4TX4 A;  5AEU B;  1DYU A;  3CCM 3;  1LVN A;  2FNQ A;  1L5G B;  3CC4 3;  2OTJ 3;  1AR0 A;  2R4I A;  2P09 A;  1FGR A;  2CIU A;  2Z7A A;  1A67 A;  1CYV A;  3JUO A;  2ML5 A;  4RNZ A;  3NX0 A;  1ROV A;  4ORL A;  4H61 A;  1RN7 A;  2D1W A;  1IU7 A;  1OUN A;  2JQ5 A;  3KII A;  3KKG A;  4IPB A;  4HJL B;  1TFK A;  3GZR A;  3NM2 A;  4I4K A;  2CFK A;  3DGM A;  2IUJ A;  2OQE A;  5I97 A;  4HZB B;  3Q2P A;  5AIH A;  3KSE D;  3OW2 2;  1VQL 3;  4R9L A;  2P38 A;  1RRH A;  3LOY A;  4K61 A;  2ZL8 A;  3CCS 3;  1GS3 A;  5JBS A;  3V92 A;  2OTL 3;  2RSX A;  2WGO A;  3UNL A;  1M1X B;  4BTX A;  2WOF A;  2Z77 A;  4WHA A;  8CHO A;  5IF6 A;  3EC9 A;  2IMJ A;  2SBL A;  3EN8 A;  3LTA A;  3Q90 A;  3DGO A;  3PCS A;  3PYJ A;  4MEI A;  1IQX A;  1YJ9 3;  1Q40 A;  2BMQ B;  4RBN A;  4LSO A;  1EQK A;  3LZA A;  1Q86 4;  1YIJ 3;  4Q53 A;  3T8N A;  2BNG A;  3B8L A;  3GRD A;  2GBW B;  2YFI B;  4EV5 A;  3M8C A;  1M1K 4;  3F7X A;  1TUH A;  2P0M A;  1STF I;  4U13 A;  3G4S 3;  3X40 A;  1U5O A;  2UX0 A;  5IW9 A;  3BNB A;  4CDL A;  3HZP A;  3SOA A;  2GEY A;  4FMD A;  4WYK A;  3NXJ A;  1CEW I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...