3FZWA

Crystal structure of ketosteroid isomerase d40n-d103n from pseudomonas putida (pksi) with bound equilenin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVINVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Hydrogen bond coupling in the ketosteroid isomerase active site.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 38
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3fzwA00
4J9AA 3JUNA 3DXOA 3EN8A 3F8HA 1AR0A 3KKGA 4RZMA 3MSOA 3F7XA 3F9SA 3H3HA 3FH1A 5IENA 2I9WA 3FSDA 3NM2A 4LMIA 3G16A 1ULJB 1Q42A 4I4KA 4PEJA 2XSHB 3DUKA 3CU3A 3F40A 4X2OA 2OWPA 3DZLA 4HM1B 2YFJB 3B7CA 1C7HA 1Q40A 2B1XB 4L8PA 1JN5A 3MG2A 1K41A 3A76A 2BNGA 1DMMA 5EVHA 3UNLA 5STDA 3EX9A 1O7PB 3OWUA 1OHPA 4XDVA 1OGZA 1HKXA 1BUQA 1O7NB 4XBTA 3ROBA 3EC9A 5KP3A 4WP5A 1E3RA 1OHSA 1GY6A 1S5AA 4XDWA 3FLJA 4OUQA 3I0YA 3OX9A 3MG1A 1JB5A 3OV4A 4HJLB 7STDA 1U5OA 3UJMA 5HGRA 3G0KA 3OWSA 3STDA 2R4IA 3KE7A 3GZBA 3NV0A 2YFLB 1JB4A 3IPTA 1ISKA 5AIGA 4HKVB 5DREA 1O7HB 3EBTA 3S5CA 6STDA 1Q40B 1E97A 1JN5B 2CHCA 3LZAA 5BVBA 3D9RA 4R1KA 2RFRA 5AI1A 5JPUA 1ASKA 3GZRA 4HM8B 3OWYA 2BMOB 3KSPA 5KP1A 2IMJA 5JPPA 1QMAA 1UUVB 5IG4A 4STDA 4LEHA 3GWRA 3T8UA 5BXQA 3Q90A 2A15A 5G2GA 3GZXB 1A2KA 2B24B 4HM0B 2HMOB 3K7CA 3B4PA 5IEPA 1IDPA 4XBYA 4HZ9B 3CPOA 3MHEA 2GBWB 4MJDA 2Z7AA 2HMMB 3FF2A 3F7SA 4WYKA 3NV0B 3NHXA 2HMNB 2XSOB 1JKGB 2GEXA 2QIYA 1DMNA 4HVNA 4R9LA 1ULIB 3SOAA 3CNMA 1GY5A 4XM4A 5DRVA 5KP4A 5IG5A 4WWUC 3VSYA 1VZZA 4HM3B 1W02A 3NBRA 3B8LA 3KZTA 4HZBB 4HM5B 2STDA 5AIHA 1E3VA 3G8ZA 3VGNA 3JUMA 3EHCA 4IIAA 1UUWB 2Z77A 3BB9A 1OHOA 3EQQB 3RGRA 3H51A 3HX8A 3HK4A 2HMJB 1JKGA 3ECFA 3MG3A 3MKIA 1TUHA 3ER7A 3FKAA 5IEOA 1EA2A 4WYKB 1JB2A 2HMKB 3GZYB 4K1VA 1Z1SA 5IG0A 8CHOA 1CQSA 3T8NA 1NDOB 3FF0A 3B4OA 4HM6B 4CDLA 2PZVA 2QGUA 5AEWB 3DMCA 1O7WB 1EG9B 1OH0A 3K0ZA 4R9KA 5FW5A 4FCJA 1GYBA 4L8OA 5IG3A 3OXAA 3NXJA 1OPYA 1W6YA 3FZWA 3DM8A 4X2HA 1OF5A 2RCDA 5AIFA 5IERA 3SOYA 5D81A 4K1UA 1GS3A 4HM2B 2Z76A 3E99A 4J8TA 2JQ5A 1ZX2A 5CK6A 2GBXB 5CLKA 3HZPA 1W00A 4HM7B 4OVMA 5IF6A 5AEUB 1DMQA 4N3VA 1NWWA 1NU3A 5CXOA 3JUPA 2BMRB 4U13A 3EF8A 1QJGA 3LYGA 3M8CA 4XBXA 3GRDA 4XB5A 3SEDA 2W2CA 1W01A 3NUVA 5D83A 2F98A 2BMQB 3FGYA 1GY7A 4L7KA 4KVHA 2INXA 2GEYA 4GB5A 5D82A 4ORLA 2F99A 5CF1A 3F8XA 1OF5B 2K54A 4H3UA 2RGQA 3EN1B 1OGXA 4LGQA 2XR8B 3F14A 1STDA 1TP6A 2CKFB 2YFIB 4FCMA 2F86B 1OCVA 3BLZA 3CNXA 1O7MB 5TGNA 5AIIA 4Q53A 4HM4B 3RGAA 3JUQA 3WMDA 1OUNA 1O7GB 2HMLB 3EJVA 2XRXB 3JUOA 3EBYA 2UX0A 1WQLB 2GXFA 5CF2A 1ZO2A 3MYTA 1SJWA
chains in the Genus database with same CATH superfamily
4J9AA 5EQLA 2D42A 3JUNA 1VQL3 3BNCA 1WMPA 1D6YA 3PZWA 4AKZA 1RN4A 9RNTA 1LNIA 2W0QA 1SQWA 3DXOA 1AVKA 1BNIA 3Q2PA 3CXC2 3EN8A 3ZG0A 1RHLA 1Q7HA 2ML5A 3HIIA 3F8HA 1G02A 1JZOA 1WNHA 3I553 3G713 1AR0A 3KKGA 4KFDA 2E2UA 1SARA 3MSOA 4RZMA 4RBNA 2CG1A 3DGNA 3F7XA 3WOFB 1RGKA 3F9SA 3X3XA 3H3HA 1RCKA 3FH1A 5IENA 2I9WA 1RGHA 1IK3A 1BSBA 3FSDA 3EB8A 1MNLA 3NM2A 1JBRA 4LMIA 3G16A 1EUIC 1ULJB 1Q42A 3V92A 1N9EA 2XEPA 3LT8A 4I4KA 4PEJA 1T5YA 1ROAA 1V58A 2XSHB 3CU3A 3DUKA 3N54B 4RNYA 3F40A 3T0UA 1YJ93 2FXTA 3K63A 4X2OA 2OWPA 3DZLA 4HM1B 1FGMA 3AHSA 2YFJB 1YJW3 3B7CA 1IQYA 3RNTA 1C7HA 1Q40A 3FG3A 2B1XB 1BNGA 1IQXA 4L8PA 1JN5A 4QWTA 3MG2A 1K41A 3A76A 2BNGA 3X41A 3K9MC 2KAAA 1YGEA 1DMMA 1PY3A 2O3OA 1A67A 1TJDA 5EVHA 1IVXA 1B3SA 3SX1A 3UNLA 1BGSA 5STDA 1B2ZA 3I563 4EBGA 1DETA 2CWTA 1BSEA 1O7PB 3EX9A 5AYSC 1I2GA 4EYCA 1NB5I 2AADA 1W2B2 3OWUA 5IW9A 3Q1CA 1I70A 5GSPA 2CFLA 3K5TA 2Z6BA 1MGWA 1OHPA 1LOWA 4XDVA 1RSNA 1OGZA 1HKXA 2J8XB 1BUQA 1O7NB 1FUWA 4XBTA 2RNTA 2ML6A 4AKYA 1B2MA 1AY7A 3N9HA 3ROBA 2C11A 1V74A 1AQZA 1TRQA 2H0IA 4NPBA 3EC9A 3U1WA 6GSPA 5KP3A 4NHFA 2P0XA 4WP5A 1X1WA 1IVWA 1E3RA 1VQM3 1JJ22 3VF1A 4BU4A 1I3FA 2W9PA 3WDGB 5BU4A 1DYUA 1OHSA 1GY6A 1B20A 4HAAA 1S5AA 1IU7A 2KF4A 4ILFA 4XDWA 1K734 1J2BA 1VQQA 3FLJA 4OUQA 4JRFA 3ZG5A 3I0YA 3OX9A 4HBRA 2W03A 3MG1A 1KSIA 4HOHA 4NREA 1JB5A 4O2HA 3OV4A 4HJLB 2QA43 1MWRA 2O9UX 2CFWA 3IJEB 2P38A 7STDA 1U5OA 4LYLB 4N6OB 3UJMA 3CCV3 5HGRA 4OK0A 4J5KA 1US1A 4BTXA 3G0KA 3OWSA 3STDA 2R4IA 3KE7A 3GZBA 1LVNA 3NV0A 4KT3B 1RGCA 2YFLB 2CG0A 3X42A 1ZS7A 1PYLA 3G4S3 1JB4A 4WFOA 3D79A 3IPTA 1FUTA 1ISKA 4KZ1A 5AIGA 3DGYA 1GOUA 1RLSA 4HKVB 4KFEA 1O7HB 5DREA 2C4BA 1IQ8A 2SARA 1IVVA 3EBTA 4RNTA 3CMA3 3S5CA 6STDA 4TX4A 3AGOA 1Q40B 2C10A 2SBLA 1E97A 2W56B 1JNQA 3EE1A 1RN1A 3SXXA 4H61A 3HOHA 3KFQC 1JN5B 2Q07A 1DVDA 2CHCA 4EV2A 1RGEA 3LZAA 2R41A 5BVBA 3D9RA 4R1KA 5M19A 2RFRA 2CFGA 1WTHA 1LQGC 5AI1A 5JPUA 2M7OA 1ASKA 1NNVA 3GZRA 3KCHA 1GOVA 4HM8B 1JRQA 3S28A 4BL2A 7GSPA 1RDSA 3OWYA 4AEQA 1CYUA 4N6TA 2BMOB 3LTAA 1T3BA 2YX9A 2JDIH 1BU4A 2P05A 3KSPA 5KP1A 3CCM3 2IMJA 4N6NB 1QMAA 1UUVB 5JPPA 4FMAA 1W6GA 4O3VA 5IG4A 2GU1A 1STFI 4STDA 1UGIA 4LEHA 1W5ZA 1D6UA 3GWRA 1FYSA 1RGLA 1QAKA 1RJOA 3T8UA 4ZM8A 1YIT3 5BXQA 2D1WA 2XGLA 2KRTA 1WMOA 3Q90A 2A15A 5G2GA 2L4VA 5HOHA 4RNZA 1UI7A 4IPBA 1BRIA 3RDEA 3GZXB 1A2KA 3SVAA 4EV5A 1YIJ3 3J7Yd 1RNTA 3G6E3 1LOVA 2IY2A 1UI8A 2OOVC 4G1MB 4K90B 1BRHA 3CPW2 2B24B 2CX1A 4J5GA 1QAFA 3GAXA 4R4KA 4IT7A 3FG4A 4HM0B 2ZDJA 1ROVA 2HMOB 1BNEA 1GMPA 2WOFA 2W9QA 1I3IA 3B4PA 3K7CA 5IEPA 1IDPA 1YVBI 1Q9EA 3DGLA 4XBYA 2P09A 2XGNA 4HZ9B 2H0GA 2CFKA 4FCZA 1TRPA 3CPOA 3IMAB 1MWSA 2GBWB 2KCDA 3MHEA 2Z7AA 4MJDA 1W7CA 2WGQA 2HMMB 3FF2A 4FMBA 2L1SA 3PS8A 3CCQ3 3F7SA 4EXRA 2XFTA 3CCL3 1FZUA 1SIIA 2BU4A 2W56A 4WYKA 1LOYA 2UUGC 1R4CA 3NV0B 3NHXA 1N9JA 1BNJA 1V57A 5M18A 2IUKA 2HMNB 2XSOB 3X3YA 3JVCA 1JKGB 1A2PA 1RKYA 1F8NA 3BU4A 1VQO3 2GEXA 1Q824 2BHMA 2UGIA 1MGRA 5A0OB 1Y4KA 2QIYA 4KFFA 2OTJ3 1DMNA 3NX0A 1YNVX 4HVNA 4R9LA 2BO9B 1ULIB 3SOAA 1K9M4 3CNMA 4LZIA 1B21A 2KF5A 1GY5A 4XM4A 2XH9A 1TU5A 3Q3FA 1EQKA 5DRVA 4MMYB 3SYUA 5KP4A 1DE3A 3HIGA 2Y74A 1Q814 4MMZB 5IG5A 4WWUC 5ELUA 3VSYA 1G96A 1RRHA 1VZZA 4HM3B 1W02A 3NBRA 1PU4A 1ZGXA 1NB3I 3B8LA 4EW5A 1BNFA 1R4YA 3KZTA 4HZBB 1S723 4HM5B 2STDA 2GU3A 5AIHA 1IT7A 1E3VA 3WA2X 1VQ83 1LRAA 2OQEC 1LXEA 3G8ZA 1HZ1A 3VGNA 3LTDA 3MPHA 5FGOA 1SPUA 2MC8A 3AHWA 3JUMA 3EHCA 4IIAA 2E2VA 1UUWB 1RTUA 3DGMA 1HU9A 3V98A 2CX0A 2Z77A 3D5GA 5LC6A 4JF8A 1FW7A 1M1XB 3BB9A 3X40A 5AYRB 1OHOA 3EQQB 1RNBA 1YHQ3 3WODG 1VQN3 1JBTA 3KN4A 3BNEA 1VQP3 1I2EA 1BSAA 3RGRA 3H51A 1RCLA 3HX8A 1BRSA 1G0TA 2OOVA 1BUJA 1BOXA 3HK4A 1GMQA 2HMJB 3U97A 3UL5A 1JKGA 1UCJA 2HOHA 3ECFA 2IUJA 2F5WA 2RSXA 1X1YA 3MG3A 1UCLA 2H0HA 3NM7A 1KD14 3MKIA 1TUHA 1OACA 4WHAA 3ER7A 3FKAA 1EEJA 3LMLA 5IEOA 1EA2A 4WYKB 3CCU3 1JB2A 2BT3A 1FUSA 3LXUX 3CCS3 2HMKB 3QK9A 3ALAA 3GZYB 3UB1A 5ELJA 3LTBA 2LQVA 4K1VA 1C54A 1Z1SA 1IV7A 3SLUA 3DH2A 5IG0A 1T2HA 8CHOA 1UGHI 1CQSA 3CCJ3 1RMSA 3T8NA 3DY5A 1RGFA 1NDOB 3FF0A 3B4OA 4R80A 4HM6B 2E2TA 3URPA 1D6ZA 1TFKA 1N5HA 4CDLA 2PZVA 2CW9A 3QRDA 1NO3A 3AMOA 2CFDA 3CC23 2QGUA 5AEWB 1B2XA 1O7WB 3DMCA 3DGOA 1BRJA 1CEWI 3NQZA 1RGAA 2BIRA 1EG9B 2WOHA 3CD63 1OH0A 1GD3A 3MWZA 3K0ZA 4R9KA 1CH0A 5FW5A 4FCJA 1GYBA 1YJN3 1QALA 4L8OA 2K0MA 3OW22 5G1KA 1MOLA 5IG3A 1M1K4 3OXAA 4EC6A 3NXJA 1LNHA 1UDII 3KSED 1OPYA 3CCE3 3D4AA 4BIRA 4BL3A 1W6YA 2OCTA 3DM8A 3FZWA 3BIRA 4X2HA 1VQ93 1BVIA 1AV4A 1FGQA 1OF5A 2RBIA 3FCSB 1N5PA 1YVSA 1QVF2 1A90A 1AVLA 1BRGA 2CK3H 2GSPA 2RCDA 5AIFA 1TIJA 5IERA 3SOYA 3PXMA 1WMNA 5D81A 4K1UA 1EKMA 1GS3A 2CC3A 1X1UA 4GSPA 3WA3A 2IA7A 1MWTA 1KC84 3S29A 3HI7A 1TFOA 2Z76A 2ZA4A 4HM2B 1TTOA 2OTL3 2QEX3 4O8SA 1M9GA 1FGRA 1JBSA 3E99A 4J8TA 1GOYA 2JQ5A 3V99A 3GSPA 1BRKA 1IVUA 2PNCA 1I0VA 1ZX2A 2XFSA 3LTCA 5CK6A 2GBXB 3CC43 1KWIA 5CLKA 3HZPA 1W00A 1W2ZA 4O02B 4HM7B 3WR2A 3NQYA 1Q864 1LOXA 3D5IA 4OVMA 5IF6A 1UW1A 4MMXB 5AEUB 2MF7A 1BANA 1DMQA 4N3VA 3CCR3 2AAEA 1NWWA 1NU3A 1RRLA 3JUPA 3N8BA 1YGWA 5CXOA 2Y73A 4CPKA 2F5MA 3CC73 1UCKA 2ZL8A 2BMRB 1N8QA 4FR9A 1VQ73 3X3ZA 1BIRA 4U13A 1BNSA 6RNTA 4GL6A 1QVG2 4CCVA 2CIUA 2K3DA 3EF8A 1QJGA 1BSDA 3AMOB 3LYGA 1FGOA 3M8CA 4XBXA 4DKIA 3GRDA 4XB5A 3SEDA 1YI23 2W2CA 1LQMB 2CWUA 1VQ63 4GHOA 3NBBA 1RGGA 1BAOA 1W01A 3NUVA 1I0XA 5EEOA 5JBSA 1L5GB 5D83A 8RNTA 3ZFZA 1Q7Y4 2F98A 2V1LA 2BMQB 1FGTA 1I2FA 3FGYA 3S67A 5I97A 1N8R4 1GY7A 4L7KA 4KVHA 2LYXA 1T2IA 2INXA 2GEYA 1IYYA 2W6JH 2P0MA 4GB5A 1FA3A 1SIHA 5D82A 2KF3A 4ORLA 2F99A 1MWUA 3PYJA 5CF1A 3F8XA 1VQ53 1OF5B 4N6LA 1JV2B 2K54A 3NBJA 4H3UA 4N6MA 3WHOA 1IV9A 1KQS2 1BRNL 2RGQA 3EN1B 3CME3 1OGXA 4HYZA 4BTYA 4LGQA 1IT8A 1B2SA 2KF6A 4I5QA 2KXGA 2XR8B 3F14A 1X1XA 3PCSA 1W4NA 2WGOA 3BNDA 1STDA 2W04A 3D3LA 1TP6A 3KIIA 2CKFB 3FG1A 4LSOA 2YFIB 4FCMA 2F86B 2F4YA 4N6V0 5G1LA 5LC7A 1HYFA 4FMDA 5BIRA 1OCVA 3TDGA 3BLZA 3A5EA 3LOYA 3O8YA 3WOEB 3CNXA 4CJNA 1GSPA 1JZDA 1O7MB 1W6CA 5TGNA 5AIIA 2OQEA 1DVCA 4Q53A 1BNRA 1K28A 1GMRA 3BNBA 5RNTA 1U8CB 2XF3A 2CH9A 2ZHXB 3PCRA 3PGBA 1UUGB 1NJI4 1A2VA 4HM4B 4MEIA 3RGAA 2F56A 3JUQA 1OUNA 3WMDA 3LT9A 1O7GB 2HMLB 1M904 3EJVA 3S27A 1BSCA 2FNQA 2XRXB 3JUOA 4FMCA 1K8A4 1CYVA 1PFPA 1I8VA 5M1AA 2FGTA 3EBYA 2WO0A 3LH4A 4BTWA 2UX0A 1WQLB 1B27A 1VQK3 1GD4A 2GXFA 3L0RA 7RNTA 5CF2A 1RN7A 1ZO2A 4N6UA 1VQ43 4K61A 1UCIA 2CWVA 2IYJA 3AGNA 3MYTA 1B2UA 3UL6A 1SJWA
chains in the Genus database with same CATH topology
4J9AA 5EQLA 2D42A 3JUNA 1VQL3 3BNCA 1WMPA 1D6YA 3PZWA 4AKZA 2W0QA 1SQWA 3DXOA 1AVKA 3Q2PA 3CXC2 3EN8A 2ML5A 3HIIA 3F8HA 1WNHA 3I553 3G713 1AR0A 3KKGA 4KFDA 2E2UA 3MSOA 4RZMA 4RBNA 2CG1A 3DGNA 3F7XA 3WOFB 3F9SA 3X3XA 3H3HA 3FH1A 5IENA 2I9WA 1IK3A 3FSDA 3EB8A 1MNLA 3NM2A 4LMIA 3G16A 3V92A 1ULJB 1Q42A 1N9EA 2XEPA 3LT8A 4I4KA 4PEJA 1T5YA 1ROAA 2XSHB 3DUKA 3CU3A 3N54B 4RNYA 3T0UA 3F40A 1YJ93 2FXTA 3K63A 4X2OA 2OWPA 3DZLA 4HM1B 1FGMA 2YFJB 1YJW3 3B7CA 1IQYA 1C7HA 1Q40A 3FG3A 2B1XB 1IQXA 4L8PA 1JN5A 4QWTA 3MG2A 1K41A 3A76A 2BNGA 3X41A 3K9MC 1YGEA 1DMMA 2O3OA 1A67A 5EVHA 1IVXA 3SX1A 3UNLA 5STDA 3I563 4EBGA 2CWTA 3EX9A 1O7PB 5AYSC 4EYCA 1NB5I 1W2B2 3OWUA 5IW9A 3Q1CA 2CFLA 3K5TA 2Z6BA 1OHPA 4XDVA 1OGZA 1HKXA 1BUQA 1FUWA 1O7NB 4XBTA 2ML6A 4AKYA 3N9HA 3ROBA 2C11A 1V74A 3EC9A 3U1WA 5KP3A 4NHFA 2P0XA 4WP5A 1IVWA 1E3RA 1VQM3 1JJ22 3VF1A 3WDGB 2W9PA 1DYUA 1OHSA 1GY6A 1S5AA 1IU7A 4XDWA 1K734 1J2BA 3FLJA 4OUQA 4JRFA 3I0YA 3OX9A 4HBRA 2W03A 3MG1A 1KSIA 4NREA 1JB5A 4O2HA 3OV4A 4HJLB 2QA43 2O9UX 2CFWA 3IJEB 2P38A 7STDA 1U5OA 4N6OB 3UJMA 3CCV3 5HGRA 4OK0A 1US1A 4BTXA 3G0KA 3OWSA 3STDA 2R4IA 3KE7A 3GZBA 1LVNA 3NV0A 2YFLB 2CG0A 3X42A 3G4S3 1JB4A 4WFOA 3IPTA 1ISKA 4KZ1A 5AIGA 4HKVB 4KFEA 1O7HB 5DREA 1IQ8A 1IVVA 3EBTA 3CMA3 3S5CA 6STDA 4TX4A 1Q40B 2C10A 2SBLA 1E97A 2W56B 1JNQA 3EE1A 3SXXA 4H61A 3KFQC 1DVDA 1JN5B 2Q07A 2CHCA 4EV2A 3LZAA 5BVBA 3D9RA 4R1KA 2RFRA 2CFGA 1WTHA 5AI1A 5JPUA 2M7OA 1ASKA 3GZRA 3S28A 4HM8B 1JRQA 3OWYA 4AEQA 1CYUA 4N6TA 2BMOB 3LTAA 2YX9A 2JDIH 2P05A 3KSPA 5KP1A 3CCM3 2IMJA 4N6NB 1QMAA 1UUVB 5JPPA 4FMAA 1W6GA 4O3VA 5IG4A 2GU1A 1STFI 4STDA 4LEHA 1W5ZA 1D6UA 3GWRA 1QAKA 1RJOA 3T8UA 4ZM8A 1YIT3 5BXQA 2D1WA 2XGLA 2KRTA 1WMOA 3Q90A 2A15A 5G2GA 2L4VA 1VQP3 4RNZA 1UI7A 4IPBA 3RDEA 3GZXB 1A2KA 3SVAA 4EV5A 1YIJ3 3J7Yd 3G6E3 1UI8A 2OOVC 4G1MB 4K90B 3CPW2 2B24B 1QAFA 3GAXA 4R4KA 4IT7A 3FG4A 4HM0B 2ZDJA 1ROVA 2HMOB 2WOFA 2W9QA 3B4PA 3K7CA 5IEPA 1IDPA 1YVBI 3DGLA 4XBYA 2P09A 2XGNA 4HZ9B 2CFKA 4FCZA 3IMAB 3CPOA 3MHEA 2GBWB 2KCDA 4MJDA 2Z7AA 1W7CA 2WGQA 2HMMB 3FF2A 4FMBA 3PS8A 3CCQ3 3F7SA 4EXRA 2XFTA 3CCL3 1SIIA 2W56A 4WYKA 1R4CA 3NV0B 3NHXA 1N9JA 2IUKA 2HMNB 2XSOB 3X3YA 3JVCA 1JKGB 1RKYA 1F8NA 1VQO3 2GEXA 1Q824 2BHMA 5A0OB 1Y4KA 2QIYA 4KFFA 2OTJ3 1DMNA 3NX0A 4HVNA 4R9LA 2BO9B 1ULIB 3SOAA 1K9M4 3CNMA 4LZIA 1GY5A 4XM4A 2XH9A 1TU5A 1EQKA 5DRVA 4MMYB 5KP4A 3HIGA 2Y74A 1Q814 4MMZB 5IG5A 4WWUC 5ELUA 3VSYA 1G96A 1RRHA 1VZZA 4HM3B 1W02A 3NBRA 1PU4A 1NB3I 3B8LA 3KZTA 4HZBB 1S723 4HM5B 2STDA 2GU3A 5AIHA 1IT7A 1E3VA 3WA2X 1VQ83 2OQEC 1LXEA 3G8ZA 3VGNA 3LTDA 3MPHA 5FGOA 1SPUA 2MC8A 3JUMA 3EHCA 4IIAA 2E2VA 1UUWB 3DGMA 3V98A 1HU9A 2Z77A 5LC6A 4JF8A 1M1XB 3BB9A 3X40A 5AYRB 1OHOA 3EQQB 1YHQ3 3WODG 1VQN3 3KN4A 3BNEA 3RGRA 3H51A 3HX8A 2OOVA 3HK4A 2HMJB 3U97A 3UL5A 1JKGA 3ECFA 2IUJA 3MG3A 2RSXA 3NM7A 1KD14 3MKIA 1TUHA 1OACA 4WHAA 3ER7A 3FKAA 3LMLA 5IEOA 1EA2A 4WYKB 3CCU3 1JB2A 2BT3A 3LXUX 3CCS3 2HMKB 3QK9A 3ALAA 3GZYB 3UB1A 5ELJA 3LTBA 2LQVA 4K1VA 1Z1SA 1IV7A 3SLUA 5IG0A 8CHOA 1CQSA 3CCJ3 3T8NA 3DY5A 1NDOB 3FF0A 3B4OA 4R80A 4HM6B 2E2TA 1D6ZA 1TFKA 1N5HA 4CDLA 2PZVA 2CW9A 3QRDA 1NO3A 3AMOA 2CFDA 3CC23 2QGUA 5AEWB 3DMCA 1O7WB 3DGOA 1CEWI 3NQZA 1EG9B 2WOHA 3CD63 1OH0A 1GD3A 3MWZA 3K0ZA 4R9KA 5FW5A 4FCJA 1GYBA 1YJN3 1QALA 4L8OA 2K0MA 3OW22 5IG3A 1MOLA 1M1K4 3OXAA 4EC6A 3NXJA 1LNHA 3KSED 3CCE3 1OPYA 1W6YA 2OCTA 3DM8A 3FZWA 4X2HA 1VQ93 1AV4A 1FGQA 1OF5A 3FCSB 1N5PA 1QVF2 1A90A 1AVLA 2CK3H 2RCDA 5AIFA 1TIJA 5IERA 3SOYA 3PXMA 1WMNA 5D81A 4K1UA 1EKMA 1GS3A 2CC3A 3WA3A 2IA7A 1KC84 3S29A 3HI7A 1TFOA 2Z76A 4HM2B 2OTL3 2QEX3 4O8SA 1M9GA 1FGRA 3E99A 4J8TA 2JQ5A 3V99A 1IVUA 2PNCA 1ZX2A 2XFSA 3LTCA 5CK6A 2GBXB 3CC43 1KWIA 5CLKA 3HZPA 1W00A 1W2ZA 4O02B 4HM7B 3NQYA 1Q864 1LOXA 4OVMA 5IF6A 1UW1A 4MMXB 5AEUB 2MF7A 1DMQA 4N3VA 3CCR3 1NWWA 1NU3A 1RRLA 3JUPA 3N8BA 5CXOA 2Y73A 3CC73 2ZL8A 2BMRB 1N8QA 4FR9A 1VQ73 3X3ZA 4U13A 4GL6A 1QVG2 4CCVA 2CIUA 3EF8A 1QJGA 3AMOB 3LYGA 1FGOA 3M8CA 4XBXA 3GRDA 4XB5A 3SEDA 1YI23 2W2CA 2CWUA 1VQ63 3NBBA 1W01A 3NUVA 5EEOA 5JBSA 1L5GB 5D83A 1Q7Y4 2F98A 2V1LA 2BMQB 1FGTA 3FGYA 3S67A 5I97A 1N8R4 1GY7A 4L7KA 4KVHA 2LYXA 2INXA 2GEYA 2W6JH 2P0MA 4GB5A 1FA3A 1SIHA 5D82A 4ORLA 2F99A 1VQ53 3PYJA 5CF1A 3F8XA 1OF5B 4N6LA 1JV2B 2K54A 3NBJA 4H3UA 4N6MA 1KQS2 1IV9A 2RGQA 3EN1B 3CME3 1OGXA 4HYZA 4BTYA 4LGQA 1IT8A 2KXGA 2XR8B 3F14A 3PCSA 1W4NA 2WGOA 3BNDA 1STDA 2W04A 3D3LA 1TP6A 3KIIA 2CKFB 3FG1A 4LSOA 2YFIB 4FCMA 2F86B 4N6V0 5LC7A 4FMDA 1OCVA 3TDGA 3BLZA 3LOYA 3O8YA 3WOEB 3CNXA 1O7MB 1W6CA 5TGNA 5AIIA 2OQEA 1DVCA 4Q53A 1K28A 3BNBA 1U8CB 2XF3A 2CH9A 3PCRA 3PGBA 1NJI4 1A2VA 4HM4B 4MEIA 3RGAA 3JUQA 3WMDA 1OUNA 3LT9A 1O7GB 2HMLB 1M904 3EJVA 3S27A 2FNQA 2XRXB 3JUOA 4FMCA 1K8A4 1CYVA 1PFPA 2FGTA 3EBYA 2WO0A 3LH4A 4BTWA 2UX0A 1WQLB 1VQK3 1GD4A 2GXFA 3L0RA 5CF2A 1RN7A 1ZO2A 4N6UA 1VQ43 4K61A 2CWVA 3MYTA 3UL6A 1SJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9A A;  3JUN A;  3DXO A;  3EN8 A;  3F8H A;  1AR0 A;  3KKG A;  4RZM A;  3MSO A;  3F7X A;  3F9S A;  3H3H A;  3FH1 A;  5IEN A;  2I9W A;  3FSD A;  3NM2 A;  4LMI A;  3G16 A;  1ULJ B;  1Q42 A;  4I4K A;  4PEJ A;  2XSH B;  3DUK A;  3CU3 A;  3F40 A;  4X2O A;  2OWP A;  3DZL A;  4HM1 B;  2YFJ B;  3B7C A;  1C7H A;  1Q40 A;  2B1X B;  4L8P A;  1JN5 A;  3MG2 A;  1K41 A;  3A76 A;  2BNG A;  1DMM A;  5EVH A;  3UNL A;  5STD A;  3EX9 A;  1O7P B;  3OWU A;  1OHP A;  4XDV A;  1OGZ A;  1HKX A;  1BUQ A;  1O7N B;  4XBT A;  3ROB A;  3EC9 A;  5KP3 A;  4WP5 A;  1E3R A;  1OHS A;  1GY6 A;  1S5A A;  4XDW A;  3FLJ A;  4OUQ A;  3I0Y A;  3OX9 A;  3MG1 A;  1JB5 A;  3OV4 A;  4HJL B;  7STD A;  1U5O A;  3UJM A;  5HGR A;  3G0K A;  3OWS A;  3STD A;  2R4I A;  3KE7 A;  3GZB A;  3NV0 A;  2YFL B;  1JB4 A;  3IPT A;  1ISK A;  5AIG A;  4HKV B;  5DRE A;  1O7H B;  3EBT A;  3S5C A;  6STD A;  1Q40 B;  1E97 A;  1JN5 B;  2CHC A;  3LZA A;  5BVB A;  3D9R A;  4R1K A;  2RFR A;  5AI1 A;  5JPU A;  1ASK A;  3GZR A;  4HM8 B;  3OWY A;  2BMO B;  3KSP A;  5KP1 A;  2IMJ A;  5JPP A;  1QMA A;  1UUV B;  5IG4 A;  4STD A;  4LEH A;  3GWR A;  3T8U A;  5BXQ A;  3Q90 A;  2A15 A;  5G2G A;  3GZX B;  1A2K A;  2B24 B;  4HM0 B;  2HMO B;  3K7C A;  3B4P A;  5IEP A;  1IDP A;  4XBY A;  4HZ9 B;  3CPO A;  3MHE A;  2GBW B;  4MJD A;  2Z7A A;  2HMM B;  3FF2 A;  3F7S A;  4WYK A;  3NV0 B;  3NHX A;  2HMN B;  2XSO B;  1JKG B;  2GEX A;  2QIY A;  1DMN A;  4HVN A;  4R9L A;  1ULI B;  3SOA A;  3CNM A;  1GY5 A;  4XM4 A;  5DRV A;  5KP4 A;  5IG5 A;  4WWU C;  3VSY A;  1VZZ A;  4HM3 B;  1W02 A;  3NBR A;  3B8L A;  3KZT A;  4HZB B;  4HM5 B;  2STD A;  5AIH A;  1E3V A;  3G8Z A;  3VGN A;  3JUM A;  3EHC A;  4IIA A;  1UUW B;  2Z77 A;  3BB9 A;  1OHO A;  3EQQ B;  3RGR A;  3H51 A;  3HX8 A;  3HK4 A;  2HMJ B;  1JKG A;  3ECF A;  3MG3 A;  3MKI A;  1TUH A;  3ER7 A;  3FKA A;  5IEO A;  1EA2 A;  4WYK B;  1JB2 A;  2HMK B;  3GZY B;  4K1V A;  1Z1S A;  5IG0 A;  8CHO A;  1CQS A;  3T8N A;  1NDO B;  3FF0 A;  3B4O A;  4HM6 B;  4CDL A;  2PZV A;  2QGU A;  5AEW B;  3DMC A;  1O7W B;  1EG9 B;  1OH0 A;  3K0Z A;  4R9K A;  5FW5 A;  4FCJ A;  1GYB A;  4L8O A;  5IG3 A;  3OXA A;  3NXJ A;  1OPY A;  1W6Y A;  3FZW A;  3DM8 A;  4X2H A;  1OF5 A;  2RCD A;  5AIF A;  5IER A;  3SOY A;  5D81 A;  4K1U A;  1GS3 A;  4HM2 B;  2Z76 A;  3E99 A;  4J8T A;  2JQ5 A;  1ZX2 A;  5CK6 A;  2GBX B;  5CLK A;  3HZP A;  1W00 A;  4HM7 B;  4OVM A;  5IF6 A;  5AEU B;  1DMQ A;  4N3V A;  1NWW A;  1NU3 A;  5CXO A;  3JUP A;  2BMR B;  4U13 A;  3EF8 A;  1QJG A;  3LYG A;  3M8C A;  4XBX A;  3GRD A;  4XB5 A;  3SED A;  2W2C A;  1W01 A;  3NUV A;  5D83 A;  2F98 A;  2BMQ B;  3FGY A;  1GY7 A;  4L7K A;  4KVH A;  2INX A;  2GEY A;  4GB5 A;  5D82 A;  4ORL A;  2F99 A;  5CF1 A;  3F8X A;  1OF5 B;  2K54 A;  4H3U A;  2RGQ A;  3EN1 B;  1OGX A;  4LGQ A;  2XR8 B;  3F14 A;  1STD A;  1TP6 A;  2CKF B;  2YFI B;  4FCM A;  2F86 B;  1OCV A;  3BLZ A;  3CNX A;  1O7M B;  5TGN A;  5AII A;  4Q53 A;  4HM4 B;  3RGA A;  3JUQ A;  3WMD A;  1OUN A;  1O7G B;  2HML B;  3EJV A;  2XRX B;  3JUO A;  3EBY A;  2UX0 A;  1WQL B;  2GXF A;  5CF2 A;  1ZO2 A;  3MYT A;  1SJW A; 
#chains in the Genus database with same CATH topology
 4J9A A;  5EQL A;  2D42 A;  3JUN A;  1VQL 3;  3BNC A;  1WMP A;  1D6Y A;  3PZW A;  4AKZ A;  1RN4 A;  9RNT A;  1LNI A;  2W0Q A;  1SQW A;  3DXO A;  1AVK A;  1BNI A;  3Q2P A;  3CXC 2;  3EN8 A;  3ZG0 A;  1RHL A;  1Q7H A;  2ML5 A;  3HII A;  3F8H A;  1G02 A;  1JZO A;  1WNH A;  3I55 3;  3G71 3;  1AR0 A;  3KKG A;  4KFD A;  2E2U A;  1SAR A;  3MSO A;  4RZM A;  4RBN A;  2CG1 A;  3DGN A;  3F7X A;  3WOF B;  1RGK A;  3F9S A;  3X3X A;  3H3H A;  1RCK A;  3FH1 A;  5IEN A;  2I9W A;  1RGH A;  1IK3 A;  1BSB A;  3FSD A;  3EB8 A;  1MNL A;  3NM2 A;  1JBR A;  4LMI A;  3G16 A;  1EUI C;  1ULJ B;  1Q42 A;  3V92 A;  1N9E A;  2XEP A;  3LT8 A;  4I4K A;  4PEJ A;  1T5Y A;  1ROA A;  1V58 A;  2XSH B;  3CU3 A;  3DUK A;  3N54 B;  4RNY A;  3F40 A;  3T0U A;  1YJ9 3;  2FXT A;  3K63 A;  4X2O A;  2OWP A;  3DZL A;  4HM1 B;  1FGM A;  3AHS A;  2YFJ B;  1YJW 3;  3B7C A;  1IQY A;  3RNT A;  1C7H A;  1Q40 A;  3FG3 A;  2B1X B;  1BNG A;  1IQX A;  4L8P A;  1JN5 A;  4QWT A;  3MG2 A;  1K41 A;  3A76 A;  2BNG A;  3X41 A;  3K9M C;  2KAA A;  1YGE A;  1DMM A;  1PY3 A;  2O3O A;  1A67 A;  1TJD A;  5EVH A;  1IVX A;  1B3S A;  3SX1 A;  3UNL A;  1BGS A;  5STD A;  1B2Z A;  3I56 3;  4EBG A;  1DET A;  2CWT A;  1BSE A;  1O7P B;  3EX9 A;  5AYS C;  1I2G A;  4EYC A;  1NB5 I;  2AAD A;  1W2B 2;  3OWU A;  5IW9 A;  3Q1C A;  1I70 A;  5GSP A;  2CFL A;  3K5T A;  2Z6B A;  1MGW A;  1OHP A;  1LOW A;  4XDV A;  1RSN A;  1OGZ A;  1HKX A;  2J8X B;  1BUQ A;  1O7N B;  1FUW A;  4XBT A;  2RNT A;  2ML6 A;  4AKY A;  1B2M A;  1AY7 A;  3N9H A;  3ROB A;  2C11 A;  1V74 A;  1AQZ A;  1TRQ A;  2H0I A;  4NPB A;  3EC9 A;  3U1W A;  6GSP A;  5KP3 A;  4NHF A;  2P0X A;  4WP5 A;  1X1W A;  1IVW A;  1E3R A;  1VQM 3;  1JJ2 2;  3VF1 A;  4BU4 A;  1I3F A;  2W9P A;  3WDG B;  5BU4 A;  1DYU A;  1OHS A;  1GY6 A;  1B20 A;  4HAA A;  1S5A A;  1IU7 A;  2KF4 A;  4ILF A;  4XDW A;  1K73 4;  1J2B A;  1VQQ A;  3FLJ A;  4OUQ A;  4JRF A;  3ZG5 A;  3I0Y A;  3OX9 A;  4HBR A;  2W03 A;  3MG1 A;  1KSI A;  4HOH A;  4NRE A;  1JB5 A;  4O2H A;  3OV4 A;  4HJL B;  2QA4 3;  1MWR A;  2O9U X;  2CFW A;  3IJE B;  2P38 A;  7STD A;  1U5O A;  4LYL B;  4N6O B;  3UJM A;  3CCV 3;  5HGR A;  4OK0 A;  4J5K A;  1US1 A;  4BTX A;  3G0K A;  3OWS A;  3STD A;  2R4I A;  3KE7 A;  3GZB A;  1LVN A;  3NV0 A;  4KT3 B;  1RGC A;  2YFL B;  2CG0 A;  3X42 A;  1ZS7 A;  1PYL A;  3G4S 3;  1JB4 A;  4WFO A;  3D79 A;  3IPT A;  1FUT A;  1ISK A;  4KZ1 A;  5AIG A;  3DGY A;  1GOU A;  1RLS A;  4HKV B;  4KFE A;  1O7H B;  5DRE A;  2C4B A;  1IQ8 A;  2SAR A;  1IVV A;  3EBT A;  4RNT A;  3CMA 3;  3S5C A;  6STD A;  4TX4 A;  3AGO A;  1Q40 B;  2C10 A;  2SBL A;  1E97 A;  2W56 B;  1JNQ A;  3EE1 A;  1RN1 A;  3SXX A;  4H61 A;  3HOH A;  3KFQ C;  1JN5 B;  2Q07 A;  1DVD A;  2CHC A;  4EV2 A;  1RGE A;  3LZA A;  2R41 A;  5BVB A;  3D9R A;  4R1K A;  5M19 A;  2RFR A;  2CFG A;  1WTH A;  1LQG C;  5AI1 A;  5JPU A;  2M7O A;  1ASK A;  1NNV A;  3GZR A;  3KCH A;  1GOV A;  4HM8 B;  1JRQ A;  3S28 A;  4BL2 A;  7GSP A;  1RDS A;  3OWY A;  4AEQ A;  1CYU A;  4N6T A;  2BMO B;  3LTA A;  1T3B A;  2YX9 A;  2JDI H;  1BU4 A;  2P05 A;  3KSP A;  5KP1 A;  3CCM 3;  2IMJ A;  4N6N B;  1QMA A;  1UUV B;  5JPP A;  4FMA A;  1W6G A;  4O3V A;  5IG4 A;  2GU1 A;  1STF I;  4STD A;  1UGI A;  4LEH A;  1W5Z A;  1D6U A;  3GWR A;  1FYS A;  1RGL A;  1QAK A;  1RJO A;  3T8U A;  4ZM8 A;  1YIT 3;  5BXQ A;  2D1W A;  2XGL A;  2KRT A;  1WMO A;  3Q90 A;  2A15 A;  5G2G A;  2L4V A;  5HOH A;  4RNZ A;  1UI7 A;  4IPB A;  1BRI A;  3RDE A;  3GZX B;  1A2K A;  3SVA A;  4EV5 A;  1YIJ 3;  3J7Y d;  1RNT A;  3G6E 3;  1LOV A;  2IY2 A;  1UI8 A;  2OOV C;  4G1M B;  4K90 B;  1BRH A;  3CPW 2;  2B24 B;  2CX1 A;  4J5G A;  1QAF A;  3GAX A;  4R4K A;  4IT7 A;  3FG4 A;  4HM0 B;  2ZDJ A;  1ROV A;  2HMO B;  1BNE A;  1GMP A;  2WOF A;  2W9Q A;  1I3I A;  3B4P A;  3K7C A;  5IEP A;  1IDP A;  1YVB I;  1Q9E A;  3DGL A;  4XBY A;  2P09 A;  2XGN A;  4HZ9 B;  2H0G A;  2CFK A;  4FCZ A;  1TRP A;  3CPO A;  3IMA B;  1MWS A;  2GBW B;  2KCD A;  3MHE A;  2Z7A A;  4MJD A;  1W7C A;  2WGQ A;  2HMM B;  3FF2 A;  4FMB A;  2L1S A;  3PS8 A;  3CCQ 3;  3F7S A;  4EXR A;  2XFT A;  3CCL 3;  1FZU A;  1SII A;  2BU4 A;  2W56 A;  4WYK A;  1LOY A;  2UUG C;  1R4C A;  3NV0 B;  3NHX A;  1N9J A;  1BNJ A;  1V57 A;  5M18 A;  2IUK A;  2HMN B;  2XSO B;  3X3Y A;  3JVC A;  1JKG B;  1A2P A;  1RKY A;  1F8N A;  3BU4 A;  1VQO 3;  2GEX A;  1Q82 4;  2BHM A;  2UGI A;  1MGR A;  5A0O B;  1Y4K A;  2QIY A;  4KFF A;  2OTJ 3;  1DMN A;  3NX0 A;  1YNV X;  4HVN A;  4R9L A;  2BO9 B;  1ULI B;  3SOA A;  1K9M 4;  3CNM A;  4LZI A;  1B21 A;  2KF5 A;  1GY5 A;  4XM4 A;  2XH9 A;  1TU5 A;  3Q3F A;  1EQK A;  5DRV A;  4MMY B;  3SYU A;  5KP4 A;  1DE3 A;  3HIG A;  2Y74 A;  1Q81 4;  4MMZ B;  5IG5 A;  4WWU C;  5ELU A;  3VSY A;  1G96 A;  1RRH A;  1VZZ A;  4HM3 B;  1W02 A;  3NBR A;  1PU4 A;  1ZGX A;  1NB3 I;  3B8L A;  4EW5 A;  1BNF A;  1R4Y A;  3KZT A;  4HZB B;  1S72 3;  4HM5 B;  2STD A;  2GU3 A;  5AIH A;  1IT7 A;  1E3V A;  3WA2 X;  1VQ8 3;  1LRA A;  2OQE C;  1LXE A;  3G8Z A;  1HZ1 A;  3VGN A;  3LTD A;  3MPH A;  5FGO A;  1SPU A;  2MC8 A;  3AHW A;  3JUM A;  3EHC A;  4IIA A;  2E2V A;  1UUW B;  1RTU A;  3DGM A;  1HU9 A;  3V98 A;  2CX0 A;  2Z77 A;  3D5G A;  5LC6 A;  4JF8 A;  1FW7 A;  1M1X B;  3BB9 A;  3X40 A;  5AYR B;  1OHO A;  3EQQ B;  1RNB A;  1YHQ 3;  3WOD G;  1VQN 3;  1JBT A;  3KN4 A;  3BNE A;  1VQP 3;  1I2E A;  1BSA A;  3RGR A;  3H51 A;  1RCL A;  3HX8 A;  1BRS A;  1G0T A;  2OOV A;  1BUJ A;  1BOX A;  3HK4 A;  1GMQ A;  2HMJ B;  3U97 A;  3UL5 A;  1JKG A;  1UCJ A;  2HOH A;  3ECF A;  2IUJ A;  2F5W A;  2RSX A;  1X1Y A;  3MG3 A;  1UCL A;  2H0H A;  3NM7 A;  1KD1 4;  3MKI A;  1TUH A;  1OAC A;  4WHA A;  3ER7 A;  3FKA A;  1EEJ A;  3LML A;  5IEO A;  1EA2 A;  4WYK B;  3CCU 3;  1JB2 A;  2BT3 A;  1FUS A;  3LXU X;  3CCS 3;  2HMK B;  3QK9 A;  3ALA A;  3GZY B;  3UB1 A;  5ELJ A;  3LTB A;  2LQV A;  4K1V A;  1C54 A;  1Z1S A;  1IV7 A;  3SLU A;  3DH2 A;  5IG0 A;  1T2H A;  8CHO A;  1UGH I;  1CQS A;  3CCJ 3;  1RMS A;  3T8N A;  3DY5 A;  1RGF A;  1NDO B;  3FF0 A;  3B4O A;  4R80 A;  4HM6 B;  2E2T A;  3URP A;  1D6Z A;  1TFK A;  1N5H A;  4CDL A;  2PZV A;  2CW9 A;  3QRD A;  1NO3 A;  3AMO A;  2CFD A;  3CC2 3;  2QGU A;  5AEW B;  1B2X A;  1O7W B;  3DMC A;  3DGO A;  1BRJ A;  1CEW I;  3NQZ A;  1RGA A;  2BIR A;  1EG9 B;  2WOH A;  3CD6 3;  1OH0 A;  1GD3 A;  3MWZ A;  3K0Z A;  4R9K A;  1CH0 A;  5FW5 A;  4FCJ A;  1GYB A;  1YJN 3;  1QAL A;  4L8O A;  2K0M A;  3OW2 2;  5G1K A;  1MOL A;  5IG3 A;  1M1K 4;  3OXA A;  4EC6 A;  3NXJ A;  1LNH A;  1UDI I;  3KSE D;  1OPY A;  3CCE 3;  3D4A A;  4BIR A;  4BL3 A;  1W6Y A;  2OCT A;  3DM8 A;  3FZW A;  3BIR A;  4X2H A;  1VQ9 3;  1BVI A;  1AV4 A;  1FGQ A;  1OF5 A;  2RBI A;  3FCS B;  1N5P A;  1YVS A;  1QVF 2;  1A90 A;  1AVL A;  1BRG A;  2CK3 H;  2GSP A;  2RCD A;  5AIF A;  1TIJ A;  5IER A;  3SOY A;  3PXM A;  1WMN A;  5D81 A;  4K1U A;  1EKM A;  1GS3 A;  2CC3 A;  1X1U A;  4GSP A;  3WA3 A;  2IA7 A;  1MWT A;  1KC8 4;  3S29 A;  3HI7 A;  1TFO A;  2Z76 A;  2ZA4 A;  4HM2 B;  1TTO A;  2OTL 3;  2QEX 3;  4O8S A;  1M9G A;  1FGR A;  1JBS A;  3E99 A;  4J8T A;  1GOY A;  2JQ5 A;  3V99 A;  3GSP A;  1BRK A;  1IVU A;  2PNC A;  1I0V A;  1ZX2 A;  2XFS A;  3LTC A;  5CK6 A;  2GBX B;  3CC4 3;  1KWI A;  5CLK A;  3HZP A;  1W00 A;  1W2Z A;  4O02 B;  4HM7 B;  3WR2 A;  3NQY A;  1Q86 4;  1LOX A;  3D5I A;  4OVM A;  5IF6 A;  1UW1 A;  4MMX B;  5AEU B;  2MF7 A;  1BAN A;  1DMQ A;  4N3V A;  3CCR 3;  2AAE A;  1NWW A;  1NU3 A;  1RRL A;  3JUP A;  3N8B A;  1YGW A;  5CXO A;  2Y73 A;  4CPK A;  2F5M A;  3CC7 3;  1UCK A;  2ZL8 A;  2BMR B;  1N8Q A;  4FR9 A;  1VQ7 3;  3X3Z A;  1BIR A;  4U13 A;  1BNS A;  6RNT A;  4GL6 A;  1QVG 2;  4CCV A;  2CIU A;  2K3D A;  3EF8 A;  1QJG A;  1BSD A;  3AMO B;  3LYG A;  1FGO A;  3M8C A;  4XBX A;  4DKI A;  3GRD A;  4XB5 A;  3SED A;  1YI2 3;  2W2C A;  1LQM B;  2CWU A;  1VQ6 3;  4GHO A;  3NBB A;  1RGG A;  1BAO A;  1W01 A;  3NUV A;  1I0X A;  5EEO A;  5JBS A;  1L5G B;  5D83 A;  8RNT A;  3ZFZ A;  1Q7Y 4;  2F98 A;  2V1L A;  2BMQ B;  1FGT A;  1I2F A;  3FGY A;  3S67 A;  5I97 A;  1N8R 4;  1GY7 A;  4L7K A;  4KVH A;  2LYX A;  1T2I A;  2INX A;  2GEY A;  1IYY A;  2W6J H;  2P0M A;  4GB5 A;  1FA3 A;  1SIH A;  5D82 A;  2KF3 A;  4ORL A;  2F99 A;  1MWU A;  3PYJ A;  5CF1 A;  3F8X A;  1VQ5 3;  1OF5 B;  4N6L A;  1JV2 B;  2K54 A;  3NBJ A;  4H3U A;  4N6M A;  3WHO A;  1IV9 A;  1KQS 2;  1BRN L;  2RGQ A;  3EN1 B;  3CME 3;  1OGX A;  4HYZ A;  4BTY A;  4LGQ A;  1IT8 A;  1B2S A;  2KF6 A;  4I5Q A;  2KXG A;  2XR8 B;  3F14 A;  1X1X A;  3PCS A;  1W4N A;  2WGO A;  3BND A;  1STD A;  2W04 A;  3D3L A;  1TP6 A;  3KII A;  2CKF B;  3FG1 A;  4LSO A;  2YFI B;  4FCM A;  2F86 B;  2F4Y A;  4N6V 0;  5G1L A;  5LC7 A;  1HYF A;  4FMD A;  5BIR A;  1OCV A;  3TDG A;  3BLZ A;  3A5E A;  3LOY A;  3O8Y A;  3WOE B;  3CNX A;  4CJN A;  1GSP A;  1JZD A;  1O7M B;  1W6C A;  5TGN A;  5AII A;  2OQE A;  1DVC A;  4Q53 A;  1BNR A;  1K28 A;  1GMR A;  3BNB A;  5RNT A;  1U8C B;  2XF3 A;  2CH9 A;  2ZHX B;  3PCR A;  3PGB A;  1UUG B;  1NJI 4;  1A2V A;  4HM4 B;  4MEI A;  3RGA A;  2F56 A;  3JUQ A;  1OUN A;  3WMD A;  3LT9 A;  1O7G B;  2HML B;  1M90 4;  3EJV A;  3S27 A;  1BSC A;  2FNQ A;  2XRX B;  3JUO A;  4FMC A;  1K8A 4;  1CYV A;  1PFP A;  1I8V A;  5M1A A;  2FGT A;  3EBY A;  2WO0 A;  3LH4 A;  4BTW A;  2UX0 A;  1WQL B;  1B27 A;  1VQK 3;  1GD4 A;  2GXF A;  3L0R A;  7RNT A;  5CF2 A;  1RN7 A;  1ZO2 A;  4N6U A;  1VQ4 3;  4K61 A;  1UCI A;  2CWV A;  2IYJ A;  3AGN A;  3MYT A;  1B2U A;  3UL6 A;  1SJW A; 
#chains in the Genus database with same CATH homology
 4J9A A;  5EQL A;  2D42 A;  3JUN A;  1VQL 3;  3BNC A;  1WMP A;  1D6Y A;  3PZW A;  4AKZ A;  2W0Q A;  1SQW A;  3DXO A;  1AVK A;  3Q2P A;  3CXC 2;  3EN8 A;  2ML5 A;  3HII A;  3F8H A;  1WNH A;  3I55 3;  3G71 3;  1AR0 A;  3KKG A;  4KFD A;  2E2U A;  3MSO A;  4RZM A;  4RBN A;  2CG1 A;  3DGN A;  3F7X A;  3WOF B;  3F9S A;  3X3X A;  3H3H A;  3FH1 A;  5IEN A;  2I9W A;  1IK3 A;  3FSD A;  3EB8 A;  1MNL A;  3NM2 A;  4LMI A;  3G16 A;  3V92 A;  1ULJ B;  1Q42 A;  1N9E A;  2XEP A;  3LT8 A;  4I4K A;  4PEJ A;  1T5Y A;  1ROA A;  2XSH B;  3DUK A;  3CU3 A;  3N54 B;  4RNY A;  3T0U A;  3F40 A;  1YJ9 3;  2FXT A;  3K63 A;  4X2O A;  2OWP A;  3DZL A;  4HM1 B;  1FGM A;  2YFJ B;  1YJW 3;  3B7C A;  1IQY A;  1C7H A;  1Q40 A;  3FG3 A;  2B1X B;  1IQX A;  4L8P A;  1JN5 A;  4QWT A;  3MG2 A;  1K41 A;  3A76 A;  2BNG A;  3X41 A;  3K9M C;  1YGE A;  1DMM A;  2O3O A;  1A67 A;  5EVH A;  1IVX A;  3SX1 A;  3UNL A;  5STD A;  3I56 3;  4EBG A;  2CWT A;  3EX9 A;  1O7P B;  5AYS C;  4EYC A;  1NB5 I;  1W2B 2;  3OWU A;  5IW9 A;  3Q1C A;  2CFL A;  3K5T A;  2Z6B A;  1OHP A;  4XDV A;  1OGZ A;  1HKX A;  1BUQ A;  1FUW A;  1O7N B;  4XBT A;  2ML6 A;  4AKY A;  3N9H A;  3ROB A;  2C11 A;  1V74 A;  3EC9 A;  3U1W A;  5KP3 A;  4NHF A;  2P0X A;  4WP5 A;  1IVW A;  1E3R A;  1VQM 3;  1JJ2 2;  3VF1 A;  3WDG B;  2W9P A;  1DYU A;  1OHS A;  1GY6 A;  1S5A A;  1IU7 A;  4XDW A;  1K73 4;  1J2B A;  3FLJ A;  4OUQ A;  4JRF A;  3I0Y A;  3OX9 A;  4HBR A;  2W03 A;  3MG1 A;  1KSI A;  4NRE A;  1JB5 A;  4O2H A;  3OV4 A;  4HJL B;  2QA4 3;  2O9U X;  2CFW A;  3IJE B;  2P38 A;  7STD A;  1U5O A;  4N6O B;  3UJM A;  3CCV 3;  5HGR A;  4OK0 A;  1US1 A;  4BTX A;  3G0K A;  3OWS A;  3STD A;  2R4I A;  3KE7 A;  3GZB A;  1LVN A;  3NV0 A;  2YFL B;  2CG0 A;  3X42 A;  3G4S 3;  1JB4 A;  4WFO A;  3IPT A;  1ISK A;  4KZ1 A;  5AIG A;  4HKV B;  4KFE A;  1O7H B;  5DRE A;  1IQ8 A;  1IVV A;  3EBT A;  3CMA 3;  3S5C A;  6STD A;  4TX4 A;  1Q40 B;  2C10 A;  2SBL A;  1E97 A;  2W56 B;  1JNQ A;  3EE1 A;  3SXX A;  4H61 A;  3KFQ C;  1DVD A;  1JN5 B;  2Q07 A;  2CHC A;  4EV2 A;  3LZA A;  5BVB A;  3D9R A;  4R1K A;  2RFR A;  2CFG A;  1WTH A;  5AI1 A;  5JPU A;  2M7O A;  1ASK A;  3GZR A;  3S28 A;  4HM8 B;  1JRQ A;  3OWY A;  4AEQ A;  1CYU A;  4N6T A;  2BMO B;  3LTA A;  2YX9 A;  2JDI H;  2P05 A;  3KSP A;  5KP1 A;  3CCM 3;  2IMJ A;  4N6N B;  1QMA A;  1UUV B;  5JPP A;  4FMA A;  1W6G A;  4O3V A;  5IG4 A;  2GU1 A;  1STF I;  4STD A;  4LEH A;  1W5Z A;  1D6U A;  3GWR A;  1QAK A;  1RJO A;  3T8U A;  4ZM8 A;  1YIT 3;  5BXQ A;  2D1W A;  2XGL A;  2KRT A;  1WMO A;  3Q90 A;  2A15 A;  5G2G A;  2L4V A;  1VQP 3;  4RNZ A;  1UI7 A;  4IPB A;  3RDE A;  3GZX B;  1A2K A;  3SVA A;  4EV5 A;  1YIJ 3;  3J7Y d;  3G6E 3;  1UI8 A;  2OOV C;  4G1M B;  4K90 B;  3CPW 2;  2B24 B;  1QAF A;  3GAX A;  4R4K A;  4IT7 A;  3FG4 A;  4HM0 B;  2ZDJ A;  1ROV A;  2HMO B;  2WOF A;  2W9Q A;  3B4P A;  3K7C A;  5IEP A;  1IDP A;  1YVB I;  3DGL A;  4XBY A;  2P09 A;  2XGN A;  4HZ9 B;  2CFK A;  4FCZ A;  3IMA B;  3CPO A;  3MHE A;  2GBW B;  2KCD A;  4MJD A;  2Z7A A;  1W7C A;  2WGQ A;  2HMM B;  3FF2 A;  4FMB A;  3PS8 A;  3CCQ 3;  3F7S A;  4EXR A;  2XFT A;  3CCL 3;  1SII A;  2W56 A;  4WYK A;  1R4C A;  3NV0 B;  3NHX A;  1N9J A;  2IUK A;  2HMN B;  2XSO B;  3X3Y A;  3JVC A;  1JKG B;  1RKY A;  1F8N A;  1VQO 3;  2GEX A;  1Q82 4;  2BHM A;  5A0O B;  1Y4K A;  2QIY A;  4KFF A;  2OTJ 3;  1DMN A;  3NX0 A;  4HVN A;  4R9L A;  2BO9 B;  1ULI B;  3SOA A;  1K9M 4;  3CNM A;  4LZI A;  1GY5 A;  4XM4 A;  2XH9 A;  1TU5 A;  1EQK A;  5DRV A;  4MMY B;  5KP4 A;  3HIG A;  2Y74 A;  1Q81 4;  4MMZ B;  5IG5 A;  4WWU C;  5ELU A;  3VSY A;  1G96 A;  1RRH A;  1VZZ A;  4HM3 B;  1W02 A;  3NBR A;  1PU4 A;  1NB3 I;  3B8L A;  3KZT A;  4HZB B;  1S72 3;  4HM5 B;  2STD A;  2GU3 A;  5AIH A;  1IT7 A;  1E3V A;  3WA2 X;  1VQ8 3;  2OQE C;  1LXE A;  3G8Z A;  3VGN A;  3LTD A;  3MPH A;  5FGO A;  1SPU A;  2MC8 A;  3JUM A;  3EHC A;  4IIA A;  2E2V A;  1UUW B;  3DGM A;  3V98 A;  1HU9 A;  2Z77 A;  5LC6 A;  4JF8 A;  1M1X B;  3BB9 A;  3X40 A;  5AYR B;  1OHO A;  3EQQ B;  1YHQ 3;  3WOD G;  1VQN 3;  3KN4 A;  3BNE A;  3RGR A;  3H51 A;  3HX8 A;  2OOV A;  3HK4 A;  2HMJ B;  3U97 A;  3UL5 A;  1JKG A;  3ECF A;  2IUJ A;  3MG3 A;  2RSX A;  3NM7 A;  1KD1 4;  3MKI A;  1TUH A;  1OAC A;  4WHA A;  3ER7 A;  3FKA A;  3LML A;  5IEO A;  1EA2 A;  4WYK B;  3CCU 3;  1JB2 A;  2BT3 A;  3LXU X;  3CCS 3;  2HMK B;  3QK9 A;  3ALA A;  3GZY B;  3UB1 A;  5ELJ A;  3LTB A;  2LQV A;  4K1V A;  1Z1S A;  1IV7 A;  3SLU A;  5IG0 A;  8CHO A;  1CQS A;  3CCJ 3;  3T8N A;  3DY5 A;  1NDO B;  3FF0 A;  3B4O A;  4R80 A;  4HM6 B;  2E2T A;  1D6Z A;  1TFK A;  1N5H A;  4CDL A;  2PZV A;  2CW9 A;  3QRD A;  1NO3 A;  3AMO A;  2CFD A;  3CC2 3;  2QGU A;  5AEW B;  3DMC A;  1O7W B;  3DGO A;  1CEW I;  3NQZ A;  1EG9 B;  2WOH A;  3CD6 3;  1OH0 A;  1GD3 A;  3MWZ A;  3K0Z A;  4R9K A;  5FW5 A;  4FCJ A;  1GYB A;  1YJN 3;  1QAL A;  4L8O A;  2K0M A;  3OW2 2;  5IG3 A;  1MOL A;  1M1K 4;  3OXA A;  4EC6 A;  3NXJ A;  1LNH A;  3KSE D;  3CCE 3;  1OPY A;  1W6Y A;  2OCT A;  3DM8 A;  3FZW A;  4X2H A;  1VQ9 3;  1AV4 A;  1FGQ A;  1OF5 A;  3FCS B;  1N5P A;  1QVF 2;  1A90 A;  1AVL A;  2CK3 H;  2RCD A;  5AIF A;  1TIJ A;  5IER A;  3SOY A;  3PXM A;  1WMN A;  5D81 A;  4K1U A;  1EKM A;  1GS3 A;  2CC3 A;  3WA3 A;  2IA7 A;  1KC8 4;  3S29 A;  3HI7 A;  1TFO A;  2Z76 A;  4HM2 B;  2OTL 3;  2QEX 3;  4O8S A;  1M9G A;  1FGR A;  3E99 A;  4J8T A;  2JQ5 A;  3V99 A;  1IVU A;  2PNC A;  1ZX2 A;  2XFS A;  3LTC A;  5CK6 A;  2GBX B;  3CC4 3;  1KWI A;  5CLK A;  3HZP A;  1W00 A;  1W2Z A;  4O02 B;  4HM7 B;  3NQY A;  1Q86 4;  1LOX A;  4OVM A;  5IF6 A;  1UW1 A;  4MMX B;  5AEU B;  2MF7 A;  1DMQ A;  4N3V A;  3CCR 3;  1NWW A;  1NU3 A;  1RRL A;  3JUP A;  3N8B A;  5CXO A;  2Y73 A;  3CC7 3;  2ZL8 A;  2BMR B;  1N8Q A;  4FR9 A;  1VQ7 3;  3X3Z A;  4U13 A;  4GL6 A;  1QVG 2;  4CCV A;  2CIU A;  3EF8 A;  1QJG A;  3AMO B;  3LYG A;  1FGO A;  3M8C A;  4XBX A;  3GRD A;  4XB5 A;  3SED A;  1YI2 3;  2W2C A;  2CWU A;  1VQ6 3;  3NBB A;  1W01 A;  3NUV A;  5EEO A;  5JBS A;  1L5G B;  5D83 A;  1Q7Y 4;  2F98 A;  2V1L A;  2BMQ B;  1FGT A;  3FGY A;  3S67 A;  5I97 A;  1N8R 4;  1GY7 A;  4L7K A;  4KVH A;  2LYX A;  2INX A;  2GEY A;  2W6J H;  2P0M A;  4GB5 A;  1FA3 A;  1SIH A;  5D82 A;  4ORL A;  2F99 A;  1VQ5 3;  3PYJ A;  5CF1 A;  3F8X A;  1OF5 B;  4N6L A;  1JV2 B;  2K54 A;  3NBJ A;  4H3U A;  4N6M A;  1KQS 2;  1IV9 A;  2RGQ A;  3EN1 B;  3CME 3;  1OGX A;  4HYZ A;  4BTY A;  4LGQ A;  1IT8 A;  2KXG A;  2XR8 B;  3F14 A;  3PCS A;  1W4N A;  2WGO A;  3BND A;  1STD A;  2W04 A;  3D3L A;  1TP6 A;  3KII A;  2CKF B;  3FG1 A;  4LSO A;  2YFI B;  4FCM A;  2F86 B;  4N6V 0;  5LC7 A;  4FMD A;  1OCV A;  3TDG A;  3BLZ A;  3LOY A;  3O8Y A;  3WOE B;  3CNX A;  1O7M B;  1W6C A;  5TGN A;  5AII A;  2OQE A;  1DVC A;  4Q53 A;  1K28 A;  3BNB A;  1U8C B;  2XF3 A;  2CH9 A;  3PCR A;  3PGB A;  1NJI 4;  1A2V A;  4HM4 B;  4MEI A;  3RGA A;  3JUQ A;  3WMD A;  1OUN A;  3LT9 A;  1O7G B;  2HML B;  1M90 4;  3EJV A;  3S27 A;  2FNQ A;  2XRX B;  3JUO A;  4FMC A;  1K8A 4;  1CYV A;  1PFP A;  2FGT A;  3EBY A;  2WO0 A;  3LH4 A;  4BTW A;  2UX0 A;  1WQL B;  1VQK 3;  1GD4 A;  2GXF A;  3L0R A;  5CF2 A;  1RN7 A;  1ZO2 A;  4N6U A;  1VQ4 3;  4K61 A;  2CWV A;  3MYT A;  3UL6 A;  1SJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...