2K54A

Solution nmr structure of protein atu0742 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg0) target att8. ontario center for structural proteomics target atc0727 .
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
123
structure length
123
Chain Sequence
b'MNSEIELPVQKQLEAYNARDIDAFMAWWADDCQYYAFPATLLAGNAAEIRVRHIERFKEPDLYGELLTRVIVGNVVIDHETVTRNFPEGKGEVDVACIYEVENGRIAKAWFKIGEPRIVSQKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of protein ATC0727 from Agrobacterium Tumefaciens.
rcsb
molecule keywords Protein Atu0742
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 25
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2k54A00
3EJVA 2RFRA 3GZXB 1JB2A 5IEPA 1A2KA 3CPOA 1OCVA 3FF0A 1WQLB 2GEXA 3SEDA 3T8NA 5CF2A 3A76A 3EC9A 4H3UA 3HK4A 3KZTA 4PEJA 3JUMA 1OF5A 1STDA 2INXA 5KP1A 2HMLB 2B1XB 3GZBA 5IERA 3OV4A 2I9WA 4KVHA 3JUQA 4XBYA 2F98A 3OWYA 2YFLB 5IG4A 4HM5B 3NUVA 5BXQA 1C7HA 4J8TA 5AIIA 5AIGA 3F9SA 2F99A 5BVBA 4HM7B 5IENA 1Q40A 3D9RA 1TP6A 1S5AA 4CDLA 1E3RA 4N3VA 2YFIB 3DUKA 3SOAA 1DMMA 1JKGA 3NM2A 2JQ5A 5D83A 4WYKA 5G2GA 1IDPA 4L8PA 3LZAA 1Q42A 2XR8B 3CNMA 2YFJB 1E97A 4XBTA 4XB5A 4HM3B 3MG1A 2RGQA 5AI1A 3K7CA 3MHEA 5CF1A 1GS3A 3NV0B 4HM6B 3VGNA 2GEYA 5IG0A 1GYBA 1OHPA 1O7PB 3F7SA 1OHOA 4L7KA 2HMNB 4HM4B 5IG5A 4XBXA 3M8CA 5EVHA 1O7WB 3GZYB 1NWWA 3DMCA 1ASKA 2GBWB 3EQQB 3KSPA 3EN1B 5FW5A 4Q53A 2K54A 4XDVA 5DRVA 1JN5B 3DM8A 3F14A 1ULIB 4STDA 3BLZA 4MJDA 3EF8A 1O7GB 4XDWA 5TGNA 3UNLA 1ZO2A 2UX0A 3S5CA 3CNXA 3H51A 2BNGA 2XRXB 3ROBA 1TUHA 2F86B 4HKVB 5IG3A 1OGZA 3CU3A 3GZRA 1O7HB 5IF6A 2XSOB 3B4OA 1ULJB 4GB5A 3OWUA 3B8LA 2BMQB 4ORLA 1OF5B 3MSOA 3FSDA 1W02A 1UUWB 1NDOB 1GY5A 1ZX2A 5HGRA 1OHSA 2PZVA 4OUQA 4J9AA 3K0ZA 3STDA 5AEUB 3DXOA 2HMOB 3ECFA 5D81A 3JUNA 2Z77A 5CLKA 1U5OA 2HMKB 3E99A 2HMMB 3ER7A 1Q40B 3WMDA 3EX9A 4HM0B 3SOYA 3FLJA 3UJMA 2CKFB 1W6YA 3NBRA 4OVMA 1JKGB 4LGQA 4WYKB 5JPPA 2BMRB 3OX9A 2GXFA 4K1VA 3LYGA 3VSYA 3OXAA 1W00A 2BMOB 1JB5A 1EG9B 1NU3A 3KE7A 7STDA 1BUQA 5KP3A 1O7MB 2IMJA 3EHCA 3F40A 2Z76A 4HM2B 3DZLA 4U13A 6STDA 8CHOA 1CQSA 3HX8A 5CK6A 4HZ9B 4FCMA 1OGXA 3MYTA 3FGYA 3F8XA 1GY6A 4HVNA 3EBYA 4HJLB 4WWUC 3BB9A 2W2CA 3JUPA 4R9LA 4LEHA 1OH0A 3H3HA 1O7NB 3RGAA 4HM8B 1ISKA 4R1KA 2B24B 3FKAA 1DMQA 4XM4A 2STDA 5KP4A 2XSHB 3EN8A 1Z1SA 4X2HA 5AIHA 2HMJB 3MG2A 1JB4A 4R9KA 5AIFA 1UUVB 3RGRA 2A15A 1SJWA 3B4PA 3G8ZA 1AR0A 1VZZA 3B7CA 1GY7A 5JPUA 3KKGA 2RCDA 3GWRA 5STDA 1K41A 3I0YA 1QMAA 3NV0A 2Z7AA 4RZMA 3G16A 3OWSA 2CHCA 3F7XA 1OPYA 5AEWB 3IPTA 1E3VA 2QIYA 1HKXA 3Q90A 5DREA 3FH1A 1OUNA 4I4KA 4X2OA 4L8OA 4WP5A 1W01A 3NXJA 4IIAA 3GRDA 5CXOA 4FCJA 3MG3A 3NHXA 2QGUA 2GBXB 3HZPA 4HZBB 1JN5A 3G0KA 1DMNA 1EA2A 3MKIA 4K1UA 5D82A 5IEOA 3FF2A 3JUOA 3EBTA 3T8UA 2R4IA 3FZWA 2OWPA 4HM1B 1QJGA 4LMIA 3F8HA
chains in the Genus database with same CATH superfamily
1MGWA 6RNTA 3EJVA 2XGLA 4QWTA 2RFRA 3GZXB 1JB2A 4HAAA 5IEPA 3D4AA 1U8CB 1A2KA 1A2VA 1MGRA 3RDEA 1RN4A 3CPOA 1KD14 2O3OA 1OCVA 1K8A4 4BTWA 1VQ93 4N6NB 3FF0A 3A5EA 1BNRA 3RNTA 1WQLB 2GEXA 4FMDA 3SEDA 1X1XA 2FGTA 3FG3A 2IUJA 3T8NA 1K734 2CG0A 5CF2A 3WR2A 3LTBA 3DGMA 3A76A 5EEOA 4EXRA 3EC9A 2XEPA 2F5WA 4H3UA 3HK4A 3KZTA 3PXMA 3JUMA 1OF5A 1STDA 4PEJA 2D42A 5BIRA 1JJ22 1B2MA 1YNVX 2INXA 2XFTA 3G713 1RNBA 1BNGA 4FMBA 5KP1A 2HMLB 2B1XB 3CD63 1N8QA 1RHLA 3GZBA 2GSPA 5IERA 4LSOA 4LZIA 1RCKA 4FR9A 3OV4A 2I9WA 2P05A 4KVHA 1VQP3 1BSBA 3X3YA 1VQL3 3JUQA 3CC23 3KIIA 3X42A 1KQS2 1RN1A 4XBYA 2F98A 1BRKA 5GSPA 1B3SA 2WOHA 3FG4A 2YFLB 3OWYA 2Y74A 2RNTA 5IG4A 1TFKA 5RNTA 1D6UA 4HM5B 2ML6A 3NUVA 2CX1A 3Q2PA 1PYLA 4EC6A 5BXQA 1C7HA 4J8TA 3WDGB 1RKYA 1LQGC 3CCM3 1AQZA 2AAEA 3NBBA 5AIIA 1QAFA 4TX4A 3F9SA 2F99A 3LTAA 1I0VA 3L0RA 1W2ZA 5AIGA 5BVBA 1Q824 1GOUA 1YGEA 3S27A 1VQK3 4HM7B 5IENA 2L1SA 1Q40A 3BNEA 3D9RA 1TP6A 1UI7A 3U1WA 1S5AA 1YGWA 4CDLA 1K9M4 3MWZA 4O3VA 1IU7A 1A2PA 4ILFA 1EQKA 1BVIA 1FGTA 1E3RA 1J2BA 8RNTA 1MNLA 2L4VA 4N3VA 2YFIB 3DUKA 2CFDA 2OCTA 3SOAA 1DMMA 3HIIA 1JKGA 4GSPA 1SIHA 1YVSA 2F5MA 3J7Yd 2ML5A 3NM2A 2JQ5A 5D83A 4WYKA 5G2GA 5FGOA 3CPW2 3LOYA 2RBIA 4LYLB 3LMLA 2UGIA 3LT8A 1IDPA 1RGFA 1CEWI 1N8R4 4L8PA 3LZAA 1LNIA 1Q42A 1RJOA 4RNZA 3I553 1LVNA 2XR8B 3CNMA 2YFJB 4RNYA 1E97A 3NQZA 1CYUA 1B27A 5HOHA 2BT3A 1I2GA 2J8XB 3X3ZA 4XBTA 4KZ1A 1BNIA 1LXEA 1T5YA 1X1YA 4AKYA 2H0IA 1DE3A 2IA7A 2CWTA 4XB5A 4HM3B 1BSEA 1I0XA 2E2VA 3MG1A 2KAAA 3PS8A 3EB8A 1SARA 2BIRA 2RGQA 3CCV3 5AI1A 3K7CA 1UDII 1RGLA 4HOHA 4J5KA 5AYRB 1UGHI 3MHEA 4RNTA 4FMCA 1N5PA 1UCLA 4K90B 2KF3A 1BRHA 7RNTA 4N6OB 5CF1A 1FGRA 1F8NA 1GS3A 4HBRA 3NV0B 4HM6B 3VGNA 2GEYA 1M1K4 3DY5A 5IG0A 2FNQA 3BNCA 1GYBA 1OHPA 3SXXA 4EV5A 2WO0A 1O7PB 3F7SA 3PZWA 1OHOA 4L7KA 1A67A 2HMNB 4HM4B 5IG5A 3CCL3 1PY3A 1YVBI 1C54A 4XBXA 4FCZA 3BIRA 3M8CA 4N6TA 1B2UA 5EVHA 3URPA 1O7WB 3GZYB 1NWWA 2OOVC 3SYUA 1B21A 1LNHA 3DMCA 1ZS7A 4MMZB 1GOVA 1FW7A 3LT9A 1IVWA 3VF1A 3D5IA 1ASKA 1BNSA 2YX9A 3KN4A 1GMRA 2OQEC 1EEJA 1TIJA 4RBNA 2GBWB 3EQQB 3KSPA 1LOXA 3D5GA 3EN1B 1RGHA 5FW5A 1DVDA 4HYZA 2IY2A 2XFSA 4KFFA 4Q53A 2K54A 3BU4A 1M1XB 1YJW3 1M904 2F4YA 2H0GA 1LQMB 4XDVA 5DRVA 1JN5B 1LOWA 1WMNA 3DGYA 3DM8A 1GD3A 1QVF2 3SLUA 3F14A 1BRGA 1UI8A 1FGQA 1GSPA 1ULIB 3S67A 1SPUA 1VQN3 1RCLA 2W04A 4STDA 1VQ73 3BLZA 4FMAA 1VQM3 3PYJA 3TDGA 1CYVA 4MJDA 4CCVA 2GU3A 3LTCA 5IW9A 2M7OA 1BRJA 1BRIA 3EF8A 2E2UA 2Q07A 3CMA3 1O7GB 4N6LA 3X3XA 3GAXA 4XDWA 1DETA 2ZDJA 5TGNA 3UNLA 1RLSA 1BRNL 3G6E3 1YIT3 1T2IA 2WOFA 1W7CA 2QEX3 1ZO2A 1QVG2 2CG1A 2OOVA 3DGLA 2UX0A 2BO9B 2KXGA 3S5CA 1JZOA 1I3IA 3CNXA 3WODG 3H51A 2BNGA 1M9GA 2C10A 2XRXB 5M1AA 1AVLA 4N6UA 3ROBA 2QA43 3AMOA 4IPBA 2OQEA 3DGNA 5G1LA 3X41A 1TUHA 1IV7A 2F86B 4HKVB 4BL3A 1OGZA 3S28A 3CU3A 5IG3A 1BRSA 2P0MA 3GZRA 1JBRA 1O7HB 1W4NA 2V1LA 3UL5A 1YJ93 5I97A 1LOYA 1MWUA 5IF6A 3WA2X 1G02A 1MWRA 1IVUA 2XSOB 3B4OA 3WOEB 2W56A 1BSAA 3ZFZA 2W9QA 1ULJB 1NNVA 4GB5A 1EKMA 3OWUA 3CC43 3B8LA 1FGOA 1K28A 2KF6A 4G1MB 3HIGA 3SVAA 1RGCA 2BMQB 3FCSB 4ORLA 1OF5B 1V58A 1WMPA 3D79A 3MSOA 1IK3A 3O8YA 1QAKA 2W0QA 1W02A 3FSDA 1UUWB 2RSXA 1SIIA 5ELUA 5LC7A 3UB1A 1VQO3 1NDOB 4O02B 1GY5A 1ZX2A 5HGRA 4EV2A 3QK9A 2CK3H 1FGMA 1OHSA 2ZHXB 1L5GB 2PZVA 4OUQA 1T2HA 3CC73 1V74A 4J9AA 3K0ZA 3STDA 1RSNA 3ALAA 5AEUB 2ZA4A 1UW1A 1NB3I 3DXOA 1HYFA 2HMOB 2KCDA 3ECFA 1RRLA 3CCU3 5AYSC 3F8HA 4CPKA 5D81A 4R80A 1Q9EA 1RTUA 3JUNA 1I2EA 2WGOA 3AMOB 3K5TA 3HI7A 3KFQC 1X1WA 4EBGA 1GOYA 2F56A 2WGQA 2Z77A 3K63A 1RGKA 5CLKA 2GU1A 1U5OA 2HMKB 3E99A 3NBJA 3ER7A 1WMOA 2W56B 1Q40B 3WMDA 4CJNA 3DGOA 3EX9A 4GL6A 3V92A 6GSPA 1W2B2 3AHWA 1GMQA 3KSED 1MWTA 2D1WA 4HM0B 2Y73A 4LMIA 3CCJ3 3WHOA 1JBSA 1TRQA 4BL2A 4N6V0 1V57A 1Y4KA 1IT8A 4EW5A 3SOYA 3FLJA 3UJMA 2CKFB 2R41A 3IJEB 1GD4A 1W6YA 3Q1CA 1B2SA 3NBRA 4OVMA 1JKGB 4KFEA 2HOHA 4LGQA 4WYKB 3ZG5A 5JPPA 1ROVA 2BMRB 4AKZA 1FUTA 3OX9A 4KFDA 2GXFA 4K1VA 3LYGA 7GSPA 3AHSA 3OXAA 1W00A 3VSYA 1AY7A 1NB5I 2BMOB 1BNEA 1JB5A 2BU4A 1RN7A 1EG9B 1A90A 1GMPA 1FYSA 1VQQA 1NU3A 1TU5A 1RRHA 1DYUA 3KE7A 1B20A 7STDA 1BANA 2CWVA 2JDIH 3Q3FA 3WOFB 3NQYA 1BNJA 1UUGB 1BUQA 5KP3A 4GHOA 2W9PA 1IYYA 1G0TA 2CFLA 4I5QA 5BU4A 3G4S3 1FZUA 1O7MB 1D6YA 1R4CA 2IMJA 3EHCA 3F40A 3NM7A 1IQ8A 2Z76A 4HM2B 3DZLA 4U13A 3BNDA 3N8BA 4BTYA 3MPHA 6STDA 8CHOA 1JNQA 1CH0A 1TRPA 1CQSA 1I3FA 3HX8A 5CK6A 3CME3 2SBLA 1W6GA 3BNBA 2LQVA 1ZGXA 1VQ53 4HZ9B 4FCMA 1OGXA 3MYTA 3FGYA 3F8XA 1MOLA 1RGGA 3X40A 1GY6A 4HVNA 3EBYA 4HJLB 4WWUC 1KC84 2KF5A 2IUKA 1Q814 2XH9A 3BB9A 2W2CA 1D6ZA 3K9MC 1BOXA 4IT7A 1RGAA 4R4KA 3SX1A 2KF4A 2P09A 3JUPA 1IVXA 4R9LA 4LEHA 2C11A 5M19A 2W03A 1TFOA 3D3LA 4WHAA 2C4BA 3PGBA 1YIJ3 1Q864 5G1KA 1I2FA 2AADA 1OH0A 3H3HA 1BU4A 1ROAA 3S29A 5A0OB 2BHMA 1O7NB 2K0MA 3RGAA 1AVKA 4HM8B 1ISKA 4R1KA 1UCKA 4KT3B 1HU9A 1RMSA 4MMYB 1BSDA 1YHQ3 3CCS3 2B24B 3FKAA 3UL6A 1PU4A 1DMQA 4XM4A 1WTHA 3KCHA 2STDA 4O2HA 5KP4A 3CCQ3 3LTDA 2XSHB 3GSPA 4AEQA 3WA3A 3EN8A 1Z1SA 4X2HA 1LRAA 2XF3A 4MEIA 2W6JH 4K61A 1TJDA 5AIHA 1BUJA 3IMAB 3NX0A 2HMJB 1NJI4 3MG2A 4O8SA 1JB4A 3PCRA 3PCSA 1IQYA 4JF8A 4R9KA 5AIFA 1I70A 1R4YA 1UUVB 1US1A 1YJN3 1IVVA 2CX0A 2P0XA 3RGRA 2A15A 3OW22 3EE1A 1SJWA 3CCR3 1JV2B 3N54B 5M18A 1QALA 3B4PA 1IV9A 3V99A 2CIUA 3G8ZA 1AR0A 1VZZA 3B7CA 1GY7A 1SQWA 1OACA 1TTOA 5JPUA 2P38A 1VQ43 1RNTA 2RCDA 3KKGA 1DVCA 2UUGC 4MMXB 3GWRA 5STDA 1K41A 3I0YA 4N6MA 1QMAA 3NV0A 2Z7AA 1IQXA 2LYXA 3G16A 4H61A 4RZMA 3OWSA 3JVCA 2CHCA 5LC6A 3F7XA 3ZG0A 4DKIA 1OPYA 2CW9A 1BNFA 2CC3A 3AGNA 1RDSA 1W6CA 1JBTA 1Q7Y4 1IT7A 1KWIA 2H0HA 4OK0A 3QRDA 5AEWB 1B2ZA 2O9UX 3IPTA 1E3VA 2QIYA 1HKXA 2CH9A 3LH4A 3CCE3 1G96A 1FUSA 1BIRA 3Q90A 5DREA 1S723 3FH1A 2SARA 2PNCA 4BIRA 1OUNA 4I4KA 4EYCA 4X2OA 1N9EA 1N5HA 1NO3A 4L8OA 4WP5A 1FUWA 1W01A 3NXJA 2CFWA 4IIAA 4BU4A 1VQ83 3GRDA 4NPBA 2MF7A 5CXOA 3T0UA 4FCJA 5ELJA 1FA3A 3MG3A 1PFPA 4JRFA 3U97A 3NHXA 9RNTA 1UGIA 1BGSA 2ZL8A 1KSIA 3HOHA 2QGUA 2OTJ3 1JZDA 4NREA 1STFI 1BAOA 2GBXB 2IYJA 3HZPA 4HZBB 1T3BA 2KRTA 1JN5A 3CXC2 1EUIC 3G0KA 1YI23 1DMNA 1Q7HA 1WNHA 1JRQA 5EQLA 1VQ63 3LXUX 1B2XA 1EA2A 2Z6BA 3MKIA 4K1UA 5D82A 5IEOA 1LOVA 2E2TA 3FF2A 2K3DA 3JUOA 3FG1A 3EBTA 3N9HA 2MC8A 4BTXA 4J5GA 2CWUA 1UCIA 1UCJA 2R4IA 3T8UA 4ZM8A 2CFGA 4WFOA 5JBSA 2CFKA 1AV4A 3FZWA 2OWPA 1I8VA 3DH2A 1W5ZA 3I563 2FXTA 4HM1B 1RGEA 1MWSA 1X1UA 1HZ1A 2XGNA 4NHFA 3AGOA 2OTL3 1BSCA 1QJGA 1N9JA 3V98A 2HMMB
chains in the Genus database with same CATH topology
3EJVA 2XGLA 4QWTA 2RFRA 3GZXB 1JB2A 5IEPA 1U8CB 1A2KA 1A2VA 3RDEA 3CPOA 1KD14 2O3OA 1OCVA 1K8A4 4BTWA 1VQ93 4N6NB 3FF0A 1WQLB 2GEXA 4FMDA 3SEDA 2FGTA 3FG3A 2IUJA 3T8NA 1K734 2CG0A 5CF2A 3LTBA 3DGMA 3A76A 5EEOA 4EXRA 3EC9A 2XEPA 4H3UA 3HK4A 3KZTA 3PXMA 3JUMA 1OF5A 1STDA 4PEJA 2D42A 1JJ22 2INXA 2XFTA 3G713 5KP1A 4FMBA 2HMLB 2B1XB 3CD63 1N8QA 3GZBA 5IERA 4LSOA 4LZIA 4FR9A 3OV4A 2I9WA 2P05A 4KVHA 1VQP3 3X3YA 1VQL3 3JUQA 3CC23 3KIIA 3X42A 1KQS2 4XBYA 2F98A 2WOHA 3FG4A 2YFLB 3OWYA 2Y74A 5IG4A 1TFKA 1D6UA 4HM5B 2ML6A 3NUVA 3Q2PA 5BXQA 1RKYA 4EC6A 3CCM3 1C7HA 4J8TA 3WDGB 3NBBA 5AIIA 1QAFA 4TX4A 3F9SA 2F99A 3LTAA 3L0RA 5AIGA 1W2ZA 5BVBA 1Q824 1YGEA 3S27A 1VQK3 4HM7B 5IENA 1Q40A 3BNEA 3D9RA 1TP6A 1UI7A 3U1WA 1S5AA 4CDLA 1K9M4 3MWZA 4O3VA 1IU7A 1EQKA 1FGTA 1E3RA 1J2BA 1MNLA 2L4VA 4N3VA 2YFIB 3DUKA 2CFDA 2OCTA 3SOAA 1DMMA 3HIIA 1JKGA 1SIHA 3J7Yd 2ML5A 3NM2A 2JQ5A 5D83A 4WYKA 5G2GA 5FGOA 3CPW2 3LOYA 3LMLA 3LT8A 1IDPA 1CEWI 4L8PA 3LZAA 1Q42A 1RJOA 4RNZA 3I553 1LVNA 2XR8B 3CNMA 2YFJB 4RNYA 1E97A 3NQZA 1CYUA 2BT3A 3X3ZA 4XBTA 4KZ1A 1LXEA 1T5YA 4AKYA 2IA7A 2CWTA 4XB5A 4HM3B 2E2VA 3MG1A 3PS8A 3EB8A 2RGQA 3CCV3 5AI1A 3K7CA 5AYRB 3MHEA 4FMCA 1N5PA 4K90B 4N6OB 5CF1A 1FGRA 1F8NA 1GS3A 4HBRA 3NV0B 4HM6B 3VGNA 2GEYA 1M1K4 3DY5A 5IG0A 2FNQA 3BNCA 1GYBA 1OHPA 3SXXA 4EV5A 2WO0A 1O7PB 3F7SA 3PZWA 1OHOA 4L7KA 1A67A 2HMNB 4HM4B 5IG5A 3CCL3 1YVBI 4XBXA 4FCZA 3M8CA 4N6TA 5EVHA 1O7WB 3GZYB 1NWWA 2OOVC 1LNHA 3DMCA 4MMZB 3LT9A 1IVWA 3VF1A 1ASKA 2YX9A 3KN4A 2OQEC 1TIJA 4RBNA 2GBWB 3EQQB 3KSPA 1LOXA 3EN1B 1DVDA 5FW5A 4HYZA 2XFSA 4KFFA 4Q53A 2K54A 1YJW3 1M1XB 1M904 4XDVA 5DRVA 1JN5B 1WMNA 3DM8A 1GD3A 1QVF2 3SLUA 3F14A 1UI8A 1FGQA 1ULIB 3S67A 1SPUA 1VQN3 1VQ73 2W04A 4STDA 3BLZA 4FMAA 1VQM3 3PYJA 3TDGA 1CYVA 4MJDA 4CCVA 2GU3A 3LTCA 5IW9A 2M7OA 3EF8A 2E2UA 2Q07A 3CMA3 1O7GB 4N6LA 3X3XA 3GAXA 4XDWA 2ZDJA 5TGNA 3UNLA 3G6E3 1YIT3 2WOFA 2QEX3 1W7CA 1QVG2 1ZO2A 2CG1A 2OOVA 3DGLA 2UX0A 2BO9B 2KXGA 3S5CA 3CNXA 3WODG 3H51A 2BNGA 1M9GA 2C10A 2XRXB 1AVLA 4N6UA 3ROBA 2QA43 3AMOA 4IPBA 2OQEA 3DGNA 3X41A 1TUHA 1IV7A 2F86B 4HKVB 5IG3A 1OGZA 3S28A 3CU3A 3GZRA 2P0MA 1O7HB 1W4NA 2V1LA 3UL5A 1YJ93 5I97A 5IF6A 3WA2X 1IVUA 2XSOB 3B4OA 3WOEB 2W56A 2W9QA 1ULJB 4GB5A 1EKMA 3OWUA 3CC43 3B8LA 1FGOA 1K28A 4G1MB 3HIGA 3SVAA 2BMQB 3FCSB 4ORLA 1OF5B 1WMPA 3MSOA 1IK3A 3O8YA 1QAKA 2W0QA 1W02A 3FSDA 1UUWB 2RSXA 1SIIA 5ELUA 5LC7A 3UB1A 1VQO3 1NDOB 4O02B 1GY5A 1ZX2A 5HGRA 4EV2A 3QK9A 2CK3H 1FGMA 1OHSA 1L5GB 2PZVA 4OUQA 3CC73 1V74A 4J9AA 3K0ZA 3STDA 3ALAA 5AEUB 1UW1A 1NB3I 3DXOA 2KCDA 2HMOB 3ECFA 1RRLA 3CCU3 5AYSC 3F8HA 5D81A 4R80A 3JUNA 2WGOA 3AMOB 3K5TA 3HI7A 3KFQC 4EBGA 2WGQA 2Z77A 3K63A 5CLKA 2GU1A 1U5OA 2HMKB 3E99A 3NBJA 3ER7A 1WMOA 2W56B 1Q40B 3WMDA 3DGOA 3EX9A 4GL6A 3V92A 1W2B2 4HM0B 3KSED 3CCJ3 2D1WA 2Y73A 4LMIA 4N6V0 1Y4KA 1IT8A 3SOYA 3FLJA 3UJMA 2CKFB 3IJEB 1GD4A 1W6YA 3Q1CA 3NBRA 4OVMA 1JKGB 4KFEA 4LGQA 4WYKB 5JPPA 1ROVA 2BMRB 4AKZA 3OX9A 4KFDA 2GXFA 4K1VA 3LYGA 3VSYA 3OXAA 1W00A 1NB5I 2BMOB 1JB5A 1RN7A 1EG9B 1A90A 1NU3A 1TU5A 1RRHA 1DYUA 3KE7A 7STDA 2CWVA 2JDIH 3WOFB 3NQYA 1BUQA 5KP3A 2W9PA 2CFLA 3G4S3 1O7MB 1D6YA 1R4CA 2IMJA 3EHCA 3F40A 3NM7A 1IQ8A 2Z76A 4HM2B 3DZLA 4U13A 3BNDA 3N8BA 4BTYA 3MPHA 6STDA 8CHOA 1JNQA 1CQSA 3HX8A 5CK6A 3CME3 2SBLA 1W6GA 3BNBA 2LQVA 1VQ53 4HZ9B 4FCMA 1OGXA 3MYTA 3FGYA 3F8XA 1MOLA 3X40A 1GY6A 4HVNA 3EBYA 4HJLB 4WWUC 1KC84 2IUKA 1Q814 2XH9A 3BB9A 2W2CA 1D6ZA 3K9MC 4IT7A 4R4KA 3SX1A 2P09A 3JUPA 1IVXA 4R9LA 4LEHA 2C11A 2W03A 1TFOA 3D3LA 4WHAA 3PGBA 1YIJ3 1Q864 1OH0A 3H3HA 1ROAA 3S29A 5A0OB 2BHMA 1O7NB 2K0MA 3RGAA 1AVKA 4HM8B 1ISKA 4R1KA 1HU9A 4MMYB 1YHQ3 3CCS3 2B24B 3FKAA 3UL6A 1PU4A 1DMQA 4XM4A 1WTHA 4O2HA 2STDA 3CCQ3 5KP4A 3LTDA 2XSHB 4AEQA 3WA3A 3EN8A 1Z1SA 4X2HA 2XF3A 4MEIA 2W6JH 4K61A 5AIHA 3IMAB 3NX0A 2HMJB 1NJI4 3MG2A 4O8SA 1JB4A 3PCRA 3PCSA 1IQYA 4JF8A 4R9KA 5AIFA 1UUVB 1US1A 1IVVA 2P0XA 3RGRA 2A15A 3OW22 3EE1A 1SJWA 3CCR3 1JV2B 3N54B 1QALA 3B4PA 1IV9A 3V99A 2CIUA 3G8ZA 1AR0A 1VZZA 3B7CA 1GY7A 1SQWA 1OACA 5JPUA 2P38A 1VQ43 3KKGA 2RCDA 1DVCA 4MMXB 3GWRA 5STDA 1K41A 3I0YA 4N6MA 1QMAA 3NV0A 2Z7AA 1IQXA 2LYXA 3G16A 4H61A 4RZMA 3OWSA 3JVCA 2CHCA 5LC6A 3F7XA 1OPYA 2CW9A 2CC3A 1W6CA 1Q7Y4 1IT7A 1KWIA 4OK0A 3QRDA 5AEWB 3IPTA 2O9UX 3CCE3 1E3VA 2QIYA 1HKXA 2CH9A 3LH4A 1G96A 3Q90A 5DREA 1S723 3FH1A 2PNCA 1OUNA 4I4KA 4EYCA 4X2OA 1N9EA 1N5HA 1NO3A 4L8OA 4WP5A 1FUWA 1W01A 3NXJA 2CFWA 4IIAA 1VQ83 3GRDA 2MF7A 5CXOA 3T0UA 4FCJA 5ELJA 1FA3A 3MG3A 1PFPA 4JRFA 3U97A 3NHXA 2ZL8A 1KSIA 2QGUA 2OTJ3 4NREA 1STFI 2GBXB 3HZPA 4HZBB 1N8R4 2KRTA 3CXC2 1JN5A 3G0KA 1YI23 1DMNA 1WNHA 1JRQA 5EQLA 1VQ63 3LXUX 2Z6BA 1EA2A 3MKIA 4K1UA 5D82A 5IEOA 2E2TA 3FF2A 3JUOA 3FG1A 3EBTA 3N9HA 2MC8A 4BTXA 1YJN3 2CWUA 3T8UA 2R4IA 4ZM8A 2CFGA 4WFOA 5JBSA 2CFKA 1AV4A 3FZWA 2OWPA 1W5ZA 3I563 2FXTA 4HM1B 2XGNA 4NHFA 2OTL3 1QJGA 1N9JA 3V98A 2HMMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJV A;  2RFR A;  3GZX B;  1JB2 A;  5IEP A;  1A2K A;  3CPO A;  1OCV A;  3FF0 A;  1WQL B;  2GEX A;  3SED A;  3T8N A;  5CF2 A;  3A76 A;  3EC9 A;  4H3U A;  3HK4 A;  3KZT A;  4PEJ A;  3JUM A;  1OF5 A;  1STD A;  2INX A;  5KP1 A;  2HML B;  2B1X B;  3GZB A;  5IER A;  3OV4 A;  2I9W A;  4KVH A;  3JUQ A;  4XBY A;  2F98 A;  3OWY A;  2YFL B;  5IG4 A;  4HM5 B;  3NUV A;  5BXQ A;  1C7H A;  4J8T A;  5AII A;  5AIG A;  3F9S A;  2F99 A;  5BVB A;  4HM7 B;  5IEN A;  1Q40 A;  3D9R A;  1TP6 A;  1S5A A;  4CDL A;  1E3R A;  4N3V A;  2YFI B;  3DUK A;  3SOA A;  1DMM A;  1JKG A;  3NM2 A;  2JQ5 A;  5D83 A;  4WYK A;  5G2G A;  1IDP A;  4L8P A;  3LZA A;  1Q42 A;  2XR8 B;  3CNM A;  2YFJ B;  1E97 A;  4XBT A;  4XB5 A;  4HM3 B;  3MG1 A;  2RGQ A;  5AI1 A;  3K7C A;  3MHE A;  5CF1 A;  1GS3 A;  3NV0 B;  4HM6 B;  3VGN A;  2GEY A;  5IG0 A;  1GYB A;  1OHP A;  1O7P B;  3F7S A;  1OHO A;  4L7K A;  2HMN B;  4HM4 B;  5IG5 A;  4XBX A;  3M8C A;  5EVH A;  1O7W B;  3GZY B;  1NWW A;  3DMC A;  1ASK A;  2GBW B;  3EQQ B;  3KSP A;  3EN1 B;  5FW5 A;  4Q53 A;  2K54 A;  4XDV A;  5DRV A;  1JN5 B;  3DM8 A;  3F14 A;  1ULI B;  4STD A;  3BLZ A;  4MJD A;  3EF8 A;  1O7G B;  4XDW A;  5TGN A;  3UNL A;  1ZO2 A;  2UX0 A;  3S5C A;  3CNX A;  3H51 A;  2BNG A;  2XRX B;  3ROB A;  1TUH A;  2F86 B;  4HKV B;  5IG3 A;  1OGZ A;  3CU3 A;  3GZR A;  1O7H B;  5IF6 A;  2XSO B;  3B4O A;  1ULJ B;  4GB5 A;  3OWU A;  3B8L A;  2BMQ B;  4ORL A;  1OF5 B;  3MSO A;  3FSD A;  1W02 A;  1UUW B;  1NDO B;  1GY5 A;  1ZX2 A;  5HGR A;  1OHS A;  2PZV A;  4OUQ A;  4J9A A;  3K0Z A;  3STD A;  5AEU B;  3DXO A;  2HMO B;  3ECF A;  5D81 A;  3JUN A;  2Z77 A;  5CLK A;  1U5O A;  2HMK B;  3E99 A;  2HMM B;  3ER7 A;  1Q40 B;  3WMD A;  3EX9 A;  4HM0 B;  3SOY A;  3FLJ A;  3UJM A;  2CKF B;  1W6Y A;  3NBR A;  4OVM A;  1JKG B;  4LGQ A;  4WYK B;  5JPP A;  2BMR B;  3OX9 A;  2GXF A;  4K1V A;  3LYG A;  3VSY A;  3OXA A;  1W00 A;  2BMO B;  1JB5 A;  1EG9 B;  1NU3 A;  3KE7 A;  7STD A;  1BUQ A;  5KP3 A;  1O7M B;  2IMJ A;  3EHC A;  3F40 A;  2Z76 A;  4HM2 B;  3DZL A;  4U13 A;  6STD A;  8CHO A;  1CQS A;  3HX8 A;  5CK6 A;  4HZ9 B;  4FCM A;  1OGX A;  3MYT A;  3FGY A;  3F8X A;  1GY6 A;  4HVN A;  3EBY A;  4HJL B;  4WWU C;  3BB9 A;  2W2C A;  3JUP A;  4R9L A;  4LEH A;  1OH0 A;  3H3H A;  1O7N B;  3RGA A;  4HM8 B;  1ISK A;  4R1K A;  2B24 B;  3FKA A;  1DMQ A;  4XM4 A;  2STD A;  5KP4 A;  2XSH B;  3EN8 A;  1Z1S A;  4X2H A;  5AIH A;  2HMJ B;  3MG2 A;  1JB4 A;  4R9K A;  5AIF A;  1UUV B;  3RGR A;  2A15 A;  1SJW A;  3B4P A;  3G8Z A;  1AR0 A;  1VZZ A;  3B7C A;  1GY7 A;  5JPU A;  3KKG A;  2RCD A;  3GWR A;  5STD A;  1K41 A;  3I0Y A;  1QMA A;  3NV0 A;  2Z7A A;  4RZM A;  3G16 A;  3OWS A;  2CHC A;  3F7X A;  1OPY A;  5AEW B;  3IPT A;  1E3V A;  2QIY A;  1HKX A;  3Q90 A;  5DRE A;  3FH1 A;  1OUN A;  4I4K A;  4X2O A;  4L8O A;  4WP5 A;  1W01 A;  3NXJ A;  4IIA A;  3GRD A;  5CXO A;  4FCJ A;  3MG3 A;  3NHX A;  2QGU A;  2GBX B;  3HZP A;  4HZB B;  1JN5 A;  3G0K A;  1DMN A;  1EA2 A;  3MKI A;  4K1U A;  5D82 A;  5IEO A;  3FF2 A;  3JUO A;  3EBT A;  3T8U A;  2R4I A;  3FZW A;  2OWP A;  4HM1 B;  1QJG A;  4LMI A;  3F8H A; 
#chains in the Genus database with same CATH topology
 1MGW A;  6RNT A;  3EJV A;  2XGL A;  4QWT A;  2RFR A;  3GZX B;  1JB2 A;  4HAA A;  5IEP A;  3D4A A;  1U8C B;  1A2K A;  1A2V A;  1MGR A;  3RDE A;  1RN4 A;  3CPO A;  1KD1 4;  2O3O A;  1OCV A;  1K8A 4;  4BTW A;  1VQ9 3;  4N6N B;  3FF0 A;  3A5E A;  1BNR A;  3RNT A;  1WQL B;  2GEX A;  4FMD A;  3SED A;  1X1X A;  2FGT A;  3FG3 A;  2IUJ A;  3T8N A;  1K73 4;  2CG0 A;  5CF2 A;  3WR2 A;  3LTB A;  3DGM A;  3A76 A;  5EEO A;  4EXR A;  3EC9 A;  2XEP A;  2F5W A;  4H3U A;  3HK4 A;  3KZT A;  3PXM A;  3JUM A;  1OF5 A;  1STD A;  4PEJ A;  2D42 A;  5BIR A;  1JJ2 2;  1B2M A;  1YNV X;  2INX A;  2XFT A;  3G71 3;  1RNB A;  1BNG A;  4FMB A;  5KP1 A;  2HML B;  2B1X B;  3CD6 3;  1N8Q A;  1RHL A;  3GZB A;  2GSP A;  5IER A;  4LSO A;  4LZI A;  1RCK A;  4FR9 A;  3OV4 A;  2I9W A;  2P05 A;  4KVH A;  1VQP 3;  1BSB A;  3X3Y A;  1VQL 3;  3JUQ A;  3CC2 3;  3KII A;  3X42 A;  1KQS 2;  1RN1 A;  4XBY A;  2F98 A;  1BRK A;  5GSP A;  1B3S A;  2WOH A;  3FG4 A;  2YFL B;  3OWY A;  2Y74 A;  2RNT A;  5IG4 A;  1TFK A;  5RNT A;  1D6U A;  4HM5 B;  2ML6 A;  3NUV A;  2CX1 A;  3Q2P A;  1PYL A;  4EC6 A;  5BXQ A;  1C7H A;  4J8T A;  3WDG B;  1RKY A;  1LQG C;  3CCM 3;  1AQZ A;  2AAE A;  3NBB A;  5AII A;  1QAF A;  4TX4 A;  3F9S A;  2F99 A;  3LTA A;  1I0V A;  3L0R A;  1W2Z A;  5AIG A;  5BVB A;  1Q82 4;  1GOU A;  1YGE A;  3S27 A;  1VQK 3;  4HM7 B;  5IEN A;  2L1S A;  1Q40 A;  3BNE A;  3D9R A;  1TP6 A;  1UI7 A;  3U1W A;  1S5A A;  1YGW A;  4CDL A;  1K9M 4;  3MWZ A;  4O3V A;  1IU7 A;  1A2P A;  4ILF A;  1EQK A;  1BVI A;  1FGT A;  1E3R A;  1J2B A;  8RNT A;  1MNL A;  2L4V A;  4N3V A;  2YFI B;  3DUK A;  2CFD A;  2OCT A;  3SOA A;  1DMM A;  3HII A;  1JKG A;  4GSP A;  1SIH A;  1YVS A;  2F5M A;  3J7Y d;  2ML5 A;  3NM2 A;  2JQ5 A;  5D83 A;  4WYK A;  5G2G A;  5FGO A;  3CPW 2;  3LOY A;  2RBI A;  4LYL B;  3LML A;  2UGI A;  3LT8 A;  1IDP A;  1RGF A;  1CEW I;  1N8R 4;  4L8P A;  3LZA A;  1LNI A;  1Q42 A;  1RJO A;  4RNZ A;  3I55 3;  1LVN A;  2XR8 B;  3CNM A;  2YFJ B;  4RNY A;  1E97 A;  3NQZ A;  1CYU A;  1B27 A;  5HOH A;  2BT3 A;  1I2G A;  2J8X B;  3X3Z A;  4XBT A;  4KZ1 A;  1BNI A;  1LXE A;  1T5Y A;  1X1Y A;  4AKY A;  2H0I A;  1DE3 A;  2IA7 A;  2CWT A;  4XB5 A;  4HM3 B;  1BSE A;  1I0X A;  2E2V A;  3MG1 A;  2KAA A;  3PS8 A;  3EB8 A;  1SAR A;  2BIR A;  2RGQ A;  3CCV 3;  5AI1 A;  3K7C A;  1UDI I;  1RGL A;  4HOH A;  4J5K A;  5AYR B;  1UGH I;  3MHE A;  4RNT A;  4FMC A;  1N5P A;  1UCL A;  4K90 B;  2KF3 A;  1BRH A;  7RNT A;  4N6O B;  5CF1 A;  1FGR A;  1F8N A;  1GS3 A;  4HBR A;  3NV0 B;  4HM6 B;  3VGN A;  2GEY A;  1M1K 4;  3DY5 A;  5IG0 A;  2FNQ A;  3BNC A;  1GYB A;  1OHP A;  3SXX A;  4EV5 A;  2WO0 A;  1O7P B;  3F7S A;  3PZW A;  1OHO A;  4L7K A;  1A67 A;  2HMN B;  4HM4 B;  5IG5 A;  3CCL 3;  1PY3 A;  1YVB I;  1C54 A;  4XBX A;  4FCZ A;  3BIR A;  3M8C A;  4N6T A;  1B2U A;  5EVH A;  3URP A;  1O7W B;  3GZY B;  1NWW A;  2OOV C;  3SYU A;  1B21 A;  1LNH A;  3DMC A;  1ZS7 A;  4MMZ B;  1GOV A;  1FW7 A;  3LT9 A;  1IVW A;  3VF1 A;  3D5I A;  1ASK A;  1BNS A;  2YX9 A;  3KN4 A;  1GMR A;  2OQE C;  1EEJ A;  1TIJ A;  4RBN A;  2GBW B;  3EQQ B;  3KSP A;  1LOX A;  3D5G A;  3EN1 B;  1RGH A;  5FW5 A;  1DVD A;  4HYZ A;  2IY2 A;  2XFS A;  4KFF A;  4Q53 A;  2K54 A;  3BU4 A;  1M1X B;  1YJW 3;  1M90 4;  2F4Y A;  2H0G A;  1LQM B;  4XDV A;  5DRV A;  1JN5 B;  1LOW A;  1WMN A;  3DGY A;  3DM8 A;  1GD3 A;  1QVF 2;  3SLU A;  3F14 A;  1BRG A;  1UI8 A;  1FGQ A;  1GSP A;  1ULI B;  3S67 A;  1SPU A;  1VQN 3;  1RCL A;  2W04 A;  4STD A;  1VQ7 3;  3BLZ A;  4FMA A;  1VQM 3;  3PYJ A;  3TDG A;  1CYV A;  4MJD A;  4CCV A;  2GU3 A;  3LTC A;  5IW9 A;  2M7O A;  1BRJ A;  1BRI A;  3EF8 A;  2E2U A;  2Q07 A;  3CMA 3;  1O7G B;  4N6L A;  3X3X A;  3GAX A;  4XDW A;  1DET A;  2ZDJ A;  5TGN A;  3UNL A;  1RLS A;  1BRN L;  3G6E 3;  1YIT 3;  1T2I A;  2WOF A;  1W7C A;  2QEX 3;  1ZO2 A;  1QVG 2;  2CG1 A;  2OOV A;  3DGL A;  2UX0 A;  2BO9 B;  2KXG A;  3S5C A;  1JZO A;  1I3I A;  3CNX A;  3WOD G;  3H51 A;  2BNG A;  1M9G A;  2C10 A;  2XRX B;  5M1A A;  1AVL A;  4N6U A;  3ROB A;  2QA4 3;  3AMO A;  4IPB A;  2OQE A;  3DGN A;  5G1L A;  3X41 A;  1TUH A;  1IV7 A;  2F86 B;  4HKV B;  4BL3 A;  1OGZ A;  3S28 A;  3CU3 A;  5IG3 A;  1BRS A;  2P0M A;  3GZR A;  1JBR A;  1O7H B;  1W4N A;  2V1L A;  3UL5 A;  1YJ9 3;  5I97 A;  1LOY A;  1MWU A;  5IF6 A;  3WA2 X;  1G02 A;  1MWR A;  1IVU A;  2XSO B;  3B4O A;  3WOE B;  2W56 A;  1BSA A;  3ZFZ A;  2W9Q A;  1ULJ B;  1NNV A;  4GB5 A;  1EKM A;  3OWU A;  3CC4 3;  3B8L A;  1FGO A;  1K28 A;  2KF6 A;  4G1M B;  3HIG A;  3SVA A;  1RGC A;  2BMQ B;  3FCS B;  4ORL A;  1OF5 B;  1V58 A;  1WMP A;  3D79 A;  3MSO A;  1IK3 A;  3O8Y A;  1QAK A;  2W0Q A;  1W02 A;  3FSD A;  1UUW B;  2RSX A;  1SII A;  5ELU A;  5LC7 A;  3UB1 A;  1VQO 3;  1NDO B;  4O02 B;  1GY5 A;  1ZX2 A;  5HGR A;  4EV2 A;  3QK9 A;  2CK3 H;  1FGM A;  1OHS A;  2ZHX B;  1L5G B;  2PZV A;  4OUQ A;  1T2H A;  3CC7 3;  1V74 A;  4J9A A;  3K0Z A;  3STD A;  1RSN A;  3ALA A;  5AEU B;  2ZA4 A;  1UW1 A;  1NB3 I;  3DXO A;  1HYF A;  2HMO B;  2KCD A;  3ECF A;  1RRL A;  3CCU 3;  5AYS C;  3F8H A;  4CPK A;  5D81 A;  4R80 A;  1Q9E A;  1RTU A;  3JUN A;  1I2E A;  2WGO A;  3AMO B;  3K5T A;  3HI7 A;  3KFQ C;  1X1W A;  4EBG A;  1GOY A;  2F56 A;  2WGQ A;  2Z77 A;  3K63 A;  1RGK A;  5CLK A;  2GU1 A;  1U5O A;  2HMK B;  3E99 A;  3NBJ A;  3ER7 A;  1WMO A;  2W56 B;  1Q40 B;  3WMD A;  4CJN A;  3DGO A;  3EX9 A;  4GL6 A;  3V92 A;  6GSP A;  1W2B 2;  3AHW A;  1GMQ A;  3KSE D;  1MWT A;  2D1W A;  4HM0 B;  2Y73 A;  4LMI A;  3CCJ 3;  3WHO A;  1JBS A;  1TRQ A;  4BL2 A;  4N6V 0;  1V57 A;  1Y4K A;  1IT8 A;  4EW5 A;  3SOY A;  3FLJ A;  3UJM A;  2CKF B;  2R41 A;  3IJE B;  1GD4 A;  1W6Y A;  3Q1C A;  1B2S A;  3NBR A;  4OVM A;  1JKG B;  4KFE A;  2HOH A;  4LGQ A;  4WYK B;  3ZG5 A;  5JPP A;  1ROV A;  2BMR B;  4AKZ A;  1FUT A;  3OX9 A;  4KFD A;  2GXF A;  4K1V A;  3LYG A;  7GSP A;  3AHS A;  3OXA A;  1W00 A;  3VSY A;  1AY7 A;  1NB5 I;  2BMO B;  1BNE A;  1JB5 A;  2BU4 A;  1RN7 A;  1EG9 B;  1A90 A;  1GMP A;  1FYS A;  1VQQ A;  1NU3 A;  1TU5 A;  1RRH A;  1DYU A;  3KE7 A;  1B20 A;  7STD A;  1BAN A;  2CWV A;  2JDI H;  3Q3F A;  3WOF B;  3NQY A;  1BNJ A;  1UUG B;  1BUQ A;  5KP3 A;  4GHO A;  2W9P A;  1IYY A;  1G0T A;  2CFL A;  4I5Q A;  5BU4 A;  3G4S 3;  1FZU A;  1O7M B;  1D6Y A;  1R4C A;  2IMJ A;  3EHC A;  3F40 A;  3NM7 A;  1IQ8 A;  2Z76 A;  4HM2 B;  3DZL A;  4U13 A;  3BND A;  3N8B A;  4BTY A;  3MPH A;  6STD A;  8CHO A;  1JNQ A;  1CH0 A;  1TRP A;  1CQS A;  1I3F A;  3HX8 A;  5CK6 A;  3CME 3;  2SBL A;  1W6G A;  3BNB A;  2LQV A;  1ZGX A;  1VQ5 3;  4HZ9 B;  4FCM A;  1OGX A;  3MYT A;  3FGY A;  3F8X A;  1MOL A;  1RGG A;  3X40 A;  1GY6 A;  4HVN A;  3EBY A;  4HJL B;  4WWU C;  1KC8 4;  2KF5 A;  2IUK A;  1Q81 4;  2XH9 A;  3BB9 A;  2W2C A;  1D6Z A;  3K9M C;  1BOX A;  4IT7 A;  1RGA A;  4R4K A;  3SX1 A;  2KF4 A;  2P09 A;  3JUP A;  1IVX A;  4R9L A;  4LEH A;  2C11 A;  5M19 A;  2W03 A;  1TFO A;  3D3L A;  4WHA A;  2C4B A;  3PGB A;  1YIJ 3;  1Q86 4;  5G1K A;  1I2F A;  2AAD A;  1OH0 A;  3H3H A;  1BU4 A;  1ROA A;  3S29 A;  5A0O B;  2BHM A;  1O7N B;  2K0M A;  3RGA A;  1AVK A;  4HM8 B;  1ISK A;  4R1K A;  1UCK A;  4KT3 B;  1HU9 A;  1RMS A;  4MMY B;  1BSD A;  1YHQ 3;  3CCS 3;  2B24 B;  3FKA A;  3UL6 A;  1PU4 A;  1DMQ A;  4XM4 A;  1WTH A;  3KCH A;  2STD A;  4O2H A;  5KP4 A;  3CCQ 3;  3LTD A;  2XSH B;  3GSP A;  4AEQ A;  3WA3 A;  3EN8 A;  1Z1S A;  4X2H A;  1LRA A;  2XF3 A;  4MEI A;  2W6J H;  4K61 A;  1TJD A;  5AIH A;  1BUJ A;  3IMA B;  3NX0 A;  2HMJ B;  1NJI 4;  3MG2 A;  4O8S A;  1JB4 A;  3PCR A;  3PCS A;  1IQY A;  4JF8 A;  4R9K A;  5AIF A;  1I70 A;  1R4Y A;  1UUV B;  1US1 A;  1YJN 3;  1IVV A;  2CX0 A;  2P0X A;  3RGR A;  2A15 A;  3OW2 2;  3EE1 A;  1SJW A;  3CCR 3;  1JV2 B;  3N54 B;  5M18 A;  1QAL A;  3B4P A;  1IV9 A;  3V99 A;  2CIU A;  3G8Z A;  1AR0 A;  1VZZ A;  3B7C A;  1GY7 A;  1SQW A;  1OAC A;  1TTO A;  5JPU A;  2P38 A;  1VQ4 3;  1RNT A;  2RCD A;  3KKG A;  1DVC A;  2UUG C;  4MMX B;  3GWR A;  5STD A;  1K41 A;  3I0Y A;  4N6M A;  1QMA A;  3NV0 A;  2Z7A A;  1IQX A;  2LYX A;  3G16 A;  4H61 A;  4RZM A;  3OWS A;  3JVC A;  2CHC A;  5LC6 A;  3F7X A;  3ZG0 A;  4DKI A;  1OPY A;  2CW9 A;  1BNF A;  2CC3 A;  3AGN A;  1RDS A;  1W6C A;  1JBT A;  1Q7Y 4;  1IT7 A;  1KWI A;  2H0H A;  4OK0 A;  3QRD A;  5AEW B;  1B2Z A;  2O9U X;  3IPT A;  1E3V A;  2QIY A;  1HKX A;  2CH9 A;  3LH4 A;  3CCE 3;  1G96 A;  1FUS A;  1BIR A;  3Q90 A;  5DRE A;  1S72 3;  3FH1 A;  2SAR A;  2PNC A;  4BIR A;  1OUN A;  4I4K A;  4EYC A;  4X2O A;  1N9E A;  1N5H A;  1NO3 A;  4L8O A;  4WP5 A;  1FUW A;  1W01 A;  3NXJ A;  2CFW A;  4IIA A;  4BU4 A;  1VQ8 3;  3GRD A;  4NPB A;  2MF7 A;  5CXO A;  3T0U A;  4FCJ A;  5ELJ A;  1FA3 A;  3MG3 A;  1PFP A;  4JRF A;  3U97 A;  3NHX A;  9RNT A;  1UGI A;  1BGS A;  2ZL8 A;  1KSI A;  3HOH A;  2QGU A;  2OTJ 3;  1JZD A;  4NRE A;  1STF I;  1BAO A;  2GBX B;  2IYJ A;  3HZP A;  4HZB B;  1T3B A;  2KRT A;  1JN5 A;  3CXC 2;  1EUI C;  3G0K A;  1YI2 3;  1DMN A;  1Q7H A;  1WNH A;  1JRQ A;  5EQL A;  1VQ6 3;  3LXU X;  1B2X A;  1EA2 A;  2Z6B A;  3MKI A;  4K1U A;  5D82 A;  5IEO A;  1LOV A;  2E2T A;  3FF2 A;  2K3D A;  3JUO A;  3FG1 A;  3EBT A;  3N9H A;  2MC8 A;  4BTX A;  4J5G A;  2CWU A;  1UCI A;  1UCJ A;  2R4I A;  3T8U A;  4ZM8 A;  2CFG A;  4WFO A;  5JBS A;  2CFK A;  1AV4 A;  3FZW A;  2OWP A;  1I8V A;  3DH2 A;  1W5Z A;  3I56 3;  2FXT A;  4HM1 B;  1RGE A;  1MWS A;  1X1U A;  1HZ1 A;  2XGN A;  4NHF A;  3AGO A;  2OTL 3;  1BSC A;  1QJG A;  1N9J A;  3V98 A;  2HMM B; 
#chains in the Genus database with same CATH homology
 3EJV A;  2XGL A;  4QWT A;  2RFR A;  3GZX B;  1JB2 A;  5IEP A;  1U8C B;  1A2K A;  1A2V A;  3RDE A;  3CPO A;  1KD1 4;  2O3O A;  1OCV A;  1K8A 4;  4BTW A;  1VQ9 3;  4N6N B;  3FF0 A;  1WQL B;  2GEX A;  4FMD A;  3SED A;  2FGT A;  3FG3 A;  2IUJ A;  3T8N A;  1K73 4;  2CG0 A;  5CF2 A;  3LTB A;  3DGM A;  3A76 A;  5EEO A;  4EXR A;  3EC9 A;  2XEP A;  4H3U A;  3HK4 A;  3KZT A;  3PXM A;  3JUM A;  1OF5 A;  1STD A;  4PEJ A;  2D42 A;  1JJ2 2;  2INX A;  2XFT A;  3G71 3;  5KP1 A;  4FMB A;  2HML B;  2B1X B;  3CD6 3;  1N8Q A;  3GZB A;  5IER A;  4LSO A;  4LZI A;  4FR9 A;  3OV4 A;  2I9W A;  2P05 A;  4KVH A;  1VQP 3;  3X3Y A;  1VQL 3;  3JUQ A;  3CC2 3;  3KII A;  3X42 A;  1KQS 2;  4XBY A;  2F98 A;  2WOH A;  3FG4 A;  2YFL B;  3OWY A;  2Y74 A;  5IG4 A;  1TFK A;  1D6U A;  4HM5 B;  2ML6 A;  3NUV A;  3Q2P A;  5BXQ A;  1RKY A;  4EC6 A;  3CCM 3;  1C7H A;  4J8T A;  3WDG B;  3NBB A;  5AII A;  1QAF A;  4TX4 A;  3F9S A;  2F99 A;  3LTA A;  3L0R A;  5AIG A;  1W2Z A;  5BVB A;  1Q82 4;  1YGE A;  3S27 A;  1VQK 3;  4HM7 B;  5IEN A;  1Q40 A;  3BNE A;  3D9R A;  1TP6 A;  1UI7 A;  3U1W A;  1S5A A;  4CDL A;  1K9M 4;  3MWZ A;  4O3V A;  1IU7 A;  1EQK A;  1FGT A;  1E3R A;  1J2B A;  1MNL A;  2L4V A;  4N3V A;  2YFI B;  3DUK A;  2CFD A;  2OCT A;  3SOA A;  1DMM A;  3HII A;  1JKG A;  1SIH A;  3J7Y d;  2ML5 A;  3NM2 A;  2JQ5 A;  5D83 A;  4WYK A;  5G2G A;  5FGO A;  3CPW 2;  3LOY A;  3LML A;  3LT8 A;  1IDP A;  1CEW I;  4L8P A;  3LZA A;  1Q42 A;  1RJO A;  4RNZ A;  3I55 3;  1LVN A;  2XR8 B;  3CNM A;  2YFJ B;  4RNY A;  1E97 A;  3NQZ A;  1CYU A;  2BT3 A;  3X3Z A;  4XBT A;  4KZ1 A;  1LXE A;  1T5Y A;  4AKY A;  2IA7 A;  2CWT A;  4XB5 A;  4HM3 B;  2E2V A;  3MG1 A;  3PS8 A;  3EB8 A;  2RGQ A;  3CCV 3;  5AI1 A;  3K7C A;  5AYR B;  3MHE A;  4FMC A;  1N5P A;  4K90 B;  4N6O B;  5CF1 A;  1FGR A;  1F8N A;  1GS3 A;  4HBR A;  3NV0 B;  4HM6 B;  3VGN A;  2GEY A;  1M1K 4;  3DY5 A;  5IG0 A;  2FNQ A;  3BNC A;  1GYB A;  1OHP A;  3SXX A;  4EV5 A;  2WO0 A;  1O7P B;  3F7S A;  3PZW A;  1OHO A;  4L7K A;  1A67 A;  2HMN B;  4HM4 B;  5IG5 A;  3CCL 3;  1YVB I;  4XBX A;  4FCZ A;  3M8C A;  4N6T A;  5EVH A;  1O7W B;  3GZY B;  1NWW A;  2OOV C;  1LNH A;  3DMC A;  4MMZ B;  3LT9 A;  1IVW A;  3VF1 A;  1ASK A;  2YX9 A;  3KN4 A;  2OQE C;  1TIJ A;  4RBN A;  2GBW B;  3EQQ B;  3KSP A;  1LOX A;  3EN1 B;  1DVD A;  5FW5 A;  4HYZ A;  2XFS A;  4KFF A;  4Q53 A;  2K54 A;  1YJW 3;  1M1X B;  1M90 4;  4XDV A;  5DRV A;  1JN5 B;  1WMN A;  3DM8 A;  1GD3 A;  1QVF 2;  3SLU A;  3F14 A;  1UI8 A;  1FGQ A;  1ULI B;  3S67 A;  1SPU A;  1VQN 3;  1VQ7 3;  2W04 A;  4STD A;  3BLZ A;  4FMA A;  1VQM 3;  3PYJ A;  3TDG A;  1CYV A;  4MJD A;  4CCV A;  2GU3 A;  3LTC A;  5IW9 A;  2M7O A;  3EF8 A;  2E2U A;  2Q07 A;  3CMA 3;  1O7G B;  4N6L A;  3X3X A;  3GAX A;  4XDW A;  2ZDJ A;  5TGN A;  3UNL A;  3G6E 3;  1YIT 3;  2WOF A;  2QEX 3;  1W7C A;  1QVG 2;  1ZO2 A;  2CG1 A;  2OOV A;  3DGL A;  2UX0 A;  2BO9 B;  2KXG A;  3S5C A;  3CNX A;  3WOD G;  3H51 A;  2BNG A;  1M9G A;  2C10 A;  2XRX B;  1AVL A;  4N6U A;  3ROB A;  2QA4 3;  3AMO A;  4IPB A;  2OQE A;  3DGN A;  3X41 A;  1TUH A;  1IV7 A;  2F86 B;  4HKV B;  5IG3 A;  1OGZ A;  3S28 A;  3CU3 A;  3GZR A;  2P0M A;  1O7H B;  1W4N A;  2V1L A;  3UL5 A;  1YJ9 3;  5I97 A;  5IF6 A;  3WA2 X;  1IVU A;  2XSO B;  3B4O A;  3WOE B;  2W56 A;  2W9Q A;  1ULJ B;  4GB5 A;  1EKM A;  3OWU A;  3CC4 3;  3B8L A;  1FGO A;  1K28 A;  4G1M B;  3HIG A;  3SVA A;  2BMQ B;  3FCS B;  4ORL A;  1OF5 B;  1WMP A;  3MSO A;  1IK3 A;  3O8Y A;  1QAK A;  2W0Q A;  1W02 A;  3FSD A;  1UUW B;  2RSX A;  1SII A;  5ELU A;  5LC7 A;  3UB1 A;  1VQO 3;  1NDO B;  4O02 B;  1GY5 A;  1ZX2 A;  5HGR A;  4EV2 A;  3QK9 A;  2CK3 H;  1FGM A;  1OHS A;  1L5G B;  2PZV A;  4OUQ A;  3CC7 3;  1V74 A;  4J9A A;  3K0Z A;  3STD A;  3ALA A;  5AEU B;  1UW1 A;  1NB3 I;  3DXO A;  2KCD A;  2HMO B;  3ECF A;  1RRL A;  3CCU 3;  5AYS C;  3F8H A;  5D81 A;  4R80 A;  3JUN A;  2WGO A;  3AMO B;  3K5T A;  3HI7 A;  3KFQ C;  4EBG A;  2WGQ A;  2Z77 A;  3K63 A;  5CLK A;  2GU1 A;  1U5O A;  2HMK B;  3E99 A;  3NBJ A;  3ER7 A;  1WMO A;  2W56 B;  1Q40 B;  3WMD A;  3DGO A;  3EX9 A;  4GL6 A;  3V92 A;  1W2B 2;  4HM0 B;  3KSE D;  3CCJ 3;  2D1W A;  2Y73 A;  4LMI A;  4N6V 0;  1Y4K A;  1IT8 A;  3SOY A;  3FLJ A;  3UJM A;  2CKF B;  3IJE B;  1GD4 A;  1W6Y A;  3Q1C A;  3NBR A;  4OVM A;  1JKG B;  4KFE A;  4LGQ A;  4WYK B;  5JPP A;  1ROV A;  2BMR B;  4AKZ A;  3OX9 A;  4KFD A;  2GXF A;  4K1V A;  3LYG A;  3VSY A;  3OXA A;  1W00 A;  1NB5 I;  2BMO B;  1JB5 A;  1RN7 A;  1EG9 B;  1A90 A;  1NU3 A;  1TU5 A;  1RRH A;  1DYU A;  3KE7 A;  7STD A;  2CWV A;  2JDI H;  3WOF B;  3NQY A;  1BUQ A;  5KP3 A;  2W9P A;  2CFL A;  3G4S 3;  1O7M B;  1D6Y A;  1R4C A;  2IMJ A;  3EHC A;  3F40 A;  3NM7 A;  1IQ8 A;  2Z76 A;  4HM2 B;  3DZL A;  4U13 A;  3BND A;  3N8B A;  4BTY A;  3MPH A;  6STD A;  8CHO A;  1JNQ A;  1CQS A;  3HX8 A;  5CK6 A;  3CME 3;  2SBL A;  1W6G A;  3BNB A;  2LQV A;  1VQ5 3;  4HZ9 B;  4FCM A;  1OGX A;  3MYT A;  3FGY A;  3F8X A;  1MOL A;  3X40 A;  1GY6 A;  4HVN A;  3EBY A;  4HJL B;  4WWU C;  1KC8 4;  2IUK A;  1Q81 4;  2XH9 A;  3BB9 A;  2W2C A;  1D6Z A;  3K9M C;  4IT7 A;  4R4K A;  3SX1 A;  2P09 A;  3JUP A;  1IVX A;  4R9L A;  4LEH A;  2C11 A;  2W03 A;  1TFO A;  3D3L A;  4WHA A;  3PGB A;  1YIJ 3;  1Q86 4;  1OH0 A;  3H3H A;  1ROA A;  3S29 A;  5A0O B;  2BHM A;  1O7N B;  2K0M A;  3RGA A;  1AVK A;  4HM8 B;  1ISK A;  4R1K A;  1HU9 A;  4MMY B;  1YHQ 3;  3CCS 3;  2B24 B;  3FKA A;  3UL6 A;  1PU4 A;  1DMQ A;  4XM4 A;  1WTH A;  4O2H A;  2STD A;  3CCQ 3;  5KP4 A;  3LTD A;  2XSH B;  4AEQ A;  3WA3 A;  3EN8 A;  1Z1S A;  4X2H A;  2XF3 A;  4MEI A;  2W6J H;  4K61 A;  5AIH A;  3IMA B;  3NX0 A;  2HMJ B;  1NJI 4;  3MG2 A;  4O8S A;  1JB4 A;  3PCR A;  3PCS A;  1IQY A;  4JF8 A;  4R9K A;  5AIF A;  1UUV B;  1US1 A;  1IVV A;  2P0X A;  3RGR A;  2A15 A;  3OW2 2;  3EE1 A;  1SJW A;  3CCR 3;  1JV2 B;  3N54 B;  1QAL A;  3B4P A;  1IV9 A;  3V99 A;  2CIU A;  3G8Z A;  1AR0 A;  1VZZ A;  3B7C A;  1GY7 A;  1SQW A;  1OAC A;  5JPU A;  2P38 A;  1VQ4 3;  3KKG A;  2RCD A;  1DVC A;  4MMX B;  3GWR A;  5STD A;  1K41 A;  3I0Y A;  4N6M A;  1QMA A;  3NV0 A;  2Z7A A;  1IQX A;  2LYX A;  3G16 A;  4H61 A;  4RZM A;  3OWS A;  3JVC A;  2CHC A;  5LC6 A;  3F7X A;  1OPY A;  2CW9 A;  2CC3 A;  1W6C A;  1Q7Y 4;  1IT7 A;  1KWI A;  4OK0 A;  3QRD A;  5AEW B;  3IPT A;  2O9U X;  3CCE 3;  1E3V A;  2QIY A;  1HKX A;  2CH9 A;  3LH4 A;  1G96 A;  3Q90 A;  5DRE A;  1S72 3;  3FH1 A;  2PNC A;  1OUN A;  4I4K A;  4EYC A;  4X2O A;  1N9E A;  1N5H A;  1NO3 A;  4L8O A;  4WP5 A;  1FUW A;  1W01 A;  3NXJ A;  2CFW A;  4IIA A;  1VQ8 3;  3GRD A;  2MF7 A;  5CXO A;  3T0U A;  4FCJ A;  5ELJ A;  1FA3 A;  3MG3 A;  1PFP A;  4JRF A;  3U97 A;  3NHX A;  2ZL8 A;  1KSI A;  2QGU A;  2OTJ 3;  4NRE A;  1STF I;  2GBX B;  3HZP A;  4HZB B;  1N8R 4;  2KRT A;  3CXC 2;  1JN5 A;  3G0K A;  1YI2 3;  1DMN A;  1WNH A;  1JRQ A;  5EQL A;  1VQ6 3;  3LXU X;  2Z6B A;  1EA2 A;  3MKI A;  4K1U A;  5D82 A;  5IEO A;  2E2T A;  3FF2 A;  3JUO A;  3FG1 A;  3EBT A;  3N9H A;  2MC8 A;  4BTX A;  1YJN 3;  2CWU A;  3T8U A;  2R4I A;  4ZM8 A;  2CFG A;  4WFO A;  5JBS A;  2CFK A;  1AV4 A;  3FZW A;  2OWP A;  1W5Z A;  3I56 3;  2FXT A;  4HM1 B;  2XGN A;  4NHF A;  2OTL 3;  1QJG A;  1N9J A;  3V98 A;  2HMM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...