2K54A

Solution nmr structure of protein atu0742 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg0) target att8. ontario center for structural proteomics target atc0727 .
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
123
structure length
123
Chain Sequence
MNSEIELPVQKQLEAYNARDIDAFMAWWADDCQYYAFPATLLAGNAAEIRVRHIERFKEPDLYGELLTRVIVGNVVIDHETVTRNFPEGKGEVDVACIYEVENGRIAKAWFKIGEPRIVSQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein Atu0742
publication title Solution structure of protein ATC0727 from Agrobacterium Tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
total genus 25
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2k54A00
3OV4A 4HZ9B 2F99A 4STDA 1UUWB 4XM4A 4PEJA 3EBYA 4LMIA 2CHCA 1HKXA 3DZLA 4CDLA 3GWRA 2RGQA 3WMDA 3OXAA 1ISKA 3RGAA 5FW5A 5DREA 5IF6A 1NU3A 5JPPA 2CKFB 5STDA 5HGRA 3EN1B 2OWPA 3CNXA 5D83A 1E3VA 1CQSA 4X2HA 3MG3A 1Q42A 3FZWA 3ER7A 5IG0A 1OGZA 3JUPA 5AIGA 3NUVA 3IPTA 2B24B 1OHOA 3EC9A 3D9RA 3NXJA 1C7HA 5IEOA 1W6YA 1GYBA 3GZBA 1DMQA 4HM3B 1E97A 2IMJA 3EBTA 8CHOA 3FGYA 2Z7AA 5AEWB 2XRXB 3G0KA 5AEUB 3EF8A 4J9AA 4U13A 3FLJA 1OHPA 1S5AA 3MSOA 3B4PA 5IENA 3GZXB 4HM4B 3F14A 3JUOA 3MHEA 2F86B 3JUMA 4MJDA 2YFJB 3BB9A 5AIIA 3H51A 3CPOA 3KSPA 1W00A 1TP6A 4HM5B 3EN8A 2R4IA 2Z77A 1OUNA 4HZBB 4WYKB 4HJLB 5IG4A 3F9SA 2K54A 4R9LA 3DUKA 1OPYA 2YFIB 3CNMA 3FF0A 4K1VA 3NV0B 2I9WA 4R9KA 3KE7A 3LYGA 5KP1A 3FH1A 3BLZA 2W2CA 1GY6A 3S5CA 1O7NB 1EA2A 1U5OA 4HM0B 2GBXB 4H3UA 1OHSA 3K7CA 4N3VA 3EHCA 3OWUA 1OF5A 1JN5B 1O7GB 4RZMA 3FF2A 2PZVA 3ECFA 1Q40B 3T8UA 1OCVA 3OX9A 2BMRB 3CU3A 3B4OA 2GEXA 1EG9B 3DMCA 3VSYA 3T8NA 2BMOB 4HM1B 3F7XA 1ZX2A 3M8CA 1QMAA 5G2GA 2STDA 3EX9A 5IEPA 1TUHA 3JUNA 1O7MB 1JKGB 4J8TA 3G16A 3FSDA 3G8ZA 3B7CA 3F40A 1DMMA 3ROBA 2Z76A 4FCMA 1ZO2A 4XBTA 5IG5A 1NWWA 5CF1A 4Q53A 4ORLA 5D81A 3H3HA 3I0YA 4I4KA 5KP3A 2GBWB 2QIYA 2RFRA 4HVNA 3OWSA 2XSHB 1OGXA 1O7HB 2YFLB 4OUQA 5DRVA 4XBXA 2HMKB 3E99A 4XBYA 1DMNA 4HM2B 4FCJA 4HM6B 3A76A 3HZPA 4IIAA 3F8HA 3NM2A 1O7PB 5EVHA 3HK4A 1IDPA 3HX8A 6STDA 1ULJB 3OWYA 2RCDA 3DM8A 1ASKA 1JB4A 4K1UA 3SOYA 5BXQA 3MG2A 1VZZA 2INXA 2HMOB 2B1XB 5D82A 1NDOB 1GY7A 3KKGA 1UUVB 4GB5A 2XSOB 3Q90A 4OVMA 5CK6A 5CXOA 2JQ5A 1ULIB 4X2OA 5KP4A 3MKIA 3KZTA 3MG1A 7STDA 5IG3A 3STDA 3UJMA 3GRDA 5TGNA 1A2KA 2QGUA 2UX0A 1AR0A 1O7WB 3EJVA 2A15A 3MYTA 4L7KA 4WP5A 1W01A 2HMMB 1JB2A 4WYKA 1SJWA 1JB5A 1GY5A 1GS3A 4XB5A 3F8XA 3NV0A 3DXOA 4LGQA 2F98A 4HKVB 5AIFA 1Z1SA 3NBRA 4WWUC 2BMQB 3K0ZA 4HM7B 5JPUA 4L8OA 1W02A 3LZAA 3NHXA 3EQQB 5AIHA 1OF5B 3VGNA 1JN5A 5CF2A 2GEYA 1Q40A 4HM8B 3RGRA 2XR8B 3FKAA 3B8LA 1E3RA 1BUQA 5IERA 5CLKA 4KVHA 2BNGA 3F7SA 3UNLA 4R1KA 3JUQA 1K41A 1WQLB 3GZRA 2HMLB 3SEDA 5AI1A 2GXFA 2HMNB 1STDA 1QJGA 2HMJB 1OH0A 4L8PA 3SOAA 5BVBA 1JKGA 4XDWA 4LEHA 3GZYB 4XDVA
chains in the Genus database with same CATH superfamily
3OV4A 3MWZA 1C54A 1RCKA 1CEWI 1LQMB 1VQ63 2AAEA 2CIUA 4EBGA 4HZ9B 2F99A 4STDA 2MC8A 2LYXA 1FW7A 4FMBA 1UUWB 3D3LA 4XM4A 1B2UA 4PEJA 3EBYA 1MWRA 4LMIA 4RNZA 1MGWA 1UDII 2UGIA 3QRDA 2CHCA 1HKXA 1LOVA 3DZLA 3CCQ3 4ZM8A 1X1YA 1BVIA 3J7Yd 4CDLA 3GWRA 3NX0A 3X3XA 1YHQ3 1JV2B 1UCIA 1F8NA 1W4NA 2RGQA 3PS8A 4ILFA 4CPKA 1LOYA 3X3ZA 3WMDA 1K734 3OXAA 1YVSA 1ISKA 2W9QA 3RGAA 5FW5A 2C10A 1US1A 5DREA 5IF6A 1NU3A 5JPPA 2CKFB 3X3YA 5STDA 5HGRA 4CCVA 1T3BA 1W2B2 3EN1B 2OWPA 1BNRA 3CNXA 1EUIC 5D83A 4FMAA 2P0MA 1E3VA 1LQGC 2M7OA 2KXGA 3BIRA 1CQSA 4X2HA 1V57A 1BNJA 3MG3A 1CYVA 1Q42A 3FZWA 3ER7A 5IG0A 1UI7A 1OGZA 1KSIA 3JUPA 3NUVA 5AIGA 3IPTA 1HZ1A 2B24B 4N6V0 5FGOA 1CH0A 4HOHA 3WODG 1MGRA 1T2IA 1Y4KA 3CC43 1GD4A 3Q2PA 1EQKA 5ELJA 1OHOA 1BNIA 3EC9A 3D9RA 2P38A 1PFPA 2CFWA 3IJEB 3CCM3 3NXJA 1JRQA 1RN1A 1EKMA 3HOHA 1C7HA 3RNTA 1IV9A 3FG4A 5JBSA 5IEOA 3S67A 1W6YA 2BU4A 4R80A 1GYBA 1AY7A 2H0GA 3GZBA 2P09A 4N6TA 1M1K4 3LTAA 1DMQA 4HM3B 1E97A 1V74A 2WGOA 6RNTA 3SVAA 1BOXA 2IMJA 2OTJ3 3EBTA 8CHOA 3FGYA 3A5EA 2Z7AA 3BNBA 1HYFA 5AEWB 2XRXB 3G0KA 3PYJA 5AEUB 3EF8A 4J9AA 4U13A 3FLJA 3CCV3 3SYUA 1JBTA 2UUGC 2OTL3 1IVWA 1BRNL 3FG3A 1N5HA 3CCL3 1AQZA 3WA3A 1IYYA 3JVCA 4QWTA 1R4YA 1BSAA 3TDGA 1OHPA 2XFTA 1LOXA 1STFI 1S5AA 1PYLA 2CFLA 3MSOA 1RKYA 2FXTA 3NQZA 2RNTA 3B4PA 4EV2A 5IENA 1A67A 3GZXB 4NPBA 2CH9A 2L4VA 4HM4B 1UI8A 3BU4A 3F14A 3JUOA 3CCU3 1FUTA 1IQXA 1RGFA 1W7CA 3MHEA 3UB1A 1KD14 2F86B 3JUMA 4MJDA 1UCKA 2CWTA 1EEJA 8RNTA 2KF5A 2W6JH 2XF3A 3LH4A 2YFJB 1DYUA 1LVNA 3BB9A 3BNEA 3LTCA 3HI7A 3H51A 5AIIA 1VQK3 3CPOA 3KSPA 3DGOA 5BIRA 1FGTA 1W00A 3V98A 1N9JA 4BIRA 1TU5A 3PCSA 1TP6A 4HM5B 2Y74A 1JJ22 3EN8A 1B21A 2SBLA 3D4AA 2OCTA 2R4IA 3D5IA 2LQVA 2KAAA 2F5WA 4EYCA 3DGLA 1NB5I 1PY3A 2Z77A 5EQLA 4LSOA 1OUNA 4HZBB 4WYKB 1RGEA 4HJLB 5IG4A 1BIRA 1GMPA 3F9SA 5RNTA 4H61A 2K54A 4R9LA 1BRIA 3DUKA 1OPYA 3LT9A 2YFIB 3CNMA 3FF0A 4K1VA 4MMZB 2XEPA 3WA2X 3NV0B 1WMOA 2I9WA 4HAAA 1D6ZA 3O8YA 4EW5A 4R9KA 3GSPA 5G1LA 5LC7A 1VQ43 1UUGB 3KE7A 3S27A 2QA43 1TTOA 3K9MC 3LYGA 1SPUA 5KP1A 1VQL3 3FH1A 4N6OB 2BHMA 2PNCA 3DGMA 2W04A 3LXUX 4LZIA 1J2BA 3BLZA 1I3FA 1SIIA 3G4S3 2W2CA 1GY6A 3S5CA 2IA7A 2K0MA 2KRTA 4O8SA 1AV4A 1O7NB 1VQO3 1EA2A 1FGRA 1YVBI 3CD63 1U5OA 2WGQA 1IQ8A 4HM0B 2GBXB 3AGNA 4H3UA 1OHSA 3K7CA 3AMOB 4N3VA 4EXRA 1B2MA 1B2SA 3EHCA 3CCE3 3OWUA 1IVUA 1OF5A 1JN5B 2P05A 3NBBA 4R4KA 1O7GB 2OQEC 4RZMA 3FF2A 1K28A 2PZVA 1LNHA 3ECFA 3HIGA 1Q40B 5A0OB 3T0UA 3PXMA 1FYSA 3T8UA 1CYUA 4GSPA 1OCVA 3OX9A 2CW9A 2R41A 2BMRB 1BSBA 7GSPA 2OOVC 1FZUA 3B4OA 3CU3A 1G02A 1N9EA 2GEXA 4KFFA 1MWSA 1RN7A 3CME3 1M9GA 1EG9B 3DMCA 3CC23 1RMSA 2Y73A 1VQN3 1YGEA 1FUWA 3VSYA 1TRQA 4K90B 2XH9A 5M18A 3T8NA 1IVVA 3CXC2 2BMOB 2O3OA 1IU7A 2XGLA 3F7XA 1ZX2A 4HBRA 4HM1B 4AEQA 3KIIA 1X1UA 2L1SA 3M8CA 4G1MB 2KF3A 3BNCA 4RBNA 1YIJ3 2ZHXB 1QMAA 5G2GA 5M19A 2STDA 2W56A 3EX9A 3EE1A 5IEPA 1YJW3 1TIJA 1RNTA 1TUHA 1NO3A 4FMDA 1X1WA 4WHAA 1JNQA 1RGAA 3JUNA 4NREA 1BNFA 1M904 1UGHI 2CG0A 1BNEA 1O7MB 1L5GB 1YNVX 1VQ83 1B3SA 1JKGB 1RGHA 3SXXA 4J8TA 2KCDA 1SARA 3PGBA 1GOUA 3G16A 3FSDA 3VF1A 3G8ZA 3B7CA 3F40A 3CMA3 4BU4A 4TX4A 3Q3FA 1DMMA 1K8A4 2D42A 3ROBA 4BL3A 4J5KA 3LTDA 1FGQA 1BRKA 2ZA4A 2H0IA 1RGGA 2BT3A 2Z76A 3L0RA 3NM7A 4FCMA 1ZO2A 4XBTA 5IG5A 3FG1A 1NWWA 4GL6A 4IT7A 2CX1A 5CF1A 2H0HA 4Q53A 4ORLA 3WOEB 5D81A 3H3HA 3I0YA 4I4KA 5KP3A 1RGKA 2GBWB 1BSCA 3FCSB 4DKIA 1RGLA 2QIYA 2IY2A 1NNVA 4GHOA 2RFRA 4J5GA 1YJN3 3WDGB 2CFGA 4HVNA 3OWSA 3ZFZA 3K5TA 3IMAB 4AKZA 2Z6BA 1YGWA 2E2VA 2XSHB 1OGXA 1O7HB 1RDSA 1X1XA 2YFLB 1VQP3 3BNDA 2GU1A 1RJOA 2E2UA 4OUQA 2KF6A 1LXEA 5DRVA 3I553 4XBXA 2HMKB 2SARA 1JBSA 3X42A 3AHWA 3QK9A 3E99A 4XBYA 2J8XB 1DMNA 3NQYA 4HM2B 3U1WA 3I563 3CCR3 1GD3A 1VQM3 4FCJA 1G96A 3DH2A 2YX9A 1IT7A 1BSEA 1BGSA 4HM6B 3A76A 2V1LA 2W03A 1GOVA 3HZPA 3SLUA 1UCJA 3AHSA 4IIAA 3F8HA 1KWIA 3NM2A 4RNTA 4N6MA 1OACA 1JZOA 1O7PB 1B20A 4KT3B 1FGOA 5EVHA 3HK4A 1I0XA 1BNSA 1IDPA 1TFOA 1I2GA 3WHOA 3GAXA 1WNHA 2CWUA 3HX8A 4JF8A 6STDA 1HU9A 1ULJB 2W9PA 4O2HA 4KFDA 3OWYA 3EB8A 1N8R4 4HYZA 2RCDA 1VQ93 1VQQA 1TJDA 3DM8A 3X40A 2F4YA 1ASKA 1JB4A 4K1UA 4MEIA 1SIHA 3SOYA 2OQEA 4KZ1A 1IQYA 1RLSA 2GU3A 1N5PA 1RNBA 3LMLA 1I3IA 1U8CB 5HOHA 5BXQA 2CFDA 1UCLA 2CK3H 3DY5A 3MG2A 3G6E3 1LNIA 3SX1A 2OOVA 5G1KA 1VZZA 3N54B 2GSPA 2INXA 2HMOB 1R4CA 1RRHA 2B1XB 1JBRA 5D82A 1NDOB 5I97A 1GY7A 1TFKA 3KKGA 1UUVB 4GB5A 3ALAA 1RSNA 2ML5A 2F56A 1WMPA 2XSOB 1QVG2 3Q90A 4OVMA 5CK6A 1JZDA 3WOFB 4O02B 1I70A 7RNTA 1NJI4 1YJ93 3RDEA 2AADA 2JDIH 3HIIA 4IPBA 1DE3A 2RBIA 1Q9EA 2JQ5A 5CXOA 5AYRB 4BL2A 1ULIB 1TRPA 4X2OA 1Q7HA 2IUJA 5KP4A 1VQ73 2KF4A 1I2EA 3KZTA 3MG1A 3MKIA 7STDA 2CWVA 1QVF2 4N6LA 1GMQA 2IYJA 3Q1CA 1BANA 3WR2A 3STDA 5IG3A 1S723 1ZGXA 1PU4A 1RCLA 4BTYA 3UJMA 3GRDA 2QEX3 5TGNA 1A2KA 1GOYA 1LOWA 1A2VA 3UL6A 2QGUA 5BU4A 1A2PA 4AKYA 1AVKA 4KFEA 1RHLA 2UX0A 2CX0A 1AR0A 1B2XA 1DETA 1O7WB 1T2HA 4BTWA 2BO9B 1DVCA 3EJVA 3NBJA 2P0XA 1K9M4 1W6GA 2A15A 2MF7A 3MYTA 4L7KA 3PCRA 1NB3I 4WP5A 1W01A 2HMMB 1JB2A 1KC84 4WYKA 1SJWA 1FGMA 3LT8A 3MPHA 1JB5A 1W6CA 2K3DA 3URPA 1W5ZA 4N6UA 1V58A 1GY5A 6GSPA 1BRHA 1B2ZA 1IV7A 1MNLA 5IW9A 1GS3A 4XB5A 3F8XA 3NV0A 2W0QA 3DXOA 4LGQA 1D6UA 1BNGA 1LRAA 2F98A 3S29A 4HKVB 5AIFA 1T5YA 3LTBA 1Z1SA 2BIRA 3KN4A 3NBRA 4WWUC 4CJNA 2C11A 2D1WA 2BMQB 2F5MA 4K61A 1VQ53 1IVXA 3V92A 3K0ZA 4HM7B 4RNYA 1BAOA 1BRGA 3N8BA 4L8OA 5EEOA 1W02A 3LZAA 5JPUA 3NHXA 3EQQB 1IT8A 3KSED 1W2ZA 2FGTA 4WFOA 5AIHA 4MMXB 1OF5B 2CC3A 1ROVA 3VGNA 3UL5A 1Q824 3AMOA 4EC6A 3OW22 3D79A 1YI23 3DGYA 4FCZA 1JN5A 1Q814 1MOLA 3S28A 2WO0A 5AYSC 5CF2A 4I5QA 4OK0A 2C4BA 2WOHA 1BUJA 1BSDA 4EV5A 2GEYA 1Q40A 1DVDA 4HM8B 1MWUA 3RGRA 4O3VA 4JRFA 3V99A 2WOFA 2XR8B 3FKAA 1I0VA 1G0TA 2ML6A 2XFSA 3CPW2 4FR9A 5ELUA 3ZG5A 3B8LA 1E3RA 4N6NB 1BUQA 2HOHA 1I2FA 1B27A 1MWTA 1QAFA 1RRLA 1ZS7A 1YIT3 5IERA 1BRJA 3U97A 1GSPA 3K63A 5CLKA 4KVHA 3G713 2BNGA 2CFKA 4NHFA 1AVLA 1D6YA 5GSPA 3LOYA 2IUKA 1ROAA 3F7SA 3CC73 2XGNA 3X41A 1QALA 3UNLA 4R1KA 3ZG0A 1SQWA 2W56B 3JUQA 3KFQC 2RSXA 1QAKA 4MMYB 1K41A 2E2TA 2Q07A 1WQLB 2ZDJA 2CG1A 1Q864 3GZRA 1KQS2 2HMLB 1A90A 3D5GA 3PZWA 3CCS3 3SEDA 1RN4A 1WMNA 1M1XB 5AI1A 2GXFA 1FUSA 2HMNB 1STDA 1IK3A 1GMRA 1QJGA 2FNQA 2HMJB 9RNTA 1OH0A 3CCJ3 1RGCA 2ZL8A 3KCHA 1BRSA 4L8PA 3SOAA 3AGOA 5BVBA 1FA3A 1UGIA 1JKGA 1I8VA 1RTUA 1N8QA 2O9UX 3N9HA 4LYLB 4XDWA 4FMCA 1UW1A 5M1AA 4LEHA 3GZYB 1Q7Y4 1BU4A 4XDVA 3DGNA 4BTXA 1WTHA 5LC6A
chains in the Genus database with same CATH topology
3OV4A 3MWZA 1CEWI 1VQ63 2CIUA 4EBGA 4HZ9B 2F99A 4STDA 2MC8A 2LYXA 4FMBA 1UUWB 3D3LA 4XM4A 4PEJA 3EBYA 4LMIA 4RNZA 3QRDA 2CHCA 1HKXA 3CCQ3 3DZLA 4ZM8A 3J7Yd 4CDLA 3GWRA 3NX0A 3X3XA 1YHQ3 1JV2B 2RGQA 1F8NA 1W4NA 3PS8A 3X3ZA 3WMDA 1K734 3OXAA 1ISKA 2W9QA 3RGAA 5FW5A 2C10A 1US1A 5DREA 5IF6A 1NU3A 5JPPA 2CKFB 3X3YA 5STDA 5HGRA 4CCVA 1W2B2 3EN1B 2OWPA 3CNXA 5D83A 4FMAA 2P0MA 1E3VA 2M7OA 2KXGA 1CQSA 4X2HA 3MG3A 1CYVA 1Q42A 3FZWA 3ER7A 5IG0A 1UI7A 1OGZA 1KSIA 3JUPA 3NUVA 5AIGA 3IPTA 2B24B 4N6V0 5FGOA 3WODG 1Y4KA 3CC43 1GD4A 3Q2PA 1EQKA 5ELJA 1OHOA 3EC9A 3D9RA 2P38A 1PFPA 2CFWA 3IJEB 3CCM3 3NXJA 1JRQA 1EKMA 1C7HA 1IV9A 3FG4A 5JBSA 5IEOA 3S67A 1W6YA 4R80A 1GYBA 3GZBA 1M1K4 2P09A 4N6TA 3LTAA 1DMQA 4HM3B 1E97A 1V74A 2WGOA 3SVAA 2IMJA 2OTJ3 3EBTA 8CHOA 3FGYA 2Z7AA 3BNBA 5AEWB 2XRXB 3G0KA 3PYJA 5AEUB 3EF8A 4J9AA 4U13A 3FLJA 3CCV3 2OTL3 1IVWA 3FG3A 1N5HA 3CCL3 3WA3A 3JVCA 4QWTA 3TDGA 1OHPA 2XFTA 1LOXA 1STFI 1S5AA 2CFLA 3MSOA 2FXTA 3NQZA 3B4PA 4EV2A 5IENA 1A67A 3GZXB 2CH9A 2L4VA 4HM4B 1UI8A 3F14A 3JUOA 3CCU3 3MHEA 1IQXA 1W7CA 3UB1A 1KD14 2F86B 3JUMA 4MJDA 2CWTA 2W6JH 2XF3A 3LH4A 2YFJB 1DYUA 1LVNA 3BB9A 3BNEA 3LTCA 3HI7A 3H51A 5AIIA 1VQK3 3CPOA 3KSPA 3DGOA 1FGTA 1W00A 3V98A 1N9JA 1TU5A 3PCSA 1TP6A 4HM5B 2Y74A 1JJ22 3EN8A 2SBLA 2OCTA 2R4IA 4EYCA 2LQVA 1NB5I 3DGLA 2Z77A 5EQLA 4LSOA 1OUNA 4HZBB 4WYKB 4HJLB 5IG4A 3F9SA 4H61A 2K54A 4R9LA 3DUKA 1OPYA 3LT9A 2YFIB 3CNMA 3FF0A 4K1VA 4MMZB 2XEPA 3WA2X 3NV0B 1WMOA 2I9WA 1RKYA 1D6ZA 3O8YA 4R9KA 5LC7A 1VQ43 3KE7A 3S27A 2QA43 3K9MC 3LYGA 1SPUA 5KP1A 1VQL3 3FH1A 4N6OB 2BHMA 2PNCA 3DGMA 2W04A 3LXUX 4LZIA 1J2BA 3BLZA 1SIIA 3G4S3 2W2CA 1GY6A 3S5CA 2IA7A 2K0MA 2KRTA 4O8SA 1AV4A 1O7NB 1VQO3 1EA2A 1FGRA 1YVBI 3CD63 1U5OA 2WGQA 1IQ8A 4HM0B 2GBXB 4H3UA 1OHSA 3K7CA 3AMOB 4N3VA 4EXRA 3EHCA 3CCE3 3OWUA 1IVUA 1OF5A 1JN5B 2P05A 3NBBA 4R4KA 1O7GB 2OQEC 4RZMA 3FF2A 1K28A 2PZVA 1LNHA 3ECFA 3HIGA 1Q40B 5A0OB 3T0UA 3PXMA 3T8UA 1CYUA 1OCVA 3OX9A 2CW9A 2BMRB 2OOVC 3CU3A 3B4OA 1N9EA 2GEXA 4KFFA 1RN7A 3CME3 1M9GA 1EG9B 3DMCA 3CC23 2Y73A 1VQN3 1YGEA 1FUWA 3VSYA 4K90B 2XH9A 3T8NA 1IVVA 3CXC2 2BMOB 2O3OA 1IU7A 2XGLA 3F7XA 1ZX2A 4HBRA 4HM1B 4AEQA 3KIIA 3M8CA 4G1MB 3BNCA 4RBNA 1YIJ3 1QMAA 5G2GA 2W56A 2STDA 3EX9A 3EE1A 5IEPA 1YJW3 1TIJA 1TUHA 1NO3A 4FMDA 4WHAA 1JNQA 3JUNA 4NREA 1M904 2CG0A 1O7MB 1L5GB 1VQ83 1JKGB 3SXXA 4J8TA 2KCDA 3PGBA 3G16A 3FSDA 3VF1A 3G8ZA 3B7CA 3F40A 3CMA3 4TX4A 1DMMA 1K8A4 2D42A 3ROBA 3LTDA 1FGQA 2BT3A 2Z76A 3L0RA 3NM7A 4FCMA 1ZO2A 4XBTA 5IG5A 3FG1A 1NWWA 4GL6A 4IT7A 5CF1A 4Q53A 4ORLA 3WOEB 5D81A 3H3HA 3I0YA 4I4KA 5KP3A 2GBWB 3FCSB 2QIYA 2RFRA 1YJN3 3WDGB 2CFGA 4HVNA 3OWSA 4AKZA 3K5TA 3IMAB 2Z6BA 2E2VA 2XSHB 1OGXA 1O7HB 1VQP3 2YFLB 3BNDA 2GU1A 1RJOA 2E2UA 4OUQA 1LXEA 5DRVA 3I553 4XBXA 2HMKB 3X42A 3QK9A 3E99A 4XBYA 1DMNA 3NQYA 4HM2B 3U1WA 3I563 3CCR3 1GD3A 1VQM3 4FCJA 1G96A 2YX9A 1IT7A 4HM6B 3A76A 2V1LA 2W03A 3HZPA 3SLUA 4IIAA 3F8HA 1KWIA 3NM2A 4N6MA 1OACA 1O7PB 1FGOA 5EVHA 3HK4A 1IDPA 1TFOA 3GAXA 1WNHA 2CWUA 3HX8A 4JF8A 6STDA 1HU9A 1ULJB 2W9PA 4O2HA 4KFDA 3OWYA 3EB8A 1N8R4 4HYZA 2RCDA 1VQ93 3DM8A 3X40A 1ASKA 1JB4A 4K1UA 4MEIA 1SIHA 3SOYA 2OQEA 4KZ1A 1IQYA 2GU3A 1N5PA 3LMLA 1U8CB 5BXQA 2CFDA 2CK3H 3DY5A 3MG2A 3G6E3 3SX1A 2OOVA 1VZZA 3N54B 2INXA 2HMOB 1R4CA 1RRHA 2B1XB 5D82A 1NDOB 5I97A 1GY7A 1TFKA 3KKGA 1UUVB 4GB5A 3ALAA 2ML5A 1WMPA 2XSOB 1QVG2 3Q90A 4OVMA 5CK6A 3WOFB 4O02B 1NJI4 1YJ93 3RDEA 2JDIH 3HIIA 4IPBA 5CXOA 2JQ5A 5AYRB 1ULIB 4X2OA 2IUJA 5KP4A 1VQ73 3MKIA 3KZTA 3MG1A 7STDA 2CWVA 1QVF2 4N6LA 3Q1CA 5IG3A 1S723 3STDA 1PU4A 4BTYA 3UJMA 3GRDA 2QEX3 5TGNA 1A2KA 1A2VA 3UL6A 2QGUA 4AKYA 1AVKA 4KFEA 2UX0A 1AR0A 1O7WB 4BTWA 2BO9B 1DVCA 3EJVA 3NBJA 2P0XA 1K9M4 1W6GA 2A15A 2MF7A 3MYTA 4L7KA 3PCRA 1NB3I 4WP5A 1W01A 2HMMB 1JB2A 1KC84 4WYKA 1SJWA 1FGMA 3LT8A 3MPHA 1JB5A 1W6CA 1W5ZA 4N6UA 1GY5A 1IV7A 1MNLA 5IW9A 1GS3A 4XB5A 3F8XA 3NV0A 2W0QA 3DXOA 4LGQA 1D6UA 2F98A 3S29A 4HKVB 5AIFA 1T5YA 3LTBA 1Z1SA 3KN4A 3NBRA 1VQ53 4WWUC 2C11A 2D1WA 2BMQB 4K61A 1IVXA 3V92A 3K0ZA 4HM7B 4RNYA 5JPUA 3N8BA 4L8OA 5EEOA 1W02A 3LZAA 3NHXA 3EQQB 1IT8A 3KSED 1W2ZA 2FGTA 4WFOA 5AIHA 4MMXB 1OF5B 2CC3A 1ROVA 3VGNA 3UL5A 1Q824 3AMOA 4EC6A 3OW22 1YI23 4FCZA 1JN5A 1Q814 1MOLA 3S28A 2WO0A 5AYSC 5CF2A 4OK0A 2WOHA 4EV5A 2GEYA 1Q40A 1DVDA 4HM8B 3RGRA 4O3VA 4JRFA 3V99A 2WOFA 2XR8B 3FKAA 2ML6A 2XFSA 3CPW2 4FR9A 5ELUA 3B8LA 1E3RA 4N6NB 1BUQA 1QAFA 1RRLA 1YIT3 5IERA 3U97A 3K63A 5CLKA 4KVHA 3G713 2BNGA 2CFKA 4NHFA 1AVLA 1D6YA 3LOYA 2IUKA 1ROAA 3F7SA 3CC73 2XGNA 3X41A 1QALA 3UNLA 4R1KA 1SQWA 2W56B 3JUQA 3KFQC 2RSXA 1QAKA 4MMYB 1K41A 2E2TA 2Q07A 1WQLB 2ZDJA 2CG1A 1Q864 3GZRA 1KQS2 2HMLB 1A90A 3PZWA 3CCS3 3SEDA 1WMNA 1M1XB 5AI1A 2GXFA 2HMNB 1STDA 1IK3A 1QJGA 2FNQA 2HMJB 1OH0A 3CCJ3 2ZL8A 4L8PA 3SOAA 5BVBA 1FA3A 1JKGA 1N8QA 2O9UX 3N9HA 4XDWA 4FMCA 1UW1A 4LEHA 3GZYB 1Q7Y4 4XDVA 3DGNA 4BTXA 1WTHA 5LC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OV4 A;  4HZ9 B;  2F99 A;  4STD A;  1UUW B;  4XM4 A;  4PEJ A;  3EBY A;  4LMI A;  2CHC A;  1HKX A;  3DZL A;  4CDL A;  3GWR A;  2RGQ A;  3WMD A;  3OXA A;  1ISK A;  3RGA A;  5FW5 A;  5DRE A;  5IF6 A;  1NU3 A;  5JPP A;  2CKF B;  5STD A;  5HGR A;  3EN1 B;  2OWP A;  3CNX A;  5D83 A;  1E3V A;  1CQS A;  4X2H A;  3MG3 A;  1Q42 A;  3FZW A;  3ER7 A;  5IG0 A;  1OGZ A;  3JUP A;  5AIG A;  3NUV A;  3IPT A;  2B24 B;  1OHO A;  3EC9 A;  3D9R A;  3NXJ A;  1C7H A;  5IEO A;  1W6Y A;  1GYB A;  3GZB A;  1DMQ A;  4HM3 B;  1E97 A;  2IMJ A;  3EBT A;  8CHO A;  3FGY A;  2Z7A A;  5AEW B;  2XRX B;  3G0K A;  5AEU B;  3EF8 A;  4J9A A;  4U13 A;  3FLJ A;  1OHP A;  1S5A A;  3MSO A;  3B4P A;  5IEN A;  3GZX B;  4HM4 B;  3F14 A;  3JUO A;  3MHE A;  2F86 B;  3JUM A;  4MJD A;  2YFJ B;  3BB9 A;  5AII A;  3H51 A;  3CPO A;  3KSP A;  1W00 A;  1TP6 A;  4HM5 B;  3EN8 A;  2R4I A;  2Z77 A;  1OUN A;  4HZB B;  4WYK B;  4HJL B;  5IG4 A;  3F9S A;  2K54 A;  4R9L A;  3DUK A;  1OPY A;  2YFI B;  3CNM A;  3FF0 A;  4K1V A;  3NV0 B;  2I9W A;  4R9K A;  3KE7 A;  3LYG A;  5KP1 A;  3FH1 A;  3BLZ A;  2W2C A;  1GY6 A;  3S5C A;  1O7N B;  1EA2 A;  1U5O A;  4HM0 B;  2GBX B;  4H3U A;  1OHS A;  3K7C A;  4N3V A;  3EHC A;  3OWU A;  1OF5 A;  1JN5 B;  1O7G B;  4RZM A;  3FF2 A;  2PZV A;  3ECF A;  1Q40 B;  3T8U A;  1OCV A;  3OX9 A;  2BMR B;  3CU3 A;  3B4O A;  2GEX A;  1EG9 B;  3DMC A;  3VSY A;  3T8N A;  2BMO B;  4HM1 B;  3F7X A;  1ZX2 A;  3M8C A;  1QMA A;  5G2G A;  2STD A;  3EX9 A;  5IEP A;  1TUH A;  3JUN A;  1O7M B;  1JKG B;  4J8T A;  3G16 A;  3FSD A;  3G8Z A;  3B7C A;  3F40 A;  1DMM A;  3ROB A;  2Z76 A;  4FCM A;  1ZO2 A;  4XBT A;  5IG5 A;  1NWW A;  5CF1 A;  4Q53 A;  4ORL A;  5D81 A;  3H3H A;  3I0Y A;  4I4K A;  5KP3 A;  2GBW B;  2QIY A;  2RFR A;  4HVN A;  3OWS A;  2XSH B;  1OGX A;  1O7H B;  2YFL B;  4OUQ A;  5DRV A;  4XBX A;  2HMK B;  3E99 A;  4XBY A;  1DMN A;  4HM2 B;  4FCJ A;  4HM6 B;  3A76 A;  3HZP A;  4IIA A;  3F8H A;  3NM2 A;  1O7P B;  5EVH A;  3HK4 A;  1IDP A;  3HX8 A;  6STD A;  1ULJ B;  3OWY A;  2RCD A;  3DM8 A;  1ASK A;  1JB4 A;  4K1U A;  3SOY A;  5BXQ A;  3MG2 A;  1VZZ A;  2INX A;  2HMO B;  2B1X B;  5D82 A;  1NDO B;  1GY7 A;  3KKG A;  1UUV B;  4GB5 A;  2XSO B;  3Q90 A;  4OVM A;  5CK6 A;  5CXO A;  2JQ5 A;  1ULI B;  4X2O A;  5KP4 A;  3MKI A;  3KZT A;  3MG1 A;  7STD A;  5IG3 A;  3STD A;  3UJM A;  3GRD A;  5TGN A;  1A2K A;  2QGU A;  2UX0 A;  1AR0 A;  1O7W B;  3EJV A;  2A15 A;  3MYT A;  4L7K A;  4WP5 A;  1W01 A;  2HMM B;  1JB2 A;  4WYK A;  1SJW A;  1JB5 A;  1GY5 A;  1GS3 A;  4XB5 A;  3F8X A;  3NV0 A;  3DXO A;  4LGQ A;  2F98 A;  4HKV B;  5AIF A;  1Z1S A;  3NBR A;  4WWU C;  2BMQ B;  3K0Z A;  4HM7 B;  5JPU A;  4L8O A;  1W02 A;  3LZA A;  3NHX A;  3EQQ B;  5AIH A;  1OF5 B;  3VGN A;  1JN5 A;  5CF2 A;  2GEY A;  1Q40 A;  4HM8 B;  3RGR A;  2XR8 B;  3FKA A;  3B8L A;  1E3R A;  1BUQ A;  5IER A;  5CLK A;  4KVH A;  2BNG A;  3F7S A;  3UNL A;  4R1K A;  3JUQ A;  1K41 A;  1WQL B;  3GZR A;  2HML B;  3SED A;  5AI1 A;  2GXF A;  2HMN B;  1STD A;  1QJG A;  2HMJ B;  1OH0 A;  4L8P A;  3SOA A;  5BVB A;  1JKG A;  4XDW A;  4LEH A;  3GZY B;  4XDV A; 
#chains in the Genus database with same CATH topology
 3OV4 A;  3MWZ A;  1C54 A;  1RCK A;  1CEW I;  1LQM B;  1VQ6 3;  2AAE A;  2CIU A;  4EBG A;  4HZ9 B;  2F99 A;  4STD A;  2MC8 A;  2LYX A;  1FW7 A;  4FMB A;  1UUW B;  3D3L A;  4XM4 A;  1B2U A;  4PEJ A;  3EBY A;  1MWR A;  4LMI A;  4RNZ A;  1MGW A;  1UDI I;  2UGI A;  3QRD A;  2CHC A;  1HKX A;  1LOV A;  3DZL A;  3CCQ 3;  4ZM8 A;  1X1Y A;  1BVI A;  3J7Y d;  4CDL A;  3GWR A;  3NX0 A;  3X3X A;  1YHQ 3;  1JV2 B;  1UCI A;  1F8N A;  1W4N A;  2RGQ A;  3PS8 A;  4ILF A;  4CPK A;  1LOY A;  3X3Z A;  3WMD A;  1K73 4;  3OXA A;  1YVS A;  1ISK A;  2W9Q A;  3RGA A;  5FW5 A;  2C10 A;  1US1 A;  5DRE A;  5IF6 A;  1NU3 A;  5JPP A;  2CKF B;  3X3Y A;  5STD A;  5HGR A;  4CCV A;  1T3B A;  1W2B 2;  3EN1 B;  2OWP A;  1BNR A;  3CNX A;  1EUI C;  5D83 A;  4FMA A;  2P0M A;  1E3V A;  1LQG C;  2M7O A;  2KXG A;  3BIR A;  1CQS A;  4X2H A;  1V57 A;  1BNJ A;  3MG3 A;  1CYV A;  1Q42 A;  3FZW A;  3ER7 A;  5IG0 A;  1UI7 A;  1OGZ A;  1KSI A;  3JUP A;  3NUV A;  5AIG A;  3IPT A;  1HZ1 A;  2B24 B;  4N6V 0;  5FGO A;  1CH0 A;  4HOH A;  3WOD G;  1MGR A;  1T2I A;  1Y4K A;  3CC4 3;  1GD4 A;  3Q2P A;  1EQK A;  5ELJ A;  1OHO A;  1BNI A;  3EC9 A;  3D9R A;  2P38 A;  1PFP A;  2CFW A;  3IJE B;  3CCM 3;  3NXJ A;  1JRQ A;  1RN1 A;  1EKM A;  3HOH A;  1C7H A;  3RNT A;  1IV9 A;  3FG4 A;  5JBS A;  5IEO A;  3S67 A;  1W6Y A;  2BU4 A;  4R80 A;  1GYB A;  1AY7 A;  2H0G A;  3GZB A;  2P09 A;  4N6T A;  1M1K 4;  3LTA A;  1DMQ A;  4HM3 B;  1E97 A;  1V74 A;  2WGO A;  6RNT A;  3SVA A;  1BOX A;  2IMJ A;  2OTJ 3;  3EBT A;  8CHO A;  3FGY A;  3A5E A;  2Z7A A;  3BNB A;  1HYF A;  5AEW B;  2XRX B;  3G0K A;  3PYJ A;  5AEU B;  3EF8 A;  4J9A A;  4U13 A;  3FLJ A;  3CCV 3;  3SYU A;  1JBT A;  2UUG C;  2OTL 3;  1IVW A;  1BRN L;  3FG3 A;  1N5H A;  3CCL 3;  1AQZ A;  3WA3 A;  1IYY A;  3JVC A;  4QWT A;  1R4Y A;  1BSA A;  3TDG A;  1OHP A;  2XFT A;  1LOX A;  1STF I;  1S5A A;  1PYL A;  2CFL A;  3MSO A;  1RKY A;  2FXT A;  3NQZ A;  2RNT A;  3B4P A;  4EV2 A;  5IEN A;  1A67 A;  3GZX B;  4NPB A;  2CH9 A;  2L4V A;  4HM4 B;  1UI8 A;  3BU4 A;  3F14 A;  3JUO A;  3CCU 3;  1FUT A;  1IQX A;  1RGF A;  1W7C A;  3MHE A;  3UB1 A;  1KD1 4;  2F86 B;  3JUM A;  4MJD A;  1UCK A;  2CWT A;  1EEJ A;  8RNT A;  2KF5 A;  2W6J H;  2XF3 A;  3LH4 A;  2YFJ B;  1DYU A;  1LVN A;  3BB9 A;  3BNE A;  3LTC A;  3HI7 A;  3H51 A;  5AII A;  1VQK 3;  3CPO A;  3KSP A;  3DGO A;  5BIR A;  1FGT A;  1W00 A;  3V98 A;  1N9J A;  4BIR A;  1TU5 A;  3PCS A;  1TP6 A;  4HM5 B;  2Y74 A;  1JJ2 2;  3EN8 A;  1B21 A;  2SBL A;  3D4A A;  2OCT A;  2R4I A;  3D5I A;  2LQV A;  2KAA A;  2F5W A;  4EYC A;  3DGL A;  1NB5 I;  1PY3 A;  2Z77 A;  5EQL A;  4LSO A;  1OUN A;  4HZB B;  4WYK B;  1RGE A;  4HJL B;  5IG4 A;  1BIR A;  1GMP A;  3F9S A;  5RNT A;  4H61 A;  2K54 A;  4R9L A;  1BRI A;  3DUK A;  1OPY A;  3LT9 A;  2YFI B;  3CNM A;  3FF0 A;  4K1V A;  4MMZ B;  2XEP A;  3WA2 X;  3NV0 B;  1WMO A;  2I9W A;  4HAA A;  1D6Z A;  3O8Y A;  4EW5 A;  4R9K A;  3GSP A;  5G1L A;  5LC7 A;  1VQ4 3;  1UUG B;  3KE7 A;  3S27 A;  2QA4 3;  1TTO A;  3K9M C;  3LYG A;  1SPU A;  5KP1 A;  1VQL 3;  3FH1 A;  4N6O B;  2BHM A;  2PNC A;  3DGM A;  2W04 A;  3LXU X;  4LZI A;  1J2B A;  3BLZ A;  1I3F A;  1SII A;  3G4S 3;  2W2C A;  1GY6 A;  3S5C A;  2IA7 A;  2K0M A;  2KRT A;  4O8S A;  1AV4 A;  1O7N B;  1VQO 3;  1EA2 A;  1FGR A;  1YVB I;  3CD6 3;  1U5O A;  2WGQ A;  1IQ8 A;  4HM0 B;  2GBX B;  3AGN A;  4H3U A;  1OHS A;  3K7C A;  3AMO B;  4N3V A;  4EXR A;  1B2M A;  1B2S A;  3EHC A;  3CCE 3;  3OWU A;  1IVU A;  1OF5 A;  1JN5 B;  2P05 A;  3NBB A;  4R4K A;  1O7G B;  2OQE C;  4RZM A;  3FF2 A;  1K28 A;  2PZV A;  1LNH A;  3ECF A;  3HIG A;  1Q40 B;  5A0O B;  3T0U A;  3PXM A;  1FYS A;  3T8U A;  1CYU A;  4GSP A;  1OCV A;  3OX9 A;  2CW9 A;  2R41 A;  2BMR B;  1BSB A;  7GSP A;  2OOV C;  1FZU A;  3B4O A;  3CU3 A;  1G02 A;  1N9E A;  2GEX A;  4KFF A;  1MWS A;  1RN7 A;  3CME 3;  1M9G A;  1EG9 B;  3DMC A;  3CC2 3;  1RMS A;  2Y73 A;  1VQN 3;  1YGE A;  1FUW A;  3VSY A;  1TRQ A;  4K90 B;  2XH9 A;  5M18 A;  3T8N A;  1IVV A;  3CXC 2;  2BMO B;  2O3O A;  1IU7 A;  2XGL A;  3F7X A;  1ZX2 A;  4HBR A;  4HM1 B;  4AEQ A;  3KII A;  1X1U A;  2L1S A;  3M8C A;  4G1M B;  2KF3 A;  3BNC A;  4RBN A;  1YIJ 3;  2ZHX B;  1QMA A;  5G2G A;  5M19 A;  2STD A;  2W56 A;  3EX9 A;  3EE1 A;  5IEP A;  1YJW 3;  1TIJ A;  1RNT A;  1TUH A;  1NO3 A;  4FMD A;  1X1W A;  4WHA A;  1JNQ A;  1RGA A;  3JUN A;  4NRE A;  1BNF A;  1M90 4;  1UGH I;  2CG0 A;  1BNE A;  1O7M B;  1L5G B;  1YNV X;  1VQ8 3;  1B3S A;  1JKG B;  1RGH A;  3SXX A;  4J8T A;  2KCD A;  1SAR A;  3PGB A;  1GOU A;  3G16 A;  3FSD A;  3VF1 A;  3G8Z A;  3B7C A;  3F40 A;  3CMA 3;  4BU4 A;  4TX4 A;  3Q3F A;  1DMM A;  1K8A 4;  2D42 A;  3ROB A;  4BL3 A;  4J5K A;  3LTD A;  1FGQ A;  1BRK A;  2ZA4 A;  2H0I A;  1RGG A;  2BT3 A;  2Z76 A;  3L0R A;  3NM7 A;  4FCM A;  1ZO2 A;  4XBT A;  5IG5 A;  3FG1 A;  1NWW A;  4GL6 A;  4IT7 A;  2CX1 A;  5CF1 A;  2H0H A;  4Q53 A;  4ORL A;  3WOE B;  5D81 A;  3H3H A;  3I0Y A;  4I4K A;  5KP3 A;  1RGK A;  2GBW B;  1BSC A;  3FCS B;  4DKI A;  1RGL A;  2QIY A;  2IY2 A;  1NNV A;  4GHO A;  2RFR A;  4J5G A;  1YJN 3;  3WDG B;  2CFG A;  4HVN A;  3OWS A;  3ZFZ A;  3K5T A;  3IMA B;  4AKZ A;  2Z6B A;  1YGW A;  2E2V A;  2XSH B;  1OGX A;  1O7H B;  1RDS A;  1X1X A;  2YFL B;  1VQP 3;  3BND A;  2GU1 A;  1RJO A;  2E2U A;  4OUQ A;  2KF6 A;  1LXE A;  5DRV A;  3I55 3;  4XBX A;  2HMK B;  2SAR A;  1JBS A;  3X42 A;  3AHW A;  3QK9 A;  3E99 A;  4XBY A;  2J8X B;  1DMN A;  3NQY A;  4HM2 B;  3U1W A;  3I56 3;  3CCR 3;  1GD3 A;  1VQM 3;  4FCJ A;  1G96 A;  3DH2 A;  2YX9 A;  1IT7 A;  1BSE A;  1BGS A;  4HM6 B;  3A76 A;  2V1L A;  2W03 A;  1GOV A;  3HZP A;  3SLU A;  1UCJ A;  3AHS A;  4IIA A;  3F8H A;  1KWI A;  3NM2 A;  4RNT A;  4N6M A;  1OAC A;  1JZO A;  1O7P B;  1B20 A;  4KT3 B;  1FGO A;  5EVH A;  3HK4 A;  1I0X A;  1BNS A;  1IDP A;  1TFO A;  1I2G A;  3WHO A;  3GAX A;  1WNH A;  2CWU A;  3HX8 A;  4JF8 A;  6STD A;  1HU9 A;  1ULJ B;  2W9P A;  4O2H A;  4KFD A;  3OWY A;  3EB8 A;  1N8R 4;  4HYZ A;  2RCD A;  1VQ9 3;  1VQQ A;  1TJD A;  3DM8 A;  3X40 A;  2F4Y A;  1ASK A;  1JB4 A;  4K1U A;  4MEI A;  1SIH A;  3SOY A;  2OQE A;  4KZ1 A;  1IQY A;  1RLS A;  2GU3 A;  1N5P A;  1RNB A;  3LML A;  1I3I A;  1U8C B;  5HOH A;  5BXQ A;  2CFD A;  1UCL A;  2CK3 H;  3DY5 A;  3MG2 A;  3G6E 3;  1LNI A;  3SX1 A;  2OOV A;  5G1K A;  1VZZ A;  3N54 B;  2GSP A;  2INX A;  2HMO B;  1R4C A;  1RRH A;  2B1X B;  1JBR A;  5D82 A;  1NDO B;  5I97 A;  1GY7 A;  1TFK A;  3KKG A;  1UUV B;  4GB5 A;  3ALA A;  1RSN A;  2ML5 A;  2F56 A;  1WMP A;  2XSO B;  1QVG 2;  3Q90 A;  4OVM A;  5CK6 A;  1JZD A;  3WOF B;  4O02 B;  1I70 A;  7RNT A;  1NJI 4;  1YJ9 3;  3RDE A;  2AAD A;  2JDI H;  3HII A;  4IPB A;  1DE3 A;  2RBI A;  1Q9E A;  2JQ5 A;  5CXO A;  5AYR B;  4BL2 A;  1ULI B;  1TRP A;  4X2O A;  1Q7H A;  2IUJ A;  5KP4 A;  1VQ7 3;  2KF4 A;  1I2E A;  3KZT A;  3MG1 A;  3MKI A;  7STD A;  2CWV A;  1QVF 2;  4N6L A;  1GMQ A;  2IYJ A;  3Q1C A;  1BAN A;  3WR2 A;  3STD A;  5IG3 A;  1S72 3;  1ZGX A;  1PU4 A;  1RCL A;  4BTY A;  3UJM A;  3GRD A;  2QEX 3;  5TGN A;  1A2K A;  1GOY A;  1LOW A;  1A2V A;  3UL6 A;  2QGU A;  5BU4 A;  1A2P A;  4AKY A;  1AVK A;  4KFE A;  1RHL A;  2UX0 A;  2CX0 A;  1AR0 A;  1B2X A;  1DET A;  1O7W B;  1T2H A;  4BTW A;  2BO9 B;  1DVC A;  3EJV A;  3NBJ A;  2P0X A;  1K9M 4;  1W6G A;  2A15 A;  2MF7 A;  3MYT A;  4L7K A;  3PCR A;  1NB3 I;  4WP5 A;  1W01 A;  2HMM B;  1JB2 A;  1KC8 4;  4WYK A;  1SJW A;  1FGM A;  3LT8 A;  3MPH A;  1JB5 A;  1W6C A;  2K3D A;  3URP A;  1W5Z A;  4N6U A;  1V58 A;  1GY5 A;  6GSP A;  1BRH A;  1B2Z A;  1IV7 A;  1MNL A;  5IW9 A;  1GS3 A;  4XB5 A;  3F8X A;  3NV0 A;  2W0Q A;  3DXO A;  4LGQ A;  1D6U A;  1BNG A;  1LRA A;  2F98 A;  3S29 A;  4HKV B;  5AIF A;  1T5Y A;  3LTB A;  1Z1S A;  2BIR A;  3KN4 A;  3NBR A;  4WWU C;  4CJN A;  2C11 A;  2D1W A;  2BMQ B;  2F5M A;  4K61 A;  1VQ5 3;  1IVX A;  3V92 A;  3K0Z A;  4HM7 B;  4RNY A;  1BAO A;  1BRG A;  3N8B A;  4L8O A;  5EEO A;  1W02 A;  3LZA A;  5JPU A;  3NHX A;  3EQQ B;  1IT8 A;  3KSE D;  1W2Z A;  2FGT A;  4WFO A;  5AIH A;  4MMX B;  1OF5 B;  2CC3 A;  1ROV A;  3VGN A;  3UL5 A;  1Q82 4;  3AMO A;  4EC6 A;  3OW2 2;  3D79 A;  1YI2 3;  3DGY A;  4FCZ A;  1JN5 A;  1Q81 4;  1MOL A;  3S28 A;  2WO0 A;  5AYS C;  5CF2 A;  4I5Q A;  4OK0 A;  2C4B A;  2WOH A;  1BUJ A;  1BSD A;  4EV5 A;  2GEY A;  1Q40 A;  1DVD A;  4HM8 B;  1MWU A;  3RGR A;  4O3V A;  4JRF A;  3V99 A;  2WOF A;  2XR8 B;  3FKA A;  1I0V A;  1G0T A;  2ML6 A;  2XFS A;  3CPW 2;  4FR9 A;  5ELU A;  3ZG5 A;  3B8L A;  1E3R A;  4N6N B;  1BUQ A;  2HOH A;  1I2F A;  1B27 A;  1MWT A;  1QAF A;  1RRL A;  1ZS7 A;  1YIT 3;  5IER A;  1BRJ A;  3U97 A;  1GSP A;  3K63 A;  5CLK A;  4KVH A;  3G71 3;  2BNG A;  2CFK A;  4NHF A;  1AVL A;  1D6Y A;  5GSP A;  3LOY A;  2IUK A;  1ROA A;  3F7S A;  3CC7 3;  2XGN A;  3X41 A;  1QAL A;  3UNL A;  4R1K A;  3ZG0 A;  1SQW A;  2W56 B;  3JUQ A;  3KFQ C;  2RSX A;  1QAK A;  4MMY B;  1K41 A;  2E2T A;  2Q07 A;  1WQL B;  2ZDJ A;  2CG1 A;  1Q86 4;  3GZR A;  1KQS 2;  2HML B;  1A90 A;  3D5G A;  3PZW A;  3CCS 3;  3SED A;  1RN4 A;  1WMN A;  1M1X B;  5AI1 A;  2GXF A;  1FUS A;  2HMN B;  1STD A;  1IK3 A;  1GMR A;  1QJG A;  2FNQ A;  2HMJ B;  9RNT A;  1OH0 A;  3CCJ 3;  1RGC A;  2ZL8 A;  3KCH A;  1BRS A;  4L8P A;  3SOA A;  3AGO A;  5BVB A;  1FA3 A;  1UGI A;  1JKG A;  1I8V A;  1RTU A;  1N8Q A;  2O9U X;  3N9H A;  4LYL B;  4XDW A;  4FMC A;  1UW1 A;  5M1A A;  4LEH A;  3GZY B;  1Q7Y 4;  1BU4 A;  4XDV A;  3DGN A;  4BTX A;  1WTH A;  5LC6 A; 
#chains in the Genus database with same CATH homology
 3OV4 A;  3MWZ A;  1CEW I;  1VQ6 3;  2CIU A;  4EBG A;  4HZ9 B;  2F99 A;  4STD A;  2MC8 A;  2LYX A;  4FMB A;  1UUW B;  3D3L A;  4XM4 A;  4PEJ A;  3EBY A;  4LMI A;  4RNZ A;  3QRD A;  2CHC A;  1HKX A;  3CCQ 3;  3DZL A;  4ZM8 A;  3J7Y d;  4CDL A;  3GWR A;  3NX0 A;  3X3X A;  1YHQ 3;  1JV2 B;  2RGQ A;  1F8N A;  1W4N A;  3PS8 A;  3X3Z A;  3WMD A;  1K73 4;  3OXA A;  1ISK A;  2W9Q A;  3RGA A;  5FW5 A;  2C10 A;  1US1 A;  5DRE A;  5IF6 A;  1NU3 A;  5JPP A;  2CKF B;  3X3Y A;  5STD A;  5HGR A;  4CCV A;  1W2B 2;  3EN1 B;  2OWP A;  3CNX A;  5D83 A;  4FMA A;  2P0M A;  1E3V A;  2M7O A;  2KXG A;  1CQS A;  4X2H A;  3MG3 A;  1CYV A;  1Q42 A;  3FZW A;  3ER7 A;  5IG0 A;  1UI7 A;  1OGZ A;  1KSI A;  3JUP A;  3NUV A;  5AIG A;  3IPT A;  2B24 B;  4N6V 0;  5FGO A;  3WOD G;  1Y4K A;  3CC4 3;  1GD4 A;  3Q2P A;  1EQK A;  5ELJ A;  1OHO A;  3EC9 A;  3D9R A;  2P38 A;  1PFP A;  2CFW A;  3IJE B;  3CCM 3;  3NXJ A;  1JRQ A;  1EKM A;  1C7H A;  1IV9 A;  3FG4 A;  5JBS A;  5IEO A;  3S67 A;  1W6Y A;  4R80 A;  1GYB A;  3GZB A;  1M1K 4;  2P09 A;  4N6T A;  3LTA A;  1DMQ A;  4HM3 B;  1E97 A;  1V74 A;  2WGO A;  3SVA A;  2IMJ A;  2OTJ 3;  3EBT A;  8CHO A;  3FGY A;  2Z7A A;  3BNB A;  5AEW B;  2XRX B;  3G0K A;  3PYJ A;  5AEU B;  3EF8 A;  4J9A A;  4U13 A;  3FLJ A;  3CCV 3;  2OTL 3;  1IVW A;  3FG3 A;  1N5H A;  3CCL 3;  3WA3 A;  3JVC A;  4QWT A;  3TDG A;  1OHP A;  2XFT A;  1LOX A;  1STF I;  1S5A A;  2CFL A;  3MSO A;  2FXT A;  3NQZ A;  3B4P A;  4EV2 A;  5IEN A;  1A67 A;  3GZX B;  2CH9 A;  2L4V A;  4HM4 B;  1UI8 A;  3F14 A;  3JUO A;  3CCU 3;  3MHE A;  1IQX A;  1W7C A;  3UB1 A;  1KD1 4;  2F86 B;  3JUM A;  4MJD A;  2CWT A;  2W6J H;  2XF3 A;  3LH4 A;  2YFJ B;  1DYU A;  1LVN A;  3BB9 A;  3BNE A;  3LTC A;  3HI7 A;  3H51 A;  5AII A;  1VQK 3;  3CPO A;  3KSP A;  3DGO A;  1FGT A;  1W00 A;  3V98 A;  1N9J A;  1TU5 A;  3PCS A;  1TP6 A;  4HM5 B;  2Y74 A;  1JJ2 2;  3EN8 A;  2SBL A;  2OCT A;  2R4I A;  4EYC A;  2LQV A;  1NB5 I;  3DGL A;  2Z77 A;  5EQL A;  4LSO A;  1OUN A;  4HZB B;  4WYK B;  4HJL B;  5IG4 A;  3F9S A;  4H61 A;  2K54 A;  4R9L A;  3DUK A;  1OPY A;  3LT9 A;  2YFI B;  3CNM A;  3FF0 A;  4K1V A;  4MMZ B;  2XEP A;  3WA2 X;  3NV0 B;  1WMO A;  2I9W A;  1RKY A;  1D6Z A;  3O8Y A;  4R9K A;  5LC7 A;  1VQ4 3;  3KE7 A;  3S27 A;  2QA4 3;  3K9M C;  3LYG A;  1SPU A;  5KP1 A;  1VQL 3;  3FH1 A;  4N6O B;  2BHM A;  2PNC A;  3DGM A;  2W04 A;  3LXU X;  4LZI A;  1J2B A;  3BLZ A;  1SII A;  3G4S 3;  2W2C A;  1GY6 A;  3S5C A;  2IA7 A;  2K0M A;  2KRT A;  4O8S A;  1AV4 A;  1O7N B;  1VQO 3;  1EA2 A;  1FGR A;  1YVB I;  3CD6 3;  1U5O A;  2WGQ A;  1IQ8 A;  4HM0 B;  2GBX B;  4H3U A;  1OHS A;  3K7C A;  3AMO B;  4N3V A;  4EXR A;  3EHC A;  3CCE 3;  3OWU A;  1IVU A;  1OF5 A;  1JN5 B;  2P05 A;  3NBB A;  4R4K A;  1O7G B;  2OQE C;  4RZM A;  3FF2 A;  1K28 A;  2PZV A;  1LNH A;  3ECF A;  3HIG A;  1Q40 B;  5A0O B;  3T0U A;  3PXM A;  3T8U A;  1CYU A;  1OCV A;  3OX9 A;  2CW9 A;  2BMR B;  2OOV C;  3CU3 A;  3B4O A;  1N9E A;  2GEX A;  4KFF A;  1RN7 A;  3CME 3;  1M9G A;  1EG9 B;  3DMC A;  3CC2 3;  2Y73 A;  1VQN 3;  1YGE A;  1FUW A;  3VSY A;  4K90 B;  2XH9 A;  3T8N A;  1IVV A;  3CXC 2;  2BMO B;  2O3O A;  1IU7 A;  2XGL A;  3F7X A;  1ZX2 A;  4HBR A;  4HM1 B;  4AEQ A;  3KII A;  3M8C A;  4G1M B;  3BNC A;  4RBN A;  1YIJ 3;  1QMA A;  5G2G A;  2W56 A;  2STD A;  3EX9 A;  3EE1 A;  5IEP A;  1YJW 3;  1TIJ A;  1TUH A;  1NO3 A;  4FMD A;  4WHA A;  1JNQ A;  3JUN A;  4NRE A;  1M90 4;  2CG0 A;  1O7M B;  1L5G B;  1VQ8 3;  1JKG B;  3SXX A;  4J8T A;  2KCD A;  3PGB A;  3G16 A;  3FSD A;  3VF1 A;  3G8Z A;  3B7C A;  3F40 A;  3CMA 3;  4TX4 A;  1DMM A;  1K8A 4;  2D42 A;  3ROB A;  3LTD A;  1FGQ A;  2BT3 A;  2Z76 A;  3L0R A;  3NM7 A;  4FCM A;  1ZO2 A;  4XBT A;  5IG5 A;  3FG1 A;  1NWW A;  4GL6 A;  4IT7 A;  5CF1 A;  4Q53 A;  4ORL A;  3WOE B;  5D81 A;  3H3H A;  3I0Y A;  4I4K A;  5KP3 A;  2GBW B;  3FCS B;  2QIY A;  2RFR A;  1YJN 3;  3WDG B;  2CFG A;  4HVN A;  3OWS A;  4AKZ A;  3K5T A;  3IMA B;  2Z6B A;  2E2V A;  2XSH B;  1OGX A;  1O7H B;  1VQP 3;  2YFL B;  3BND A;  2GU1 A;  1RJO A;  2E2U A;  4OUQ A;  1LXE A;  5DRV A;  3I55 3;  4XBX A;  2HMK B;  3X42 A;  3QK9 A;  3E99 A;  4XBY A;  1DMN A;  3NQY A;  4HM2 B;  3U1W A;  3I56 3;  3CCR 3;  1GD3 A;  1VQM 3;  4FCJ A;  1G96 A;  2YX9 A;  1IT7 A;  4HM6 B;  3A76 A;  2V1L A;  2W03 A;  3HZP A;  3SLU A;  4IIA A;  3F8H A;  1KWI A;  3NM2 A;  4N6M A;  1OAC A;  1O7P B;  1FGO A;  5EVH A;  3HK4 A;  1IDP A;  1TFO A;  3GAX A;  1WNH A;  2CWU A;  3HX8 A;  4JF8 A;  6STD A;  1HU9 A;  1ULJ B;  2W9P A;  4O2H A;  4KFD A;  3OWY A;  3EB8 A;  1N8R 4;  4HYZ A;  2RCD A;  1VQ9 3;  3DM8 A;  3X40 A;  1ASK A;  1JB4 A;  4K1U A;  4MEI A;  1SIH A;  3SOY A;  2OQE A;  4KZ1 A;  1IQY A;  2GU3 A;  1N5P A;  3LML A;  1U8C B;  5BXQ A;  2CFD A;  2CK3 H;  3DY5 A;  3MG2 A;  3G6E 3;  3SX1 A;  2OOV A;  1VZZ A;  3N54 B;  2INX A;  2HMO B;  1R4C A;  1RRH A;  2B1X B;  5D82 A;  1NDO B;  5I97 A;  1GY7 A;  1TFK A;  3KKG A;  1UUV B;  4GB5 A;  3ALA A;  2ML5 A;  1WMP A;  2XSO B;  1QVG 2;  3Q90 A;  4OVM A;  5CK6 A;  3WOF B;  4O02 B;  1NJI 4;  1YJ9 3;  3RDE A;  2JDI H;  3HII A;  4IPB A;  5CXO A;  2JQ5 A;  5AYR B;  1ULI B;  4X2O A;  2IUJ A;  5KP4 A;  1VQ7 3;  3MKI A;  3KZT A;  3MG1 A;  7STD A;  2CWV A;  1QVF 2;  4N6L A;  3Q1C A;  5IG3 A;  1S72 3;  3STD A;  1PU4 A;  4BTY A;  3UJM A;  3GRD A;  2QEX 3;  5TGN A;  1A2K A;  1A2V A;  3UL6 A;  2QGU A;  4AKY A;  1AVK A;  4KFE A;  2UX0 A;  1AR0 A;  1O7W B;  4BTW A;  2BO9 B;  1DVC A;  3EJV A;  3NBJ A;  2P0X A;  1K9M 4;  1W6G A;  2A15 A;  2MF7 A;  3MYT A;  4L7K A;  3PCR A;  1NB3 I;  4WP5 A;  1W01 A;  2HMM B;  1JB2 A;  1KC8 4;  4WYK A;  1SJW A;  1FGM A;  3LT8 A;  3MPH A;  1JB5 A;  1W6C A;  1W5Z A;  4N6U A;  1GY5 A;  1IV7 A;  1MNL A;  5IW9 A;  1GS3 A;  4XB5 A;  3F8X A;  3NV0 A;  2W0Q A;  3DXO A;  4LGQ A;  1D6U A;  2F98 A;  3S29 A;  4HKV B;  5AIF A;  1T5Y A;  3LTB A;  1Z1S A;  3KN4 A;  3NBR A;  1VQ5 3;  4WWU C;  2C11 A;  2D1W A;  2BMQ B;  4K61 A;  1IVX A;  3V92 A;  3K0Z A;  4HM7 B;  4RNY A;  5JPU A;  3N8B A;  4L8O A;  5EEO A;  1W02 A;  3LZA A;  3NHX A;  3EQQ B;  1IT8 A;  3KSE D;  1W2Z A;  2FGT A;  4WFO A;  5AIH A;  4MMX B;  1OF5 B;  2CC3 A;  1ROV A;  3VGN A;  3UL5 A;  1Q82 4;  3AMO A;  4EC6 A;  3OW2 2;  1YI2 3;  4FCZ A;  1JN5 A;  1Q81 4;  1MOL A;  3S28 A;  2WO0 A;  5AYS C;  5CF2 A;  4OK0 A;  2WOH A;  4EV5 A;  2GEY A;  1Q40 A;  1DVD A;  4HM8 B;  3RGR A;  4O3V A;  4JRF A;  3V99 A;  2WOF A;  2XR8 B;  3FKA A;  2ML6 A;  2XFS A;  3CPW 2;  4FR9 A;  5ELU A;  3B8L A;  1E3R A;  4N6N B;  1BUQ A;  1QAF A;  1RRL A;  1YIT 3;  5IER A;  3U97 A;  3K63 A;  5CLK A;  4KVH A;  3G71 3;  2BNG A;  2CFK A;  4NHF A;  1AVL A;  1D6Y A;  3LOY A;  2IUK A;  1ROA A;  3F7S A;  3CC7 3;  2XGN A;  3X41 A;  1QAL A;  3UNL A;  4R1K A;  1SQW A;  2W56 B;  3JUQ A;  3KFQ C;  2RSX A;  1QAK A;  4MMY B;  1K41 A;  2E2T A;  2Q07 A;  1WQL B;  2ZDJ A;  2CG1 A;  1Q86 4;  3GZR A;  1KQS 2;  2HML B;  1A90 A;  3PZW A;  3CCS 3;  3SED A;  1WMN A;  1M1X B;  5AI1 A;  2GXF A;  2HMN B;  1STD A;  1IK3 A;  1QJG A;  2FNQ A;  2HMJ B;  1OH0 A;  3CCJ 3;  2ZL8 A;  4L8P A;  3SOA A;  5BVB A;  1FA3 A;  1JKG A;  1N8Q A;  2O9U X;  3N9H A;  4XDW A;  4FMC A;  1UW1 A;  4LEH A;  3GZY B;  1Q7Y 4;  4XDV A;  3DGN A;  4BTX A;  1WTH A;  5LC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...