2W56A

Structure of the hypothetical protein vc0508 from vibrio cholerae vsp- ii pathogenicity island
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
145
structure length
143
Chain Sequence
KLTFTASSLPVSKKLHKLLSKQLTAHLLSSEALTTSRYLVFNFRDKSYSADEGGFHPVEMAICQTSTGEWSIEYITDFAYMYYPELERNLDFDFRVGQFFVAYRGWLPMQGSRDAKELYRLWESNFLAYVDMDAYNEIAITAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords VC0508
publication title Structure of the Hypothetical Protein Vc0508 from Vibrio Cholerae Vsp-II Pathogenicity Island
rcsb
source organism Vibrio cholerae
total genus 33
structure length 143
sequence length 145
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10980 DUF2787 Protein of unknown function (DUF2787)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.430 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w56A00
2W56A 2W56B 2V1LA
chains in the Genus database with same CATH superfamily
1IT7A 2KRTA 3PYJA 2KF4A 5IERA 3KSPA 3X41A 2ZL8A 3G4S3 2GBXB 4O2HA 4JF8A 1EQKA 1O7WB 1HZ1A 3KZTA 2UGIA 4LSOA 3CD63 5DRVA 1SIIA 3CNMA 2P09A 1BSDA 1YJN3 1M904 3SXXA 1T5YA 1BSBA 1ULJB 2K54A 2ZHXB 3CU3A 2OQEA 1BRGA 1I2EA 1SQWA 4I5QA 1CEWI 1RDSA 2Z77A 3S28A 3RGRA 3GZBA 4STDA 3AGNA 1JJ22 1IQYA 1RGGA 3LOYA 3MWZA 3B7CA 3GAXA 1OPYA 2JDIH 1FW7A 3NM2A 1M9GA 3A76A 1CH0A 5I97A 3G6E3 4R1KA 3OWSA 5A0OB 3X3XA 4N3VA 1BANA 1RGAA 2R41A 3PZWA 1Q7HA 4RNYA 5IG5A 1QVF2 1OHOA 1X1WA 4WYKB 1B27A 1E3RA 1TTOA 1QMAA 1IDPA 1ULIB 1OCVA 3DGNA 3TDGA 1VQQA 1RGFA 4WP5A 3DGYA 1IQ8A 4R80A 2MF7A 1FGOA 2W0QA 1UGIA 2XGNA 5IW9A 1NWWA 1VZZA 1IVUA 2BMOB 2K0MA 5ELJA 1IQXA 2OQEC 3Q2PA 3VSYA 1LOYA 1BVIA 3DGOA 3JUMA 4QWTA 3FF2A 4FMAA 4K1UA 5BU4A 1KC84 1LOVA 1B2ZA 5AIIA 2XSOB 4MJDA 1STDA 4K61A 4HOHA 5AIGA 3V99A 1BRSA 2ZDJA 3SOYA 4DKIA 1RNBA 1R4YA 4WYKA 2OWPA 3NQYA 1TFKA 1QVG2 4XBYA 1T2IA 3EN8A 3DXOA 4HM3B 3K0ZA 1NO3A 4HVNA 2M7OA 2GSPA 2OOVA 5D81A 2IYJA 3DGLA 1A2KA 3HIGA 1IVVA 5FW5A 3KN4A 4GSPA 4LZIA 1UUGB 2Q07A 1US1A 1JZDA 5LC6A 1SPUA 3HX8A 1W2B2 1N8R4 2STDA 1BAOA 3D79A 2RGQA 1JBRA 1AVLA 1LQMB 3KFQC 1BNRA 1J2BA 2H0IA 2BMQB 4EBGA 1JKGB 1I0XA 4MEIA 3WHOA 2XEPA 3IPTA 2WOFA 1JBTA 1GD3A 1N9EA 2BMRB 3X3ZA 1RN4A 5M18A 1QJGA 5CK6A 3X40A 5AYSC 3LZAA 1VQ43 1U8CB 4KT3B 5LC7A 4MMYB 1TRPA 1IK3A 3UJMA 3PCRA 1B3SA 1WMNA 3UL6A 2B1XB 3MKIA 1F8NA 5AIHA 5G1LA 1B2MA 4XDWA 2OOVC 1LNIA 5IEOA 1BOXA 1JKGA 4J5KA 3T8UA 1K9M4 2D42A 1TP6A 5KP3A 4XB5A 1JB5A 3EF8A 1U5OA 3OWUA 4O02B 2ML5A 3K5TA 4R9LA 3SVAA 2CWUA 1FGMA 1MWTA 2HOHA 3FF0A 1SARA 2CKFB 3FLJA 3JUNA 4FR9A 1WNHA 3RNTA 3FG1A 1RJOA 1GY6A 4OK0A 1NJI4 1VQ63 2XFTA 1Q814 1V57A 4OUQA 1I3IA 2YX9A 3FSDA 3PCSA 3CCR3 2KF6A 1FA3A 3OWYA 3EC9A 1GMQA 1W02A 2CWVA 4L8OA 1DVDA 1JB2A 3CXC2 1YVBI 3AHSA 1RSNA 2W2CA 1QAKA 3WMDA 2Y73A 1BRNL 3G8ZA 1W7CA 3NUVA 3V92A 3CCV3 4N6TA 5CF1A 1E3VA 3I0YA 3NBJA 2IUJA 1RGLA 3V98A 1JZOA 3NQZA 1V58A 1YHQ3 1JBSA 3CCM3 1RHLA 4BU4A 3CCQ3 1AV4A 7RNTA 1UUWB 1K734 2XH9A 3KCHA 2E2VA 1DMMA 2GU3A 2R4IA 1EA2A 1LQGC 1W01A 3OXAA 1G96A 1EG9B 1MGWA 1DE3A 1M1K4 4HM7B 1C54A 3NX0A 5IENA 1B2XA 1N9JA 2I9WA 2Z7AA 3OW22 4IPBA 5EEOA 1IVXA 2P0XA 4BIRA 5IEPA 3GZXB 2W04A 8RNTA 5HOHA 1O7GB 1HU9A 1I8VA 3NBBA 3MG2A 3BNEA 5HGRA 1NB5I 3DH2A 4EV2A 1ZO2A 1DVCA 1EEJA 2YFJB 3MPHA 4HYZA 5EQLA 4X2HA 1BSAA 5D82A 2XF3A 3ECFA 1E97A 5CLKA 1RRLA 2BIRA 1UW1A 4HM5B 4O8SA 3CCU3 5FGOA 3T0UA 1GD4A 1GSPA 2JQ5A 3D4AA 3EE1A 1UCLA 3SLUA 3EBYA 1NB3I 2B24B 3LTAA 1B2SA 2UX0A 4KFEA 1JV2B 1A2PA 1ZGXA 5JPPA 3FH1A 3H51A 1VQL3 1GY5A 3IMAB 1D6ZA 3QRDA 1VQ93 1OHPA 1O7NB 4NPBA 4KFFA 2YFLB 5D83A 3EQQB 3UL5A 4WWUC 3MYTA 4U13A 1GY7A 2V1LA 1VQ83 1D6UA 1Q9EA 1B20A 2W56B 1PYLA 3GWRA 2H0HA 1VQK3 3SYUA 1YIT3 1ZX2A 2A15A 2CWTA 2RNTA 3WA2X 4G1MB 2YFIB 4LGQA 5KP1A 3CCJ3 1FZUA 1R4CA 2IMJA 4HJLB 5M19A 3D5GA 3FG3A 3GRDA 3BNCA 3QK9A 2XR8B 1QALA 4HZBB 3K7CA 2RCDA 3D5IA 1TU5A 1VQ53 1QAFA 1ROVA 3PXMA 2CW9A 3SOAA 1FGQA 6RNTA 3BIRA 2OTL3 1LNHA 2W56A 4HM0B 4GB5A 1N5PA 1I2FA 3HOHA 5IG3A 2P05A 2OTJ3 2WO0A 4L7KA 1OHSA 4RZMA 1NU3A 1W6GA 3WA3A 1RKYA 1MGRA 5AIFA 3S67A 1LRAA 1Y4KA 4MMZB 1SJWA 1TRQA 2ML6A 5IF6A 1DETA 4L8PA 3CPW2 2PNCA 4FMDA 1ASKA 1IU7A 1HKXA 2O9UX 2KF3A 3MSOA 1JB4A 3F8XA 4HM4B 3CPOA 1LXEA 1EUIC 1O7PB 1BNSA 1IVWA 1FGTA 4HM2B 3GZRA 1W4NA 1BNGA 2F5MA 4HM1B 2Y74A 2Z76A 3CC73 2HMKB 8CHOA 3G0KA 3WDGB 1K41A 4J5GA 2O3OA 1IV7A 1KQS2 2QGUA 1UCJA 1IV9A 3BLZA 3S27A 3OX9A 4EW5A 3Q90A 1RGHA 1UGHI 3EB8A 3RDEA 4IIAA 1BNIA 2INXA 4XDVA 1Q864 5AEUB 1X1UA 1CYVA 3N54B 1ZS7A 1BRHA 1FUWA 3B4OA 3G16A 1AQZA 4H61A 5M1AA 1TFOA 2L4VA 3DGMA 1X1XA 3AMOB 3LT9A 3MG3A 4XBXA 1WQLB 1S5AA 1BNEA 1WTHA 3ER7A 3DY5A 4BTWA 4JRFA 1K8A4 3CCE3 3U97A 1W6YA 4RNZA 3CNXA 1JRQA 3H3HA 2CX1A 3U1WA 1GOVA 3BB9A 4EYCA 2F56A 2HMNB 4KZ1A 4ORLA 3ZG5A 3T8NA 1IYYA 3PS8A 1FYSA 3AMOA 1JNQA 1GOYA 1OH0A 3JUOA 1OF5B 2SARA 1LOXA 3AHWA 3LTDA 1BSEA 1ROAA 4R4KA 2IUKA 3LMLA 5G1KA 3CMA3 1DMNA 4FCZA 4HBRA 2GU1A 4EC6A 3S29A 1GS3A 2J8XB 5AEWB 3ALAA 2CC3A 4EV5A 3S5CA 1BUQA 4RBNA 4HZ9B 1RN7A 3UNLA 3MHEA 3F8HA 1X1YA 3STDA 1GMPA 1AVKA 2SBLA 1W6CA 3DUKA 1I3FA 3WOFB 2D1WA 1Q40B 2KXGA 3F14A 4HM8B 4CDLA 3EJVA 1GYBA 2CG1A 2W9PA 4CCVA 4NHFA 2F4YA 1GOUA 1OF5A 4FMCA 1BRJA 2Z6BA 1PFPA 1A90A 1C7HA 6GSPA 1NNVA 4RNTA 1A67A 3I553 3CC43 4N6MA 3OV4A 5BXQA 1VQN3 1KWIA 3KE7A 1A2VA 1VQM3 4WFOA 1VQ73 4MMXB 1OUNA 1ISKA 2CFDA 4AKYA 2HMJB 2RSXA 2FXTA 3NM7A 4ILFA 3WODG 2P38A 3LYGA 1HYFA 1N5HA 3KKGA 1YVSA 3LXUX 3Q1CA 5EVHA 3LT8A 1I2GA 1Q824 1K28A 2F86B 2KF5A 2GEYA 3M8CA 1BRIA 4N6OB 1MNLA 3E99A 2CX0A 2F5WA 3F9SA 2RBIA 2BU4A 1STFI 2C4BA 3G713 1KD14 4TX4A 3B4PA 1YJW3 1SIHA 3UB1A 1RCKA 1TJDA 4FCJA 1BUJA 1RNTA 1RGCA 3LTCA 1RTUA 4O3VA 3HK4A 1UCKA 3ROBA 2F99A 1Q7Y4 1G0TA 1FGRA 5IG4A 2CH9A 2K3DA 4KFDA 3GZYB 2L1SA 4BL2A 3BU4A 4GHOA 4X2OA 3HZPA 3K63A 4H3UA 1BU4A 3BNDA 4HKVB 4N6LA 3NBRA 4I4KA 3Q3FA 3EN1B 3X3YA 2HMLB 2PZVA 1YIJ3 5IG0A 3F40A 4FMBA 1I0VA 1Q42A 2CFWA 2WGOA 4Q53A 2GEXA 3JUQA 3RGAA 9RNTA 1VQO3 7STDA 1TUHA 2C11A 3A5EA 3KIIA 3PGBA 1T2HA 2E2TA 2CFLA 2XSHB 4FCMA 1OGZA 3D9RA 2HMOB 3WR2A 2W9QA 2CIUA 1FUTA 1LOWA 1UDII 1YGEA 1W2ZA 2CG0A 3B8LA 4WHAA 2LYXA 5BIRA 1T3BA 3D3LA 1W00A 4IT7A 1W5ZA 4BTXA 5BVBA 4OVMA 5ELUA 5G2GA 1UI7A 4EXRA 6STDA 1AR0A 1OACA 3FCSB 2WGQA 1LVNA 1N8QA 2IY2A 4HM6B 5CXOA 4BL3A 3NV0B 1WMPA 3CME3 4AEQA 4BTYA 1S723 2OCTA 2XRXB 2KCDA 3CC23 1VQP3 3NHXA 4LEHA 1OGXA 1RGEA 4LYLB 3NXJA 1JN5B 2C10A 5AI1A 3EBTA 3FKAA 3J7Yd 1MOLA 1DYUA 3LTBA 3N8BA 4J9AA 2MC8A 4CPKA 1YJ93 1IT8A 2E2UA 4N6V0 1BGSA 4PEJA 2CK3H 2AAEA 2HMMB 3L0RA 3FZWA 3FG4A 5STDA 4K90B 1RMSA 3HI7A 3NV0A 1Z1SA 4R9KA 3JVCA 2GBWB 2GXFA 3N9HA 3X42A 1DMQA 3GSPA 3K9MC 1O7MB 2UUGC 2P0MA 2W6JH 1BNJA 1UCIA 4XBTA 1EKMA 1UI8A 2CHCA 3WOEB 3I563 1JN5A 5TGNA 2BO9B 2QA43 1PU4A 1NDOB 2AADA 2BHMA 2CFGA 5JBSA 4KVHA 1BRKA 5CF2A 1YNVX 1MWSA 3CCS3 2W03A 2BNGA 3EHCA 3AGOA 1M1XB 2WOHA 3DM8A 5GSPA 1GMRA 4N6NB 2XFSA 2QEX3 3DZLA 1D6YA 1YI23 2KAAA 3LH4A 1RRHA 1AY7A 3CCL3 3F7SA 2ZA4A 3URPA 1I70A 2IA7A 3KSED 1MWUA 4J8TA 1WMOA 2BT3A 3JUPA 5JPUA 2QIYA 4N6UA 1UUVB 1YGWA 2FGTA 3SEDA 1TIJA 2XGLA 3O8YA 4K1VA 4NREA 4HAAA 3VGNA 1BSCA 4GL6A 1B2UA 3F7XA 1G02A 1RGKA 1V74A 3FGYA 3HIIA 5DREA 3ZG0A 4XM4A 4AKZA 5AYRB 1MWRA 3MG1A 1CQSA 4LMIA 4ZM8A 3DMCA 3VF1A 2LQVA 1PY3A 3ZFZA 1RLSA 3BNBA 7GSPA 1CYUA 1KSIA 1BIRA 2CFKA 2FNQA 3SX1A 4CJNA 1O7HB 2RFRA 1RN1A 5RNTA 3EX9A 1B21A 1FUSA 5KP4A 3IJEB 1L5GB 2F98A 2H0GA 1Q40A 1BNFA 1RCLA
chains in the Genus database with same CATH topology
1IT7A 2KRTA 3PYJA 5IERA 3KSPA 3X41A 2ZL8A 3G4S3 2GBXB 4O2HA 4JF8A 1EQKA 1O7WB 3KZTA 4LSOA 3CD63 5DRVA 1SIIA 3CNMA 2P09A 1YJN3 1M904 3SXXA 1T5YA 1ULJB 2K54A 3CU3A 2OQEA 1SQWA 1CEWI 2Z77A 3S28A 3RGRA 3GZBA 4STDA 1JJ22 1IQYA 3MWZA 3LOYA 3B7CA 3GAXA 1OPYA 2JDIH 3NM2A 1M9GA 3A76A 5I97A 3G6E3 4R1KA 3OWSA 5A0OB 3X3XA 4N3VA 3PZWA 4RNYA 5IG5A 1QVF2 1OHOA 4WYKB 1E3RA 3DGNA 1QMAA 1IDPA 1ULIB 1OCVA 3TDGA 4WP5A 1IQ8A 4R80A 2MF7A 1FGOA 2W0QA 2XGNA 5IW9A 1NWWA 1VZZA 1IVUA 2BMOB 2K0MA 5ELJA 1IQXA 2OQEC 3Q2PA 3VSYA 4QWTA 3DGOA 3JUMA 1KC84 3FF2A 4FMAA 4K1UA 5AIIA 2XSOB 4MJDA 1STDA 4K61A 5AIGA 3V99A 2ZDJA 3SOYA 4WYKA 2OWPA 3NQYA 1TFKA 1QVG2 4XBYA 3EN8A 3DXOA 4HM3B 3K0ZA 1NO3A 4HVNA 2M7OA 2OOVA 5D81A 3DGLA 1A2KA 3HIGA 1IVVA 5FW5A 3KN4A 4LZIA 2Q07A 1N8R4 1US1A 5LC6A 1W2B2 1SPUA 3HX8A 2STDA 2RGQA 1AVLA 3KFQC 1J2BA 2BMQB 4EBGA 1JKGB 4MEIA 2XEPA 3IPTA 2WOFA 1GD3A 1N9EA 2BMRB 3X3ZA 1QJGA 5CK6A 3X40A 5AYSC 3LZAA 1VQ43 1U8CB 5LC7A 4MMYB 1IK3A 3UJMA 3PCRA 1WMNA 3UL6A 2B1XB 3MKIA 1F8NA 5AIHA 4XDWA 2OOVC 5IEOA 1JKGA 3T8UA 1K9M4 2D42A 1TP6A 5KP3A 4XB5A 1JB5A 3EF8A 1U5OA 3OWUA 4O02B 2ML5A 3K5TA 4R9LA 3SVAA 2CWUA 1FGMA 3FF0A 4FR9A 3FLJA 2CKFB 3JUNA 1WNHA 3FG1A 1RJOA 1GY6A 4OK0A 1NJI4 1VQ63 2XFTA 1Q814 4OUQA 2YX9A 3FSDA 3PCSA 3CCR3 1FA3A 3OWYA 3EC9A 4L8OA 1W02A 2CWVA 1DVDA 1JB2A 3CXC2 1YVBI 2W2CA 1QAKA 3WMDA 2Y73A 3G8ZA 1W7CA 3NUVA 3V92A 3CCV3 4N6TA 5CF1A 1E3VA 3I0YA 3NBJA 2IUJA 3V98A 1YHQ3 3NQZA 3CCM3 3CCQ3 1AV4A 1UUWB 1K734 2XH9A 2E2VA 1DMMA 2GU3A 2R4IA 1EA2A 1W01A 3OXAA 1G96A 1EG9B 1M1K4 4HM7B 3NX0A 5IENA 1N9JA 2I9WA 2Z7AA 3OW22 4IPBA 5EEOA 1IVXA 2P0XA 5IEPA 3GZXB 2W04A 1O7GB 1HU9A 3NBBA 3MG2A 3BNEA 5HGRA 1NB5I 4EV2A 1ZO2A 1DVCA 2YFJB 3MPHA 4HYZA 5EQLA 4X2HA 5D82A 2XF3A 3ECFA 1E97A 5CLKA 1RRLA 4HM5B 1UW1A 4O8SA 3CCU3 1YIT3 5FGOA 3T0UA 1GD4A 2JQ5A 3EE1A 3SLUA 3EBYA 1NB3I 2B24B 3LTAA 2UX0A 4KFEA 1JV2B 5JPPA 3FH1A 3H51A 1VQL3 1GY5A 3IMAB 1D6ZA 3QRDA 1VQ93 1OHPA 1O7NB 4KFFA 2YFLB 5D83A 3EQQB 3UL5A 4WWUC 3MYTA 4U13A 1GY7A 2V1LA 1VQ83 1D6UA 2W56B 3GWRA 1VQK3 1ZX2A 2A15A 2CWTA 3WA2X 4G1MB 2YFIB 4LGQA 5KP1A 3CCJ3 1R4CA 2IMJA 4HJLB 3FG3A 3GRDA 3BNCA 3QK9A 2XR8B 1QALA 4HZBB 3K7CA 2RCDA 1TU5A 1VQ53 1QAFA 1ROVA 3PXMA 2CW9A 3SOAA 1FGQA 2OTL3 1LNHA 2W56A 4HM0B 4GB5A 1N5PA 5IG3A 2P05A 2OTJ3 2WO0A 4L7KA 1OHSA 4RZMA 1NU3A 1W6GA 3WA3A 1RKYA 5AIFA 3S67A 1Y4KA 4MMZB 1SJWA 2ML6A 5IF6A 4L8PA 3CPW2 2PNCA 4FMDA 1ASKA 1IU7A 1HKXA 2O9UX 3MSOA 1JB4A 3F8XA 4HM4B 3CPOA 1LXEA 1O7PB 1IVWA 4HM2B 1FGTA 3GZRA 1W4NA 4HM1B 2Y74A 2Z76A 3CC73 2HMKB 8CHOA 3G0KA 3WDGB 1K41A 2O3OA 1IV7A 1KQS2 2QGUA 1IV9A 3BLZA 3S27A 3OX9A 3Q90A 3EB8A 3RDEA 4IIAA 2INXA 4XDVA 1Q864 5AEUB 1CYVA 3N54B 1FUWA 3B4OA 3G16A 4H61A 1TFOA 2L4VA 3DGMA 3AMOB 3LT9A 3MG3A 4XBXA 1WQLB 1S5AA 1WTHA 3ER7A 3DY5A 4BTWA 4JRFA 1K8A4 3CCE3 3U97A 1W6YA 4RNZA 3CNXA 1JRQA 3H3HA 3U1WA 3BB9A 4EYCA 2HMNB 4KZ1A 4ORLA 3T8NA 3PS8A 3AMOA 1JNQA 1OH0A 3JUOA 1OF5B 1LOXA 3LTDA 1ROAA 3CMA3 4R4KA 2IUKA 3LMLA 1DMNA 4FCZA 4HBRA 2GU1A 4EC6A 3S29A 1GS3A 5AEWB 3ALAA 2CC3A 4EV5A 3S5CA 1BUQA 4RBNA 4HZ9B 1RN7A 3UNLA 3MHEA 3F8HA 3STDA 1AVKA 2SBLA 1W6CA 3DUKA 3WOFB 2D1WA 1Q40B 2KXGA 3F14A 4HM8B 4CDLA 3EJVA 1GYBA 2CG1A 2W9PA 4CCVA 4NHFA 1OF5A 4FMCA 2Z6BA 1PFPA 1A90A 1C7HA 1A67A 3I553 3CC43 4N6MA 3OV4A 5BXQA 1VQN3 1KWIA 3KE7A 1A2VA 1VQM3 4WFOA 1VQ73 4MMXB 1OUNA 1ISKA 2CFDA 4AKYA 2HMJB 2RSXA 2FXTA 3NM7A 3WODG 2P38A 3LYGA 5EVHA 1N5HA 3KKGA 3Q1CA 3LXUX 3LT8A 1Q824 1K28A 2F86B 2GEYA 3M8CA 4N6OB 1MNLA 3E99A 3F9SA 3G713 1KD14 1STFI 4TX4A 3B4PA 1YJW3 1SIHA 3UB1A 4FCJA 3LTCA 4O3VA 3HK4A 3ROBA 2F99A 1Q7Y4 1FGRA 5IG4A 2CH9A 4KFDA 3GZYB 4X2OA 3HZPA 3K63A 4H3UA 3BNDA 4HKVB 4N6LA 3NBRA 4I4KA 3EN1B 3X3YA 2HMLB 2PZVA 1YIJ3 5IG0A 3F40A 4FMBA 1Q42A 2CFWA 2WGOA 4Q53A 2GEXA 3JUQA 3RGAA 1VQO3 7STDA 1TUHA 2C11A 3PGBA 3KIIA 2E2TA 2CFLA 2XSHB 4FCMA 1OGZA 3D9RA 2HMOB 2W9QA 2CIUA 1YGEA 1W2ZA 2CG0A 3B8LA 4WHAA 2LYXA 3D3LA 1W00A 4IT7A 1W5ZA 4BTXA 5BVBA 4OVMA 5ELUA 5G2GA 1UI7A 4EXRA 6STDA 1AR0A 1OACA 3FCSB 2WGQA 1LVNA 1N8QA 4HM6B 5CXOA 3NV0B 1WMPA 3CME3 4AEQA 4BTYA 1S723 2OCTA 2XRXB 2KCDA 3CC23 1VQP3 3NHXA 4LEHA 1OGXA 3NXJA 1JN5B 2C10A 5AI1A 3EBTA 3FKAA 3J7Yd 1MOLA 1DYUA 3LTBA 3N8BA 4J9AA 2MC8A 1YJ93 1IT8A 2E2UA 4N6V0 4PEJA 2CK3H 2HMMB 3L0RA 3FZWA 3FG4A 5STDA 4K90B 3HI7A 3NV0A 4R9KA 1Z1SA 3JVCA 2GBWB 2GXFA 3N9HA 3X42A 1DMQA 3K9MC 1O7MB 2P0MA 2W6JH 4XBTA 1EKMA 1UI8A 2CHCA 3WOEB 3I563 1JN5A 5TGNA 2BO9B 2QA43 1PU4A 1NDOB 2BHMA 2CFGA 5JBSA 4KVHA 5CF2A 3CCS3 2W03A 2BNGA 3EHCA 1M1XB 2WOHA 3DM8A 4N6NB 2XFSA 2QEX3 3DZLA 1D6YA 1YI23 3LH4A 1RRHA 3CCL3 3F7SA 2IA7A 3KSED 4J8TA 1WMOA 2BT3A 3JUPA 5JPUA 2QIYA 4N6UA 1UUVB 2FGTA 3SEDA 1TIJA 2XGLA 3O8YA 4K1VA 4NREA 3VGNA 4GL6A 3F7XA 1V74A 3HIIA 5DREA 3FGYA 4XM4A 4AKZA 5AYRB 3MG1A 1CQSA 4LMIA 4ZM8A 3DMCA 3VF1A 2LQVA 1CYUA 3BNBA 1KSIA 2CFKA 2FNQA 3SX1A 1O7HB 2RFRA 3EX9A 5KP4A 3IJEB 1L5GB 2F98A 1Q40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W56 A;  2W56 B;  2V1L A; 
#chains in the Genus database with same CATH topology
 1IT7 A;  2KRT A;  3PYJ A;  2KF4 A;  5IER A;  3KSP A;  3X41 A;  2ZL8 A;  3G4S 3;  2GBX B;  4O2H A;  4JF8 A;  1EQK A;  1O7W B;  1HZ1 A;  3KZT A;  2UGI A;  4LSO A;  3CD6 3;  5DRV A;  1SII A;  3CNM A;  2P09 A;  1BSD A;  1YJN 3;  1M90 4;  3SXX A;  1T5Y A;  1BSB A;  1ULJ B;  2K54 A;  2ZHX B;  3CU3 A;  2OQE A;  1BRG A;  1I2E A;  1SQW A;  4I5Q A;  1CEW I;  1RDS A;  2Z77 A;  3S28 A;  3RGR A;  3GZB A;  4STD A;  3AGN A;  1JJ2 2;  1IQY A;  1RGG A;  3LOY A;  3MWZ A;  3B7C A;  3GAX A;  1OPY A;  2JDI H;  1FW7 A;  3NM2 A;  1M9G A;  3A76 A;  1CH0 A;  5I97 A;  3G6E 3;  4R1K A;  3OWS A;  5A0O B;  3X3X A;  4N3V A;  1BAN A;  1RGA A;  2R41 A;  3PZW A;  1Q7H A;  4RNY A;  5IG5 A;  1QVF 2;  1OHO A;  1X1W A;  4WYK B;  1B27 A;  1E3R A;  1TTO A;  1QMA A;  1IDP A;  1ULI B;  1OCV A;  3DGN A;  3TDG A;  1VQQ A;  1RGF A;  4WP5 A;  3DGY A;  1IQ8 A;  4R80 A;  2MF7 A;  1FGO A;  2W0Q A;  1UGI A;  2XGN A;  5IW9 A;  1NWW A;  1VZZ A;  1IVU A;  2BMO B;  2K0M A;  5ELJ A;  1IQX A;  2OQE C;  3Q2P A;  3VSY A;  1LOY A;  1BVI A;  3DGO A;  3JUM A;  4QWT A;  3FF2 A;  4FMA A;  4K1U A;  5BU4 A;  1KC8 4;  1LOV A;  1B2Z A;  5AII A;  2XSO B;  4MJD A;  1STD A;  4K61 A;  4HOH A;  5AIG A;  3V99 A;  1BRS A;  2ZDJ A;  3SOY A;  4DKI A;  1RNB A;  1R4Y A;  4WYK A;  2OWP A;  3NQY A;  1TFK A;  1QVG 2;  4XBY A;  1T2I A;  3EN8 A;  3DXO A;  4HM3 B;  3K0Z A;  1NO3 A;  4HVN A;  2M7O A;  2GSP A;  2OOV A;  5D81 A;  2IYJ A;  3DGL A;  1A2K A;  3HIG A;  1IVV A;  5FW5 A;  3KN4 A;  4GSP A;  4LZI A;  1UUG B;  2Q07 A;  1US1 A;  1JZD A;  5LC6 A;  1SPU A;  3HX8 A;  1W2B 2;  1N8R 4;  2STD A;  1BAO A;  3D79 A;  2RGQ A;  1JBR A;  1AVL A;  1LQM B;  3KFQ C;  1BNR A;  1J2B A;  2H0I A;  2BMQ B;  4EBG A;  1JKG B;  1I0X A;  4MEI A;  3WHO A;  2XEP A;  3IPT A;  2WOF A;  1JBT A;  1GD3 A;  1N9E A;  2BMR B;  3X3Z A;  1RN4 A;  5M18 A;  1QJG A;  5CK6 A;  3X40 A;  5AYS C;  3LZA A;  1VQ4 3;  1U8C B;  4KT3 B;  5LC7 A;  4MMY B;  1TRP A;  1IK3 A;  3UJM A;  3PCR A;  1B3S A;  1WMN A;  3UL6 A;  2B1X B;  3MKI A;  1F8N A;  5AIH A;  5G1L A;  1B2M A;  4XDW A;  2OOV C;  1LNI A;  5IEO A;  1BOX A;  1JKG A;  4J5K A;  3T8U A;  1K9M 4;  2D42 A;  1TP6 A;  5KP3 A;  4XB5 A;  1JB5 A;  3EF8 A;  1U5O A;  3OWU A;  4O02 B;  2ML5 A;  3K5T A;  4R9L A;  3SVA A;  2CWU A;  1FGM A;  1MWT A;  2HOH A;  3FF0 A;  1SAR A;  2CKF B;  3FLJ A;  3JUN A;  4FR9 A;  1WNH A;  3RNT A;  3FG1 A;  1RJO A;  1GY6 A;  4OK0 A;  1NJI 4;  1VQ6 3;  2XFT A;  1Q81 4;  1V57 A;  4OUQ A;  1I3I A;  2YX9 A;  3FSD A;  3PCS A;  3CCR 3;  2KF6 A;  1FA3 A;  3OWY A;  3EC9 A;  1GMQ A;  1W02 A;  2CWV A;  4L8O A;  1DVD A;  1JB2 A;  3CXC 2;  1YVB I;  3AHS A;  1RSN A;  2W2C A;  1QAK A;  3WMD A;  2Y73 A;  1BRN L;  3G8Z A;  1W7C A;  3NUV A;  3V92 A;  3CCV 3;  4N6T A;  5CF1 A;  1E3V A;  3I0Y A;  3NBJ A;  2IUJ A;  1RGL A;  3V98 A;  1JZO A;  3NQZ A;  1V58 A;  1YHQ 3;  1JBS A;  3CCM 3;  1RHL A;  4BU4 A;  3CCQ 3;  1AV4 A;  7RNT A;  1UUW B;  1K73 4;  2XH9 A;  3KCH A;  2E2V A;  1DMM A;  2GU3 A;  2R4I A;  1EA2 A;  1LQG C;  1W01 A;  3OXA A;  1G96 A;  1EG9 B;  1MGW A;  1DE3 A;  1M1K 4;  4HM7 B;  1C54 A;  3NX0 A;  5IEN A;  1B2X A;  1N9J A;  2I9W A;  2Z7A A;  3OW2 2;  4IPB A;  5EEO A;  1IVX A;  2P0X A;  4BIR A;  5IEP A;  3GZX B;  2W04 A;  8RNT A;  5HOH A;  1O7G B;  1HU9 A;  1I8V A;  3NBB A;  3MG2 A;  3BNE A;  5HGR A;  1NB5 I;  3DH2 A;  4EV2 A;  1ZO2 A;  1DVC A;  1EEJ A;  2YFJ B;  3MPH A;  4HYZ A;  5EQL A;  4X2H A;  1BSA A;  5D82 A;  2XF3 A;  3ECF A;  1E97 A;  5CLK A;  1RRL A;  2BIR A;  1UW1 A;  4HM5 B;  4O8S A;  3CCU 3;  5FGO A;  3T0U A;  1GD4 A;  1GSP A;  2JQ5 A;  3D4A A;  3EE1 A;  1UCL A;  3SLU A;  3EBY A;  1NB3 I;  2B24 B;  3LTA A;  1B2S A;  2UX0 A;  4KFE A;  1JV2 B;  1A2P A;  1ZGX A;  5JPP A;  3FH1 A;  3H51 A;  1VQL 3;  1GY5 A;  3IMA B;  1D6Z A;  3QRD A;  1VQ9 3;  1OHP A;  1O7N B;  4NPB A;  4KFF A;  2YFL B;  5D83 A;  3EQQ B;  3UL5 A;  4WWU C;  3MYT A;  4U13 A;  1GY7 A;  2V1L A;  1VQ8 3;  1D6U A;  1Q9E A;  1B20 A;  2W56 B;  1PYL A;  3GWR A;  2H0H A;  1VQK 3;  3SYU A;  1YIT 3;  1ZX2 A;  2A15 A;  2CWT A;  2RNT A;  3WA2 X;  4G1M B;  2YFI B;  4LGQ A;  5KP1 A;  3CCJ 3;  1FZU A;  1R4C A;  2IMJ A;  4HJL B;  5M19 A;  3D5G A;  3FG3 A;  3GRD A;  3BNC A;  3QK9 A;  2XR8 B;  1QAL A;  4HZB B;  3K7C A;  2RCD A;  3D5I A;  1TU5 A;  1VQ5 3;  1QAF A;  1ROV A;  3PXM A;  2CW9 A;  3SOA A;  1FGQ A;  6RNT A;  3BIR A;  2OTL 3;  1LNH A;  2W56 A;  4HM0 B;  4GB5 A;  1N5P A;  1I2F A;  3HOH A;  5IG3 A;  2P05 A;  2OTJ 3;  2WO0 A;  4L7K A;  1OHS A;  4RZM A;  1NU3 A;  1W6G A;  3WA3 A;  1RKY A;  1MGR A;  5AIF A;  3S67 A;  1LRA A;  1Y4K A;  4MMZ B;  1SJW A;  1TRQ A;  2ML6 A;  5IF6 A;  1DET A;  4L8P A;  3CPW 2;  2PNC A;  4FMD A;  1ASK A;  1IU7 A;  1HKX A;  2O9U X;  2KF3 A;  3MSO A;  1JB4 A;  3F8X A;  4HM4 B;  3CPO A;  1LXE A;  1EUI C;  1O7P B;  1BNS A;  1IVW A;  1FGT A;  4HM2 B;  3GZR A;  1W4N A;  1BNG A;  2F5M A;  4HM1 B;  2Y74 A;  2Z76 A;  3CC7 3;  2HMK B;  8CHO A;  3G0K A;  3WDG B;  1K41 A;  4J5G A;  2O3O A;  1IV7 A;  1KQS 2;  2QGU A;  1UCJ A;  1IV9 A;  3BLZ A;  3S27 A;  3OX9 A;  4EW5 A;  3Q90 A;  1RGH A;  1UGH I;  3EB8 A;  3RDE A;  4IIA A;  1BNI A;  2INX A;  4XDV A;  1Q86 4;  5AEU B;  1X1U A;  1CYV A;  3N54 B;  1ZS7 A;  1BRH A;  1FUW A;  3B4O A;  3G16 A;  1AQZ A;  4H61 A;  5M1A A;  1TFO A;  2L4V A;  3DGM A;  1X1X A;  3AMO B;  3LT9 A;  3MG3 A;  4XBX A;  1WQL B;  1S5A A;  1BNE A;  1WTH A;  3ER7 A;  3DY5 A;  4BTW A;  4JRF A;  1K8A 4;  3CCE 3;  3U97 A;  1W6Y A;  4RNZ A;  3CNX A;  1JRQ A;  3H3H A;  2CX1 A;  3U1W A;  1GOV A;  3BB9 A;  4EYC A;  2F56 A;  2HMN B;  4KZ1 A;  4ORL A;  3ZG5 A;  3T8N A;  1IYY A;  3PS8 A;  1FYS A;  3AMO A;  1JNQ A;  1GOY A;  1OH0 A;  3JUO A;  1OF5 B;  2SAR A;  1LOX A;  3AHW A;  3LTD A;  1BSE A;  1ROA A;  4R4K A;  2IUK A;  3LML A;  5G1K A;  3CMA 3;  1DMN A;  4FCZ A;  4HBR A;  2GU1 A;  4EC6 A;  3S29 A;  1GS3 A;  2J8X B;  5AEW B;  3ALA A;  2CC3 A;  4EV5 A;  3S5C A;  1BUQ A;  4RBN A;  4HZ9 B;  1RN7 A;  3UNL A;  3MHE A;  3F8H A;  1X1Y A;  3STD A;  1GMP A;  1AVK A;  2SBL A;  1W6C A;  3DUK A;  1I3F A;  3WOF B;  2D1W A;  1Q40 B;  2KXG A;  3F14 A;  4HM8 B;  4CDL A;  3EJV A;  1GYB A;  2CG1 A;  2W9P A;  4CCV A;  4NHF A;  2F4Y A;  1GOU A;  1OF5 A;  4FMC A;  1BRJ A;  2Z6B A;  1PFP A;  1A90 A;  1C7H A;  6GSP A;  1NNV A;  4RNT A;  1A67 A;  3I55 3;  3CC4 3;  4N6M A;  3OV4 A;  5BXQ A;  1VQN 3;  1KWI A;  3KE7 A;  1A2V A;  1VQM 3;  4WFO A;  1VQ7 3;  4MMX B;  1OUN A;  1ISK A;  2CFD A;  4AKY A;  2HMJ B;  2RSX A;  2FXT A;  3NM7 A;  4ILF A;  3WOD G;  2P38 A;  3LYG A;  1HYF A;  1N5H A;  3KKG A;  1YVS A;  3LXU X;  3Q1C A;  5EVH A;  3LT8 A;  1I2G A;  1Q82 4;  1K28 A;  2F86 B;  2KF5 A;  2GEY A;  3M8C A;  1BRI A;  4N6O B;  1MNL A;  3E99 A;  2CX0 A;  2F5W A;  3F9S A;  2RBI A;  2BU4 A;  1STF I;  2C4B A;  3G71 3;  1KD1 4;  4TX4 A;  3B4P A;  1YJW 3;  1SIH A;  3UB1 A;  1RCK A;  1TJD A;  4FCJ A;  1BUJ A;  1RNT A;  1RGC A;  3LTC A;  1RTU A;  4O3V A;  3HK4 A;  1UCK A;  3ROB A;  2F99 A;  1Q7Y 4;  1G0T A;  1FGR A;  5IG4 A;  2CH9 A;  2K3D A;  4KFD A;  3GZY B;  2L1S A;  4BL2 A;  3BU4 A;  4GHO A;  4X2O A;  3HZP A;  3K63 A;  4H3U A;  1BU4 A;  3BND A;  4HKV B;  4N6L A;  3NBR A;  4I4K A;  3Q3F A;  3EN1 B;  3X3Y A;  2HML B;  2PZV A;  1YIJ 3;  5IG0 A;  3F40 A;  4FMB A;  1I0V A;  1Q42 A;  2CFW A;  2WGO A;  4Q53 A;  2GEX A;  3JUQ A;  3RGA A;  9RNT A;  1VQO 3;  7STD A;  1TUH A;  2C11 A;  3A5E A;  3KII A;  3PGB A;  1T2H A;  2E2T A;  2CFL A;  2XSH B;  4FCM A;  1OGZ A;  3D9R A;  2HMO B;  3WR2 A;  2W9Q A;  2CIU A;  1FUT A;  1LOW A;  1UDI I;  1YGE A;  1W2Z A;  2CG0 A;  3B8L A;  4WHA A;  2LYX A;  5BIR A;  1T3B A;  3D3L A;  1W00 A;  4IT7 A;  1W5Z A;  4BTX A;  5BVB A;  4OVM A;  5ELU A;  5G2G A;  1UI7 A;  4EXR A;  6STD A;  1AR0 A;  1OAC A;  3FCS B;  2WGQ A;  1LVN A;  1N8Q A;  2IY2 A;  4HM6 B;  5CXO A;  4BL3 A;  3NV0 B;  1WMP A;  3CME 3;  4AEQ A;  4BTY A;  1S72 3;  2OCT A;  2XRX B;  2KCD A;  3CC2 3;  1VQP 3;  3NHX A;  4LEH A;  1OGX A;  1RGE A;  4LYL B;  3NXJ A;  1JN5 B;  2C10 A;  5AI1 A;  3EBT A;  3FKA A;  3J7Y d;  1MOL A;  1DYU A;  3LTB A;  3N8B A;  4J9A A;  2MC8 A;  4CPK A;  1YJ9 3;  1IT8 A;  2E2U A;  4N6V 0;  1BGS A;  4PEJ A;  2CK3 H;  2AAE A;  2HMM B;  3L0R A;  3FZW A;  3FG4 A;  5STD A;  4K90 B;  1RMS A;  3HI7 A;  3NV0 A;  1Z1S A;  4R9K A;  3JVC A;  2GBW B;  2GXF A;  3N9H A;  3X42 A;  1DMQ A;  3GSP A;  3K9M C;  1O7M B;  2UUG C;  2P0M A;  2W6J H;  1BNJ A;  1UCI A;  4XBT A;  1EKM A;  1UI8 A;  2CHC A;  3WOE B;  3I56 3;  1JN5 A;  5TGN A;  2BO9 B;  2QA4 3;  1PU4 A;  1NDO B;  2AAD A;  2BHM A;  2CFG A;  5JBS A;  4KVH A;  1BRK A;  5CF2 A;  1YNV X;  1MWS A;  3CCS 3;  2W03 A;  2BNG A;  3EHC A;  3AGO A;  1M1X B;  2WOH A;  3DM8 A;  5GSP A;  1GMR A;  4N6N B;  2XFS A;  2QEX 3;  3DZL A;  1D6Y A;  1YI2 3;  2KAA A;  3LH4 A;  1RRH A;  1AY7 A;  3CCL 3;  3F7S A;  2ZA4 A;  3URP A;  1I70 A;  2IA7 A;  3KSE D;  1MWU A;  4J8T A;  1WMO A;  2BT3 A;  3JUP A;  5JPU A;  2QIY A;  4N6U A;  1UUV B;  1YGW A;  2FGT A;  3SED A;  1TIJ A;  2XGL A;  3O8Y A;  4K1V A;  4NRE A;  4HAA A;  3VGN A;  1BSC A;  4GL6 A;  1B2U A;  3F7X A;  1G02 A;  1RGK A;  1V74 A;  3FGY A;  3HII A;  5DRE A;  3ZG0 A;  4XM4 A;  4AKZ A;  5AYR B;  1MWR A;  3MG1 A;  1CQS A;  4LMI A;  4ZM8 A;  3DMC A;  3VF1 A;  2LQV A;  1PY3 A;  3ZFZ A;  1RLS A;  3BNB A;  7GSP A;  1CYU A;  1KSI A;  1BIR A;  2CFK A;  2FNQ A;  3SX1 A;  4CJN A;  1O7H B;  2RFR A;  1RN1 A;  5RNT A;  3EX9 A;  1B21 A;  1FUS A;  5KP4 A;  3IJE B;  1L5G B;  2F98 A;  2H0G A;  1Q40 A;  1BNF A;  1RCL A; 
#chains in the Genus database with same CATH homology
 1IT7 A;  2KRT A;  3PYJ A;  5IER A;  3KSP A;  3X41 A;  2ZL8 A;  3G4S 3;  2GBX B;  4O2H A;  4JF8 A;  1EQK A;  1O7W B;  3KZT A;  4LSO A;  3CD6 3;  5DRV A;  1SII A;  3CNM A;  2P09 A;  1YJN 3;  1M90 4;  3SXX A;  1T5Y A;  1ULJ B;  2K54 A;  3CU3 A;  2OQE A;  1SQW A;  1CEW I;  2Z77 A;  3S28 A;  3RGR A;  3GZB A;  4STD A;  1JJ2 2;  1IQY A;  3MWZ A;  3LOY A;  3B7C A;  3GAX A;  1OPY A;  2JDI H;  3NM2 A;  1M9G A;  3A76 A;  5I97 A;  3G6E 3;  4R1K A;  3OWS A;  5A0O B;  3X3X A;  4N3V A;  3PZW A;  4RNY A;  5IG5 A;  1QVF 2;  1OHO A;  4WYK B;  1E3R A;  3DGN A;  1QMA A;  1IDP A;  1ULI B;  1OCV A;  3TDG A;  4WP5 A;  1IQ8 A;  4R80 A;  2MF7 A;  1FGO A;  2W0Q A;  2XGN A;  5IW9 A;  1NWW A;  1VZZ A;  1IVU A;  2BMO B;  2K0M A;  5ELJ A;  1IQX A;  2OQE C;  3Q2P A;  3VSY A;  4QWT A;  3DGO A;  3JUM A;  1KC8 4;  3FF2 A;  4FMA A;  4K1U A;  5AII A;  2XSO B;  4MJD A;  1STD A;  4K61 A;  5AIG A;  3V99 A;  2ZDJ A;  3SOY A;  4WYK A;  2OWP A;  3NQY A;  1TFK A;  1QVG 2;  4XBY A;  3EN8 A;  3DXO A;  4HM3 B;  3K0Z A;  1NO3 A;  4HVN A;  2M7O A;  2OOV A;  5D81 A;  3DGL A;  1A2K A;  3HIG A;  1IVV A;  5FW5 A;  3KN4 A;  4LZI A;  2Q07 A;  1N8R 4;  1US1 A;  5LC6 A;  1W2B 2;  1SPU A;  3HX8 A;  2STD A;  2RGQ A;  1AVL A;  3KFQ C;  1J2B A;  2BMQ B;  4EBG A;  1JKG B;  4MEI A;  2XEP A;  3IPT A;  2WOF A;  1GD3 A;  1N9E A;  2BMR B;  3X3Z A;  1QJG A;  5CK6 A;  3X40 A;  5AYS C;  3LZA A;  1VQ4 3;  1U8C B;  5LC7 A;  4MMY B;  1IK3 A;  3UJM A;  3PCR A;  1WMN A;  3UL6 A;  2B1X B;  3MKI A;  1F8N A;  5AIH A;  4XDW A;  2OOV C;  5IEO A;  1JKG A;  3T8U A;  1K9M 4;  2D42 A;  1TP6 A;  5KP3 A;  4XB5 A;  1JB5 A;  3EF8 A;  1U5O A;  3OWU A;  4O02 B;  2ML5 A;  3K5T A;  4R9L A;  3SVA A;  2CWU A;  1FGM A;  3FF0 A;  4FR9 A;  3FLJ A;  2CKF B;  3JUN A;  1WNH A;  3FG1 A;  1RJO A;  1GY6 A;  4OK0 A;  1NJI 4;  1VQ6 3;  2XFT A;  1Q81 4;  4OUQ A;  2YX9 A;  3FSD A;  3PCS A;  3CCR 3;  1FA3 A;  3OWY A;  3EC9 A;  4L8O A;  1W02 A;  2CWV A;  1DVD A;  1JB2 A;  3CXC 2;  1YVB I;  2W2C A;  1QAK A;  3WMD A;  2Y73 A;  3G8Z A;  1W7C A;  3NUV A;  3V92 A;  3CCV 3;  4N6T A;  5CF1 A;  1E3V A;  3I0Y A;  3NBJ A;  2IUJ A;  3V98 A;  1YHQ 3;  3NQZ A;  3CCM 3;  3CCQ 3;  1AV4 A;  1UUW B;  1K73 4;  2XH9 A;  2E2V A;  1DMM A;  2GU3 A;  2R4I A;  1EA2 A;  1W01 A;  3OXA A;  1G96 A;  1EG9 B;  1M1K 4;  4HM7 B;  3NX0 A;  5IEN A;  1N9J A;  2I9W A;  2Z7A A;  3OW2 2;  4IPB A;  5EEO A;  1IVX A;  2P0X A;  5IEP A;  3GZX B;  2W04 A;  1O7G B;  1HU9 A;  3NBB A;  3MG2 A;  3BNE A;  5HGR A;  1NB5 I;  4EV2 A;  1ZO2 A;  1DVC A;  2YFJ B;  3MPH A;  4HYZ A;  5EQL A;  4X2H A;  5D82 A;  2XF3 A;  3ECF A;  1E97 A;  5CLK A;  1RRL A;  4HM5 B;  1UW1 A;  4O8S A;  3CCU 3;  1YIT 3;  5FGO A;  3T0U A;  1GD4 A;  2JQ5 A;  3EE1 A;  3SLU A;  3EBY A;  1NB3 I;  2B24 B;  3LTA A;  2UX0 A;  4KFE A;  1JV2 B;  5JPP A;  3FH1 A;  3H51 A;  1VQL 3;  1GY5 A;  3IMA B;  1D6Z A;  3QRD A;  1VQ9 3;  1OHP A;  1O7N B;  4KFF A;  2YFL B;  5D83 A;  3EQQ B;  3UL5 A;  4WWU C;  3MYT A;  4U13 A;  1GY7 A;  2V1L A;  1VQ8 3;  1D6U A;  2W56 B;  3GWR A;  1VQK 3;  1ZX2 A;  2A15 A;  2CWT A;  3WA2 X;  4G1M B;  2YFI B;  4LGQ A;  5KP1 A;  3CCJ 3;  1R4C A;  2IMJ A;  4HJL B;  3FG3 A;  3GRD A;  3BNC A;  3QK9 A;  2XR8 B;  1QAL A;  4HZB B;  3K7C A;  2RCD A;  1TU5 A;  1VQ5 3;  1QAF A;  1ROV A;  3PXM A;  2CW9 A;  3SOA A;  1FGQ A;  2OTL 3;  1LNH A;  2W56 A;  4HM0 B;  4GB5 A;  1N5P A;  5IG3 A;  2P05 A;  2OTJ 3;  2WO0 A;  4L7K A;  1OHS A;  4RZM A;  1NU3 A;  1W6G A;  3WA3 A;  1RKY A;  5AIF A;  3S67 A;  1Y4K A;  4MMZ B;  1SJW A;  2ML6 A;  5IF6 A;  4L8P A;  3CPW 2;  2PNC A;  4FMD A;  1ASK A;  1IU7 A;  1HKX A;  2O9U X;  3MSO A;  1JB4 A;  3F8X A;  4HM4 B;  3CPO A;  1LXE A;  1O7P B;  1IVW A;  4HM2 B;  1FGT A;  3GZR A;  1W4N A;  4HM1 B;  2Y74 A;  2Z76 A;  3CC7 3;  2HMK B;  8CHO A;  3G0K A;  3WDG B;  1K41 A;  2O3O A;  1IV7 A;  1KQS 2;  2QGU A;  1IV9 A;  3BLZ A;  3S27 A;  3OX9 A;  3Q90 A;  3EB8 A;  3RDE A;  4IIA A;  2INX A;  4XDV A;  1Q86 4;  5AEU B;  1CYV A;  3N54 B;  1FUW A;  3B4O A;  3G16 A;  4H61 A;  1TFO A;  2L4V A;  3DGM A;  3AMO B;  3LT9 A;  3MG3 A;  4XBX A;  1WQL B;  1S5A A;  1WTH A;  3ER7 A;  3DY5 A;  4BTW A;  4JRF A;  1K8A 4;  3CCE 3;  3U97 A;  1W6Y A;  4RNZ A;  3CNX A;  1JRQ A;  3H3H A;  3U1W A;  3BB9 A;  4EYC A;  2HMN B;  4KZ1 A;  4ORL A;  3T8N A;  3PS8 A;  3AMO A;  1JNQ A;  1OH0 A;  3JUO A;  1OF5 B;  1LOX A;  3LTD A;  1ROA A;  3CMA 3;  4R4K A;  2IUK A;  3LML A;  1DMN A;  4FCZ A;  4HBR A;  2GU1 A;  4EC6 A;  3S29 A;  1GS3 A;  5AEW B;  3ALA A;  2CC3 A;  4EV5 A;  3S5C A;  1BUQ A;  4RBN A;  4HZ9 B;  1RN7 A;  3UNL A;  3MHE A;  3F8H A;  3STD A;  1AVK A;  2SBL A;  1W6C A;  3DUK A;  3WOF B;  2D1W A;  1Q40 B;  2KXG A;  3F14 A;  4HM8 B;  4CDL A;  3EJV A;  1GYB A;  2CG1 A;  2W9P A;  4CCV A;  4NHF A;  1OF5 A;  4FMC A;  2Z6B A;  1PFP A;  1A90 A;  1C7H A;  1A67 A;  3I55 3;  3CC4 3;  4N6M A;  3OV4 A;  5BXQ A;  1VQN 3;  1KWI A;  3KE7 A;  1A2V A;  1VQM 3;  4WFO A;  1VQ7 3;  4MMX B;  1OUN A;  1ISK A;  2CFD A;  4AKY A;  2HMJ B;  2RSX A;  2FXT A;  3NM7 A;  3WOD G;  2P38 A;  3LYG A;  5EVH A;  1N5H A;  3KKG A;  3Q1C A;  3LXU X;  3LT8 A;  1Q82 4;  1K28 A;  2F86 B;  2GEY A;  3M8C A;  4N6O B;  1MNL A;  3E99 A;  3F9S A;  3G71 3;  1KD1 4;  1STF I;  4TX4 A;  3B4P A;  1YJW 3;  1SIH A;  3UB1 A;  4FCJ A;  3LTC A;  4O3V A;  3HK4 A;  3ROB A;  2F99 A;  1Q7Y 4;  1FGR A;  5IG4 A;  2CH9 A;  4KFD A;  3GZY B;  4X2O A;  3HZP A;  3K63 A;  4H3U A;  3BND A;  4HKV B;  4N6L A;  3NBR A;  4I4K A;  3EN1 B;  3X3Y A;  2HML B;  2PZV A;  1YIJ 3;  5IG0 A;  3F40 A;  4FMB A;  1Q42 A;  2CFW A;  2WGO A;  4Q53 A;  2GEX A;  3JUQ A;  3RGA A;  1VQO 3;  7STD A;  1TUH A;  2C11 A;  3PGB A;  3KII A;  2E2T A;  2CFL A;  2XSH B;  4FCM A;  1OGZ A;  3D9R A;  2HMO B;  2W9Q A;  2CIU A;  1YGE A;  1W2Z A;  2CG0 A;  3B8L A;  4WHA A;  2LYX A;  3D3L A;  1W00 A;  4IT7 A;  1W5Z A;  4BTX A;  5BVB A;  4OVM A;  5ELU A;  5G2G A;  1UI7 A;  4EXR A;  6STD A;  1AR0 A;  1OAC A;  3FCS B;  2WGQ A;  1LVN A;  1N8Q A;  4HM6 B;  5CXO A;  3NV0 B;  1WMP A;  3CME 3;  4AEQ A;  4BTY A;  1S72 3;  2OCT A;  2XRX B;  2KCD A;  3CC2 3;  1VQP 3;  3NHX A;  4LEH A;  1OGX A;  3NXJ A;  1JN5 B;  2C10 A;  5AI1 A;  3EBT A;  3FKA A;  3J7Y d;  1MOL A;  1DYU A;  3LTB A;  3N8B A;  4J9A A;  2MC8 A;  1YJ9 3;  1IT8 A;  2E2U A;  4N6V 0;  4PEJ A;  2CK3 H;  2HMM B;  3L0R A;  3FZW A;  3FG4 A;  5STD A;  4K90 B;  3HI7 A;  3NV0 A;  4R9K A;  1Z1S A;  3JVC A;  2GBW B;  2GXF A;  3N9H A;  3X42 A;  1DMQ A;  3K9M C;  1O7M B;  2P0M A;  2W6J H;  4XBT A;  1EKM A;  1UI8 A;  2CHC A;  3WOE B;  3I56 3;  1JN5 A;  5TGN A;  2BO9 B;  2QA4 3;  1PU4 A;  1NDO B;  2BHM A;  2CFG A;  5JBS A;  4KVH A;  5CF2 A;  3CCS 3;  2W03 A;  2BNG A;  3EHC A;  1M1X B;  2WOH A;  3DM8 A;  4N6N B;  2XFS A;  2QEX 3;  3DZL A;  1D6Y A;  1YI2 3;  3LH4 A;  1RRH A;  3CCL 3;  3F7S A;  2IA7 A;  3KSE D;  4J8T A;  1WMO A;  2BT3 A;  3JUP A;  5JPU A;  2QIY A;  4N6U A;  1UUV B;  2FGT A;  3SED A;  1TIJ A;  2XGL A;  3O8Y A;  4K1V A;  4NRE A;  3VGN A;  4GL6 A;  3F7X A;  1V74 A;  3HII A;  5DRE A;  3FGY A;  4XM4 A;  4AKZ A;  5AYR B;  3MG1 A;  1CQS A;  4LMI A;  4ZM8 A;  3DMC A;  3VF1 A;  2LQV A;  1CYU A;  3BNB A;  1KSI A;  2CFK A;  2FNQ A;  3SX1 A;  1O7H B;  2RFR A;  3EX9 A;  5KP4 A;  3IJE B;  1L5G B;  2F98 A;  1Q40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...