1KQS2

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kqs200
1Q824 1QVF2 2QA43 3CCJ3 1VQP3 3I553 3CCM3 1K8A4 1M1K4 1KC84 1N8R4 3I563 3CPW2 1YHQ3 1Q7Y4 1QVG2 1NJI4 1VQL3 3CC73 1VQM3 1YJW3 3CXC2 1VQ93 1VQ63 3CCL3 3CME3 3CCR3 3CD63 3CCE3 2QEX3 1YI23 3CCV3 1Q864 1K9M4 3CCS3 3CMA3 3CCU3 1VQN3 2OTJ3 3G4S3 1VQK3 1YIT3 1YJN3 2OTL3 3G713 1Q814 1VQ73 3OW22 1VQ53 1YJ93 1JJ22 3G6E3 1M904 3CCQ3 1VQ43 1VQ83 1KQS2 1W2B2 3CC43 1K734 1S723 1VQO3 1KD14 1YIJ3 3CC23
chains in the Genus database with same CATH superfamily
1Q9EA 1DMMA 1RKYA 2CFLA 1TIJA 3BU4A 1RGEA 3UB1A 2OWPA 1YVBI 1R4CA 3URPA 2YFIB 1M1K4 3MPHA 3I563 1STDA 4MMZB 2LYXA 5BIRA 3CME3 2R4IA 3CCE3 1AQZA 1BOXA 2CW9A 2FXTA 1TFKA 2GBWB 1TU5A 4O02B 3CCU3 3CMA3 1CEWI 1EKMA 5AEWB 5BU4A 2W9QA 1GS3A 1LOYA 3G0KA 2E2UA 3NV0A 3NXJA 1W5ZA 5M1AA 3F9SA 1NB5I 1BNGA 1B3SA 1X1YA 3VSYA 3J7Yd 3NQYA 5CK6A 2L1SA 4GB5A 3JUOA 2K54A 4BL3A 5D83A 4ORLA 5AI1A 5CLKA 1L5GB 2AAEA 1ULJB 2RBIA 2XFSA 1NNVA 1N8R4 1BUJA 1B20A 1GMRA 1EG9B 3B8LA 3PS8A 2XGNA 2BNGA 4XBXA 5IW9A 3CPW2 3A5EA 2P05A 1I70A 1VQM3 4RNYA 3VGNA 1VQ93 1AR0A 1TUHA 4HM8B 3ZG5A 2YX9A 1B27A 3MG1A 1RSNA 3H3HA 3X3XA 2QEX3 2HMJB 1Q864 4BU4A 1PU4A 5GSPA 3D5GA 1RRLA 1BU4A 1LOXA 2P38A 2RCDA 1K41A 2QGUA 2ZA4A 4CJNA 5CF1A 2GU3A 5D81A 4FCZA 1SJWA 4HM3B 1GY7A 1MWUA 1VQO3 5IERA 3CPOA 2GSPA 2IY2A 3OWSA 4LEHA 5IG5A 4FMAA 3KFQC 2OOVC 1K28A 8CHOA 3MG3A 4O2HA 4R9KA 4X2HA 5JPPA 4KFDA 2GXFA 4IIAA 1QVG2 1ISKA 1NJI4 2OQEC 1BRKA 5BXQA 3FF2A 5ELUA 1T3BA 2CH9A 2WGQA 2XRXB 1CQSA 1RN1A 3K7CA 2OTJ3 3NBJA 1VQK3 1YJN3 2CIUA 3G713 1JKGA 2L4VA 2OCTA 4HM1B 3HIIA 1N9EA 2CWTA 1IVVA 3LTBA 4J9AA 1GOUA 3NBRA 4K90B 1W6CA 2V1LA 5IG4A 1JNQA 2ZL8A 2KF3A 2INXA 1RGGA 3CNMA 3DGOA 2F99A 4EW5A 2H0IA 7RNTA 4KZ1A 8RNTA 2BT3A 3EJVA 1FGTA 1UGHI 1B2SA 1GSPA 1UCJA 2GU1A 1KSIA 2O9UX 3DGLA 4N6LA 2STDA 1AVKA 1V58A 5M18A 1TFOA 2W04A 1OHOA 4XB5A 1GY6A 5G1LA 3EQQB 4LSOA 3CD63 2Z6BA 5I97A 1FUWA 1HKXA 2GEYA 3EX9A 1E3VA 3BLZA 3BNEA 4HM0B 1UW1A 5CXOA 1IQXA 2C11A 3IPTA 1D6YA 1UI7A 2XSOB 1F8NA 3F8HA 3OWUA 2H0HA 1TRPA 1VQ53 1A67A 1O7GB 9RNTA 3KE7A 1X1XA 4FCJA 5AIGA 2CC3A 4BTWA 1S723 1N9JA 1QALA 2YFJB 1O7MB 2CX0A 2C4BA 2RSXA 3S27A 1LQGC 2HMLB 3I0YA 1V74A 2CHCA 2Z7AA 4FMCA 3U97A 3GZRA 1YVSA 1IT8A 1RMSA 3AMOB 4HJLB 1GYBA 2MF7A 4IT7A 1GMPA 1YJ93 4KT3B 3GZBA 4AEQA 5IF6A 1YNVX 1GD4A 1MOLA 2ML5A 1DYUA 2R41A 4WWUC 4XDWA 3X42A 1GOYA 1JBTA 5LC6A 4ZM8A 2PZVA 4FCMA 4GSPA 1ZO2A 4STDA 1T5YA 3ALAA 1MNLA 1BRIA 3K9MC 1OUNA 1TRQA 2CK3H 1SARA 4RNTA 1BSDA 1IV7A 3RGAA 3S67A 4BTXA 3G8ZA 4N6MA 2P0MA 3SX1A 1KWIA 4U13A 2XFTA 1W01A 1ZX2A 2WGOA 1O7WB 4N6TA 3NHXA 3OXAA 1MWRA 3FZWA 3X3YA 3DGNA 5EEOA 1QVF2 3DH2A 3STDA 3KSED 3CCJ3 2IA7A 4HOHA 5G2GA 1VQP3 1OF5B 4HZ9B 4EYCA 2Z77A 5CF2A 5IEPA 3FG4A 4JF8A 5IENA 4XDVA 3ER7A 3FH1A 5AIFA 1CH0A 1JN5B 3AHWA 3SVAA 4HKVB 4NHFA 1FW7A 1IT7A 1ULIB 5STDA 1YGWA 4HM4B 2MC8A 1PYLA 3EN1B 1BANA 3OW22 1VQ73 2I9WA 3K5TA 5RNTA 1HU9A 4HM5B 4EV5A 4O3VA 3QK9A 1AV4A 1EUIC 1Q42A 3PXMA 3OV4A 1X1WA 2HMMB 1BSCA 3LT9A 3MYTA 2HMKB 3MWZA 3TDGA 1UUGB 3JUQA 4LMIA 4XM4A 1LNHA 2Y73A 2XF3A 2KF4A 4J5KA 1DVCA 2QIYA 1I0VA 3WOFB 4R9LA 4N6V0 1RGAA 5AYRB 1KC84 3D9RA 1QAFA 3V99A 1SQWA 4J8TA 1DMQA 2RNTA 2FGTA 1JRQA 1E97A 3DXOA 1I0XA 2O3OA 1LOVA 1RN4A 5D82A 3F14A 3NM2A 2OOVA 2LQVA 3X3ZA 3ZG0A 2CFGA 3RGRA 3F40A 4HYZA 5AEUB 2OQEA 4EC6A 2JQ5A 4KVHA 3BNCA 3AMOA 4OUQA 1O7NB 1JBRA 2P0XA 1GOVA 2Z76A 2W0QA 4GHOA 3BNBA 3LTAA 5A0OB 1O7PB 4ILFA 1I2EA 1BNJA 1WTHA 2CKFB 1IQYA 2F5MA 3AGNA 2F5WA 3NM7A 3KCHA 3HZPA 4XBYA 6GSPA 2BMRB 1IVWA 1OH0A 4EV2A 2CFDA 3LMLA 4RBNA 4MMYB 4LZIA 3RDEA 1JZOA 2KCDA 3D3LA 3FF0A 4FR9A 2FNQA 3ECFA 4R80A 1YI23 5EVHA 1QAKA 3F7SA 4QWTA 6STDA 5IG0A 1MWTA 3Q3FA 3WMDA 3G4S3 4DKIA 1U8CB 1EA2A 2SBLA 1MWSA 1NB3I 2CFKA 1M904 1KQS2 1IK3A 3FGYA 1IV9A 2Y74A 2HMOB 2IMJA 1D6ZA 1FGOA 1RN7A 5FW5A 1KD14 2W6JH 3SOAA 1OF5A 3F8XA 4FMBA 3F7XA 3NUVA 4GL6A 3D4AA 3S29A 1J2BA 5AIHA 4L7KA 1OACA 1EEJA 1I8VA 4FMDA 4TX4A 4I5QA 3GZXB 5G1KA 1LRAA 2JDIH 1QMAA 1JN5A 4I4KA 1RNBA 3KN4A 1C54A 1JB2A 2YFLB 3GAXA 3DM8A 1UCKA 1YJW3 4R1KA 2W56B 1M1XB 1WQLB 2AADA 3B4OA 3CU3A 3UNLA 1BRNL 3CCR3 2KRTA 1SIHA 4CPKA 3DMCA 3V92A 2HMNB 1BVIA 3DZLA 2OTL3 1RGHA 1OGXA 2CWUA 7GSPA 5AYSC 3X41A 3NQZA 1RTUA 1V57A 1IVUA 1B2MA 1JBSA 3AHSA 1K734 1W00A 3NV0B 3WA2X 5IG3A 1DE3A 4K61A 5DRVA 1PY3A 3CC23 2SARA 1Q824 1BRSA 1FGQA 2CFWA 3LH4A 4K1UA 2XEPA 4WHAA 1SIIA 3GSPA 3OX9A 4AKYA 4HM7B 3BIRA 4O8SA 1NWWA 1ROAA 1RLSA 1I3IA 3DY5A 3JUNA 3Q2PA 3KZTA 3CXC2 4H3UA 5AIIA 3U1WA 1BSBA 1G02A 1D6UA 1NDOB 4WP5A 1C7HA 4EBGA 1M9GA 1LQMB 1MGRA 3BB9A 1GY5A 1FUTA 3FG1A 1AY7A 1NU3A 1HZ1A 3X40A 1YIT3 1B2ZA 4OK0A 3WDGB 2IUJA 2BIRA 1PFPA 1I3FA 4BIRA 3MSOA 4JRFA 2BHMA 3A76A 2CX1A 3S28A 3CNXA 3KIIA 1BNSA 3GRDA 3MKIA 2J8XB 1Z1SA 1WMOA 3HOHA 4N6OB 2ZDJA 3IJEB 1FGRA 1BSAA 1WMNA 2XR8B 2GBXB 3LTCA 1JV2B 1ZS7A 5IEOA 1IYYA 1IQ8A 1T2HA 3M8CA 1STFI 4CCVA 4XBTA 1MGWA 2H0GA 3KKGA 1LXEA 1W02A 3CCS3 1VQQA 3MG2A 1Q814 3O8YA 3EBTA 3Q90A 1US1A 3L0RA 1JZDA 4L8OA 1RDSA 1S5AA 1TJDA 6RNTA 1GD3A 3LYGA 2WOFA 2PNCA 1N5HA 4RNZA 3WA3A 4L8PA 1GMQA 1BNFA 1BNIA 2W56A 1ZGXA 1RHLA 3B4PA 5JPUA 2XH9A 4PEJA 1Q7Y4 1R4YA 4NPBA 1CYVA 3N8BA 3D5IA 3CC73 2E2TA 1G0TA 2F4YA 4N3VA 1W6YA 1BNRA 1O7HB 1TTOA 1U5OA 2XGLA 3T0UA 2ZHXB 3AGOA 2B24B 4J5GA 1BNEA 1YGEA 4OVMA 1FZUA 3CCQ3 1X1UA 5LC7A 1UGIA 2HOHA 3FKAA 3IMAB 4HAAA 1YIJ3 1W7CA 3EF8A 3EN8A 3OWYA 4HM6B 3JVCA 1OPYA 3GWRA 1OCVA 1LNIA 1Y4KA 2W2CA 2W03A 3CCM3 1BAOA 2CG1A 1WNHA 4BL2A 3UL5A 3SLUA 1LVNA 5KP4A 1B2UA 3EC9A 2Q07A 2RFRA 3LT8A 2W9PA 4MEIA 1VZZA 2ML6A 1G96A 2BU4A 3PGBA 3T8NA 3UJMA 1UI8A 4R4KA 1BRHA 2B1XB 3JUPA 5DREA 3DGMA 3FCSB 3GZYB 4WYKB 1JJ22 3G6E3 4WFOA 3E99A 2CG0A 3S5CA 1TP6A 4HZBB 1OHSA 2C10A 2UGIA 4NREA 3PZWA 5M19A 3MHEA 1A90A 1FA3A 1OHPA 5HGRA 3LOYA 1BUQA 1Q40B 3PCSA 1IDPA 1NO3A 2KAAA 3FSDA 3D79A 3SXXA 1DETA 3K63A 1HYFA 3I553 2P09A 1RCLA 1W6GA 1RNTA 1A2KA 2KF6A 3DGYA 1A2VA 1DVDA 1RGKA 1ASKA 3CCL3 3FG3A 3PCRA 1A2PA 4LGQA 1UCIA 2F56A 1RRHA 3EBYA 3CCV3 2UX0A 3N9HA 3SOYA 1BIRA 3K0ZA 2F86B 1WMPA 2WO0A 3KSPA 1UUVB 4LYLB 1BRJA 1VQ43 3NBBA 1VQ83 5ELJA 3CC43 4Q53A 3WODG 1RJOA 3WOEB 5BVBA 1FYSA 2BO9B 2IYJA 4MMXB 2BMQB 3EE1A 4MJDA 3N54B 2QA43 3EHCA 3SYUA 3JUMA 3LTDA 4BTYA 4HBRA 3PYJA 1K8A4 4CDLA 4HM2B 1N8QA 1CYUA 3G16A 1YHQ3 3LXUX 1EQKA 1VQL3 1W4NA 1VQ63 2A15A 3BNDA 2CWVA 1BGSA 1K9M4 4X2OA 5JBSA 2D1WA 1LOWA 2E2VA 3ZFZA 1DMNA 1W2ZA 1VQN3 3WR2A 3DUKA 3NX0A 1B21A 1RGCA 1RGFA 2UUGC 3H51A 5KP1A 1AVLA 4EXRA 2KF5A 1I2GA 3HX8A 4AKZA 1BSEA 1I2FA 3EB8A 1IVXA 3UL6A 4N6NB 4K1VA 4N6UA 5KP3A 3V98A 4H61A 1OGZA 1UCLA 1IU7A 2K0MA 3VF1A 1JB5A 1RCKA 3HI7A 4IPBA 1T2IA 3B7CA 1B2XA 1SPUA 1UUWB 2IUKA 1ROVA 3RNTA 1N5PA 4KFEA 1Q7HA 1JB4A 4KFFA 4WYKA 5HOHA 2WOHA 3HK4A 2KXGA 3QRDA 3WHOA 2BMOB 2K3DA 4RZMA 1BRGA 1FGMA 2GEXA 5EQLA 3ROBA 3SEDA 7STDA 1FUSA 2F98A 1Q40A 5FGOA 1UDII 2XSHB 2D42A 3FLJA 5TGNA 3LZAA 4HVNA 1RGLA 3HIGA 1W2B2 1E3RA 1QJGA 1JKGB 4G1MB 3T8UA 2RGQA 2M7OA 3Q1CA
chains in the Genus database with same CATH topology
1DMMA 1RKYA 2CFLA 1TIJA 3UB1A 2OWPA 1YVBI 1R4CA 2YFIB 1M1K4 3MPHA 3I563 1STDA 4MMZB 2LYXA 3CME3 2R4IA 3CCE3 2CW9A 2FXTA 1TFKA 2GBWB 1TU5A 4O02B 3CCU3 3CMA3 1CEWI 1EKMA 5AEWB 2W9QA 1GS3A 3G0KA 2E2UA 3NV0A 3NXJA 1W5ZA 3F9SA 1NB5I 3VSYA 3J7Yd 3NQYA 5CK6A 4GB5A 3JUOA 2K54A 5D83A 4ORLA 5AI1A 5CLKA 1L5GB 1ULJB 2XFSA 1N8R4 5IW9A 3PS8A 1EG9B 3B8LA 4XBXA 2XGNA 2BNGA 3CPW2 1VQM3 1VQ93 2P05A 4RNYA 3VGNA 1AR0A 1TUHA 4HM8B 2YX9A 3MG1A 2QEX3 3H3HA 3X3XA 1Q864 2HMJB 1PU4A 1RRLA 1LOXA 2P38A 2RCDA 1K41A 2QGUA 5CF1A 1YJ93 2GU3A 5D81A 4FCZA 1SJWA 4HM3B 1GY7A 1VQO3 5IERA 3CPOA 4LEHA 3OWSA 5IG5A 4FMAA 3KFQC 2OOVC 1K28A 8CHOA 3MG3A 4O2HA 4R9KA 4X2HA 5JPPA 4KFDA 2GXFA 4IIAA 1QVG2 1ISKA 1NJI4 2OQEC 5BXQA 3FF2A 5ELUA 2CH9A 2WGQA 2XRXB 1CQSA 3K7CA 2OTJ3 3NBJA 1VQK3 1YJN3 2CIUA 3G713 1JKGA 2L4VA 2OCTA 4HM1B 3HIIA 1N9EA 2CWTA 1IVVA 3LTBA 4J9AA 3NBRA 4K90B 1W6CA 2V1LA 5IG4A 1JNQA 2ZL8A 2INXA 3CNMA 3DGOA 2F99A 4KZ1A 2BT3A 3EJVA 1FGTA 2GU1A 1KSIA 2O9UX 3DGLA 4N6LA 2STDA 1AVKA 1TFOA 2W04A 1OHOA 4XB5A 1GY6A 3EQQB 4LSOA 3CD63 2Z6BA 5I97A 1FUWA 1HKXA 2GEYA 3EX9A 1E3VA 3BLZA 3BNEA 4HM0B 1UW1A 5CXOA 1IQXA 2C11A 3IPTA 2XSOB 1D6YA 1UI7A 1F8NA 3F8HA 3OWUA 1VQ53 1A67A 1O7GB 3KE7A 5AIGA 4FCJA 2CC3A 4BTWA 1S723 1N9JA 1QALA 2YFJB 1O7MB 2RSXA 3S27A 2HMLB 3I0YA 1V74A 2CHCA 2Z7AA 4FMCA 3U97A 3GZRA 1IT8A 4HJLB 3AMOB 4IT7A 1GYBA 2MF7A 3GZBA 4AEQA 5IF6A 3X42A 1GD4A 1MOLA 2ML5A 1DYUA 4WWUC 4XDWA 5LC6A 4ZM8A 2PZVA 4FCMA 1ZO2A 4STDA 1T5YA 3ALAA 1MNLA 3K9MC 1OUNA 2CK3H 3RGAA 4BTXA 3S67A 1IV7A 3G8ZA 4N6MA 2P0MA 3SX1A 1KWIA 4U13A 2XFTA 1W01A 1ZX2A 2WGOA 1O7WB 4N6TA 3NHXA 3OXAA 3FZWA 3X3YA 3DGNA 5EEOA 1QVF2 3STDA 3KSED 3CCJ3 2IA7A 5G2GA 1VQP3 1OF5B 4HZ9B 4EYCA 2Z77A 5CF2A 5IEPA 3FG4A 4JF8A 5IENA 4XDVA 3ER7A 3FH1A 5AIFA 1JN5B 3SVAA 4HKVB 4NHFA 1IT7A 1ULIB 5STDA 4HM4B 2MC8A 3EN1B 1VQ73 3OW22 2I9WA 3K5TA 1HU9A 4HM5B 4EV5A 4O3VA 3QK9A 1AV4A 1Q42A 3PXMA 3OV4A 2HMMB 3MYTA 3LT9A 2HMKB 3MWZA 3TDGA 4XM4A 3JUQA 4LMIA 1LNHA 2Y73A 2XF3A 1DVCA 2QIYA 3WOFB 4R9LA 4N6V0 5AYRB 1KC84 3D9RA 1QAFA 3V99A 1SQWA 4J8TA 1DMQA 2FGTA 1JRQA 1E97A 3DXOA 2O3OA 5D82A 3F14A 3NM2A 2OOVA 2LQVA 3X3ZA 2CFGA 3RGRA 3F40A 4HYZA 5AEUB 2OQEA 4EC6A 2JQ5A 4KVHA 3BNCA 3AMOA 4OUQA 1O7NB 2P0XA 2Z76A 2W0QA 3BNBA 3LTAA 5A0OB 1O7PB 1WTHA 2CKFB 1IQYA 3NM7A 3HZPA 4XBYA 2BMRB 1IVWA 1OH0A 4EV2A 2CFDA 3LMLA 4RBNA 4MMYB 4LZIA 3RDEA 2KCDA 3D3LA 3FF0A 4FR9A 2FNQA 3ECFA 4R80A 1YI23 5EVHA 1QAKA 3F7SA 4QWTA 6STDA 5IG0A 3G4S3 3WMDA 1U8CB 1EA2A 2SBLA 2CFKA 1NB3I 1M904 1KQS2 1IK3A 3FGYA 1IV9A 2Y74A 2HMOB 2IMJA 1D6ZA 1FGOA 1RN7A 5FW5A 1KD14 2W6JH 3SOAA 1OF5A 3F8XA 4FMBA 3F7XA 3NUVA 4GL6A 3S29A 1J2BA 5AIHA 4L7KA 1OACA 4FMDA 4TX4A 3GZXB 2JDIH 1QMAA 1JN5A 4I4KA 3KN4A 1JB2A 2YFLB 3GAXA 3DM8A 1YJW3 4R1KA 2W56B 1M1XB 1WQLB 3B4OA 3CU3A 3UNLA 3CCR3 2KRTA 1SIHA 3DMCA 3V92A 2HMNB 3DZLA 2OTL3 1OGXA 2CWUA 5AYSC 3X41A 3NQZA 1IVUA 1K734 1W00A 3NV0B 3WA2X 5IG3A 4K61A 5DRVA 3CC23 1Q824 1FGQA 2CFWA 3LH4A 4K1UA 2XEPA 4WHAA 1SIIA 4AKYA 3OX9A 4HM7B 4O8SA 1NWWA 1ROAA 3DY5A 3JUNA 3Q2PA 3KZTA 3CXC2 4H3UA 5AIIA 3U1WA 4WP5A 1D6UA 1NDOB 1C7HA 4EBGA 1M9GA 3BB9A 1GY5A 3FG1A 1YIT3 1NU3A 3X40A 4OK0A 3WDGB 2IUJA 1PFPA 3MSOA 4JRFA 2BHMA 3A76A 3S28A 3CNXA 3KIIA 3GRDA 3MKIA 1Z1SA 1WMOA 4N6OB 2ZDJA 3IJEB 1FGRA 3LTCA 1WMNA 2XR8B 2GBXB 5IEOA 1JV2B 1IQ8A 3M8CA 1STFI 4CCVA 4XBTA 3KKGA 1LXEA 1W02A 3CCS3 3MG2A 1Q814 3O8YA 3EBTA 3Q90A 1US1A 3L0RA 4L8OA 1S5AA 1GD3A 3LYGA 2WOFA 2PNCA 1N5HA 4RNZA 3WA3A 4L8PA 2W56A 3B4PA 5JPUA 2XH9A 4PEJA 1Q7Y4 1CYVA 3N8BA 3CC73 2E2TA 4N3VA 1W6YA 1O7HB 1U5OA 2XGLA 3T0UA 2B24B 1YGEA 4OVMA 3CCQ3 5LC7A 3FKAA 3IMAB 1YIJ3 1W7CA 3EF8A 3EN8A 3OWYA 4HM6B 3JVCA 1OPYA 3GWRA 1OCVA 2W2CA 1Y4KA 2W03A 3CCM3 2CG1A 1WNHA 3UL5A 3SLUA 1LVNA 5KP4A 3EC9A 2Q07A 2RFRA 3LT8A 2W9PA 4MEIA 1VZZA 2ML6A 1G96A 3PGBA 3T8NA 3UJMA 1UI8A 4R4KA 2B1XB 3JUPA 5DREA 3DGMA 3FCSB 3GZYB 4WYKB 1JJ22 3G6E3 4WFOA 3E99A 2CG0A 3S5CA 1TP6A 4HZBB 1OHSA 2C10A 4NREA 3PZWA 1A90A 3MHEA 1FA3A 1OHPA 5HGRA 3LOYA 1BUQA 1Q40B 3PCSA 1IDPA 1NO3A 3FSDA 3SXXA 3K63A 3I553 2P09A 1W6GA 1A2KA 1A2VA 1DVDA 1ASKA 3CCL3 3FG3A 3PCRA 4LGQA 3EBYA 1RRHA 3CCV3 2UX0A 3N9HA 3SOYA 3K0ZA 2F86B 1WMPA 2WO0A 3KSPA 1UUVB 1VQ83 1VQ43 3NBBA 5ELJA 3CC43 4Q53A 3WODG 1RJOA 3WOEB 5BVBA 2BO9B 4MMXB 2BMQB 3EE1A 4MJDA 3N54B 2QA43 3EHCA 3JUMA 3LTDA 4BTYA 4HBRA 3PYJA 1K8A4 4CDLA 4HM2B 1N8QA 1CYUA 3G16A 1YHQ3 3LXUX 1EQKA 1VQL3 1W4NA 1VQ63 2A15A 3BNDA 2CWVA 1K9M4 4X2OA 5JBSA 2D1WA 2E2VA 1VQN3 1DMNA 1W2ZA 3DUKA 3NX0A 3H51A 5KP1A 1AVLA 4EXRA 3HX8A 4AKZA 3UL6A 3EB8A 1IVXA 4N6NB 4K1VA 4N6UA 5KP3A 3V98A 4H61A 1OGZA 1IU7A 2K0MA 3VF1A 1JB5A 3HI7A 4IPBA 3B7CA 1SPUA 1UUWB 2IUKA 1ROVA 1N5PA 4KFEA 1JB4A 4KFFA 4WYKA 2WOHA 3HK4A 2KXGA 3QRDA 2BMOB 4RZMA 1FGMA 5EQLA 2GEXA 3ROBA 3SEDA 7STDA 2F98A 1Q40A 5FGOA 2XSHB 5TGNA 2D42A 3FLJA 1W2B2 3LZAA 4HVNA 3HIGA 1E3RA 1QJGA 1JKGB 4G1MB 3T8UA 2RGQA 2M7OA 3Q1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 4;  1QVF 2;  2QA4 3;  3CCJ 3;  1VQP 3;  3I55 3;  3CCM 3;  1K8A 4;  1M1K 4;  1KC8 4;  1N8R 4;  3I56 3;  3CPW 2;  1YHQ 3;  1Q7Y 4;  1QVG 2;  1NJI 4;  1VQL 3;  3CC7 3;  1VQM 3;  1YJW 3;  3CXC 2;  1VQ9 3;  1VQ6 3;  3CCL 3;  3CME 3;  3CCR 3;  3CD6 3;  3CCE 3;  2QEX 3;  1YI2 3;  3CCV 3;  1Q86 4;  1K9M 4;  3CCS 3;  3CMA 3;  3CCU 3;  1VQN 3;  2OTJ 3;  3G4S 3;  1VQK 3;  1YIT 3;  1YJN 3;  2OTL 3;  3G71 3;  1Q81 4;  1VQ7 3;  3OW2 2;  1VQ5 3;  1YJ9 3;  1JJ2 2;  3G6E 3;  1M90 4;  3CCQ 3;  1VQ4 3;  1VQ8 3;  1KQS 2;  1W2B 2;  3CC4 3;  1K73 4;  1S72 3;  1VQO 3;  1KD1 4;  1YIJ 3;  3CC2 3; 
#chains in the Genus database with same CATH topology
 1Q9E A;  1DMM A;  1RKY A;  2CFL A;  1TIJ A;  3BU4 A;  1RGE A;  3UB1 A;  2OWP A;  1YVB I;  1R4C A;  3URP A;  2YFI B;  1M1K 4;  3MPH A;  3I56 3;  1STD A;  4MMZ B;  2LYX A;  5BIR A;  3CME 3;  2R4I A;  3CCE 3;  1AQZ A;  1BOX A;  2CW9 A;  2FXT A;  1TFK A;  2GBW B;  1TU5 A;  4O02 B;  3CCU 3;  3CMA 3;  1CEW I;  1EKM A;  5AEW B;  5BU4 A;  2W9Q A;  1GS3 A;  1LOY A;  3G0K A;  2E2U A;  3NV0 A;  3NXJ A;  1W5Z A;  5M1A A;  3F9S A;  1NB5 I;  1BNG A;  1B3S A;  1X1Y A;  3VSY A;  3J7Y d;  3NQY A;  5CK6 A;  2L1S A;  4GB5 A;  3JUO A;  2K54 A;  4BL3 A;  5D83 A;  4ORL A;  5AI1 A;  5CLK A;  1L5G B;  2AAE A;  1ULJ B;  2RBI A;  2XFS A;  1NNV A;  1N8R 4;  1BUJ A;  1B20 A;  1GMR A;  1EG9 B;  3B8L A;  3PS8 A;  2XGN A;  2BNG A;  4XBX A;  5IW9 A;  3CPW 2;  3A5E A;  2P05 A;  1I70 A;  1VQM 3;  4RNY A;  3VGN A;  1VQ9 3;  1AR0 A;  1TUH A;  4HM8 B;  3ZG5 A;  2YX9 A;  1B27 A;  3MG1 A;  1RSN A;  3H3H A;  3X3X A;  2QEX 3;  2HMJ B;  1Q86 4;  4BU4 A;  1PU4 A;  5GSP A;  3D5G A;  1RRL A;  1BU4 A;  1LOX A;  2P38 A;  2RCD A;  1K41 A;  2QGU A;  2ZA4 A;  4CJN A;  5CF1 A;  2GU3 A;  5D81 A;  4FCZ A;  1SJW A;  4HM3 B;  1GY7 A;  1MWU A;  1VQO 3;  5IER A;  3CPO A;  2GSP A;  2IY2 A;  3OWS A;  4LEH A;  5IG5 A;  4FMA A;  3KFQ C;  2OOV C;  1K28 A;  8CHO A;  3MG3 A;  4O2H A;  4R9K A;  4X2H A;  5JPP A;  4KFD A;  2GXF A;  4IIA A;  1QVG 2;  1ISK A;  1NJI 4;  2OQE C;  1BRK A;  5BXQ A;  3FF2 A;  5ELU A;  1T3B A;  2CH9 A;  2WGQ A;  2XRX B;  1CQS A;  1RN1 A;  3K7C A;  2OTJ 3;  3NBJ A;  1VQK 3;  1YJN 3;  2CIU A;  3G71 3;  1JKG A;  2L4V A;  2OCT A;  4HM1 B;  3HII A;  1N9E A;  2CWT A;  1IVV A;  3LTB A;  4J9A A;  1GOU A;  3NBR A;  4K90 B;  1W6C A;  2V1L A;  5IG4 A;  1JNQ A;  2ZL8 A;  2KF3 A;  2INX A;  1RGG A;  3CNM A;  3DGO A;  2F99 A;  4EW5 A;  2H0I A;  7RNT A;  4KZ1 A;  8RNT A;  2BT3 A;  3EJV A;  1FGT A;  1UGH I;  1B2S A;  1GSP A;  1UCJ A;  2GU1 A;  1KSI A;  2O9U X;  3DGL A;  4N6L A;  2STD A;  1AVK A;  1V58 A;  5M18 A;  1TFO A;  2W04 A;  1OHO A;  4XB5 A;  1GY6 A;  5G1L A;  3EQQ B;  4LSO A;  3CD6 3;  2Z6B A;  5I97 A;  1FUW A;  1HKX A;  2GEY A;  3EX9 A;  1E3V A;  3BLZ A;  3BNE A;  4HM0 B;  1UW1 A;  5CXO A;  1IQX A;  2C11 A;  3IPT A;  1D6Y A;  1UI7 A;  2XSO B;  1F8N A;  3F8H A;  3OWU A;  2H0H A;  1TRP A;  1VQ5 3;  1A67 A;  1O7G B;  9RNT A;  3KE7 A;  1X1X A;  4FCJ A;  5AIG A;  2CC3 A;  4BTW A;  1S72 3;  1N9J A;  1QAL A;  2YFJ B;  1O7M B;  2CX0 A;  2C4B A;  2RSX A;  3S27 A;  1LQG C;  2HML B;  3I0Y A;  1V74 A;  2CHC A;  2Z7A A;  4FMC A;  3U97 A;  3GZR A;  1YVS A;  1IT8 A;  1RMS A;  3AMO B;  4HJL B;  1GYB A;  2MF7 A;  4IT7 A;  1GMP A;  1YJ9 3;  4KT3 B;  3GZB A;  4AEQ A;  5IF6 A;  1YNV X;  1GD4 A;  1MOL A;  2ML5 A;  1DYU A;  2R41 A;  4WWU C;  4XDW A;  3X42 A;  1GOY A;  1JBT A;  5LC6 A;  4ZM8 A;  2PZV A;  4FCM A;  4GSP A;  1ZO2 A;  4STD A;  1T5Y A;  3ALA A;  1MNL A;  1BRI A;  3K9M C;  1OUN A;  1TRQ A;  2CK3 H;  1SAR A;  4RNT A;  1BSD A;  1IV7 A;  3RGA A;  3S67 A;  4BTX A;  3G8Z A;  4N6M A;  2P0M A;  3SX1 A;  1KWI A;  4U13 A;  2XFT A;  1W01 A;  1ZX2 A;  2WGO A;  1O7W B;  4N6T A;  3NHX A;  3OXA A;  1MWR A;  3FZW A;  3X3Y A;  3DGN A;  5EEO A;  1QVF 2;  3DH2 A;  3STD A;  3KSE D;  3CCJ 3;  2IA7 A;  4HOH A;  5G2G A;  1VQP 3;  1OF5 B;  4HZ9 B;  4EYC A;  2Z77 A;  5CF2 A;  5IEP A;  3FG4 A;  4JF8 A;  5IEN A;  4XDV A;  3ER7 A;  3FH1 A;  5AIF A;  1CH0 A;  1JN5 B;  3AHW A;  3SVA A;  4HKV B;  4NHF A;  1FW7 A;  1IT7 A;  1ULI B;  5STD A;  1YGW A;  4HM4 B;  2MC8 A;  1PYL A;  3EN1 B;  1BAN A;  3OW2 2;  1VQ7 3;  2I9W A;  3K5T A;  5RNT A;  1HU9 A;  4HM5 B;  4EV5 A;  4O3V A;  3QK9 A;  1AV4 A;  1EUI C;  1Q42 A;  3PXM A;  3OV4 A;  1X1W A;  2HMM B;  1BSC A;  3LT9 A;  3MYT A;  2HMK B;  3MWZ A;  3TDG A;  1UUG B;  3JUQ A;  4LMI A;  4XM4 A;  1LNH A;  2Y73 A;  2XF3 A;  2KF4 A;  4J5K A;  1DVC A;  2QIY A;  1I0V A;  3WOF B;  4R9L A;  4N6V 0;  1RGA A;  5AYR B;  1KC8 4;  3D9R A;  1QAF A;  3V99 A;  1SQW A;  4J8T A;  1DMQ A;  2RNT A;  2FGT A;  1JRQ A;  1E97 A;  3DXO A;  1I0X A;  2O3O A;  1LOV A;  1RN4 A;  5D82 A;  3F14 A;  3NM2 A;  2OOV A;  2LQV A;  3X3Z A;  3ZG0 A;  2CFG A;  3RGR A;  3F40 A;  4HYZ A;  5AEU B;  2OQE A;  4EC6 A;  2JQ5 A;  4KVH A;  3BNC A;  3AMO A;  4OUQ A;  1O7N B;  1JBR A;  2P0X A;  1GOV A;  2Z76 A;  2W0Q A;  4GHO A;  3BNB A;  3LTA A;  5A0O B;  1O7P B;  4ILF A;  1I2E A;  1BNJ A;  1WTH A;  2CKF B;  1IQY A;  2F5M A;  3AGN A;  2F5W A;  3NM7 A;  3KCH A;  3HZP A;  4XBY A;  6GSP A;  2BMR B;  1IVW A;  1OH0 A;  4EV2 A;  2CFD A;  3LML A;  4RBN A;  4MMY B;  4LZI A;  3RDE A;  1JZO A;  2KCD A;  3D3L A;  3FF0 A;  4FR9 A;  2FNQ A;  3ECF A;  4R80 A;  1YI2 3;  5EVH A;  1QAK A;  3F7S A;  4QWT A;  6STD A;  5IG0 A;  1MWT A;  3Q3F A;  3WMD A;  3G4S 3;  4DKI A;  1U8C B;  1EA2 A;  2SBL A;  1MWS A;  1NB3 I;  2CFK A;  1M90 4;  1KQS 2;  1IK3 A;  3FGY A;  1IV9 A;  2Y74 A;  2HMO B;  2IMJ A;  1D6Z A;  1FGO A;  1RN7 A;  5FW5 A;  1KD1 4;  2W6J H;  3SOA A;  1OF5 A;  3F8X A;  4FMB A;  3F7X A;  3NUV A;  4GL6 A;  3D4A A;  3S29 A;  1J2B A;  5AIH A;  4L7K A;  1OAC A;  1EEJ A;  1I8V A;  4FMD A;  4TX4 A;  4I5Q A;  3GZX B;  5G1K A;  1LRA A;  2JDI H;  1QMA A;  1JN5 A;  4I4K A;  1RNB A;  3KN4 A;  1C54 A;  1JB2 A;  2YFL B;  3GAX A;  3DM8 A;  1UCK A;  1YJW 3;  4R1K A;  2W56 B;  1M1X B;  1WQL B;  2AAD A;  3B4O A;  3CU3 A;  3UNL A;  1BRN L;  3CCR 3;  2KRT A;  1SIH A;  4CPK A;  3DMC A;  3V92 A;  2HMN B;  1BVI A;  3DZL A;  2OTL 3;  1RGH A;  1OGX A;  2CWU A;  7GSP A;  5AYS C;  3X41 A;  3NQZ A;  1RTU A;  1V57 A;  1IVU A;  1B2M A;  1JBS A;  3AHS A;  1K73 4;  1W00 A;  3NV0 B;  3WA2 X;  5IG3 A;  1DE3 A;  4K61 A;  5DRV A;  1PY3 A;  3CC2 3;  2SAR A;  1Q82 4;  1BRS A;  1FGQ A;  2CFW A;  3LH4 A;  4K1U A;  2XEP A;  4WHA A;  1SII A;  3GSP A;  3OX9 A;  4AKY A;  4HM7 B;  3BIR A;  4O8S A;  1NWW A;  1ROA A;  1RLS A;  1I3I A;  3DY5 A;  3JUN A;  3Q2P A;  3KZT A;  3CXC 2;  4H3U A;  5AII A;  3U1W A;  1BSB A;  1G02 A;  1D6U A;  1NDO B;  4WP5 A;  1C7H A;  4EBG A;  1M9G A;  1LQM B;  1MGR A;  3BB9 A;  1GY5 A;  1FUT A;  3FG1 A;  1AY7 A;  1NU3 A;  1HZ1 A;  3X40 A;  1YIT 3;  1B2Z A;  4OK0 A;  3WDG B;  2IUJ A;  2BIR A;  1PFP A;  1I3F A;  4BIR A;  3MSO A;  4JRF A;  2BHM A;  3A76 A;  2CX1 A;  3S28 A;  3CNX A;  3KII A;  1BNS A;  3GRD A;  3MKI A;  2J8X B;  1Z1S A;  1WMO A;  3HOH A;  4N6O B;  2ZDJ A;  3IJE B;  1FGR A;  1BSA A;  1WMN A;  2XR8 B;  2GBX B;  3LTC A;  1JV2 B;  1ZS7 A;  5IEO A;  1IYY A;  1IQ8 A;  1T2H A;  3M8C A;  1STF I;  4CCV A;  4XBT A;  1MGW A;  2H0G A;  3KKG A;  1LXE A;  1W02 A;  3CCS 3;  1VQQ A;  3MG2 A;  1Q81 4;  3O8Y A;  3EBT A;  3Q90 A;  1US1 A;  3L0R A;  1JZD A;  4L8O A;  1RDS A;  1S5A A;  1TJD A;  6RNT A;  1GD3 A;  3LYG A;  2WOF A;  2PNC A;  1N5H A;  4RNZ A;  3WA3 A;  4L8P A;  1GMQ A;  1BNF A;  1BNI A;  2W56 A;  1ZGX A;  1RHL A;  3B4P A;  5JPU A;  2XH9 A;  4PEJ A;  1Q7Y 4;  1R4Y A;  4NPB A;  1CYV A;  3N8B A;  3D5I A;  3CC7 3;  2E2T A;  1G0T A;  2F4Y A;  4N3V A;  1W6Y A;  1BNR A;  1O7H B;  1TTO A;  1U5O A;  2XGL A;  3T0U A;  2ZHX B;  3AGO A;  2B24 B;  4J5G A;  1BNE A;  1YGE A;  4OVM A;  1FZU A;  3CCQ 3;  1X1U A;  5LC7 A;  1UGI A;  2HOH A;  3FKA A;  3IMA B;  4HAA A;  1YIJ 3;  1W7C A;  3EF8 A;  3EN8 A;  3OWY A;  4HM6 B;  3JVC A;  1OPY A;  3GWR A;  1OCV A;  1LNI A;  1Y4K A;  2W2C A;  2W03 A;  3CCM 3;  1BAO A;  2CG1 A;  1WNH A;  4BL2 A;  3UL5 A;  3SLU A;  1LVN A;  5KP4 A;  1B2U A;  3EC9 A;  2Q07 A;  2RFR A;  3LT8 A;  2W9P A;  4MEI A;  1VZZ A;  2ML6 A;  1G96 A;  2BU4 A;  3PGB A;  3T8N A;  3UJM A;  1UI8 A;  4R4K A;  1BRH A;  2B1X B;  3JUP A;  5DRE A;  3DGM A;  3FCS B;  3GZY B;  4WYK B;  1JJ2 2;  3G6E 3;  4WFO A;  3E99 A;  2CG0 A;  3S5C A;  1TP6 A;  4HZB B;  1OHS A;  2C10 A;  2UGI A;  4NRE A;  3PZW A;  5M19 A;  3MHE A;  1A90 A;  1FA3 A;  1OHP A;  5HGR A;  3LOY A;  1BUQ A;  1Q40 B;  3PCS A;  1IDP A;  1NO3 A;  2KAA A;  3FSD A;  3D79 A;  3SXX A;  1DET A;  3K63 A;  1HYF A;  3I55 3;  2P09 A;  1RCL A;  1W6G A;  1RNT A;  1A2K A;  2KF6 A;  3DGY A;  1A2V A;  1DVD A;  1RGK A;  1ASK A;  3CCL 3;  3FG3 A;  3PCR A;  1A2P A;  4LGQ A;  1UCI A;  2F56 A;  1RRH A;  3EBY A;  3CCV 3;  2UX0 A;  3N9H A;  3SOY A;  1BIR A;  3K0Z A;  2F86 B;  1WMP A;  2WO0 A;  3KSP A;  1UUV B;  4LYL B;  1BRJ A;  1VQ4 3;  3NBB A;  1VQ8 3;  5ELJ A;  3CC4 3;  4Q53 A;  3WOD G;  1RJO A;  3WOE B;  5BVB A;  1FYS A;  2BO9 B;  2IYJ A;  4MMX B;  2BMQ B;  3EE1 A;  4MJD A;  3N54 B;  2QA4 3;  3EHC A;  3SYU A;  3JUM A;  3LTD A;  4BTY A;  4HBR A;  3PYJ A;  1K8A 4;  4CDL A;  4HM2 B;  1N8Q A;  1CYU A;  3G16 A;  1YHQ 3;  3LXU X;  1EQK A;  1VQL 3;  1W4N A;  1VQ6 3;  2A15 A;  3BND A;  2CWV A;  1BGS A;  1K9M 4;  4X2O A;  5JBS A;  2D1W A;  1LOW A;  2E2V A;  3ZFZ A;  1DMN A;  1W2Z A;  1VQN 3;  3WR2 A;  3DUK A;  3NX0 A;  1B21 A;  1RGC A;  1RGF A;  2UUG C;  3H51 A;  5KP1 A;  1AVL A;  4EXR A;  2KF5 A;  1I2G A;  3HX8 A;  4AKZ A;  1BSE A;  1I2F A;  3EB8 A;  1IVX A;  3UL6 A;  4N6N B;  4K1V A;  4N6U A;  5KP3 A;  3V98 A;  4H61 A;  1OGZ A;  1UCL A;  1IU7 A;  2K0M A;  3VF1 A;  1JB5 A;  1RCK A;  3HI7 A;  4IPB A;  1T2I A;  3B7C A;  1B2X A;  1SPU A;  1UUW B;  2IUK A;  1ROV A;  3RNT A;  1N5P A;  4KFE A;  1Q7H A;  1JB4 A;  4KFF A;  4WYK A;  5HOH A;  2WOH A;  3HK4 A;  2KXG A;  3QRD A;  3WHO A;  2BMO B;  2K3D A;  4RZM A;  1BRG A;  1FGM A;  2GEX A;  5EQL A;  3ROB A;  3SED A;  7STD A;  1FUS A;  2F98 A;  1Q40 A;  5FGO A;  1UDI I;  2XSH B;  2D42 A;  3FLJ A;  5TGN A;  3LZA A;  4HVN A;  1RGL A;  3HIG A;  1W2B 2;  1E3R A;  1QJG A;  1JKG B;  4G1M B;  3T8U A;  2RGQ A;  2M7O A;  3Q1C A; 
#chains in the Genus database with same CATH homology
 1DMM A;  1RKY A;  2CFL A;  1TIJ A;  3UB1 A;  2OWP A;  1YVB I;  1R4C A;  2YFI B;  1M1K 4;  3MPH A;  3I56 3;  1STD A;  4MMZ B;  2LYX A;  3CME 3;  2R4I A;  3CCE 3;  2CW9 A;  2FXT A;  1TFK A;  2GBW B;  1TU5 A;  4O02 B;  3CCU 3;  3CMA 3;  1CEW I;  1EKM A;  5AEW B;  2W9Q A;  1GS3 A;  3G0K A;  2E2U A;  3NV0 A;  3NXJ A;  1W5Z A;  3F9S A;  1NB5 I;  3VSY A;  3J7Y d;  3NQY A;  5CK6 A;  4GB5 A;  3JUO A;  2K54 A;  5D83 A;  4ORL A;  5AI1 A;  5CLK A;  1L5G B;  1ULJ B;  2XFS A;  1N8R 4;  5IW9 A;  3PS8 A;  1EG9 B;  3B8L A;  4XBX A;  2XGN A;  2BNG A;  3CPW 2;  1VQM 3;  1VQ9 3;  2P05 A;  4RNY A;  3VGN A;  1AR0 A;  1TUH A;  4HM8 B;  2YX9 A;  3MG1 A;  2QEX 3;  3H3H A;  3X3X A;  1Q86 4;  2HMJ B;  1PU4 A;  1RRL A;  1LOX A;  2P38 A;  2RCD A;  1K41 A;  2QGU A;  5CF1 A;  1YJ9 3;  2GU3 A;  5D81 A;  4FCZ A;  1SJW A;  4HM3 B;  1GY7 A;  1VQO 3;  5IER A;  3CPO A;  4LEH A;  3OWS A;  5IG5 A;  4FMA A;  3KFQ C;  2OOV C;  1K28 A;  8CHO A;  3MG3 A;  4O2H A;  4R9K A;  4X2H A;  5JPP A;  4KFD A;  2GXF A;  4IIA A;  1QVG 2;  1ISK A;  1NJI 4;  2OQE C;  5BXQ A;  3FF2 A;  5ELU A;  2CH9 A;  2WGQ A;  2XRX B;  1CQS A;  3K7C A;  2OTJ 3;  3NBJ A;  1VQK 3;  1YJN 3;  2CIU A;  3G71 3;  1JKG A;  2L4V A;  2OCT A;  4HM1 B;  3HII A;  1N9E A;  2CWT A;  1IVV A;  3LTB A;  4J9A A;  3NBR A;  4K90 B;  1W6C A;  2V1L A;  5IG4 A;  1JNQ A;  2ZL8 A;  2INX A;  3CNM A;  3DGO A;  2F99 A;  4KZ1 A;  2BT3 A;  3EJV A;  1FGT A;  2GU1 A;  1KSI A;  2O9U X;  3DGL A;  4N6L A;  2STD A;  1AVK A;  1TFO A;  2W04 A;  1OHO A;  4XB5 A;  1GY6 A;  3EQQ B;  4LSO A;  3CD6 3;  2Z6B A;  5I97 A;  1FUW A;  1HKX A;  2GEY A;  3EX9 A;  1E3V A;  3BLZ A;  3BNE A;  4HM0 B;  1UW1 A;  5CXO A;  1IQX A;  2C11 A;  3IPT A;  2XSO B;  1D6Y A;  1UI7 A;  1F8N A;  3F8H A;  3OWU A;  1VQ5 3;  1A67 A;  1O7G B;  3KE7 A;  5AIG A;  4FCJ A;  2CC3 A;  4BTW A;  1S72 3;  1N9J A;  1QAL A;  2YFJ B;  1O7M B;  2RSX A;  3S27 A;  2HML B;  3I0Y A;  1V74 A;  2CHC A;  2Z7A A;  4FMC A;  3U97 A;  3GZR A;  1IT8 A;  4HJL B;  3AMO B;  4IT7 A;  1GYB A;  2MF7 A;  3GZB A;  4AEQ A;  5IF6 A;  3X42 A;  1GD4 A;  1MOL A;  2ML5 A;  1DYU A;  4WWU C;  4XDW A;  5LC6 A;  4ZM8 A;  2PZV A;  4FCM A;  1ZO2 A;  4STD A;  1T5Y A;  3ALA A;  1MNL A;  3K9M C;  1OUN A;  2CK3 H;  3RGA A;  4BTX A;  3S67 A;  1IV7 A;  3G8Z A;  4N6M A;  2P0M A;  3SX1 A;  1KWI A;  4U13 A;  2XFT A;  1W01 A;  1ZX2 A;  2WGO A;  1O7W B;  4N6T A;  3NHX A;  3OXA A;  3FZW A;  3X3Y A;  3DGN A;  5EEO A;  1QVF 2;  3STD A;  3KSE D;  3CCJ 3;  2IA7 A;  5G2G A;  1VQP 3;  1OF5 B;  4HZ9 B;  4EYC A;  2Z77 A;  5CF2 A;  5IEP A;  3FG4 A;  4JF8 A;  5IEN A;  4XDV A;  3ER7 A;  3FH1 A;  5AIF A;  1JN5 B;  3SVA A;  4HKV B;  4NHF A;  1IT7 A;  1ULI B;  5STD A;  4HM4 B;  2MC8 A;  3EN1 B;  1VQ7 3;  3OW2 2;  2I9W A;  3K5T A;  1HU9 A;  4HM5 B;  4EV5 A;  4O3V A;  3QK9 A;  1AV4 A;  1Q42 A;  3PXM A;  3OV4 A;  2HMM B;  3MYT A;  3LT9 A;  2HMK B;  3MWZ A;  3TDG A;  4XM4 A;  3JUQ A;  4LMI A;  1LNH A;  2Y73 A;  2XF3 A;  1DVC A;  2QIY A;  3WOF B;  4R9L A;  4N6V 0;  5AYR B;  1KC8 4;  3D9R A;  1QAF A;  3V99 A;  1SQW A;  4J8T A;  1DMQ A;  2FGT A;  1JRQ A;  1E97 A;  3DXO A;  2O3O A;  5D82 A;  3F14 A;  3NM2 A;  2OOV A;  2LQV A;  3X3Z A;  2CFG A;  3RGR A;  3F40 A;  4HYZ A;  5AEU B;  2OQE A;  4EC6 A;  2JQ5 A;  4KVH A;  3BNC A;  3AMO A;  4OUQ A;  1O7N B;  2P0X A;  2Z76 A;  2W0Q A;  3BNB A;  3LTA A;  5A0O B;  1O7P B;  1WTH A;  2CKF B;  1IQY A;  3NM7 A;  3HZP A;  4XBY A;  2BMR B;  1IVW A;  1OH0 A;  4EV2 A;  2CFD A;  3LML A;  4RBN A;  4MMY B;  4LZI A;  3RDE A;  2KCD A;  3D3L A;  3FF0 A;  4FR9 A;  2FNQ A;  3ECF A;  4R80 A;  1YI2 3;  5EVH A;  1QAK A;  3F7S A;  4QWT A;  6STD A;  5IG0 A;  3G4S 3;  3WMD A;  1U8C B;  1EA2 A;  2SBL A;  2CFK A;  1NB3 I;  1M90 4;  1KQS 2;  1IK3 A;  3FGY A;  1IV9 A;  2Y74 A;  2HMO B;  2IMJ A;  1D6Z A;  1FGO A;  1RN7 A;  5FW5 A;  1KD1 4;  2W6J H;  3SOA A;  1OF5 A;  3F8X A;  4FMB A;  3F7X A;  3NUV A;  4GL6 A;  3S29 A;  1J2B A;  5AIH A;  4L7K A;  1OAC A;  4FMD A;  4TX4 A;  3GZX B;  2JDI H;  1QMA A;  1JN5 A;  4I4K A;  3KN4 A;  1JB2 A;  2YFL B;  3GAX A;  3DM8 A;  1YJW 3;  4R1K A;  2W56 B;  1M1X B;  1WQL B;  3B4O A;  3CU3 A;  3UNL A;  3CCR 3;  2KRT A;  1SIH A;  3DMC A;  3V92 A;  2HMN B;  3DZL A;  2OTL 3;  1OGX A;  2CWU A;  5AYS C;  3X41 A;  3NQZ A;  1IVU A;  1K73 4;  1W00 A;  3NV0 B;  3WA2 X;  5IG3 A;  4K61 A;  5DRV A;  3CC2 3;  1Q82 4;  1FGQ A;  2CFW A;  3LH4 A;  4K1U A;  2XEP A;  4WHA A;  1SII A;  4AKY A;  3OX9 A;  4HM7 B;  4O8S A;  1NWW A;  1ROA A;  3DY5 A;  3JUN A;  3Q2P A;  3KZT A;  3CXC 2;  4H3U A;  5AII A;  3U1W A;  4WP5 A;  1D6U A;  1NDO B;  1C7H A;  4EBG A;  1M9G A;  3BB9 A;  1GY5 A;  3FG1 A;  1YIT 3;  1NU3 A;  3X40 A;  4OK0 A;  3WDG B;  2IUJ A;  1PFP A;  3MSO A;  4JRF A;  2BHM A;  3A76 A;  3S28 A;  3CNX A;  3KII A;  3GRD A;  3MKI A;  1Z1S A;  1WMO A;  4N6O B;  2ZDJ A;  3IJE B;  1FGR A;  3LTC A;  1WMN A;  2XR8 B;  2GBX B;  5IEO A;  1JV2 B;  1IQ8 A;  3M8C A;  1STF I;  4CCV A;  4XBT A;  3KKG A;  1LXE A;  1W02 A;  3CCS 3;  3MG2 A;  1Q81 4;  3O8Y A;  3EBT A;  3Q90 A;  1US1 A;  3L0R A;  4L8O A;  1S5A A;  1GD3 A;  3LYG A;  2WOF A;  2PNC A;  1N5H A;  4RNZ A;  3WA3 A;  4L8P A;  2W56 A;  3B4P A;  5JPU A;  2XH9 A;  4PEJ A;  1Q7Y 4;  1CYV A;  3N8B A;  3CC7 3;  2E2T A;  4N3V A;  1W6Y A;  1O7H B;  1U5O A;  2XGL A;  3T0U A;  2B24 B;  1YGE A;  4OVM A;  3CCQ 3;  5LC7 A;  3FKA A;  3IMA B;  1YIJ 3;  1W7C A;  3EF8 A;  3EN8 A;  3OWY A;  4HM6 B;  3JVC A;  1OPY A;  3GWR A;  1OCV A;  2W2C A;  1Y4K A;  2W03 A;  3CCM 3;  2CG1 A;  1WNH A;  3UL5 A;  3SLU A;  1LVN A;  5KP4 A;  3EC9 A;  2Q07 A;  2RFR A;  3LT8 A;  2W9P A;  4MEI A;  1VZZ A;  2ML6 A;  1G96 A;  3PGB A;  3T8N A;  3UJM A;  1UI8 A;  4R4K A;  2B1X B;  3JUP A;  5DRE A;  3DGM A;  3FCS B;  3GZY B;  4WYK B;  1JJ2 2;  3G6E 3;  4WFO A;  3E99 A;  2CG0 A;  3S5C A;  1TP6 A;  4HZB B;  1OHS A;  2C10 A;  4NRE A;  3PZW A;  1A90 A;  3MHE A;  1FA3 A;  1OHP A;  5HGR A;  3LOY A;  1BUQ A;  1Q40 B;  3PCS A;  1IDP A;  1NO3 A;  3FSD A;  3SXX A;  3K63 A;  3I55 3;  2P09 A;  1W6G A;  1A2K A;  1A2V A;  1DVD A;  1ASK A;  3CCL 3;  3FG3 A;  3PCR A;  4LGQ A;  3EBY A;  1RRH A;  3CCV 3;  2UX0 A;  3N9H A;  3SOY A;  3K0Z A;  2F86 B;  1WMP A;  2WO0 A;  3KSP A;  1UUV B;  1VQ8 3;  1VQ4 3;  3NBB A;  5ELJ A;  3CC4 3;  4Q53 A;  3WOD G;  1RJO A;  3WOE B;  5BVB A;  2BO9 B;  4MMX B;  2BMQ B;  3EE1 A;  4MJD A;  3N54 B;  2QA4 3;  3EHC A;  3JUM A;  3LTD A;  4BTY A;  4HBR A;  3PYJ A;  1K8A 4;  4CDL A;  4HM2 B;  1N8Q A;  1CYU A;  3G16 A;  1YHQ 3;  3LXU X;  1EQK A;  1VQL 3;  1W4N A;  1VQ6 3;  2A15 A;  3BND A;  2CWV A;  1K9M 4;  4X2O A;  5JBS A;  2D1W A;  2E2V A;  1VQN 3;  1DMN A;  1W2Z A;  3DUK A;  3NX0 A;  3H51 A;  5KP1 A;  1AVL A;  4EXR A;  3HX8 A;  4AKZ A;  3UL6 A;  3EB8 A;  1IVX A;  4N6N B;  4K1V A;  4N6U A;  5KP3 A;  3V98 A;  4H61 A;  1OGZ A;  1IU7 A;  2K0M A;  3VF1 A;  1JB5 A;  3HI7 A;  4IPB A;  3B7C A;  1SPU A;  1UUW B;  2IUK A;  1ROV A;  1N5P A;  4KFE A;  1JB4 A;  4KFF A;  4WYK A;  2WOH A;  3HK4 A;  2KXG A;  3QRD A;  2BMO B;  4RZM A;  1FGM A;  5EQL A;  2GEX A;  3ROB A;  3SED A;  7STD A;  2F98 A;  1Q40 A;  5FGO A;  2XSH B;  5TGN A;  2D42 A;  3FLJ A;  1W2B 2;  3LZA A;  4HVN A;  3HIG A;  1E3R A;  1QJG A;  1JKG B;  4G1M B;  3T8U A;  2RGQ A;  2M7O A;  3Q1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...