1KQS2

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kqs200
2QEX3 1KC84 3I553 1K9M4 1M1K4 3CXC2 1YIJ3 1YJW3 1N8R4 1VQL3 1K734 3CCR3 3CCE3 3CCJ3 1VQ93 2QA43 3CCS3 3CPW2 3CCV3 1S723 1YIT3 1VQK3 1W2B2 1Q864 3G4S3 1YJ93 1JJ22 1YHQ3 1YI23 1K8A4 3CCU3 1VQ73 1VQM3 1QVG2 3G6E3 1KQS2 2OTL3 3CCM3 3OW22 3I563 1Q814 3CC43 3CC73 3CCQ3 3CCL3 1VQ83 1VQ43 1VQ63 1Q7Y4 1YJN3 1Q824 3CME3 3CC23 1VQ53 2OTJ3 1QVF2 1NJI4 3CD63 1VQN3 1M904 1KD14 1VQP3 3CMA3 1VQO3 3G713
chains in the Genus database with same CATH superfamily
1NNVA 1TFKA 1JBTA 1LVNA 1Q7HA 1SIHA 4KVHA 5IG0A 3CXC2 3B8LA 2XFSA 3JUPA 3LTBA 3WODG 1YVSA 3LTCA 1QALA 5M1AA 3X3XA 1ULJB 1YIT3 1I0XA 4N6V0 3PZWA 3EF8A 3BB9A 1YGWA 3DGLA 1AV4A 1JZOA 2MF7A 3EBTA 5ELUA 1EQKA 3PYJA 5ELJA 1ISKA 3FH1A 2F5WA 3HK4A 4KFFA 3DGYA 1KSIA 1NO3A 3IMAB 1Q7Y4 1PFPA 5FW5A 1N5HA 1QAKA 3QK9A 4GSPA 2CIUA 1DMNA 2KAAA 1QVF2 1L5GB 5CF1A 1NJI4 4J5KA 4XBYA 1UW1A 3FG4A 3G16A 5IG5A 1RN4A 1ZS7A 6RNTA 2J8XB 1VQL3 2BT3A 3AGNA 3CCR3 2I9WA 3GWRA 1BRJA 2ZHXB 3B4PA 3HI7A 1E3VA 1WMNA 1STFI 2HMLB 1GY5A 1TP6A 1G96A 1V57A 3MKIA 1A67A 3GZRA 2K3DA 1JBSA 1RNBA 1RGCA 3CCM3 2OCTA 1S5AA 1K41A 5KP4A 1W00A 1OHOA 5RNTA 3PCRA 1EA2A 1Q9EA 5D81A 1FGQA 1A90A 3NQYA 1W6CA 3NUVA 1RRHA 1TTOA 1WNHA 1A2KA 3S28A 3SOYA 1VQN3 2OQEA 4RBNA 3H3HA 2GXFA 3CMA3 1U8CB 5I97A 3KSPA 3I553 2UUGC 3Q1CA 3EN8A 1GY7A 1D6ZA 3LTAA 1IK3A 1RGFA 2D1WA 9RNTA 2KF4A 1W7CA 1BGSA 5CLKA 5AIGA 4BL3A 1JJ22 3SOAA 1B27A 1W2ZA 4RNYA 3DUKA 3STDA 4FCMA 1IVXA 4N6UA 1BAOA 8RNTA 1UGIA 4LSOA 1RRLA 1GOUA 3UJMA 1KQS2 1I70A 3UNLA 3ALAA 4RNTA 1RMSA 1YVBI 4G1MB 1GYBA 1HYFA 3BNBA 1BSEA 1YGEA 3DMCA 5AYSC 1GMRA 1N9JA 1FUTA 2KXGA 3WOFB 4AEQA 2SARA 1BNGA 1MWTA 5G1LA 1CEWI 1UI7A 2CWUA 2BU4A 1RGAA 1IT7A 1TIJA 2L1SA 1OCVA 1BSCA 3F8XA 5TGNA 2A15A 3V99A 1T2IA 2KCDA 5IERA 3CCV3 1I2FA 1TFOA 4N6TA 1I8VA 1Z1SA 2ML6A 3MHEA 1OHSA 1YI23 1VZZA 3GZBA 1QVG2 1OHPA 2LQVA 4HM3B 4R9KA 5M19A 5A0OB 2CX0A 3FG3A 1VQ63 3D5IA 1GY6A 1N8QA 5IW9A 1KWIA 1MWUA 1BSAA 3CNMA 3SLUA 4FCJA 3CME3 1DVCA 1X1UA 4IT7A 1UUGB 2KF3A 3A5EA 4NHFA 3BIRA 1D6YA 1MGWA 3WA3A 3FCSB 3NM7A 1NWWA 4WWUC 1FW7A 3MSOA 3G713 1MGRA 1TRPA 4XBTA 3RGRA 1F8NA 2HMNB 3N8BA 1O7PB 3ECFA 3X3YA 3F7XA 4HAAA 5STDA 1K734 1IQ8A 1E3RA 1I2GA 1Q42A 4I4KA 4LYLB 2CFKA 1S723 3HIGA 4ORLA 1AVLA 2W03A 1Q864 1FUWA 2JDIH 3SVAA 3MG2A 1BRIA 2STDA 4WFOA 1GOYA 3T8NA 3CCU3 2OTL3 1MWRA 1VQ83 4AKZA 4DKIA 1CYVA 4J5GA 1RSNA 2ZDJA 4XDWA 2CFWA 4WP5A 3HX8A 2QGUA 2WOFA 4K1VA 4EV5A 3CU3A 2M7OA 3CC23 3DH2A 5AIHA 2B24B 2XH9A 1JB5A 3JUMA 1M904 1LOXA 2WOHA 4XBXA 1VQO3 3D79A 2PNCA 5JBSA 1J2BA 1ZGXA 3UL6A 2CFGA 1W02A 2BMRB 3X41A 1EG9B 1B21A 2PZVA 4FMBA 4FMAA 2CHCA 5BXQA 3LH4A 2W2CA 1YJ93 2IUKA 3CNXA 2O3OA 1BRSA 4K1UA 4IIAA 3FLJA 2W0QA 3BNEA 3EE1A 3BU4A 2XGLA 3KIIA 4O2HA 3E99A 2CWVA 3HOHA 2HMMB 4OK0A 2W6JH 1Q824 1BSBA 4BTYA 2F5MA 2FNQA 1LXEA 2ZL8A 1JKGA 5IENA 1FGTA 1BVIA 5DRVA 4BIRA 2F99A 3MPHA 1MOLA 1O7HB 1FYSA 1DMMA 4EV2A 5LC7A 3JUQA 2W56A 3MG3A 4BL2A 1ROAA 1RJOA 3CCJ3 1VQ93 1V58A 3CPW2 2E2TA 3HIIA 2OOVA 1CQSA 1TUHA 4HVNA 3K7CA 4EYCA 1UI8A 1E97A 3DY5A 1N5PA 2CW9A 1B2MA 1AY7A 3LTDA 5BU4A 3D5GA 1JB2A 4RZMA 3N54B 3GSPA 2YFLB 2WGQA 3OWSA 3QRDA 2YX9A 3X40A 1PY3A 7STDA 1Y4KA 4HYZA 2GEXA 1ROVA 2YFJB 3K9MC 3IJEB 1VQ53 1M1XB 1N9EA 2F4YA 1U5OA 1TRQA 3Q3FA 2SBLA 4TX4A 3SYUA 3SEDA 1OF5A 3NX0A 1VQP3 1OGZA 2KF5A 4K61A 4HBRA 5AIIA 5D82A 1FZUA 1US1A 5IF6A 1N8R4 2BMOB 2W56B 3IPTA 1BANA 1DYUA 4HZ9B 2F98A 2QA43 3K0ZA 4R1KA 4LEHA 3M8CA 5IG3A 2FGTA 5JPPA 2W9PA 4MMZB 4BTWA 1IV9A 1G0TA 1NDOB 3LZAA 4LMIA 4N6OB 4EBGA 1OACA 4HM6B 3NM2A 1JN5A 5BIRA 2W9QA 3S29A 1C7HA 3G6E3 1Q814 1VQ43 3L0RA 2QIYA 5AEUB 1BRNL 1B2SA 1AR0A 2L4VA 3LYGA 3NHXA 3SXXA 1RCLA 3GZXB 1TU5A 3AMOA 3WR2A 1IDPA 5AIFA 2RSXA 5HGRA 1GMQA 1X1WA 1A2PA 3B7CA 3LOYA 3S67A 5M18A 2XRXB 3G8ZA 7RNTA 4CDLA 1I3FA 1BRHA 5JPUA 1BNEA 1R4CA 1O7WB 1W5ZA 2BO9B 2XF3A 3JVCA 3OWUA 3NBJA 4JRFA 3CCE3 2Z6BA 4R80A 1RN1A 1LOVA 1AQZA 2IY2A 1LRAA 3F40A 2Z76A 4NREA 1SQWA 1BNRA 4O8SA 1FUSA 2AAEA 3ER7A 3FGYA 1JZDA 4J8TA 4Q53A 2IUJA 3GAXA 4HM5B 4KT3B 1VQM3 4FMCA 1BUJA 2BMQB 4HOHA 1M9GA 3MWZA 3NXJA 2RCDA 2H0IA 1UUVB 1OF5B 1WTHA 3FZWA 1W6YA 3I0YA 3F9SA 2CWTA 5GSPA 5CF2A 1HKXA 1K28A 1TJDA 3CPOA 4QWTA 4L7KA 3LMLA 2HMJB 2BNGA 2F86B 3HZPA 1KC84 2XGNA 1PU4A 2RBIA 3OXAA 4MMYB 1FGOA 1RCKA 3NBRA 1BOXA 1O7GB 4MJDA 3LT9A 2XEPA 3X42A 1RN7A 2CG1A 3AHWA 3OX9A 2HOHA 2GU1A 6STDA 3J7Yd 3G4S3 1WQLB 4O3VA 4STDA 1JBRA 3KKGA 1K8A4 1FGMA 3D3LA 2Q07A 4R4KA 4WYKB 2AADA 3D9RA 4FCZA 1BNSA 1I3IA 2GSPA 3O8YA 4HKVB 4HM4B 4PEJA 2E2VA 4XM4A 1HZ1A 2ZA4A 1MWSA 1JRQA 2CK3H 1DMQA 1HU9A 3SX1A 2OTJ3 3UL5A 4CJNA 1D6UA 3ZG5A 1KD14 1EEJA 2XSOB 4BTXA 3MYTA 1DVDA 3DM8A 4LGQA 1FGRA 1RGGA 2QEX3 1K9M4 1Q40A 3F7SA 1B3SA 4MEIA 4EC6A 5CXOA 1BUQA 4HM2B 3G0KA 3MG1A 5KP1A 4N3VA 2BHMA 1EKMA 3BLZA 1UCIA 1W2B2 3UB1A 2Z7AA 3K63A 3PXMA 4JF8A 3GZYB 2INXA 5EVHA 2H0HA 4K90B 3T8UA 4KFDA 1BRKA 4HM0B 4J9AA 2C4BA 4FR9A 1SARA 2IMJA 2CC3A 3EQQB 3I563 3CCL3 3WMDA 3S5CA 2Y73A 4GHOA 1UGHI 1OPYA 2XFTA 1JB4A 3B4OA 4KZ1A 8CHOA 3EX9A 5LC6A 3NV0B 1IU7A 2IA7A 4WHAA 1B2UA 1R4YA 3EBYA 2WO0A 5EQLA 1JNQA 3FKAA 4LZIA 4HM8B 6GSPA 2GBWB 2CFLA 4WYKA 1VQQA 3RNTA 4MMXB 5AI1A 4H3UA 2XSHB 4H61A 3EJVA 1BNFA 4ILFA 4N6NB 2H0GA 3F14A 3GRDA 5EEOA 1IVVA 1BU4A 2W04A 4O02B 2UX0A 2RNTA 4U13A 3CC73 3PGBA 5IEPA 1IVUA 4EW5A 1RLSA 2V1LA 3FF0A 1BIRA 2JQ5A 5DREA 2D42A 1IT8A 1X1XA 3FF2A 3WOEB 2RFRA 4HZBB 1CH0A 2Z77A 3AHSA 3NV0A 4NPBA 4L8PA 1IQYA 1Q40B 1EUIC 2K0MA 1JV2B 3EC9A 1SPUA 2C10A 2WGOA 3DGOA 4X2OA 2B1XB 2MC8A 3NQZA 4KFEA 1JN5B 1RGLA 2CX1A 1WMOA 2IYJA 2KF6A 1T2HA 3KFQC 1GD3A 2KRTA 3DGNA 1BNJA 4FMDA 1YHQ3 1IYYA 1LOWA 3DXOA 2OWPA 4X2HA 3WA2X 1OGXA 2GBXB 3U97A 1OUNA 3H51A 1GD4A 1DE3A 1RGKA 1QAFA 2HMKB 3T0UA 1LOYA 4EXRA 4N6LA 1YJN3 3DGMA 4N6MA 1B2XA 1O7MB 4HM1B 1ZO2A 3KCHA 1BRGA 3A76A 1ZX2A 4IPBA 1RHLA 1UCLA 1GOVA 3NBBA 3AGOA 1UDII 1QJGA 2LYXA 3DZLA 3VGNA 3KZTA 1RGHA 1OH0A 1B2ZA 1GS3A 3ZFZA 5FGOA 1SJWA 1W4NA 1I2EA 5G2GA 1T5YA 1ASKA 3RDEA 2P0XA 3TDGA 2OQEC 2HMOB 3BNDA 3VSYA 3K5TA 1VQ73 3FG1A 3WDGB 1JKGB 4BU4A 3CC43 5D83A 1O7NB 5AEWB 3WHOA 5IG4A 3FSDA 2R41A 3X3ZA 4GB5A 7GSPA 1ULIB 2P0MA 1YNVX 4ZM8A 1PYLA 2UGIA 3PS8A 5KP3A 3PCSA 1V74A 4XB5A 1DETA 2CFDA 3LXUX 5G1KA 3ZG0A 2ML5A 1BNIA 1M1K4 1YIJ3 2BIRA 1GMPA 1I0VA 1W6GA 5CK6A 3VF1A 3JUOA 5HOHA 1NU3A 1MNLA 3OWYA 1FA3A 2E2UA 5IEOA 3KE7A 1VQK3 2CKFB 2CH9A 4HJLB 2R4IA 3KSED 4HM7B 1QMAA 1C54A 1GSPA 3EN1B 3N9HA 2RGQA 1RKYA 1RTUA 1UCJA 3OW22 4CCVA 3CCQ3 3D4AA 3V92A 1LNIA 4OUQA 3Q90A 1STDA 2O9UX 2P05A 1RDSA 1RNTA 1A2VA 4I5QA 2C11A 2P09A 2Y74A 1LQMB 1NB5I 1X1YA 4AKYA 1NB3I 3EB8A 2K54A 1IQXA 4L8OA 1LNHA 4R9LA 2XR8B 3KN4A 1YJW3 3V98A 3Q2PA 5BVBA 1G02A 3LT8A 3U1WA 3RGAA 3CCS3 4XDVA 4GL6A 2CG0A 1UCKA 4OVMA 3OV4A 3F8HA 1CYUA 1T3BA 2GU3A 1AVKA 3EHCA 1SIIA 3AMOB 1WMPA 1BSDA 3S27A 2P38A 1RGEA 1IV7A 2YFIB 2FXTA 3BNCA 2F56A 1LQGC 1IVWA 2OOVC 2GEYA 3JUNA 3CD63 1UUWB 4CPKA 5AYRB 1W01A 1B20A 4RNZA 3URPA 3ROBA
chains in the Genus database with same CATH topology
1TFKA 1LVNA 1SIHA 4KVHA 5IG0A 3CXC2 3B8LA 2XFSA 3JUPA 3LTBA 3WODG 3LTCA 1QALA 3X3XA 1ULJB 1YIT3 4N6V0 3PZWA 3EF8A 3BB9A 3DGLA 1AV4A 2MF7A 3EBTA 5ELUA 1EQKA 3PYJA 5ELJA 1ISKA 3FH1A 4KFFA 3HK4A 1KSIA 1NO3A 3IMAB 1Q7Y4 1PFPA 5FW5A 1N5HA 1QAKA 3QK9A 2CIUA 1DMNA 1QVF2 1L5GB 5CF1A 1NJI4 4XBYA 1UW1A 3FG4A 3G16A 5IG5A 1VQL3 2BT3A 3CCR3 2I9WA 3GWRA 3B4PA 3HI7A 1E3VA 1WMNA 1STFI 2HMLB 1GY5A 1TP6A 1G96A 3MKIA 1A67A 3GZRA 3CCM3 2OCTA 1S5AA 1K41A 5KP4A 1W00A 1OHOA 3PCRA 1EA2A 5D81A 1FGQA 1A90A 3NQYA 1W6CA 3NUVA 1RRHA 1WNHA 1A2KA 3S28A 3SOYA 1VQN3 2OQEA 4RBNA 3H3HA 2GXFA 3CMA3 1U8CB 5I97A 3KSPA 3I553 3Q1CA 3EN8A 1GY7A 1D6ZA 3LTAA 1IK3A 2D1WA 1W7CA 5CLKA 5AIGA 1JJ22 3SOAA 1W2ZA 4RNYA 3DUKA 3STDA 4FCMA 1IVXA 4N6UA 4LSOA 1RRLA 3UJMA 1KQS2 3UNLA 3ALAA 1YVBI 4G1MB 1GYBA 3BNBA 5AYSC 1YGEA 3DMCA 1N9JA 3WOFB 2KXGA 4AEQA 1CEWI 1UI7A 2CWUA 1IT7A 1TIJA 1OCVA 3F8XA 5TGNA 2A15A 3V99A 2KCDA 5IERA 3CCV3 1TFOA 4N6TA 1Z1SA 2ML6A 3MHEA 1OHSA 1YI23 1VZZA 3GZBA 1QVG2 1OHPA 2LQVA 4HM3B 4R9KA 5A0OB 3FG3A 1VQ63 1GY6A 1N8QA 5IW9A 1KWIA 3CNMA 3SLUA 4FCJA 3CME3 1DVCA 4IT7A 4NHFA 1D6YA 3WA3A 3FCSB 3NM7A 1NWWA 4WWUC 3MSOA 3G713 4XBTA 3RGRA 1F8NA 2HMNB 3N8BA 1O7PB 3ECFA 3X3YA 3F7XA 5STDA 1K734 1IQ8A 1E3RA 1Q42A 4I4KA 2CFKA 1S723 3HIGA 4ORLA 1AVLA 2W03A 1Q864 1FUWA 2JDIH 3SVAA 3MG2A 2STDA 4WFOA 3CCU3 3T8NA 2OTL3 1VQ83 4AKZA 1CYVA 4XDWA 2ZDJA 2CFWA 4WP5A 3HX8A 2QGUA 2WOFA 4K1VA 4EV5A 3CU3A 2M7OA 3CC23 5AIHA 2B24B 2XH9A 1JB5A 3JUMA 1M904 1LOXA 2WOHA 4XBXA 1VQO3 2PNCA 5JBSA 1J2BA 3UL6A 2CFGA 1W02A 2BMRB 3X41A 1EG9B 2PZVA 4FMBA 4FMAA 2CHCA 5BXQA 3LH4A 2W2CA 1YJ93 2IUKA 3CNXA 2O3OA 4K1UA 4IIAA 3FLJA 2W0QA 3BNEA 3EE1A 2XGLA 3KIIA 4O2HA 3E99A 2CWVA 2HMMB 4OK0A 2W6JH 1Q824 4BTYA 2FNQA 1LXEA 2ZL8A 1JKGA 5IENA 1FGTA 5DRVA 2F99A 3MPHA 1MOLA 1O7HB 1DMMA 4EV2A 5LC7A 3JUQA 2W56A 3MG3A 1ROAA 1RJOA 3CCJ3 1VQ93 3CPW2 2E2TA 3HIIA 2OOVA 1CQSA 1TUHA 4HVNA 3K7CA 4EYCA 1UI8A 1E97A 3DY5A 1N5PA 2CW9A 3LTDA 1JB2A 4RZMA 3N54B 3X40A 2YFLB 2WGQA 3OWSA 3QRDA 2YX9A 7STDA 1Y4KA 4HYZA 2GEXA 1ROVA 2YFJB 3K9MC 3IJEB 1VQ53 1M1XB 1N9EA 1U5OA 4TX4A 2SBLA 3SEDA 1OF5A 3NX0A 1VQP3 1OGZA 4K61A 4HBRA 5AIIA 5D82A 1US1A 5IF6A 1N8R4 2BMOB 2W56B 3IPTA 4HZ9B 1DYUA 2F98A 2QA43 3K0ZA 4R1KA 4LEHA 3M8CA 5IG3A 2FGTA 5JPPA 2W9PA 4MMZB 4BTWA 1IV9A 1NDOB 3LZAA 4LMIA 4N6OB 4EBGA 1OACA 4HM6B 3NM2A 1JN5A 2W9QA 3S29A 1C7HA 3G6E3 1Q814 1VQ43 3L0RA 2QIYA 5AEUB 1AR0A 2L4VA 3LYGA 3NHXA 3SXXA 3GZXB 1TU5A 3AMOA 1IDPA 5AIFA 2RSXA 5HGRA 3B7CA 3LOYA 3S67A 2XRXB 3G8ZA 4CDLA 5JPUA 1R4CA 1W5ZA 1O7WB 2BO9B 2XF3A 3JVCA 3OWUA 3CCE3 3NBJA 4JRFA 2Z6BA 4R80A 3F40A 2Z76A 4NREA 1SQWA 4O8SA 3ER7A 3FGYA 4J8TA 2IUJA 4Q53A 3GAXA 4HM5B 1VQM3 4FMCA 2BMQB 1M9GA 3MWZA 3NXJA 2RCDA 1UUVB 1OF5B 1WTHA 3FZWA 1W6YA 3I0YA 3F9SA 2CWTA 5CF2A 1HKXA 1K28A 3CPOA 4QWTA 4L7KA 3LMLA 2HMJB 2BNGA 2F86B 3HZPA 1KC84 2XGNA 1PU4A 4MMYB 3OXAA 1FGOA 3NBRA 1O7GB 4MJDA 3LT9A 2XEPA 3X42A 1RN7A 2CG1A 3OX9A 3J7Yd 2GU1A 6STDA 3G4S3 1WQLB 4O3VA 4STDA 3KKGA 1K8A4 1FGMA 3D3LA 2Q07A 4R4KA 4WYKB 3D9RA 4FCZA 3O8YA 4HKVB 4HM4B 4PEJA 2E2VA 4XM4A 1JRQA 2CK3H 1DMQA 1HU9A 3SX1A 2OTJ3 3UL5A 1D6UA 1KD14 2XSOB 4BTXA 3MYTA 1DVDA 3DM8A 4LGQA 1FGRA 2QEX3 1K9M4 1BUQA 1Q40A 3F7SA 4MEIA 4EC6A 5CXOA 4HM2B 3G0KA 3MG1A 5KP1A 4N3VA 2BHMA 1EKMA 3BLZA 1W2B2 3UB1A 2Z7AA 3K63A 3PXMA 4JF8A 3GZYB 2INXA 5EVHA 4K90B 3T8UA 4KFDA 4HM0B 4J9AA 4FR9A 2IMJA 3I563 2CC3A 3EQQB 3CCL3 3WMDA 3S5CA 2Y73A 1OPYA 2XFTA 1JB4A 3B4OA 4KZ1A 8CHOA 3EX9A 5LC6A 3NV0B 1IU7A 2IA7A 4WHAA 3EBYA 2WO0A 5EQLA 1JNQA 3FKAA 4LZIA 4HM8B 2GBWB 2CFLA 4WYKA 4MMXB 5AI1A 4H3UA 2XSHB 4H61A 3EJVA 4N6NB 3F14A 3GRDA 5EEOA 1IVVA 2W04A 4O02B 2UX0A 4U13A 3CC73 3PGBA 5IEPA 1IVUA 2V1LA 3FF0A 2JQ5A 5DREA 2D42A 1IT8A 3FF2A 3WOEB 2RFRA 4HZBB 2Z77A 3NV0A 4L8PA 1IQYA 2K0MA 1Q40B 1JV2B 3EC9A 1SPUA 2C10A 2WGOA 3DGOA 4X2OA 2B1XB 2MC8A 3NQZA 4KFEA 1JN5B 1WMOA 3KFQC 1GD3A 2KRTA 3DGNA 4FMDA 1YHQ3 3DXOA 2OWPA 4X2HA 3WA2X 1OGXA 2GBXB 3U97A 1OUNA 3H51A 1GD4A 1QAFA 2HMKB 3T0UA 4EXRA 1YJN3 4N6LA 3DGMA 4N6MA 1O7MB 4HM1B 1ZO2A 3A76A 1ZX2A 4IPBA 3NBBA 1QJGA 2LYXA 3DZLA 3VGNA 3KZTA 1OH0A 1GS3A 5FGOA 1SJWA 1W4NA 5G2GA 1T5YA 1ASKA 3RDEA 2P0XA 3TDGA 2OQEC 2HMOB 3BNDA 3VSYA 3K5TA 1VQ73 3FG1A 3WDGB 1JKGB 3CC43 5D83A 1O7NB 5AEWB 5IG4A 3FSDA 3X3ZA 4GB5A 1ULIB 2P0MA 4ZM8A 3PS8A 5KP3A 3PCSA 1V74A 4XB5A 2CFDA 3LXUX 2ML5A 1M1K4 1YIJ3 5CK6A 1W6GA 3VF1A 3JUOA 1NU3A 1MNLA 3OWYA 1FA3A 2E2UA 5IEOA 3KE7A 1VQK3 2CKFB 2CH9A 4HJLB 2R4IA 3KSED 4HM7B 1QMAA 3N9HA 3EN1B 2RGQA 1RKYA 3OW22 4CCVA 3CCQ3 3V92A 4OUQA 3Q90A 1STDA 2O9UX 2P05A 1A2VA 2C11A 2P09A 2Y74A 1NB5I 4AKYA 1NB3I 3EB8A 2K54A 1IQXA 4L8OA 1LNHA 4R9LA 2XR8B 3KN4A 1YJW3 3V98A 3Q2PA 5BVBA 3LT8A 3U1WA 3CCS3 3RGAA 4XDVA 4GL6A 2CG0A 4OVMA 3OV4A 3F8HA 1CYUA 2GU3A 1AVKA 3EHCA 1SIIA 3AMOB 1WMPA 3S27A 2P38A 1IV7A 2YFIB 2FXTA 3BNCA 1IVWA 2OOVC 2GEYA 3JUNA 3CD63 1UUWB 5AYRB 1W01A 4RNZA 3ROBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX 3;  1KC8 4;  3I55 3;  1K9M 4;  1M1K 4;  3CXC 2;  1YIJ 3;  1YJW 3;  1N8R 4;  1VQL 3;  1K73 4;  3CCR 3;  3CCE 3;  3CCJ 3;  1VQ9 3;  2QA4 3;  3CCS 3;  3CPW 2;  3CCV 3;  1S72 3;  1YIT 3;  1VQK 3;  1W2B 2;  1Q86 4;  3G4S 3;  1YJ9 3;  1JJ2 2;  1YHQ 3;  1YI2 3;  1K8A 4;  3CCU 3;  1VQ7 3;  1VQM 3;  1QVG 2;  3G6E 3;  1KQS 2;  2OTL 3;  3CCM 3;  3OW2 2;  3I56 3;  1Q81 4;  3CC4 3;  3CC7 3;  3CCQ 3;  3CCL 3;  1VQ8 3;  1VQ4 3;  1VQ6 3;  1Q7Y 4;  1YJN 3;  1Q82 4;  3CME 3;  3CC2 3;  1VQ5 3;  2OTJ 3;  1QVF 2;  1NJI 4;  3CD6 3;  1VQN 3;  1M90 4;  1KD1 4;  1VQP 3;  3CMA 3;  1VQO 3;  3G71 3; 
#chains in the Genus database with same CATH topology
 1NNV A;  1TFK A;  1JBT A;  1LVN A;  1Q7H A;  1SIH A;  4KVH A;  5IG0 A;  3CXC 2;  3B8L A;  2XFS A;  3JUP A;  3LTB A;  3WOD G;  1YVS A;  3LTC A;  1QAL A;  5M1A A;  3X3X A;  1ULJ B;  1YIT 3;  1I0X A;  4N6V 0;  3PZW A;  3EF8 A;  3BB9 A;  1YGW A;  3DGL A;  1AV4 A;  1JZO A;  2MF7 A;  3EBT A;  5ELU A;  1EQK A;  3PYJ A;  5ELJ A;  1ISK A;  3FH1 A;  2F5W A;  3HK4 A;  4KFF A;  3DGY A;  1KSI A;  1NO3 A;  3IMA B;  1Q7Y 4;  1PFP A;  5FW5 A;  1N5H A;  1QAK A;  3QK9 A;  4GSP A;  2CIU A;  1DMN A;  2KAA A;  1QVF 2;  1L5G B;  5CF1 A;  1NJI 4;  4J5K A;  4XBY A;  1UW1 A;  3FG4 A;  3G16 A;  5IG5 A;  1RN4 A;  1ZS7 A;  6RNT A;  2J8X B;  1VQL 3;  2BT3 A;  3AGN A;  3CCR 3;  2I9W A;  3GWR A;  1BRJ A;  2ZHX B;  3B4P A;  3HI7 A;  1E3V A;  1WMN A;  1STF I;  2HML B;  1GY5 A;  1TP6 A;  1G96 A;  1V57 A;  3MKI A;  1A67 A;  3GZR A;  2K3D A;  1JBS A;  1RNB A;  1RGC A;  3CCM 3;  2OCT A;  1S5A A;  1K41 A;  5KP4 A;  1W00 A;  1OHO A;  5RNT A;  3PCR A;  1EA2 A;  1Q9E A;  5D81 A;  1FGQ A;  1A90 A;  3NQY A;  1W6C A;  3NUV A;  1RRH A;  1TTO A;  1WNH A;  1A2K A;  3S28 A;  3SOY A;  1VQN 3;  2OQE A;  4RBN A;  3H3H A;  2GXF A;  3CMA 3;  1U8C B;  5I97 A;  3KSP A;  3I55 3;  2UUG C;  3Q1C A;  3EN8 A;  1GY7 A;  1D6Z A;  3LTA A;  1IK3 A;  1RGF A;  2D1W A;  9RNT A;  2KF4 A;  1W7C A;  1BGS A;  5CLK A;  5AIG A;  4BL3 A;  1JJ2 2;  3SOA A;  1B27 A;  1W2Z A;  4RNY A;  3DUK A;  3STD A;  4FCM A;  1IVX A;  4N6U A;  1BAO A;  8RNT A;  1UGI A;  4LSO A;  1RRL A;  1GOU A;  3UJM A;  1KQS 2;  1I70 A;  3UNL A;  3ALA A;  4RNT A;  1RMS A;  1YVB I;  4G1M B;  1GYB A;  1HYF A;  3BNB A;  1BSE A;  1YGE A;  3DMC A;  5AYS C;  1GMR A;  1N9J A;  1FUT A;  2KXG A;  3WOF B;  4AEQ A;  2SAR A;  1BNG A;  1MWT A;  5G1L A;  1CEW I;  1UI7 A;  2CWU A;  2BU4 A;  1RGA A;  1IT7 A;  1TIJ A;  2L1S A;  1OCV A;  1BSC A;  3F8X A;  5TGN A;  2A15 A;  3V99 A;  1T2I A;  2KCD A;  5IER A;  3CCV 3;  1I2F A;  1TFO A;  4N6T A;  1I8V A;  1Z1S A;  2ML6 A;  3MHE A;  1OHS A;  1YI2 3;  1VZZ A;  3GZB A;  1QVG 2;  1OHP A;  2LQV A;  4HM3 B;  4R9K A;  5M19 A;  5A0O B;  2CX0 A;  3FG3 A;  1VQ6 3;  3D5I A;  1GY6 A;  1N8Q A;  5IW9 A;  1KWI A;  1MWU A;  1BSA A;  3CNM A;  3SLU A;  4FCJ A;  3CME 3;  1DVC A;  1X1U A;  4IT7 A;  1UUG B;  2KF3 A;  3A5E A;  4NHF A;  3BIR A;  1D6Y A;  1MGW A;  3WA3 A;  3FCS B;  3NM7 A;  1NWW A;  4WWU C;  1FW7 A;  3MSO A;  3G71 3;  1MGR A;  1TRP A;  4XBT A;  3RGR A;  1F8N A;  2HMN B;  3N8B A;  1O7P B;  3ECF A;  3X3Y A;  3F7X A;  4HAA A;  5STD A;  1K73 4;  1IQ8 A;  1E3R A;  1I2G A;  1Q42 A;  4I4K A;  4LYL B;  2CFK A;  1S72 3;  3HIG A;  4ORL A;  1AVL A;  2W03 A;  1Q86 4;  1FUW A;  2JDI H;  3SVA A;  3MG2 A;  1BRI A;  2STD A;  4WFO A;  1GOY A;  3T8N A;  3CCU 3;  2OTL 3;  1MWR A;  1VQ8 3;  4AKZ A;  4DKI A;  1CYV A;  4J5G A;  1RSN A;  2ZDJ A;  4XDW A;  2CFW A;  4WP5 A;  3HX8 A;  2QGU A;  2WOF A;  4K1V A;  4EV5 A;  3CU3 A;  2M7O A;  3CC2 3;  3DH2 A;  5AIH A;  2B24 B;  2XH9 A;  1JB5 A;  3JUM A;  1M90 4;  1LOX A;  2WOH A;  4XBX A;  1VQO 3;  3D79 A;  2PNC A;  5JBS A;  1J2B A;  1ZGX A;  3UL6 A;  2CFG A;  1W02 A;  2BMR B;  3X41 A;  1EG9 B;  1B21 A;  2PZV A;  4FMB A;  4FMA A;  2CHC A;  5BXQ A;  3LH4 A;  2W2C A;  1YJ9 3;  2IUK A;  3CNX A;  2O3O A;  1BRS A;  4K1U A;  4IIA A;  3FLJ A;  2W0Q A;  3BNE A;  3EE1 A;  3BU4 A;  2XGL A;  3KII A;  4O2H A;  3E99 A;  2CWV A;  3HOH A;  2HMM B;  4OK0 A;  2W6J H;  1Q82 4;  1BSB A;  4BTY A;  2F5M A;  2FNQ A;  1LXE A;  2ZL8 A;  1JKG A;  5IEN A;  1FGT A;  1BVI A;  5DRV A;  4BIR A;  2F99 A;  3MPH A;  1MOL A;  1O7H B;  1FYS A;  1DMM A;  4EV2 A;  5LC7 A;  3JUQ A;  2W56 A;  3MG3 A;  4BL2 A;  1ROA A;  1RJO A;  3CCJ 3;  1VQ9 3;  1V58 A;  3CPW 2;  2E2T A;  3HII A;  2OOV A;  1CQS A;  1TUH A;  4HVN A;  3K7C A;  4EYC A;  1UI8 A;  1E97 A;  3DY5 A;  1N5P A;  2CW9 A;  1B2M A;  1AY7 A;  3LTD A;  5BU4 A;  3D5G A;  1JB2 A;  4RZM A;  3N54 B;  3GSP A;  2YFL B;  2WGQ A;  3OWS A;  3QRD A;  2YX9 A;  3X40 A;  1PY3 A;  7STD A;  1Y4K A;  4HYZ A;  2GEX A;  1ROV A;  2YFJ B;  3K9M C;  3IJE B;  1VQ5 3;  1M1X B;  1N9E A;  2F4Y A;  1U5O A;  1TRQ A;  3Q3F A;  2SBL A;  4TX4 A;  3SYU A;  3SED A;  1OF5 A;  3NX0 A;  1VQP 3;  1OGZ A;  2KF5 A;  4K61 A;  4HBR A;  5AII A;  5D82 A;  1FZU A;  1US1 A;  5IF6 A;  1N8R 4;  2BMO B;  2W56 B;  3IPT A;  1BAN A;  1DYU A;  4HZ9 B;  2F98 A;  2QA4 3;  3K0Z A;  4R1K A;  4LEH A;  3M8C A;  5IG3 A;  2FGT A;  5JPP A;  2W9P A;  4MMZ B;  4BTW A;  1IV9 A;  1G0T A;  1NDO B;  3LZA A;  4LMI A;  4N6O B;  4EBG A;  1OAC A;  4HM6 B;  3NM2 A;  1JN5 A;  5BIR A;  2W9Q A;  3S29 A;  1C7H A;  3G6E 3;  1Q81 4;  1VQ4 3;  3L0R A;  2QIY A;  5AEU B;  1BRN L;  1B2S A;  1AR0 A;  2L4V A;  3LYG A;  3NHX A;  3SXX A;  1RCL A;  3GZX B;  1TU5 A;  3AMO A;  3WR2 A;  1IDP A;  5AIF A;  2RSX A;  5HGR A;  1GMQ A;  1X1W A;  1A2P A;  3B7C A;  3LOY A;  3S67 A;  5M18 A;  2XRX B;  3G8Z A;  7RNT A;  4CDL A;  1I3F A;  1BRH A;  5JPU A;  1BNE A;  1R4C A;  1O7W B;  1W5Z A;  2BO9 B;  2XF3 A;  3JVC A;  3OWU A;  3NBJ A;  4JRF A;  3CCE 3;  2Z6B A;  4R80 A;  1RN1 A;  1LOV A;  1AQZ A;  2IY2 A;  1LRA A;  3F40 A;  2Z76 A;  4NRE A;  1SQW A;  1BNR A;  4O8S A;  1FUS A;  2AAE A;  3ER7 A;  3FGY A;  1JZD A;  4J8T A;  4Q53 A;  2IUJ A;  3GAX A;  4HM5 B;  4KT3 B;  1VQM 3;  4FMC A;  1BUJ A;  2BMQ B;  4HOH A;  1M9G A;  3MWZ A;  3NXJ A;  2RCD A;  2H0I A;  1UUV B;  1OF5 B;  1WTH A;  3FZW A;  1W6Y A;  3I0Y A;  3F9S A;  2CWT A;  5GSP A;  5CF2 A;  1HKX A;  1K28 A;  1TJD A;  3CPO A;  4QWT A;  4L7K A;  3LML A;  2HMJ B;  2BNG A;  2F86 B;  3HZP A;  1KC8 4;  2XGN A;  1PU4 A;  2RBI A;  3OXA A;  4MMY B;  1FGO A;  1RCK A;  3NBR A;  1BOX A;  1O7G B;  4MJD A;  3LT9 A;  2XEP A;  3X42 A;  1RN7 A;  2CG1 A;  3AHW A;  3OX9 A;  2HOH A;  2GU1 A;  6STD A;  3J7Y d;  3G4S 3;  1WQL B;  4O3V A;  4STD A;  1JBR A;  3KKG A;  1K8A 4;  1FGM A;  3D3L A;  2Q07 A;  4R4K A;  4WYK B;  2AAD A;  3D9R A;  4FCZ A;  1BNS A;  1I3I A;  2GSP A;  3O8Y A;  4HKV B;  4HM4 B;  4PEJ A;  2E2V A;  4XM4 A;  1HZ1 A;  2ZA4 A;  1MWS A;  1JRQ A;  2CK3 H;  1DMQ A;  1HU9 A;  3SX1 A;  2OTJ 3;  3UL5 A;  4CJN A;  1D6U A;  3ZG5 A;  1KD1 4;  1EEJ A;  2XSO B;  4BTX A;  3MYT A;  1DVD A;  3DM8 A;  4LGQ A;  1FGR A;  1RGG A;  2QEX 3;  1K9M 4;  1Q40 A;  3F7S A;  1B3S A;  4MEI A;  4EC6 A;  5CXO A;  1BUQ A;  4HM2 B;  3G0K A;  3MG1 A;  5KP1 A;  4N3V A;  2BHM A;  1EKM A;  3BLZ A;  1UCI A;  1W2B 2;  3UB1 A;  2Z7A A;  3K63 A;  3PXM A;  4JF8 A;  3GZY B;  2INX A;  5EVH A;  2H0H A;  4K90 B;  3T8U A;  4KFD A;  1BRK A;  4HM0 B;  4J9A A;  2C4B A;  4FR9 A;  1SAR A;  2IMJ A;  2CC3 A;  3EQQ B;  3I56 3;  3CCL 3;  3WMD A;  3S5C A;  2Y73 A;  4GHO A;  1UGH I;  1OPY A;  2XFT A;  1JB4 A;  3B4O A;  4KZ1 A;  8CHO A;  3EX9 A;  5LC6 A;  3NV0 B;  1IU7 A;  2IA7 A;  4WHA A;  1B2U A;  1R4Y A;  3EBY A;  2WO0 A;  5EQL A;  1JNQ A;  3FKA A;  4LZI A;  4HM8 B;  6GSP A;  2GBW B;  2CFL A;  4WYK A;  1VQQ A;  3RNT A;  4MMX B;  5AI1 A;  4H3U A;  2XSH B;  4H61 A;  3EJV A;  1BNF A;  4ILF A;  4N6N B;  2H0G A;  3F14 A;  3GRD A;  5EEO A;  1IVV A;  1BU4 A;  2W04 A;  4O02 B;  2UX0 A;  2RNT A;  4U13 A;  3CC7 3;  3PGB A;  5IEP A;  1IVU A;  4EW5 A;  1RLS A;  2V1L A;  3FF0 A;  1BIR A;  2JQ5 A;  5DRE A;  2D42 A;  1IT8 A;  1X1X A;  3FF2 A;  3WOE B;  2RFR A;  4HZB B;  1CH0 A;  2Z77 A;  3AHS A;  3NV0 A;  4NPB A;  4L8P A;  1IQY A;  1Q40 B;  1EUI C;  2K0M A;  1JV2 B;  3EC9 A;  1SPU A;  2C10 A;  2WGO A;  3DGO A;  4X2O A;  2B1X B;  2MC8 A;  3NQZ A;  4KFE A;  1JN5 B;  1RGL A;  2CX1 A;  1WMO A;  2IYJ A;  2KF6 A;  1T2H A;  3KFQ C;  1GD3 A;  2KRT A;  3DGN A;  1BNJ A;  4FMD A;  1YHQ 3;  1IYY A;  1LOW A;  3DXO A;  2OWP A;  4X2H A;  3WA2 X;  1OGX A;  2GBX B;  3U97 A;  1OUN A;  3H51 A;  1GD4 A;  1DE3 A;  1RGK A;  1QAF A;  2HMK B;  3T0U A;  1LOY A;  4EXR A;  4N6L A;  1YJN 3;  3DGM A;  4N6M A;  1B2X A;  1O7M B;  4HM1 B;  1ZO2 A;  3KCH A;  1BRG A;  3A76 A;  1ZX2 A;  4IPB A;  1RHL A;  1UCL A;  1GOV A;  3NBB A;  3AGO A;  1UDI I;  1QJG A;  2LYX A;  3DZL A;  3VGN A;  3KZT A;  1RGH A;  1OH0 A;  1B2Z A;  1GS3 A;  3ZFZ A;  5FGO A;  1SJW A;  1W4N A;  1I2E A;  5G2G A;  1T5Y A;  1ASK A;  3RDE A;  2P0X A;  3TDG A;  2OQE C;  2HMO B;  3BND A;  3VSY A;  3K5T A;  1VQ7 3;  3FG1 A;  3WDG B;  1JKG B;  4BU4 A;  3CC4 3;  5D83 A;  1O7N B;  5AEW B;  3WHO A;  5IG4 A;  3FSD A;  2R41 A;  3X3Z A;  4GB5 A;  7GSP A;  1ULI B;  2P0M A;  1YNV X;  4ZM8 A;  1PYL A;  2UGI A;  3PS8 A;  5KP3 A;  3PCS A;  1V74 A;  4XB5 A;  1DET A;  2CFD A;  3LXU X;  5G1K A;  3ZG0 A;  2ML5 A;  1BNI A;  1M1K 4;  1YIJ 3;  2BIR A;  1GMP A;  1I0V A;  1W6G A;  5CK6 A;  3VF1 A;  3JUO A;  5HOH A;  1NU3 A;  1MNL A;  3OWY A;  1FA3 A;  2E2U A;  5IEO A;  3KE7 A;  1VQK 3;  2CKF B;  2CH9 A;  4HJL B;  2R4I A;  3KSE D;  4HM7 B;  1QMA A;  1C54 A;  1GSP A;  3EN1 B;  3N9H A;  2RGQ A;  1RKY A;  1RTU A;  1UCJ A;  3OW2 2;  4CCV A;  3CCQ 3;  3D4A A;  3V92 A;  1LNI A;  4OUQ A;  3Q90 A;  1STD A;  2O9U X;  2P05 A;  1RDS A;  1RNT A;  1A2V A;  4I5Q A;  2C11 A;  2P09 A;  2Y74 A;  1LQM B;  1NB5 I;  1X1Y A;  4AKY A;  1NB3 I;  3EB8 A;  2K54 A;  1IQX A;  4L8O A;  1LNH A;  4R9L A;  2XR8 B;  3KN4 A;  1YJW 3;  3V98 A;  3Q2P A;  5BVB A;  1G02 A;  3LT8 A;  3U1W A;  3RGA A;  3CCS 3;  4XDV A;  4GL6 A;  2CG0 A;  1UCK A;  4OVM A;  3OV4 A;  3F8H A;  1CYU A;  1T3B A;  2GU3 A;  1AVK A;  3EHC A;  1SII A;  3AMO B;  1WMP A;  1BSD A;  3S27 A;  2P38 A;  1RGE A;  1IV7 A;  2YFI B;  2FXT A;  3BNC A;  2F56 A;  1LQG C;  1IVW A;  2OOV C;  2GEY A;  3JUN A;  3CD6 3;  1UUW B;  4CPK A;  5AYR B;  1W01 A;  1B20 A;  4RNZ A;  3URP A;  3ROB A; 
#chains in the Genus database with same CATH homology
 1TFK A;  1LVN A;  1SIH A;  4KVH A;  5IG0 A;  3CXC 2;  3B8L A;  2XFS A;  3JUP A;  3LTB A;  3WOD G;  3LTC A;  1QAL A;  3X3X A;  1ULJ B;  1YIT 3;  4N6V 0;  3PZW A;  3EF8 A;  3BB9 A;  3DGL A;  1AV4 A;  2MF7 A;  3EBT A;  5ELU A;  1EQK A;  3PYJ A;  5ELJ A;  1ISK A;  3FH1 A;  4KFF A;  3HK4 A;  1KSI A;  1NO3 A;  3IMA B;  1Q7Y 4;  1PFP A;  5FW5 A;  1N5H A;  1QAK A;  3QK9 A;  2CIU A;  1DMN A;  1QVF 2;  1L5G B;  5CF1 A;  1NJI 4;  4XBY A;  1UW1 A;  3FG4 A;  3G16 A;  5IG5 A;  1VQL 3;  2BT3 A;  3CCR 3;  2I9W A;  3GWR A;  3B4P A;  3HI7 A;  1E3V A;  1WMN A;  1STF I;  2HML B;  1GY5 A;  1TP6 A;  1G96 A;  3MKI A;  1A67 A;  3GZR A;  3CCM 3;  2OCT A;  1S5A A;  1K41 A;  5KP4 A;  1W00 A;  1OHO A;  3PCR A;  1EA2 A;  5D81 A;  1FGQ A;  1A90 A;  3NQY A;  1W6C A;  3NUV A;  1RRH A;  1WNH A;  1A2K A;  3S28 A;  3SOY A;  1VQN 3;  2OQE A;  4RBN A;  3H3H A;  2GXF A;  3CMA 3;  1U8C B;  5I97 A;  3KSP A;  3I55 3;  3Q1C A;  3EN8 A;  1GY7 A;  1D6Z A;  3LTA A;  1IK3 A;  2D1W A;  1W7C A;  5CLK A;  5AIG A;  1JJ2 2;  3SOA A;  1W2Z A;  4RNY A;  3DUK A;  3STD A;  4FCM A;  1IVX A;  4N6U A;  4LSO A;  1RRL A;  3UJM A;  1KQS 2;  3UNL A;  3ALA A;  1YVB I;  4G1M B;  1GYB A;  3BNB A;  5AYS C;  1YGE A;  3DMC A;  1N9J A;  3WOF B;  2KXG A;  4AEQ A;  1CEW I;  1UI7 A;  2CWU A;  1IT7 A;  1TIJ A;  1OCV A;  3F8X A;  5TGN A;  2A15 A;  3V99 A;  2KCD A;  5IER A;  3CCV 3;  1TFO A;  4N6T A;  1Z1S A;  2ML6 A;  3MHE A;  1OHS A;  1YI2 3;  1VZZ A;  3GZB A;  1QVG 2;  1OHP A;  2LQV A;  4HM3 B;  4R9K A;  5A0O B;  3FG3 A;  1VQ6 3;  1GY6 A;  1N8Q A;  5IW9 A;  1KWI A;  3CNM A;  3SLU A;  4FCJ A;  3CME 3;  1DVC A;  4IT7 A;  4NHF A;  1D6Y A;  3WA3 A;  3FCS B;  3NM7 A;  1NWW A;  4WWU C;  3MSO A;  3G71 3;  4XBT A;  3RGR A;  1F8N A;  2HMN B;  3N8B A;  1O7P B;  3ECF A;  3X3Y A;  3F7X A;  5STD A;  1K73 4;  1IQ8 A;  1E3R A;  1Q42 A;  4I4K A;  2CFK A;  1S72 3;  3HIG A;  4ORL A;  1AVL A;  2W03 A;  1Q86 4;  1FUW A;  2JDI H;  3SVA A;  3MG2 A;  2STD A;  4WFO A;  3CCU 3;  3T8N A;  2OTL 3;  1VQ8 3;  4AKZ A;  1CYV A;  4XDW A;  2ZDJ A;  2CFW A;  4WP5 A;  3HX8 A;  2QGU A;  2WOF A;  4K1V A;  4EV5 A;  3CU3 A;  2M7O A;  3CC2 3;  5AIH A;  2B24 B;  2XH9 A;  1JB5 A;  3JUM A;  1M90 4;  1LOX A;  2WOH A;  4XBX A;  1VQO 3;  2PNC A;  5JBS A;  1J2B A;  3UL6 A;  2CFG A;  1W02 A;  2BMR B;  3X41 A;  1EG9 B;  2PZV A;  4FMB A;  4FMA A;  2CHC A;  5BXQ A;  3LH4 A;  2W2C A;  1YJ9 3;  2IUK A;  3CNX A;  2O3O A;  4K1U A;  4IIA A;  3FLJ A;  2W0Q A;  3BNE A;  3EE1 A;  2XGL A;  3KII A;  4O2H A;  3E99 A;  2CWV A;  2HMM B;  4OK0 A;  2W6J H;  1Q82 4;  4BTY A;  2FNQ A;  1LXE A;  2ZL8 A;  1JKG A;  5IEN A;  1FGT A;  5DRV A;  2F99 A;  3MPH A;  1MOL A;  1O7H B;  1DMM A;  4EV2 A;  5LC7 A;  3JUQ A;  2W56 A;  3MG3 A;  1ROA A;  1RJO A;  3CCJ 3;  1VQ9 3;  3CPW 2;  2E2T A;  3HII A;  2OOV A;  1CQS A;  1TUH A;  4HVN A;  3K7C A;  4EYC A;  1UI8 A;  1E97 A;  3DY5 A;  1N5P A;  2CW9 A;  3LTD A;  1JB2 A;  4RZM A;  3N54 B;  3X40 A;  2YFL B;  2WGQ A;  3OWS A;  3QRD A;  2YX9 A;  7STD A;  1Y4K A;  4HYZ A;  2GEX A;  1ROV A;  2YFJ B;  3K9M C;  3IJE B;  1VQ5 3;  1M1X B;  1N9E A;  1U5O A;  4TX4 A;  2SBL A;  3SED A;  1OF5 A;  3NX0 A;  1VQP 3;  1OGZ A;  4K61 A;  4HBR A;  5AII A;  5D82 A;  1US1 A;  5IF6 A;  1N8R 4;  2BMO B;  2W56 B;  3IPT A;  4HZ9 B;  1DYU A;  2F98 A;  2QA4 3;  3K0Z A;  4R1K A;  4LEH A;  3M8C A;  5IG3 A;  2FGT A;  5JPP A;  2W9P A;  4MMZ B;  4BTW A;  1IV9 A;  1NDO B;  3LZA A;  4LMI A;  4N6O B;  4EBG A;  1OAC A;  4HM6 B;  3NM2 A;  1JN5 A;  2W9Q A;  3S29 A;  1C7H A;  3G6E 3;  1Q81 4;  1VQ4 3;  3L0R A;  2QIY A;  5AEU B;  1AR0 A;  2L4V A;  3LYG A;  3NHX A;  3SXX A;  3GZX B;  1TU5 A;  3AMO A;  1IDP A;  5AIF A;  2RSX A;  5HGR A;  3B7C A;  3LOY A;  3S67 A;  2XRX B;  3G8Z A;  4CDL A;  5JPU A;  1R4C A;  1W5Z A;  1O7W B;  2BO9 B;  2XF3 A;  3JVC A;  3OWU A;  3CCE 3;  3NBJ A;  4JRF A;  2Z6B A;  4R80 A;  3F40 A;  2Z76 A;  4NRE A;  1SQW A;  4O8S A;  3ER7 A;  3FGY A;  4J8T A;  2IUJ A;  4Q53 A;  3GAX A;  4HM5 B;  1VQM 3;  4FMC A;  2BMQ B;  1M9G A;  3MWZ A;  3NXJ A;  2RCD A;  1UUV B;  1OF5 B;  1WTH A;  3FZW A;  1W6Y A;  3I0Y A;  3F9S A;  2CWT A;  5CF2 A;  1HKX A;  1K28 A;  3CPO A;  4QWT A;  4L7K A;  3LML A;  2HMJ B;  2BNG A;  2F86 B;  3HZP A;  1KC8 4;  2XGN A;  1PU4 A;  4MMY B;  3OXA A;  1FGO A;  3NBR A;  1O7G B;  4MJD A;  3LT9 A;  2XEP A;  3X42 A;  1RN7 A;  2CG1 A;  3OX9 A;  3J7Y d;  2GU1 A;  6STD A;  3G4S 3;  1WQL B;  4O3V A;  4STD A;  3KKG A;  1K8A 4;  1FGM A;  3D3L A;  2Q07 A;  4R4K A;  4WYK B;  3D9R A;  4FCZ A;  3O8Y A;  4HKV B;  4HM4 B;  4PEJ A;  2E2V A;  4XM4 A;  1JRQ A;  2CK3 H;  1DMQ A;  1HU9 A;  3SX1 A;  2OTJ 3;  3UL5 A;  1D6U A;  1KD1 4;  2XSO B;  4BTX A;  3MYT A;  1DVD A;  3DM8 A;  4LGQ A;  1FGR A;  2QEX 3;  1K9M 4;  1BUQ A;  1Q40 A;  3F7S A;  4MEI A;  4EC6 A;  5CXO A;  4HM2 B;  3G0K A;  3MG1 A;  5KP1 A;  4N3V A;  2BHM A;  1EKM A;  3BLZ A;  1W2B 2;  3UB1 A;  2Z7A A;  3K63 A;  3PXM A;  4JF8 A;  3GZY B;  2INX A;  5EVH A;  4K90 B;  3T8U A;  4KFD A;  4HM0 B;  4J9A A;  4FR9 A;  2IMJ A;  3I56 3;  2CC3 A;  3EQQ B;  3CCL 3;  3WMD A;  3S5C A;  2Y73 A;  1OPY A;  2XFT A;  1JB4 A;  3B4O A;  4KZ1 A;  8CHO A;  3EX9 A;  5LC6 A;  3NV0 B;  1IU7 A;  2IA7 A;  4WHA A;  3EBY A;  2WO0 A;  5EQL A;  1JNQ A;  3FKA A;  4LZI A;  4HM8 B;  2GBW B;  2CFL A;  4WYK A;  4MMX B;  5AI1 A;  4H3U A;  2XSH B;  4H61 A;  3EJV A;  4N6N B;  3F14 A;  3GRD A;  5EEO A;  1IVV A;  2W04 A;  4O02 B;  2UX0 A;  4U13 A;  3CC7 3;  3PGB A;  5IEP A;  1IVU A;  2V1L A;  3FF0 A;  2JQ5 A;  5DRE A;  2D42 A;  1IT8 A;  3FF2 A;  3WOE B;  2RFR A;  4HZB B;  2Z77 A;  3NV0 A;  4L8P A;  1IQY A;  2K0M A;  1Q40 B;  1JV2 B;  3EC9 A;  1SPU A;  2C10 A;  2WGO A;  3DGO A;  4X2O A;  2B1X B;  2MC8 A;  3NQZ A;  4KFE A;  1JN5 B;  1WMO A;  3KFQ C;  1GD3 A;  2KRT A;  3DGN A;  4FMD A;  1YHQ 3;  3DXO A;  2OWP A;  4X2H A;  3WA2 X;  1OGX A;  2GBX B;  3U97 A;  1OUN A;  3H51 A;  1GD4 A;  1QAF A;  2HMK B;  3T0U A;  4EXR A;  1YJN 3;  4N6L A;  3DGM A;  4N6M A;  1O7M B;  4HM1 B;  1ZO2 A;  3A76 A;  1ZX2 A;  4IPB A;  3NBB A;  1QJG A;  2LYX A;  3DZL A;  3VGN A;  3KZT A;  1OH0 A;  1GS3 A;  5FGO A;  1SJW A;  1W4N A;  5G2G A;  1T5Y A;  1ASK A;  3RDE A;  2P0X A;  3TDG A;  2OQE C;  2HMO B;  3BND A;  3VSY A;  3K5T A;  1VQ7 3;  3FG1 A;  3WDG B;  1JKG B;  3CC4 3;  5D83 A;  1O7N B;  5AEW B;  5IG4 A;  3FSD A;  3X3Z A;  4GB5 A;  1ULI B;  2P0M A;  4ZM8 A;  3PS8 A;  5KP3 A;  3PCS A;  1V74 A;  4XB5 A;  2CFD A;  3LXU X;  2ML5 A;  1M1K 4;  1YIJ 3;  5CK6 A;  1W6G A;  3VF1 A;  3JUO A;  1NU3 A;  1MNL A;  3OWY A;  1FA3 A;  2E2U A;  5IEO A;  3KE7 A;  1VQK 3;  2CKF B;  2CH9 A;  4HJL B;  2R4I A;  3KSE D;  4HM7 B;  1QMA A;  3N9H A;  3EN1 B;  2RGQ A;  1RKY A;  3OW2 2;  4CCV A;  3CCQ 3;  3V92 A;  4OUQ A;  3Q90 A;  1STD A;  2O9U X;  2P05 A;  1A2V A;  2C11 A;  2P09 A;  2Y74 A;  1NB5 I;  4AKY A;  1NB3 I;  3EB8 A;  2K54 A;  1IQX A;  4L8O A;  1LNH A;  4R9L A;  2XR8 B;  3KN4 A;  1YJW 3;  3V98 A;  3Q2P A;  5BVB A;  3LT8 A;  3U1W A;  3CCS 3;  3RGA A;  4XDV A;  4GL6 A;  2CG0 A;  4OVM A;  3OV4 A;  3F8H A;  1CYU A;  2GU3 A;  1AVK A;  3EHC A;  1SII A;  3AMO B;  1WMP A;  3S27 A;  2P38 A;  1IV7 A;  2YFI B;  2FXT A;  3BNC A;  1IVW A;  2OOV C;  2GEY A;  3JUN A;  3CD6 3;  1UUW B;  5AYR B;  1W01 A;  4RNZ A;  3ROB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...