1KQS2

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kqs200
1VQM3 3CC23 1VQL3 3CCV3 1YJW3 2QA43 1VQ73 1YI23 3G4S3 3CC43 1S723 2QEX3 3CME3 1Q824 3CXC2 3CCE3 1VQ43 3CCQ3 1K9M4 3CPW2 3CC73 3OW22 3CCL3 2OTL3 3CCS3 1KC84 1QVF2 1YIT3 1M904 3CCJ3 1VQK3 1VQN3 1N8R4 3CMA3 3I553 1K734 1Q814 3CCR3 1NJI4 1YJN3 3I563 1JJ22 1Q864 1K8A4 1YJ93 1W2B2 1QVG2 1VQ63 1VQ53 3CCM3 3CD63 3G6E3 2OTJ3 3CCU3 1M1K4 1YIJ3 1Q7Y4 1VQ93 1KQS2 1VQ83 1YHQ3 3G713 1VQO3 1VQP3 1KD14
chains in the Genus database with same CATH superfamily
1SPUA 3FLJA 4NPBA 1UUWB 1US1A 3JUMA 4XM4A 3FG1A 7RNTA 1JZOA 1W5ZA 3GZXB 5FW5A 1UW1A 2B24B 1T2HA 3ZG5A 3EHCA 1JRQA 4K1UA 3X3XA 1BSEA 4BL2A 1NO3A 1RTUA 5KP1A 4HAAA 2BNGA 4WHAA 3CCR3 2YFIB 3JVCA 1LNHA 2HMOB 3T8NA 2W2CA 4RNYA 1Q7Y4 1EEJA 3GWRA 1JKGB 1ZO2A 1CEWI 4NREA 5IEPA 1DMNA 1VQO3 1LRAA 4J5KA 1NB3I 2C10A 3IPTA 1YI23 2GU1A 1B2UA 4KFEA 2Y73A 2CFWA 1HZ1A 2CFDA 5AIHA 1AVLA 4BL3A 4HM5B 3HI7A 3HZPA 1OHPA 2W0QA 1MWUA 1YVBI 3X3YA 2ZDJA 5JPPA 1Z1SA 5BU4A 3F14A 5FGOA 1AQZA 1VQK3 1OF5B 1RCKA 3NM2A 9RNTA 1FW7A 3V92A 8CHOA 2C11A 3A5EA 1DYUA 3PXMA 1RGAA 1MWTA 3B7CA 2KF6A 1K8A4 1BSDA 1D6YA 3G6E3 3IJEB 1BRNL 1CH0A 1EUIC 3HIIA 1RHLA 1GY6A 2CFLA 5CLKA 1BNJA 4FCZA 4HZ9B 1D6UA 2CX0A 2KAAA 4WP5A 2L1SA 1GOUA 2IY2A 1NB5I 2KF3A 1MWSA 1O7PB 3CCQ3 3CCL3 3GAXA 3KE7A 4GSPA 4ZM8A 3EX9A 3CCS3 4EV2A 1IV7A 3LTCA 1YIT3 4MJDA 5BIRA 1IK3A 1STFI 3NX0A 1SIIA 2P38A 3X3ZA 2BHMA 3V99A 1Q814 1G02A 3LXUX 1Q864 3NQZA 1W2B2 4BTYA 3D9RA 1QVG2 1VQ63 3F9SA 1RGHA 4N6NB 3DM8A 2W04A 1RRLA 4K1VA 4GL6A 4EXRA 3UL6A 1GD3A 3CD63 3J7Yd 3LTDA 3ER7A 2RCDA 3BNDA 3BLZA 5IEOA 1A90A 3BNCA 2YFLB 3SOYA 1RGLA 8RNTA 1JBSA 4KZ1A 1K28A 4LSOA 3MKIA 1MOLA 3OWSA 1W6YA 3F8HA 2GU3A 2M7OA 5GSPA 1W4NA 3D5IA 1HU9A 1BVIA 4EYCA 3WA2X 1B2XA 3X42A 1T5YA 1FA3A 1DE3A 2Z77A 1SIHA 3DGNA 5ELUA 1N8R4 2LQVA 3G0KA 1BSCA 1K734 1LVNA 1MGWA 1WNHA 3FCSB 5STDA 3FG3A 1BNRA 1JB5A 2WGOA 3Q3FA 1M1K4 1UUVB 1O7HB 3NBJA 1OHSA 1GY5A 2XFSA 1UCJA 4BTXA 1J2BA 1S5AA 4FCMA 4WWUC 4H3UA 3T8UA 5D81A 3ZFZA 3CC23 1M1XB 2INXA 2R41A 2RNTA 3DGYA 1FGOA 5AYSC 1DMQA 1SARA 1OH0A 4R9LA 3EQQB 1X1YA 2CKFB 3EJVA 4N6TA 3VSYA 1AR0A 1NWWA 2IUJA 3G16A 4XBTA 1W01A 2W9PA 3X41A 1IU7A 1Y4KA 4O2HA 4ORLA 3K63A 3CCJ3 2RSXA 3EBTA 1DVDA 1LOYA 1JN5B 3H3HA 2XSHB 2BIRA 1GMQA 3FH1A 3B4PA 1YJ93 1UCIA 3MYTA 1UCLA 3UL5A 4J9AA 1JBRA 1TTOA 1CYUA 1U5OA 2XEPA 2XR8B 1AV4A 3DMCA 3F8XA 3S28A 3STDA 4BIRA 4PEJA 3OXAA 1GMRA 2KF5A 2XFTA 4J5GA 5AIGA 5DREA 2QEX3 3CU3A 4GHOA 1WTHA 3B4OA 3EF8A 2CW9A 1NDOB 1I3IA 3AGOA 1EKMA 3JUQA 3WMDA 6STDA 2W56B 5M19A 3CPW2 2OTL3 1B21A 6GSPA 1RGGA 2RBIA 1FGQA 1PFPA 2XRXB 3H51A 1YGEA 2HMKB 1HKXA 1U8CB 2W56A 4G1MB 2E2UA 1TJDA 3HOHA 3JUNA 3TDGA 2OQEA 2OTJ3 3VF1A 1RLSA 1FGMA 1RN4A 3GZBA 1OGZA 4AKYA 1BUQA 3SLUA 2GBXB 4AKZA 1BRJA 2QGUA 1W6GA 3EB8A 2CG1A 4HM2B 1JB2A 3S5CA 4MMYB 1TP6A 3G4S3 3MHEA 4HM7B 1GY7A 3ZG0A 1JKGA 4N6V0 3FKAA 1W00A 3DUKA 1TUHA 1CQSA 3PZWA 1A2PA 1ZGXA 3N8BA 2IYJA 5AEUB 1GMPA 3ALAA 3AMOB 4R9KA 4XB5A 1BUJA 1L5GB 4KFDA 1QVF2 2R4IA 1T3BA 4HVNA 2Q07A 2YFJB 1TRPA 4FCJA 2GEYA 3RDEA 3U1WA 1Q42A 3F7XA 5AIIA 3AMOA 5CXOA 3WA3A 4N3VA 4HM1B 2F56A 2CH9A 4L7KA 1I2EA 3ROBA 1A67A 3FF0A 1OF5A 1KQS2 2CFKA 1UDII 3G713 5JPUA 2CWTA 1BOXA 3KN4A 2MC8A 1VQP3 1ZS7A 3JUPA 3T0UA 1CYVA 1I2FA 1V74A 1E3RA 2HMJB 3LT8A 4DKIA 2UGIA 2FXTA 2CC3A 5JBSA 3EBYA 1BU4A 3CXC2 2QIYA 3UB1A 5I97A 1PU4A 1M904 2Y74A 4XDVA 2KCDA 1MNLA 4BTWA 1ROAA 5AEWB 1WMPA 4CJNA 4TX4A 1IVVA 3M8CA 5M1AA 2Z7AA 1YGWA 4LYLB 1NU3A 3KSED 4STDA 1RGFA 3LYGA 1YHQ3 4RNTA 1FUSA 3AHSA 3URPA 1T2IA 5IENA 1W2ZA 2K0MA 4X2OA 2QA43 1VQ73 2W6JH 3Q2PA 2C4BA 1JB4A 1NNVA 2OWPA 1ZX2A 1IQ8A 4L8OA 3L0RA 4QWTA 1PY3A 3S67A 3K7CA 2MF7A 3V98A 2RFRA 2ZHXB 3MPHA 1W7CA 5AI1A 3CMA3 3N54B 4O8SA 1NJI4 2GXFA 3OWYA 1BRHA 7GSPA 3O8YA 1Q40B 1TRQA 1IYYA 3FF2A 1IQYA 3JUOA 1M9GA 1GS3A 2IUKA 3VGNA 2F98A 3LH4A 1N9JA 2PNCA 1BNEA 1FGRA 1UGHI 1OCVA 1VQM3 2HOHA 1Q40A 1RRHA 4WFOA 1YJW3 1BRIA 1QJGA 1B3SA 3NV0B 1R4YA 1LXEA 1WMOA 2O3OA 3RGRA 1W02A 2WGQA 3KSPA 5IG5A 3CME3 2SBLA 2HMMB 2XGLA 3FGYA 4OUQA 4IT7A 5EVHA 2F99A 3SXXA 3D79A 4N6UA 3CC73 5A0OB 3NV0A 1JBTA 4K61A 1KC84 3I0YA 3Q1CA 3MSOA 1BNFA 4R80A 1FZUA 4U13A 1C54A 1LOVA 1G96A 5G2GA 2O9UX 1D6ZA 4WYKB 2CG0A 1RJOA 1BGSA 4IIAA 2L4VA 3CCM3 1DVCA 1TIJA 1ROVA 2Z76A 2XH9A 2B1XB 1N9EA 1BSAA 1N5PA 1JN5A 1AY7A 1GOVA 1B2MA 1TFKA 2D1WA 4XBYA 3FZWA 3MWZA 4CDLA 1SJWA 2OOVA 3QRDA 2H0HA 3HK4A 1X1XA 3CNMA 2KRTA 2SARA 1X1WA 3A76A 1S723 4HM8B 3UNLA 3NBBA 2K3DA 1Q824 7STDA 2HMNB 5LC6A 3D3LA 1QAKA 1WMNA 1EA2A 4R4KA 4HJLB 4N6LA 5M18A 1KSIA 2KF4A 1TFOA 1RKYA 4FMCA 3K0ZA 1FUWA 1RCLA 3NM7A 3E99A 1BSBA 3RGAA 3BIRA 3LT9A 5IERA 3I563 1Q7HA 2J8XB 1JJ22 3MG2A 1VQ53 2OCTA 3PYJA 3FG4A 2XF3A 5LC7A 3CCU3 1YIJ3 4HM0B 1UCKA 4EV5A 1GD4A 4N6OB 2XSOB 4MMZB 4EBGA 2CFGA 1UUGB 3BU4A 1RSNA 3SX1A 2F5WA 3WR2A 1I3FA 1HYFA 2BMRB 2P0MA 3HIGA 4KT3B 3GZRA 3SYUA 1B2SA 6RNTA 2F4YA 4RZMA 3IMAB 2IMJA 5D82A 4CCVA 3WOEB 1FGTA 1ULJB 3B8LA 5HGRA 2WO0A 5CF2A 2H0GA 3LMLA 2BMOB 1TU5A 1EQKA 3BNEA 4NHFA 1G0TA 3EE1A 1RN1A 1OPYA 2LYXA 1EG9B 2OOVC 1OHOA 3PS8A 3F40A 4H61A 4HBRA 4EW5A 1MGRA 4BU4A 2WOHA 1UI8A 2A15A 2ML6A 2P0XA 3DXOA 1B20A 4XDWA 1BRSA 1F8NA 1RGCA 4LGQA 5HOHA 4OVMA 3OV4A 3WODG 4ILFA 1VQ93 4O02B 2GEXA 3S29A 1OUNA 1RNTA 3NHXA 2BO9B 1LQMB 1STDA 1V58A 3D5GA 3GRDA 3OWUA 3U97A 3LTAA 4HKVB 4N6MA 1SQWA 2P09A 3F7SA 1BRGA 3G8ZA 4FR9A 4HM6B 1Q9EA 4Q53A 4KFFA 1I8VA 3GZYB 4X2HA 1E3VA 1I0VA 3KCHA 2OQEC 1BNSA 3KZTA 4K90B 1VZZA 1AVKA 3K5TA 4LMIA 2ZA4A 3LTBA 4R1KA 5IG3A 1V57A 4XBXA 2IA7A 3OX9A 1RGKA 5G1KA 1JV2B 3SVAA 3PCRA 1JNQA 2BMQB 3S27A 1IT7A 2CWVA 3BB9A 1BIRA 1QAFA 5IG0A 5KP4A 3WOFB 1GYBA 1QMAA 2RGQA 1B2ZA 3EC9A 1BNGA 3BNBA 1IVUA 1KD14 4HYZA 2CWUA 2WOFA 4RBNA 3UJMA 4FMDA 3CC43 4HOHA 2K54A 2E2TA 2W03A 3NXJA 1ULIB 1LOWA 1QALA 1RDSA 4I4KA 1RGEA 2CIUA 2STDA 4LZIA 3PCSA 3PGBA 5BVBA 2F5MA 2PZVA 5CF1A 3FSDA 2F86B 4I5QA 5IG4A 1I2GA 3X40A 4HZBB 1E97A 4EC6A 1O7MB 4L8PA 1YJN3 3Q90A 4MMXB 5AYRB 3MG3A 2BT3A 3DH2A 4HM3B 1DMMA 1R4CA 4HM4B 2H0IA 1UI7A 3AHWA 3MG1A 1OACA 2JQ5A 2CX1A 4GB5A 4MEIA 4FMAA 4RNZA 3SEDA 1VQ83 1O7NB 2D42A 3WHOA 3WDGB 2FNQA 1GOYA 1I70A 2CK3H 2KXGA 2P05A 3QK9A 3CCV3 3LZAA 5ELJA 5DRVA 3GSPA 1IV9A 2W9QA 1DETA 3DGOA 1X1UA 2BU4A 3HX8A 1W6CA 2I9WA 1FUTA 1RMSA 3EN8A 3NBRA 1YNVX 1VQ43 2FGTA 1IVWA 1IT8A 3OW22 1IQXA 1O7WB 4J8TA 3LOYA 2ZL8A 4LEHA 2AADA 1VQN3 1KWIA 1ASKA 3AGNA 4O3VA 3KKGA 1ISKA 1N8QA 1N5HA 1WQLB 2GBWB 3EN1B 1IVXA 4OK0A 1LOXA 5D83A 1A2KA 3KIIA 1MWRA 5RNTA 1BRKA 1A2VA 4JRFA 5IW9A 3D4AA 2JDIH 4WYKA 3ECFA 5AIFA 1OGXA 3DGMA 5IF6A 2XGNA 1BANA 1VQL3 3KFQC 5CK6A 1GSPA 3DY5A 2AAEA 1LNIA 5EQLA 3NUVA 1IDPA 2Z6BA 3NQYA 3RNTA 1JZDA 2CHCA 5TGNA 4AEQA 3CCE3 2UUGC 2ML5A 1K9M4 1C7HA 5EEOA 5BXQA 3CNXA 1LQGC 4CPKA 2UX0A 3CPOA 4JF8A 1YVSA 1B27A 1PYLA 2YX9A 1UGIA 3I553 2E2VA 1O7GB 2HMLB 3K9MC 3DGLA 5KP3A 1BAOA 1RNBA 1I0XA 4FMBA 1VQQA 1BNIA 4KVHA 5G1LA 1FYSA 1K41A 1RN7A 2V1LA 3DZLA 2GSPA 3SOAA 3N9HA 4IPBA
chains in the Genus database with same CATH topology
1SPUA 3FLJA 1UUWB 1US1A 3JUMA 4XM4A 3FG1A 1W5ZA 3GZXB 5FW5A 1UW1A 2B24B 3EHCA 1JRQA 4K1UA 3X3XA 5KP1A 1NO3A 2BNGA 4WHAA 3CCR3 2YFIB 3JVCA 1LNHA 2HMOB 3T8NA 2W2CA 4RNYA 1Q7Y4 3GWRA 1JKGB 1ZO2A 1CEWI 4NREA 5IEPA 1DMNA 1VQO3 1NB3I 2C10A 3IPTA 1YI23 2GU1A 4KFEA 2Y73A 2CFWA 2CFDA 5AIHA 1AVLA 4HM5B 3HI7A 3HZPA 1OHPA 2W0QA 1YVBI 3X3YA 2ZDJA 5JPPA 1Z1SA 3F14A 5FGOA 1VQK3 1OF5B 3NM2A 3V92A 8CHOA 2C11A 1DYUA 3PXMA 3B7CA 1K8A4 1D6YA 3G6E3 3IJEB 3HIIA 1GY6A 2CFLA 5CLKA 4FCZA 4HZ9B 1D6UA 4WP5A 1NB5I 1O7PB 3CCQ3 3CCL3 3GAXA 3KE7A 4ZM8A 3CCS3 3EX9A 4EV2A 1IV7A 3LTCA 1YIT3 4MJDA 1IK3A 1STFI 3NX0A 1SIIA 2P38A 3X3ZA 2BHMA 3V99A 1Q814 3LXUX 1Q864 3NQZA 1W2B2 4BTYA 3D9RA 1QVG2 1VQ63 3F9SA 4N6NB 3DM8A 2W04A 1RRLA 4K1VA 4GL6A 4EXRA 3UL6A 1GD3A 3CD63 3J7Yd 3LTDA 3ER7A 2RCDA 3BNDA 3BLZA 5IEOA 1A90A 3BNCA 2YFLB 3SOYA 4KZ1A 1K28A 4LSOA 3MKIA 1MOLA 3OWSA 1W6YA 3F8HA 2GU3A 2M7OA 1W4NA 1HU9A 4EYCA 3WA2X 3X42A 1T5YA 1FA3A 2Z77A 1SIHA 3DGNA 5ELUA 1N8R4 2LQVA 3G0KA 1K734 1LVNA 1WNHA 3FCSB 5STDA 3FG3A 1JB5A 2WGOA 1M1K4 1UUVB 1O7HB 3NBJA 1OHSA 1GY5A 2XFSA 1J2BA 4BTXA 1S5AA 4FCMA 4WWUC 4H3UA 3T8UA 5D81A 3CC23 1M1XB 2INXA 1FGOA 5AYSC 1DMQA 4R9LA 1OH0A 3EQQB 2CKFB 3EJVA 4N6TA 3VSYA 1AR0A 1NWWA 2IUJA 3G16A 4XBTA 1W01A 2W9PA 3X41A 1IU7A 1Y4KA 4O2HA 4ORLA 3K63A 3CCJ3 2RSXA 3EBTA 1DVDA 1JN5B 3H3HA 2XSHB 3FH1A 3B4PA 1YJ93 3MYTA 3UL5A 4J9AA 1CYUA 1U5OA 2XEPA 2XR8B 1AV4A 3DMCA 3F8XA 3S28A 3STDA 4PEJA 3OXAA 5AIGA 2XFTA 5DREA 2QEX3 3CU3A 1WTHA 3B4OA 3EF8A 2CW9A 1NDOB 1EKMA 3JUQA 3WMDA 6STDA 2W56B 3CPW2 2OTL3 1FGQA 1PFPA 2XRXB 3H51A 1YGEA 2HMKB 1HKXA 1U8CB 2W56A 4G1MB 2E2UA 3JUNA 3TDGA 2OQEA 2OTJ3 3VF1A 1FGMA 3GZBA 1OGZA 4AKYA 1BUQA 3SLUA 2GBXB 4AKZA 2QGUA 1W6GA 3EB8A 2CG1A 4HM2B 1JB2A 3S5CA 4MMYB 1TP6A 3G4S3 3MHEA 4HM7B 1GY7A 1JKGA 4N6V0 3FKAA 1W00A 3DUKA 1TUHA 1CQSA 3PZWA 3N8BA 5AEUB 3ALAA 4R9KA 3AMOB 4XB5A 1L5GB 4KFDA 1QVF2 2R4IA 4HVNA 2Q07A 2YFJB 4FCJA 2GEYA 3RDEA 3U1WA 1Q42A 3F7XA 5AIIA 3AMOA 5CXOA 3WA3A 4N3VA 4HM1B 2CH9A 4L7KA 3ROBA 1A67A 3FF0A 1OF5A 1KQS2 2CFKA 3G713 5JPUA 2CWTA 3KN4A 1VQP3 2MC8A 3JUPA 3T0UA 1CYVA 1V74A 1E3RA 2HMJB 3LT8A 2FXTA 2CC3A 5JBSA 3EBYA 3CXC2 2QIYA 3UB1A 5I97A 1PU4A 1M904 2Y74A 4XDVA 2KCDA 1MNLA 4BTWA 1ROAA 5AEWB 1WMPA 4TX4A 1IVVA 3M8CA 2Z7AA 1NU3A 3KSED 4STDA 3LYGA 1YHQ3 5IENA 1W2ZA 2K0MA 4X2OA 2QA43 1VQ73 2W6JH 3Q2PA 1JB4A 2OWPA 1ZX2A 1IQ8A 4L8OA 3L0RA 4QWTA 3S67A 3K7CA 2MF7A 3V98A 2RFRA 3MPHA 5AI1A 1W7CA 3CMA3 3N54B 4O8SA 1NJI4 2GXFA 3OWYA 3O8YA 1Q40B 3FF2A 1IQYA 3JUOA 1M9GA 1GS3A 2IUKA 3VGNA 2F98A 3LH4A 1N9JA 2PNCA 1FGRA 1OCVA 1VQM3 1Q40A 1RRHA 4WFOA 1YJW3 3NV0B 1QJGA 1LXEA 1WMOA 2O3OA 3RGRA 1W02A 2WGQA 3KSPA 5IG5A 3CME3 2SBLA 2HMMB 2XGLA 3FGYA 4OUQA 4IT7A 5EVHA 2F99A 3SXXA 4N6UA 3CC73 5A0OB 3NV0A 4K61A 1KC84 3I0YA 3Q1CA 3MSOA 4R80A 4U13A 1G96A 5G2GA 2O9UX 1D6ZA 4WYKB 2CG0A 1RJOA 4IIAA 2L4VA 3CCM3 1DVCA 1TIJA 1ROVA 2Z76A 2XH9A 2B1XB 1N9EA 1N5PA 1JN5A 1TFKA 2D1WA 4XBYA 3FZWA 3MWZA 4CDLA 1SJWA 2OOVA 3QRDA 3HK4A 3CNMA 2KRTA 3A76A 1S723 4HM8B 3UNLA 3NBBA 1Q824 7STDA 2HMNB 5LC6A 3D3LA 1QAKA 1WMNA 1EA2A 4R4KA 4HJLB 4N6LA 1KSIA 1TFOA 1RKYA 4FMCA 3K0ZA 1FUWA 3NM7A 3E99A 3RGAA 3LT9A 5IERA 3I563 1JJ22 3MG2A 1VQ53 2OCTA 3PYJA 3FG4A 2XF3A 5LC7A 3CCU3 1YIJ3 4HM0B 4EV5A 1GD4A 4N6OB 2XSOB 4MMZB 4EBGA 2CFGA 3SX1A 2BMRB 2P0MA 3HIGA 3GZRA 4RZMA 3IMAB 2IMJA 5D82A 4CCVA 3WOEB 1FGTA 1ULJB 3B8LA 5HGRA 2WO0A 5CF2A 3LMLA 2BMOB 1TU5A 1EQKA 3BNEA 4NHFA 3EE1A 4H61A 1OPYA 2LYXA 1EG9B 2OOVC 1OHOA 3PS8A 3F40A 4HBRA 2WOHA 1UI8A 2A15A 2ML6A 2P0XA 3DXOA 4XDWA 1F8NA 4LGQA 4OVMA 3OV4A 3WODG 1VQ93 4O02B 2GEXA 3S29A 1OUNA 3NHXA 2BO9B 3U97A 1STDA 3GRDA 3OWUA 3LTAA 4HKVB 4N6MA 1SQWA 2P09A 3F7SA 3G8ZA 4FR9A 4HM6B 4Q53A 4KFFA 3GZYB 4X2HA 1E3VA 4K90B 3KZTA 2OQEC 1VZZA 1AVKA 3K5TA 4LMIA 4R1KA 3LTBA 5IG3A 4XBXA 2IA7A 3OX9A 1JV2B 3SVAA 3PCRA 1JNQA 2BMQB 3S27A 1IT7A 2CWVA 3BB9A 1QAFA 5IG0A 5KP4A 3WOFB 1GYBA 1QMAA 2RGQA 3EC9A 3BNBA 1IVUA 1KD14 4HYZA 2CWUA 2WOFA 4RBNA 3UJMA 4FMDA 3CC43 2K54A 2E2TA 2W03A 3NXJA 1ULIB 1QALA 4I4KA 2CIUA 2STDA 4LZIA 3PCSA 3PGBA 5BVBA 2PZVA 5CF1A 3FSDA 2F86B 5IG4A 3X40A 4HZBB 1E97A 4EC6A 1O7MB 4L8PA 1YJN3 3Q90A 4MMXB 5AYRB 3MG3A 2BT3A 4HM3B 1DMMA 1R4CA 4HM4B 1UI7A 3MG1A 4MEIA 1OACA 2JQ5A 4GB5A 4FMAA 4RNZA 3SEDA 1VQ83 1O7NB 2D42A 3WDGB 2FNQA 2CK3H 2KXGA 2P05A 3QK9A 3CCV3 3LZAA 5ELJA 5DRVA 1IV9A 2W9QA 3DGOA 3NBRA 3HX8A 1W6CA 2I9WA 3EN8A 1VQ43 2FGTA 1IVWA 1IT8A 3OW22 1IQXA 1O7WB 4J8TA 3LOYA 2ZL8A 4LEHA 1VQN3 1KWIA 1ASKA 4O3VA 3KKGA 1ISKA 1N8QA 1N5HA 1WQLB 2GBWB 3EN1B 1IVXA 4OK0A 1LOXA 5D83A 1A2KA 3KIIA 1A2VA 4JRFA 5IW9A 2JDIH 4WYKA 3ECFA 5AIFA 1OGXA 3DGMA 5IF6A 2XGNA 1VQL3 3KFQC 5CK6A 3DY5A 5EQLA 3NUVA 1IDPA 2Z6BA 3NQYA 4AEQA 2CHCA 3CCE3 5TGNA 2ML5A 1K9M4 1C7HA 5EEOA 5BXQA 3CNXA 2UX0A 3CPOA 4JF8A 2YX9A 3I553 2E2VA 1O7GB 2HMLB 3K9MC 3DGLA 5KP3A 4FMBA 4KVHA 1K41A 1RN7A 2V1LA 3DZLA 3SOAA 3N9HA 4IPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM 3;  3CC2 3;  1VQL 3;  3CCV 3;  1YJW 3;  2QA4 3;  1VQ7 3;  1YI2 3;  3G4S 3;  3CC4 3;  1S72 3;  2QEX 3;  3CME 3;  1Q82 4;  3CXC 2;  3CCE 3;  1VQ4 3;  3CCQ 3;  1K9M 4;  3CPW 2;  3CC7 3;  3OW2 2;  3CCL 3;  2OTL 3;  3CCS 3;  1KC8 4;  1QVF 2;  1YIT 3;  1M90 4;  3CCJ 3;  1VQK 3;  1VQN 3;  1N8R 4;  3CMA 3;  3I55 3;  1K73 4;  1Q81 4;  3CCR 3;  1NJI 4;  1YJN 3;  3I56 3;  1JJ2 2;  1Q86 4;  1K8A 4;  1YJ9 3;  1W2B 2;  1QVG 2;  1VQ6 3;  1VQ5 3;  3CCM 3;  3CD6 3;  3G6E 3;  2OTJ 3;  3CCU 3;  1M1K 4;  1YIJ 3;  1Q7Y 4;  1VQ9 3;  1KQS 2;  1VQ8 3;  1YHQ 3;  3G71 3;  1VQO 3;  1VQP 3;  1KD1 4; 
#chains in the Genus database with same CATH topology
 1SPU A;  3FLJ A;  4NPB A;  1UUW B;  1US1 A;  3JUM A;  4XM4 A;  3FG1 A;  7RNT A;  1JZO A;  1W5Z A;  3GZX B;  5FW5 A;  1UW1 A;  2B24 B;  1T2H A;  3ZG5 A;  3EHC A;  1JRQ A;  4K1U A;  3X3X A;  1BSE A;  4BL2 A;  1NO3 A;  1RTU A;  5KP1 A;  4HAA A;  2BNG A;  4WHA A;  3CCR 3;  2YFI B;  3JVC A;  1LNH A;  2HMO B;  3T8N A;  2W2C A;  4RNY A;  1Q7Y 4;  1EEJ A;  3GWR A;  1JKG B;  1ZO2 A;  1CEW I;  4NRE A;  5IEP A;  1DMN A;  1VQO 3;  1LRA A;  4J5K A;  1NB3 I;  2C10 A;  3IPT A;  1YI2 3;  2GU1 A;  1B2U A;  4KFE A;  2Y73 A;  2CFW A;  1HZ1 A;  2CFD A;  5AIH A;  1AVL A;  4BL3 A;  4HM5 B;  3HI7 A;  3HZP A;  1OHP A;  2W0Q A;  1MWU A;  1YVB I;  3X3Y A;  2ZDJ A;  5JPP A;  1Z1S A;  5BU4 A;  3F14 A;  5FGO A;  1AQZ A;  1VQK 3;  1OF5 B;  1RCK A;  3NM2 A;  9RNT A;  1FW7 A;  3V92 A;  8CHO A;  2C11 A;  3A5E A;  1DYU A;  3PXM A;  1RGA A;  1MWT A;  3B7C A;  2KF6 A;  1K8A 4;  1BSD A;  1D6Y A;  3G6E 3;  3IJE B;  1BRN L;  1CH0 A;  1EUI C;  3HII A;  1RHL A;  1GY6 A;  2CFL A;  5CLK A;  1BNJ A;  4FCZ A;  4HZ9 B;  1D6U A;  2CX0 A;  2KAA A;  4WP5 A;  2L1S A;  1GOU A;  2IY2 A;  1NB5 I;  2KF3 A;  1MWS A;  1O7P B;  3CCQ 3;  3CCL 3;  3GAX A;  3KE7 A;  4GSP A;  4ZM8 A;  3EX9 A;  3CCS 3;  4EV2 A;  1IV7 A;  3LTC A;  1YIT 3;  4MJD A;  5BIR A;  1IK3 A;  1STF I;  3NX0 A;  1SII A;  2P38 A;  3X3Z A;  2BHM A;  3V99 A;  1Q81 4;  1G02 A;  3LXU X;  1Q86 4;  3NQZ A;  1W2B 2;  4BTY A;  3D9R A;  1QVG 2;  1VQ6 3;  3F9S A;  1RGH A;  4N6N B;  3DM8 A;  2W04 A;  1RRL A;  4K1V A;  4GL6 A;  4EXR A;  3UL6 A;  1GD3 A;  3CD6 3;  3J7Y d;  3LTD A;  3ER7 A;  2RCD A;  3BND A;  3BLZ A;  5IEO A;  1A90 A;  3BNC A;  2YFL B;  3SOY A;  1RGL A;  8RNT A;  1JBS A;  4KZ1 A;  1K28 A;  4LSO A;  3MKI A;  1MOL A;  3OWS A;  1W6Y A;  3F8H A;  2GU3 A;  2M7O A;  5GSP A;  1W4N A;  3D5I A;  1HU9 A;  1BVI A;  4EYC A;  3WA2 X;  1B2X A;  3X42 A;  1T5Y A;  1FA3 A;  1DE3 A;  2Z77 A;  1SIH A;  3DGN A;  5ELU A;  1N8R 4;  2LQV A;  3G0K A;  1BSC A;  1K73 4;  1LVN A;  1MGW A;  1WNH A;  3FCS B;  5STD A;  3FG3 A;  1BNR A;  1JB5 A;  2WGO A;  3Q3F A;  1M1K 4;  1UUV B;  1O7H B;  3NBJ A;  1OHS A;  1GY5 A;  2XFS A;  1UCJ A;  4BTX A;  1J2B A;  1S5A A;  4FCM A;  4WWU C;  4H3U A;  3T8U A;  5D81 A;  3ZFZ A;  3CC2 3;  1M1X B;  2INX A;  2R41 A;  2RNT A;  3DGY A;  1FGO A;  5AYS C;  1DMQ A;  1SAR A;  1OH0 A;  4R9L A;  3EQQ B;  1X1Y A;  2CKF B;  3EJV A;  4N6T A;  3VSY A;  1AR0 A;  1NWW A;  2IUJ A;  3G16 A;  4XBT A;  1W01 A;  2W9P A;  3X41 A;  1IU7 A;  1Y4K A;  4O2H A;  4ORL A;  3K63 A;  3CCJ 3;  2RSX A;  3EBT A;  1DVD A;  1LOY A;  1JN5 B;  3H3H A;  2XSH B;  2BIR A;  1GMQ A;  3FH1 A;  3B4P A;  1YJ9 3;  1UCI A;  3MYT A;  1UCL A;  3UL5 A;  4J9A A;  1JBR A;  1TTO A;  1CYU A;  1U5O A;  2XEP A;  2XR8 B;  1AV4 A;  3DMC A;  3F8X A;  3S28 A;  3STD A;  4BIR A;  4PEJ A;  3OXA A;  1GMR A;  2KF5 A;  2XFT A;  4J5G A;  5AIG A;  5DRE A;  2QEX 3;  3CU3 A;  4GHO A;  1WTH A;  3B4O A;  3EF8 A;  2CW9 A;  1NDO B;  1I3I A;  3AGO A;  1EKM A;  3JUQ A;  3WMD A;  6STD A;  2W56 B;  5M19 A;  3CPW 2;  2OTL 3;  1B21 A;  6GSP A;  1RGG A;  2RBI A;  1FGQ A;  1PFP A;  2XRX B;  3H51 A;  1YGE A;  2HMK B;  1HKX A;  1U8C B;  2W56 A;  4G1M B;  2E2U A;  1TJD A;  3HOH A;  3JUN A;  3TDG A;  2OQE A;  2OTJ 3;  3VF1 A;  1RLS A;  1FGM A;  1RN4 A;  3GZB A;  1OGZ A;  4AKY A;  1BUQ A;  3SLU A;  2GBX B;  4AKZ A;  1BRJ A;  2QGU A;  1W6G A;  3EB8 A;  2CG1 A;  4HM2 B;  1JB2 A;  3S5C A;  4MMY B;  1TP6 A;  3G4S 3;  3MHE A;  4HM7 B;  1GY7 A;  3ZG0 A;  1JKG A;  4N6V 0;  3FKA A;  1W00 A;  3DUK A;  1TUH A;  1CQS A;  3PZW A;  1A2P A;  1ZGX A;  3N8B A;  2IYJ A;  5AEU B;  1GMP A;  3ALA A;  3AMO B;  4R9K A;  4XB5 A;  1BUJ A;  1L5G B;  4KFD A;  1QVF 2;  2R4I A;  1T3B A;  4HVN A;  2Q07 A;  2YFJ B;  1TRP A;  4FCJ A;  2GEY A;  3RDE A;  3U1W A;  1Q42 A;  3F7X A;  5AII A;  3AMO A;  5CXO A;  3WA3 A;  4N3V A;  4HM1 B;  2F56 A;  2CH9 A;  4L7K A;  1I2E A;  3ROB A;  1A67 A;  3FF0 A;  1OF5 A;  1KQS 2;  2CFK A;  1UDI I;  3G71 3;  5JPU A;  2CWT A;  1BOX A;  3KN4 A;  2MC8 A;  1VQP 3;  1ZS7 A;  3JUP A;  3T0U A;  1CYV A;  1I2F A;  1V74 A;  1E3R A;  2HMJ B;  3LT8 A;  4DKI A;  2UGI A;  2FXT A;  2CC3 A;  5JBS A;  3EBY A;  1BU4 A;  3CXC 2;  2QIY A;  3UB1 A;  5I97 A;  1PU4 A;  1M90 4;  2Y74 A;  4XDV A;  2KCD A;  1MNL A;  4BTW A;  1ROA A;  5AEW B;  1WMP A;  4CJN A;  4TX4 A;  1IVV A;  3M8C A;  5M1A A;  2Z7A A;  1YGW A;  4LYL B;  1NU3 A;  3KSE D;  4STD A;  1RGF A;  3LYG A;  1YHQ 3;  4RNT A;  1FUS A;  3AHS A;  3URP A;  1T2I A;  5IEN A;  1W2Z A;  2K0M A;  4X2O A;  2QA4 3;  1VQ7 3;  2W6J H;  3Q2P A;  2C4B A;  1JB4 A;  1NNV A;  2OWP A;  1ZX2 A;  1IQ8 A;  4L8O A;  3L0R A;  4QWT A;  1PY3 A;  3S67 A;  3K7C A;  2MF7 A;  3V98 A;  2RFR A;  2ZHX B;  3MPH A;  1W7C A;  5AI1 A;  3CMA 3;  3N54 B;  4O8S A;  1NJI 4;  2GXF A;  3OWY A;  1BRH A;  7GSP A;  3O8Y A;  1Q40 B;  1TRQ A;  1IYY A;  3FF2 A;  1IQY A;  3JUO A;  1M9G A;  1GS3 A;  2IUK A;  3VGN A;  2F98 A;  3LH4 A;  1N9J A;  2PNC A;  1BNE A;  1FGR A;  1UGH I;  1OCV A;  1VQM 3;  2HOH A;  1Q40 A;  1RRH A;  4WFO A;  1YJW 3;  1BRI A;  1QJG A;  1B3S A;  3NV0 B;  1R4Y A;  1LXE A;  1WMO A;  2O3O A;  3RGR A;  1W02 A;  2WGQ A;  3KSP A;  5IG5 A;  3CME 3;  2SBL A;  2HMM B;  2XGL A;  3FGY A;  4OUQ A;  4IT7 A;  5EVH A;  2F99 A;  3SXX A;  3D79 A;  4N6U A;  3CC7 3;  5A0O B;  3NV0 A;  1JBT A;  4K61 A;  1KC8 4;  3I0Y A;  3Q1C A;  3MSO A;  1BNF A;  4R80 A;  1FZU A;  4U13 A;  1C54 A;  1LOV A;  1G96 A;  5G2G A;  2O9U X;  1D6Z A;  4WYK B;  2CG0 A;  1RJO A;  1BGS A;  4IIA A;  2L4V A;  3CCM 3;  1DVC A;  1TIJ A;  1ROV A;  2Z76 A;  2XH9 A;  2B1X B;  1N9E A;  1BSA A;  1N5P A;  1JN5 A;  1AY7 A;  1GOV A;  1B2M A;  1TFK A;  2D1W A;  4XBY A;  3FZW A;  3MWZ A;  4CDL A;  1SJW A;  2OOV A;  3QRD A;  2H0H A;  3HK4 A;  1X1X A;  3CNM A;  2KRT A;  2SAR A;  1X1W A;  3A76 A;  1S72 3;  4HM8 B;  3UNL A;  3NBB A;  2K3D A;  1Q82 4;  7STD A;  2HMN B;  5LC6 A;  3D3L A;  1QAK A;  1WMN A;  1EA2 A;  4R4K A;  4HJL B;  4N6L A;  5M18 A;  1KSI A;  2KF4 A;  1TFO A;  1RKY A;  4FMC A;  3K0Z A;  1FUW A;  1RCL A;  3NM7 A;  3E99 A;  1BSB A;  3RGA A;  3BIR A;  3LT9 A;  5IER A;  3I56 3;  1Q7H A;  2J8X B;  1JJ2 2;  3MG2 A;  1VQ5 3;  2OCT A;  3PYJ A;  3FG4 A;  2XF3 A;  5LC7 A;  3CCU 3;  1YIJ 3;  4HM0 B;  1UCK A;  4EV5 A;  1GD4 A;  4N6O B;  2XSO B;  4MMZ B;  4EBG A;  2CFG A;  1UUG B;  3BU4 A;  1RSN A;  3SX1 A;  2F5W A;  3WR2 A;  1I3F A;  1HYF A;  2BMR B;  2P0M A;  3HIG A;  4KT3 B;  3GZR A;  3SYU A;  1B2S A;  6RNT A;  2F4Y A;  4RZM A;  3IMA B;  2IMJ A;  5D82 A;  4CCV A;  3WOE B;  1FGT A;  1ULJ B;  3B8L A;  5HGR A;  2WO0 A;  5CF2 A;  2H0G A;  3LML A;  2BMO B;  1TU5 A;  1EQK A;  3BNE A;  4NHF A;  1G0T A;  3EE1 A;  1RN1 A;  1OPY A;  2LYX A;  1EG9 B;  2OOV C;  1OHO A;  3PS8 A;  3F40 A;  4H61 A;  4HBR A;  4EW5 A;  1MGR A;  4BU4 A;  2WOH A;  1UI8 A;  2A15 A;  2ML6 A;  2P0X A;  3DXO A;  1B20 A;  4XDW A;  1BRS A;  1F8N A;  1RGC A;  4LGQ A;  5HOH A;  4OVM A;  3OV4 A;  3WOD G;  4ILF A;  1VQ9 3;  4O02 B;  2GEX A;  3S29 A;  1OUN A;  1RNT A;  3NHX A;  2BO9 B;  1LQM B;  1STD A;  1V58 A;  3D5G A;  3GRD A;  3OWU A;  3U97 A;  3LTA A;  4HKV B;  4N6M A;  1SQW A;  2P09 A;  3F7S A;  1BRG A;  3G8Z A;  4FR9 A;  4HM6 B;  1Q9E A;  4Q53 A;  4KFF A;  1I8V A;  3GZY B;  4X2H A;  1E3V A;  1I0V A;  3KCH A;  2OQE C;  1BNS A;  3KZT A;  4K90 B;  1VZZ A;  1AVK A;  3K5T A;  4LMI A;  2ZA4 A;  3LTB A;  4R1K A;  5IG3 A;  1V57 A;  4XBX A;  2IA7 A;  3OX9 A;  1RGK A;  5G1K A;  1JV2 B;  3SVA A;  3PCR A;  1JNQ A;  2BMQ B;  3S27 A;  1IT7 A;  2CWV A;  3BB9 A;  1BIR A;  1QAF A;  5IG0 A;  5KP4 A;  3WOF B;  1GYB A;  1QMA A;  2RGQ A;  1B2Z A;  3EC9 A;  1BNG A;  3BNB A;  1IVU A;  1KD1 4;  4HYZ A;  2CWU A;  2WOF A;  4RBN A;  3UJM A;  4FMD A;  3CC4 3;  4HOH A;  2K54 A;  2E2T A;  2W03 A;  3NXJ A;  1ULI B;  1LOW A;  1QAL A;  1RDS A;  4I4K A;  1RGE A;  2CIU A;  2STD A;  4LZI A;  3PCS A;  3PGB A;  5BVB A;  2F5M A;  2PZV A;  5CF1 A;  3FSD A;  2F86 B;  4I5Q A;  5IG4 A;  1I2G A;  3X40 A;  4HZB B;  1E97 A;  4EC6 A;  1O7M B;  4L8P A;  1YJN 3;  3Q90 A;  4MMX B;  5AYR B;  3MG3 A;  2BT3 A;  3DH2 A;  4HM3 B;  1DMM A;  1R4C A;  4HM4 B;  2H0I A;  1UI7 A;  3AHW A;  3MG1 A;  1OAC A;  2JQ5 A;  2CX1 A;  4GB5 A;  4MEI A;  4FMA A;  4RNZ A;  3SED A;  1VQ8 3;  1O7N B;  2D42 A;  3WHO A;  3WDG B;  2FNQ A;  1GOY A;  1I70 A;  2CK3 H;  2KXG A;  2P05 A;  3QK9 A;  3CCV 3;  3LZA A;  5ELJ A;  5DRV A;  3GSP A;  1IV9 A;  2W9Q A;  1DET A;  3DGO A;  1X1U A;  2BU4 A;  3HX8 A;  1W6C A;  2I9W A;  1FUT A;  1RMS A;  3EN8 A;  3NBR A;  1YNV X;  1VQ4 3;  2FGT A;  1IVW A;  1IT8 A;  3OW2 2;  1IQX A;  1O7W B;  4J8T A;  3LOY A;  2ZL8 A;  4LEH A;  2AAD A;  1VQN 3;  1KWI A;  1ASK A;  3AGN A;  4O3V A;  3KKG A;  1ISK A;  1N8Q A;  1N5H A;  1WQL B;  2GBW B;  3EN1 B;  1IVX A;  4OK0 A;  1LOX A;  5D83 A;  1A2K A;  3KII A;  1MWR A;  5RNT A;  1BRK A;  1A2V A;  4JRF A;  5IW9 A;  3D4A A;  2JDI H;  4WYK A;  3ECF A;  5AIF A;  1OGX A;  3DGM A;  5IF6 A;  2XGN A;  1BAN A;  1VQL 3;  3KFQ C;  5CK6 A;  1GSP A;  3DY5 A;  2AAE A;  1LNI A;  5EQL A;  3NUV A;  1IDP A;  2Z6B A;  3NQY A;  3RNT A;  1JZD A;  2CHC A;  5TGN A;  4AEQ A;  3CCE 3;  2UUG C;  2ML5 A;  1K9M 4;  1C7H A;  5EEO A;  5BXQ A;  3CNX A;  1LQG C;  4CPK A;  2UX0 A;  3CPO A;  4JF8 A;  1YVS A;  1B27 A;  1PYL A;  2YX9 A;  1UGI A;  3I55 3;  2E2V A;  1O7G B;  2HML B;  3K9M C;  3DGL A;  5KP3 A;  1BAO A;  1RNB A;  1I0X A;  4FMB A;  1VQQ A;  1BNI A;  4KVH A;  5G1L A;  1FYS A;  1K41 A;  1RN7 A;  2V1L A;  3DZL A;  2GSP A;  3SOA A;  3N9H A;  4IPB A; 
#chains in the Genus database with same CATH homology
 1SPU A;  3FLJ A;  1UUW B;  1US1 A;  3JUM A;  4XM4 A;  3FG1 A;  1W5Z A;  3GZX B;  5FW5 A;  1UW1 A;  2B24 B;  3EHC A;  1JRQ A;  4K1U A;  3X3X A;  5KP1 A;  1NO3 A;  2BNG A;  4WHA A;  3CCR 3;  2YFI B;  3JVC A;  1LNH A;  2HMO B;  3T8N A;  2W2C A;  4RNY A;  1Q7Y 4;  3GWR A;  1JKG B;  1ZO2 A;  1CEW I;  4NRE A;  5IEP A;  1DMN A;  1VQO 3;  1NB3 I;  2C10 A;  3IPT A;  1YI2 3;  2GU1 A;  4KFE A;  2Y73 A;  2CFW A;  2CFD A;  5AIH A;  1AVL A;  4HM5 B;  3HI7 A;  3HZP A;  1OHP A;  2W0Q A;  1YVB I;  3X3Y A;  2ZDJ A;  5JPP A;  1Z1S A;  3F14 A;  5FGO A;  1VQK 3;  1OF5 B;  3NM2 A;  3V92 A;  8CHO A;  2C11 A;  1DYU A;  3PXM A;  3B7C A;  1K8A 4;  1D6Y A;  3G6E 3;  3IJE B;  3HII A;  1GY6 A;  2CFL A;  5CLK A;  4FCZ A;  4HZ9 B;  1D6U A;  4WP5 A;  1NB5 I;  1O7P B;  3CCQ 3;  3CCL 3;  3GAX A;  3KE7 A;  4ZM8 A;  3CCS 3;  3EX9 A;  4EV2 A;  1IV7 A;  3LTC A;  1YIT 3;  4MJD A;  1IK3 A;  1STF I;  3NX0 A;  1SII A;  2P38 A;  3X3Z A;  2BHM A;  3V99 A;  1Q81 4;  3LXU X;  1Q86 4;  3NQZ A;  1W2B 2;  4BTY A;  3D9R A;  1QVG 2;  1VQ6 3;  3F9S A;  4N6N B;  3DM8 A;  2W04 A;  1RRL A;  4K1V A;  4GL6 A;  4EXR A;  3UL6 A;  1GD3 A;  3CD6 3;  3J7Y d;  3LTD A;  3ER7 A;  2RCD A;  3BND A;  3BLZ A;  5IEO A;  1A90 A;  3BNC A;  2YFL B;  3SOY A;  4KZ1 A;  1K28 A;  4LSO A;  3MKI A;  1MOL A;  3OWS A;  1W6Y A;  3F8H A;  2GU3 A;  2M7O A;  1W4N A;  1HU9 A;  4EYC A;  3WA2 X;  3X42 A;  1T5Y A;  1FA3 A;  2Z77 A;  1SIH A;  3DGN A;  5ELU A;  1N8R 4;  2LQV A;  3G0K A;  1K73 4;  1LVN A;  1WNH A;  3FCS B;  5STD A;  3FG3 A;  1JB5 A;  2WGO A;  1M1K 4;  1UUV B;  1O7H B;  3NBJ A;  1OHS A;  1GY5 A;  2XFS A;  1J2B A;  4BTX A;  1S5A A;  4FCM A;  4WWU C;  4H3U A;  3T8U A;  5D81 A;  3CC2 3;  1M1X B;  2INX A;  1FGO A;  5AYS C;  1DMQ A;  4R9L A;  1OH0 A;  3EQQ B;  2CKF B;  3EJV A;  4N6T A;  3VSY A;  1AR0 A;  1NWW A;  2IUJ A;  3G16 A;  4XBT A;  1W01 A;  2W9P A;  3X41 A;  1IU7 A;  1Y4K A;  4O2H A;  4ORL A;  3K63 A;  3CCJ 3;  2RSX A;  3EBT A;  1DVD A;  1JN5 B;  3H3H A;  2XSH B;  3FH1 A;  3B4P A;  1YJ9 3;  3MYT A;  3UL5 A;  4J9A A;  1CYU A;  1U5O A;  2XEP A;  2XR8 B;  1AV4 A;  3DMC A;  3F8X A;  3S28 A;  3STD A;  4PEJ A;  3OXA A;  5AIG A;  2XFT A;  5DRE A;  2QEX 3;  3CU3 A;  1WTH A;  3B4O A;  3EF8 A;  2CW9 A;  1NDO B;  1EKM A;  3JUQ A;  3WMD A;  6STD A;  2W56 B;  3CPW 2;  2OTL 3;  1FGQ A;  1PFP A;  2XRX B;  3H51 A;  1YGE A;  2HMK B;  1HKX A;  1U8C B;  2W56 A;  4G1M B;  2E2U A;  3JUN A;  3TDG A;  2OQE A;  2OTJ 3;  3VF1 A;  1FGM A;  3GZB A;  1OGZ A;  4AKY A;  1BUQ A;  3SLU A;  2GBX B;  4AKZ A;  2QGU A;  1W6G A;  3EB8 A;  2CG1 A;  4HM2 B;  1JB2 A;  3S5C A;  4MMY B;  1TP6 A;  3G4S 3;  3MHE A;  4HM7 B;  1GY7 A;  1JKG A;  4N6V 0;  3FKA A;  1W00 A;  3DUK A;  1TUH A;  1CQS A;  3PZW A;  3N8B A;  5AEU B;  3ALA A;  4R9K A;  3AMO B;  4XB5 A;  1L5G B;  4KFD A;  1QVF 2;  2R4I A;  4HVN A;  2Q07 A;  2YFJ B;  4FCJ A;  2GEY A;  3RDE A;  3U1W A;  1Q42 A;  3F7X A;  5AII A;  3AMO A;  5CXO A;  3WA3 A;  4N3V A;  4HM1 B;  2CH9 A;  4L7K A;  3ROB A;  1A67 A;  3FF0 A;  1OF5 A;  1KQS 2;  2CFK A;  3G71 3;  5JPU A;  2CWT A;  3KN4 A;  1VQP 3;  2MC8 A;  3JUP A;  3T0U A;  1CYV A;  1V74 A;  1E3R A;  2HMJ B;  3LT8 A;  2FXT A;  2CC3 A;  5JBS A;  3EBY A;  3CXC 2;  2QIY A;  3UB1 A;  5I97 A;  1PU4 A;  1M90 4;  2Y74 A;  4XDV A;  2KCD A;  1MNL A;  4BTW A;  1ROA A;  5AEW B;  1WMP A;  4TX4 A;  1IVV A;  3M8C A;  2Z7A A;  1NU3 A;  3KSE D;  4STD A;  3LYG A;  1YHQ 3;  5IEN A;  1W2Z A;  2K0M A;  4X2O A;  2QA4 3;  1VQ7 3;  2W6J H;  3Q2P A;  1JB4 A;  2OWP A;  1ZX2 A;  1IQ8 A;  4L8O A;  3L0R A;  4QWT A;  3S67 A;  3K7C A;  2MF7 A;  3V98 A;  2RFR A;  3MPH A;  5AI1 A;  1W7C A;  3CMA 3;  3N54 B;  4O8S A;  1NJI 4;  2GXF A;  3OWY A;  3O8Y A;  1Q40 B;  3FF2 A;  1IQY A;  3JUO A;  1M9G A;  1GS3 A;  2IUK A;  3VGN A;  2F98 A;  3LH4 A;  1N9J A;  2PNC A;  1FGR A;  1OCV A;  1VQM 3;  1Q40 A;  1RRH A;  4WFO A;  1YJW 3;  3NV0 B;  1QJG A;  1LXE A;  1WMO A;  2O3O A;  3RGR A;  1W02 A;  2WGQ A;  3KSP A;  5IG5 A;  3CME 3;  2SBL A;  2HMM B;  2XGL A;  3FGY A;  4OUQ A;  4IT7 A;  5EVH A;  2F99 A;  3SXX A;  4N6U A;  3CC7 3;  5A0O B;  3NV0 A;  4K61 A;  1KC8 4;  3I0Y A;  3Q1C A;  3MSO A;  4R80 A;  4U13 A;  1G96 A;  5G2G A;  2O9U X;  1D6Z A;  4WYK B;  2CG0 A;  1RJO A;  4IIA A;  2L4V A;  3CCM 3;  1DVC A;  1TIJ A;  1ROV A;  2Z76 A;  2XH9 A;  2B1X B;  1N9E A;  1N5P A;  1JN5 A;  1TFK A;  2D1W A;  4XBY A;  3FZW A;  3MWZ A;  4CDL A;  1SJW A;  2OOV A;  3QRD A;  3HK4 A;  3CNM A;  2KRT A;  3A76 A;  1S72 3;  4HM8 B;  3UNL A;  3NBB A;  1Q82 4;  7STD A;  2HMN B;  5LC6 A;  3D3L A;  1QAK A;  1WMN A;  1EA2 A;  4R4K A;  4HJL B;  4N6L A;  1KSI A;  1TFO A;  1RKY A;  4FMC A;  3K0Z A;  1FUW A;  3NM7 A;  3E99 A;  3RGA A;  3LT9 A;  5IER A;  3I56 3;  1JJ2 2;  3MG2 A;  1VQ5 3;  2OCT A;  3PYJ A;  3FG4 A;  2XF3 A;  5LC7 A;  3CCU 3;  1YIJ 3;  4HM0 B;  4EV5 A;  1GD4 A;  4N6O B;  2XSO B;  4MMZ B;  4EBG A;  2CFG A;  3SX1 A;  2BMR B;  2P0M A;  3HIG A;  3GZR A;  4RZM A;  3IMA B;  2IMJ A;  5D82 A;  4CCV A;  3WOE B;  1FGT A;  1ULJ B;  3B8L A;  5HGR A;  2WO0 A;  5CF2 A;  3LML A;  2BMO B;  1TU5 A;  1EQK A;  3BNE A;  4NHF A;  3EE1 A;  4H61 A;  1OPY A;  2LYX A;  1EG9 B;  2OOV C;  1OHO A;  3PS8 A;  3F40 A;  4HBR A;  2WOH A;  1UI8 A;  2A15 A;  2ML6 A;  2P0X A;  3DXO A;  4XDW A;  1F8N A;  4LGQ A;  4OVM A;  3OV4 A;  3WOD G;  1VQ9 3;  4O02 B;  2GEX A;  3S29 A;  1OUN A;  3NHX A;  2BO9 B;  3U97 A;  1STD A;  3GRD A;  3OWU A;  3LTA A;  4HKV B;  4N6M A;  1SQW A;  2P09 A;  3F7S A;  3G8Z A;  4FR9 A;  4HM6 B;  4Q53 A;  4KFF A;  3GZY B;  4X2H A;  1E3V A;  4K90 B;  3KZT A;  2OQE C;  1VZZ A;  1AVK A;  3K5T A;  4LMI A;  4R1K A;  3LTB A;  5IG3 A;  4XBX A;  2IA7 A;  3OX9 A;  1JV2 B;  3SVA A;  3PCR A;  1JNQ A;  2BMQ B;  3S27 A;  1IT7 A;  2CWV A;  3BB9 A;  1QAF A;  5IG0 A;  5KP4 A;  3WOF B;  1GYB A;  1QMA A;  2RGQ A;  3EC9 A;  3BNB A;  1IVU A;  1KD1 4;  4HYZ A;  2CWU A;  2WOF A;  4RBN A;  3UJM A;  4FMD A;  3CC4 3;  2K54 A;  2E2T A;  2W03 A;  3NXJ A;  1ULI B;  1QAL A;  4I4K A;  2CIU A;  2STD A;  4LZI A;  3PCS A;  3PGB A;  5BVB A;  2PZV A;  5CF1 A;  3FSD A;  2F86 B;  5IG4 A;  3X40 A;  4HZB B;  1E97 A;  4EC6 A;  1O7M B;  4L8P A;  1YJN 3;  3Q90 A;  4MMX B;  5AYR B;  3MG3 A;  2BT3 A;  4HM3 B;  1DMM A;  1R4C A;  4HM4 B;  1UI7 A;  3MG1 A;  4MEI A;  1OAC A;  2JQ5 A;  4GB5 A;  4FMA A;  4RNZ A;  3SED A;  1VQ8 3;  1O7N B;  2D42 A;  3WDG B;  2FNQ A;  2CK3 H;  2KXG A;  2P05 A;  3QK9 A;  3CCV 3;  3LZA A;  5ELJ A;  5DRV A;  1IV9 A;  2W9Q A;  3DGO A;  3NBR A;  3HX8 A;  1W6C A;  2I9W A;  3EN8 A;  1VQ4 3;  2FGT A;  1IVW A;  1IT8 A;  3OW2 2;  1IQX A;  1O7W B;  4J8T A;  3LOY A;  2ZL8 A;  4LEH A;  1VQN 3;  1KWI A;  1ASK A;  4O3V A;  3KKG A;  1ISK A;  1N8Q A;  1N5H A;  1WQL B;  2GBW B;  3EN1 B;  1IVX A;  4OK0 A;  1LOX A;  5D83 A;  1A2K A;  3KII A;  1A2V A;  4JRF A;  5IW9 A;  2JDI H;  4WYK A;  3ECF A;  5AIF A;  1OGX A;  3DGM A;  5IF6 A;  2XGN A;  1VQL 3;  3KFQ C;  5CK6 A;  3DY5 A;  5EQL A;  3NUV A;  1IDP A;  2Z6B A;  3NQY A;  4AEQ A;  2CHC A;  3CCE 3;  5TGN A;  2ML5 A;  1K9M 4;  1C7H A;  5EEO A;  5BXQ A;  3CNX A;  2UX0 A;  3CPO A;  4JF8 A;  2YX9 A;  3I55 3;  2E2V A;  1O7G B;  2HML B;  3K9M C;  3DGL A;  5KP3 A;  4FMB A;  4KVH A;  1K41 A;  1RN7 A;  2V1L A;  3DZL A;  3SOA A;  3N9H A;  4IPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...