1KQS2

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kqs200
2QEX3 3CC23 1VQ53 3CME3 1YHQ3 3CC43 3CMA3 2OTJ3 1YJ93 3I563 3CCV3 1VQK3 3CCS3 1S723 1KQS2 3CCE3 1VQ93 1Q864 1N8R4 1K9M4 1VQL3 2QA43 3G6E3 3CCJ3 1VQ43 1M1K4 3G4S3 1VQO3 3CCQ3 3CXC2 1YJW3 1YIJ3 1KC84 1KD14 3CCL3 1VQP3 1VQ73 1YIT3 1W2B2 1Q824 3CCM3 1YJN3 1QVG2 1QVF2 1VQN3 3CPW2 1VQ83 2OTL3 1VQM3 3CD63 3OW22 3G713 1YI23 1NJI4 3CCR3 1K8A4 1JJ22 1Q814 1M904 1VQ63 3CC73 1Q7Y4 3CCU3 1K734 3I553
chains in the Genus database with same CATH superfamily
5AIHA 2MC8A 2CW9A 3ZG5A 1Y4KA 1QAFA 2CFDA 3CU3A 2L1SA 4HM5B 7RNTA 2OTJ3 4X2HA 2LQVA 1RRHA 5A0OB 5IG0A 3URPA 3NHXA 3LOYA 4WYKB 4HKVB 1RNBA 1GD3A 1I8VA 1HU9A 2F4YA 2HMOB 2IA7A 2KF4A 1SIIA 1SPUA 2P09A 5AIFA 1N9EA 2INXA 3D9RA 2C4BA 3EBTA 3MG3A 1B3SA 1BSAA 1X1XA 3DM8A 3MWZA 4FCJA 1LRAA 1MGRA 2E2UA 5AYSC 2LYXA 1BNGA 3D3LA 1TIJA 1UGIA 5IW9A 1YI23 5IG4A 3CD63 1FA3A 3NBRA 6GSPA 1ULIB 3D79A 1J2BA 4K1UA 1K734 2IMJA 1O7MB 1SQWA 1N8QA 2HMMB 3F40A 1DMQA 1LOYA 3WA3A 3I563 1RGAA 4N6LA 1GOUA 1IT8A 1E3RA 2ZDJA 4HAAA 1ISKA 1V74A 1Q40A 3GZRA 1FGOA 1AY7A 3K5TA 1N8R4 3T8UA 2MF7A 1OCVA 1VQL3 2YFIB 1UI7A 1RGGA 1JV2B 3CXC2 3EHCA 3MG1A 1EA2A 3NBJA 1O7NB 3O8YA 4R9LA 2KXGA 2P05A 3CCL3 2HMLB 3EBYA 3ZFZA 3Q1CA 4IT7A 4AEQA 1YIT3 1QVF2 1BVIA 3J7Yd 2H0IA 5JPPA 4XDWA 1VQ83 2W2CA 1RN4A 2OTL3 1CQSA 1N5HA 3MPHA 5M18A 1GY6A 1RGEA 1TUHA 1LQMB 2F86B 1I70A 4LEHA 1BNEA 1JKGB 2RNTA 4XBXA 4HM4B 5G1KA 1RDSA 4BTYA 2ZHXB 1BRJA 3G0KA 3K7CA 3SXXA 3AGOA 1W02A 3DH2A 3WHOA 3MKIA 2I9WA 2QA43 3B4OA 4RBNA 1BRIA 3CNXA 4KFFA 7GSPA 4LGQA 3MHEA 3PS8A 5IG5A 1QVG2 4HM1B 4BIRA 1YJN3 1BSCA 3DXOA 3BU4A 3NXJA 4WFOA 5AI1A 3NQYA 1GMPA 2Y74A 5DREA 3OV4A 1TRPA 4R9KA 1WMNA 4EYCA 2XSHB 2ZL8A 2CFLA 3LZAA 3LTAA 4RZMA 5IENA 2P0MA 1VQ53 3OWSA 3OWUA 1AR0A 3DGOA 4J9AA 5IEOA 1ZO2A 1HKXA 3NUVA 3V92A 2FXTA 5AEWB 5M19A 1UW1A 1MWSA 3KIIA 2Z76A 2KRTA 3F9SA 1JKGA 3H3HA 1JRQA 1BNFA 4KFDA 1JB2A 2CWTA 1GS3A 4L7KA 3UL5A 2R41A 3LH4A 1K41A 1UCKA 1VQ43 1I2GA 1B27A 2D1WA 1NNVA 1IQYA 5DRVA 1MWUA 3UL6A 3NQZA 4ORLA 4EV2A 4N6TA 4XM4A 4HM7B 5HOHA 3FF0A 3CNMA 1HYFA 3HK4A 5BU4A 2CKFB 3CCR3 2BMQB 4RNTA 3AHWA 5ELUA 4JF8A 3UJMA 2OOVC 2V1LA 3EJVA 1LNIA 3KE7A 2L4VA 4KT3B 4JRFA 4N3VA 1W4NA 1Q7HA 3JVCA 3JUOA 1OHPA 3OXAA 4HBRA 2OQEA 2A15A 6STDA 1O7WB 3VGNA 1G96A 5CF2A 3G8ZA 3S27A 2IYJA 3G6E3 3OWYA 1BRSA 4KZ1A 5JBSA 4LYLB 1BSBA 1RTUA 3UNLA 2JDIH 2KF6A 1YGEA 3M8CA 4EXRA 4HZ9B 1YIJ3 1F8NA 1JZDA 1Q824 1FW7A 3EQQB 1D6YA 3JUMA 1VQN3 1IQXA 2B1XB 2O9UX 1CEWI 2PNCA 4HYZA 4BL3A 1M904 4FMCA 2F98A 1FZUA 1UUGB 3DGNA 1DMNA 3DY5A 4K90B 3D4AA 1SIHA 5G2GA 4CJNA 1PU4A 3T0UA 1ZGXA 1K28A 4GHOA 1GYBA 1RMSA 1E3VA 4HM3B 4EW5A 2ZA4A 4WWUC 3PZWA 1W6YA 1UCLA 1B2XA 1LXEA 3LYGA 2HMKB 1B2MA 1W00A 3JUQA 3NBBA 2W04A 4RNZA 1YVSA 2UX0A 3EC9A 3S28A 1TP6A 2GU1A 3FG1A 4NPBA 3VSYA 3BB9A 1I2EA 2Q07A 4L8OA 4BL2A 1NB3I 1UI8A 4KVHA 3X41A 4HM6B 4AKZA 5BXQA 2GU3A 5HGRA 2XF3A 5RNTA 1OH0A 3ALAA 4MEIA 1GSPA 3G713 5CK6A 2K54A 1IVUA 3B4PA 4U13A 1NJI4 1BRNL 1ROAA 1VZZA 4J8TA 2K0MA 4DKIA 4PEJA 1BNSA 4MMZB 1VQ63 1B2UA 1I3FA 3HIGA 3FG4A 1GOVA 1UUWB 4IIAA 1A2PA 1AVKA 2XH9A 4N6UA 2CG1A 3V98A 2YFJB 4OVMA 5G1LA 3KN4A 3ROBA 3CCV3 2YX9A 3DUKA 3ER7A 4FCMA 3SLUA 3WOFB 1D6UA 1DMMA 3HX8A 1TU5A 2W9QA 5JPUA 2CG0A 1W01A 1V58A 3K9MC 3EN1B 3IJEB 2CWVA 1OF5B 2F99A 2WO0A 3KSED 4J5KA 1BRKA 1US1A 3ZG0A 4MMXB 4BTXA 3F8XA 3GRDA 5M1AA 1FYSA 1RGCA 1FUSA 3U1WA 3FH1A 5BIRA 1BNJA 3MYTA 1IU7A 4KFEA 1A2VA 1FUTA 2ML6A 1S5AA 1V57A 1DYUA 3IMAB 1A2KA 1RN7A 2RCDA 5LC7A 1BAOA 1UGHI 1C7HA 1IVXA 5CLKA 3RGRA 3GZXB 4K1VA 3CCS3 4RNYA 4O02B 1K9M4 1AV4A 1WMOA 3CCJ3 2XRXB 2HMNB 4EV5A 3AMOB 2KAAA 3HIIA 4QWTA 1YJW3 2UUGC 1T3BA 1WNHA 2C11A 1BIRA 1VQ73 1PY3A 1CH0A 2KF5A 3CCM3 3KZTA 5FW5A 3NM7A 2BIRA 2CX1A 3PXMA 2CX0A 4H3UA 3GSPA 5KP1A 1BRHA 1N5PA 1BU4A 1I0VA 3MSOA 4LMIA 1OF5A 3CCU3 4HOHA 1G0TA 3LT9A 1ASKA 2C10A 3EE1A 2W6JH 1DETA 4LZIA 3Q90A 1GD4A 2IUJA 3CCE3 2F5WA 2GBWB 3G16A 1M1XB 2BNGA 4FR9A 5AIGA 3SX1A 2XSOB 1IVWA 4I4KA 1RGLA 9RNTA 1M1K4 3FZWA 3D5IA 4XBTA 1BSDA 1X1UA 4FMDA 1UCJA 3KCHA 5BVBA 1MGWA 1G02A 3D5GA 4O2HA 4HVNA 2XFSA 1RSNA 4NREA 1TFKA 3X3YA 3DZLA 3B7CA 4FCZA 4MJDA 1QALA 1BOXA 1ZS7A 4O8SA 1IQ8A 2XR8B 1JBTA 1BANA 3L0RA 1LOWA 3FLJA 1LQGC 4HZBB 3PCSA 1FGQA 1I2FA 3AMOA 4N6OB 3LT8A 4XBYA 1U8CB 2W56A 3EF8A 3I553 1W2ZA 3LXUX 1FGMA 2R4IA 3I0YA 4BTWA 1JNQA 4HM2B 4LSOA 4GSPA 3PYJA 1YHQ3 4R1KA 1DVDA 1KWIA 2RSXA 4AKYA 4L8PA 1OPYA 1EQKA 4H61A 2W0QA 1KSIA 1Q9EA 1X1WA 8RNTA 1IT7A 1CYVA 1BNIA 1C54A 3FF2A 1PFPA 1CYUA 1GY7A 1NWWA 6RNTA 1IYYA 5GSPA 1RGFA 1KC84 1TFOA 2P38A 1RLSA 5IG3A 1R4CA 1GMRA 1TTOA 2OWPA 1RCKA 3F8HA 1N9JA 3GZYB 3K0ZA 3WDGB 5IEPA 2M7OA 1A67A 1JJ22 3VF1A 1Q7Y4 1W7CA 1B2ZA 4OK0A 3ECFA 2IY2A 2KCDA 3SOYA 3TDGA 4HJLB 5FGOA 5EVHA 2XEPA 1WTHA 3CMA3 3Q3FA 1M9GA 1T5YA 1YJ93 2WGQA 4G1MB 2E2VA 3WR2A 3GAXA 3WODG 3B8LA 3T8NA 4GB5A 4CDLA 2KF3A 1IV7A 4WHAA 4HM8B 1O7GB 2W9PA 3BNCA 1OGXA 5EEOA 2P0XA 1U5OA 2BT3A 4OUQA 4N6NB 1B21A 2RFRA 2Z7AA 3DGMA 4N6MA 4XB5A 5IF6A 3WA2X 2JQ5A 1RGKA 3CPW2 1NB5I 2HOHA 3HZPA 4I5QA 2H0HA 5AIIA 3SYUA 1YGWA 2GXFA 3NM2A 1MWTA 3GZBA 2UGIA 7STDA 1EUIC 3A76A 1RJOA 1YVBI 4WP5A 4HM0B 1NO3A 2QGUA 5TGNA 4FMAA 4N6V0 1I3IA 2CWUA 3FKAA 1LNHA 1Q864 3QRDA 2CC3A 3KSPA 2OCTA 2GSPA 3LTCA 2OQEC 3G4S3 1VQO3 2D42A 1MOLA 3PGBA 5CXOA 1Z1SA 2YFLB 3NX0A 3FSDA 2GBXB 1EKMA 4IPBA 1BSEA 1GOYA 1IK3A 3U97A 1OUNA 2PZVA 1DE3A 2ML5A 3DGLA 4J5GA 2WOHA 1UUVB 1UDII 3SOAA 1IVVA 1WQLB 1I0XA 2CIUA 3BNBA 2XFTA 2F56A 4R4KA 1LOXA 1RNTA 1W5ZA 2BHMA 1O7PB 1NDOB 1FGTA 3CME3 4NHFA 3S29A 2QIYA 1ZX2A 3BIRA 4ZM8A 1RN1A 3F14A 1MWRA 2AADA 5D82A 1JN5B 3SVAA 3X3XA 2K3DA 3RNTA 1VQ93 1JB5A 1STFI 3FG3A 1B2SA 1EEJA 2GEYA 5I97A 3N8BA 3CCQ3 3S5CA 8CHOA 5AEUB 1DVCA 5CF1A 2W56B 5LC6A 4WYKA 1O7HB 3F7SA 2GEXA 3KKGA 1T2HA 1VQM3 3AGNA 2FGTA 1PYLA 1FUWA 2H0GA 3N9HA 1QAKA 2OOVA 1LOVA 3WOEB 3S67A 4O3VA 1B20A 1VQQA 2CK3H 3EB8A 4STDA 3CC23 3Q2PA 3IPTA 3JUPA 1JZOA 1JBRA 3CC43 3H51A 1VQK3 2BO9B 1YNVX 5IERA 1RCLA 2F5MA 3DGYA 5D81A 5KP3A 1MNLA 1KQS2 2HMJB 4R80A 5AYRB 1GY5A 2FNQA 2Y73A 3PCRA 3LTDA 3E99A 4CPKA 5KP4A 1ROVA 3BLZA 1QJGA 2STDA 1JN5A 1BRGA 2CHCA 3MG2A 1OGZA 4K61A 2WGOA 3LTBA 2SBLA 3NV0B 4Q53A 3OW22 2AAEA 3N54B 1RGHA 2Z6BA 3EN8A 2Z77A 1Q814 3K63A 3EX9A 3BNDA 3CC73 2BU4A 2B24B 2CFKA 1A90A 2CH9A 1UCIA 3QK9A 3X42A 3DMCA 2WOFA 3STDA 3F7XA 3RGAA 1R4YA 1TJDA 4MMYB 1T2IA 1S723 3JUNA 3LMLA 1X1YA 1W6GA 3GWRA 1OACA 3RDEA 1SARA 1ULJB 3HOHA 1IV9A 3FCSB 1NU3A 1RRLA 1WMPA 4BU4A 4TX4A 1KD14 4X2OA 1VQP3 3A5EA 1LVNA 3V99A 4EBGA 3OX9A 1SJWA 3HI7A 1AQZA 2E2TA 3KFQC 2SARA 4GL6A 1AVLA 1IDPA 1QMAA 1BUJA 2QEX3 3BNEA 1EG9B 2IUKA 3CPOA 2XGNA 3FGYA 2J8XB 3NV0A 1HZ1A 2CFGA 1FGRA 1RHLA 3UB1A 1OHOA 1Q42A 2XGLA 1BUQA 3AHSA 1D6ZA 1BGSA 3SEDA 3X3ZA 5D83A 1E97A 1STDA 1L5GB 3WMDA 2CFWA 5ELJA 1OHSA 1JB4A 1TRQA 1BNRA 2RGQA 1W2B2 2O3OA 3X40A 2W03A 1GMQA 4XDVA 4CCVA 1W6CA 2BMRB 2BMOB 4FMBA 5EQLA 2RBIA 1K8A4 4EC6A 1Q40B 4ILFA 1JBSA 1RKYA 5STDA
chains in the Genus database with same CATH topology
5AIHA 2MC8A 2CW9A 1Y4KA 1QAFA 2CFDA 3CU3A 4HM5B 2OTJ3 4X2HA 2LQVA 1RRHA 5A0OB 5IG0A 3NHXA 3LOYA 4WYKB 4HKVB 1GD3A 1HU9A 2HMOB 2IA7A 1SIIA 1SPUA 2P09A 5AIFA 1N9EA 2INXA 3D9RA 3EBTA 3MG3A 4FCJA 3DM8A 3MWZA 5AYSC 5AEWB 5IW9A 2E2UA 3CD63 2LYXA 1YI23 3D3LA 1TIJA 1FA3A 5IG4A 3NBRA 1ULIB 1J2BA 4K1UA 1K734 2IMJA 1O7MB 1SQWA 1N8QA 2HMMB 3F40A 1DMQA 3WA3A 3I563 4N6LA 1IT8A 1E3RA 2ZDJA 1ISKA 1V74A 1Q40A 3GZRA 1FGOA 3K5TA 1N8R4 3T8UA 2MF7A 1OCVA 1VQL3 2YFIB 1UI7A 1JV2B 3CXC2 3EHCA 3MG1A 1EA2A 3NBJA 1O7NB 3O8YA 4R9LA 2KXGA 2P05A 3CCL3 2HMLB 3EBYA 1YIT3 3Q1CA 4IT7A 4AEQA 1QVF2 3J7Yd 5JPPA 4XDWA 1VQ83 2W2CA 2OTL3 1CQSA 1N5HA 3MPHA 1GY6A 1TUHA 2F86B 4LEHA 1JKGB 4XBXA 4HM4B 4BTYA 3G0KA 3K7CA 3SXXA 1W02A 3MKIA 2I9WA 2QA43 3B4OA 4RBNA 3CNXA 4KFFA 4LGQA 3MHEA 3PS8A 5IG5A 1QVG2 4HM1B 1YJN3 3DXOA 4WFOA 3NXJA 5AI1A 3NQYA 2Y74A 5DREA 3OV4A 4R9KA 1WMNA 4EYCA 2XSHB 2ZL8A 2CFLA 3LZAA 3LTAA 4RZMA 5IENA 2P0MA 1VQ53 3OWSA 3OWUA 1AR0A 3DGOA 4J9AA 5IEOA 1ZO2A 1HKXA 3NUVA 3V92A 2FXTA 1UW1A 3KIIA 2Z76A 2KRTA 3F9SA 1JKGA 3H3HA 1JRQA 4KFDA 1VQ43 1JB2A 2CWTA 1GS3A 4L7KA 3UL5A 3LH4A 1K41A 2D1WA 1IQYA 5DRVA 3UL6A 4EV2A 3NQZA 4ORLA 4N6TA 4XM4A 4HM7B 3FF0A 3CNMA 3HK4A 2CKFB 3CCR3 2BMQB 5ELUA 4JF8A 3UJMA 2OOVC 2V1LA 3EJVA 3KE7A 2L4VA 4JRFA 4N3VA 1W4NA 3JVCA 3JUOA 1OHPA 3OXAA 4HBRA 2OQEA 2A15A 6STDA 1O7WB 3VGNA 1G96A 5CF2A 3G8ZA 3S27A 3G6E3 3OWYA 4KZ1A 5JBSA 4EXRA 3UNLA 1YIJ3 2JDIH 3M8CA 1YGEA 4HZ9B 1F8NA 1Q824 3EQQB 1D6YA 3JUMA 1VQN3 1IQXA 2B1XB 2O9UX 1CEWI 2PNCA 4HYZA 1M904 4FMCA 2F98A 3DGNA 1DMNA 3DY5A 4K90B 1SIHA 5G2GA 1PU4A 3T0UA 1K28A 1GYBA 1E3VA 4HM3B 4WWUC 3PZWA 1W6YA 1LXEA 3LYGA 2HMKB 1W00A 3JUQA 3NBBA 2W04A 4RNZA 2UX0A 3EC9A 3S28A 1TP6A 2GU1A 3FG1A 3VSYA 3BB9A 2Q07A 4L8OA 1NB3I 1UI8A 4KVHA 3X41A 4HM6B 4AKZA 5BXQA 2GU3A 5HGRA 2XF3A 1OH0A 3ALAA 4MEIA 3G713 1NJI4 5CK6A 2K54A 1IVUA 3B4PA 4U13A 1ROAA 1VZZA 4J8TA 2K0MA 4PEJA 4MMZB 1VQ63 3HIGA 3FG4A 1UUWB 4IIAA 2XH9A 1AVKA 4N6UA 2CG1A 3V98A 2YFJB 4OVMA 3ROBA 3KN4A 3CCV3 2YX9A 3DUKA 3ER7A 4FCMA 3SLUA 3WOFB 1D6UA 1DMMA 3HX8A 1TU5A 2W9QA 5JPUA 2CG0A 1W01A 3K9MC 3EN1B 3IJEB 2CWVA 1OF5B 2F99A 2WO0A 3KSED 1US1A 4MMXB 4BTXA 3F8XA 3GRDA 3U1WA 3FH1A 3MYTA 1IU7A 4KFEA 1A2VA 2ML6A 1S5AA 1DYUA 3IMAB 1A2KA 1RN7A 2RCDA 5LC7A 1C7HA 1IVXA 5CLKA 3RGRA 3GZXB 4K1VA 3CCS3 4RNYA 4O02B 1K9M4 1AV4A 1WMOA 3CCJ3 2XRXB 2HMNB 4EV5A 3AMOB 3HIIA 1YJW3 4QWTA 2C11A 1WNHA 1VQ73 3CCM3 3KZTA 5FW5A 3NM7A 3PXMA 4H3UA 5KP1A 1N5PA 3MSOA 4LMIA 1OF5A 3CCU3 3LT9A 1ASKA 2C10A 3EE1A 2W6JH 4LZIA 3Q90A 1GD4A 2IUJA 3CCE3 2GBWB 3G16A 1M1XB 2BNGA 4FR9A 5AIGA 3SX1A 2XSOB 1IVWA 4I4KA 1M1K4 3FZWA 4XBTA 4FMDA 5BVBA 4O2HA 4HVNA 2XFSA 4NREA 3X3YA 1TFKA 3DZLA 3B7CA 4FCZA 4MJDA 1QALA 4O8SA 1IQ8A 2XR8B 3L0RA 3FLJA 4HZBB 3PCSA 1FGQA 3AMOA 4N6OB 3LT8A 4XBYA 1U8CB 2W56A 3EF8A 3I553 1W2ZA 3LXUX 1FGMA 2R4IA 3I0YA 4BTWA 1JNQA 4HM2B 4LSOA 3PYJA 1YHQ3 4R1KA 1DVDA 1KWIA 2RSXA 4AKYA 4L8PA 1OPYA 1EQKA 4H61A 2W0QA 1KSIA 1IT7A 1CYVA 3FF2A 1PFPA 1CYUA 1GY7A 1NWWA 1KC84 1TFOA 2P38A 5IG3A 1R4CA 2OWPA 3F8HA 1N9JA 3GZYB 3K0ZA 3WDGB 5IEPA 2M7OA 1A67A 1JJ22 3VF1A 1Q7Y4 1W7CA 4OK0A 3ECFA 2KCDA 3SOYA 3TDGA 4HJLB 5FGOA 5EVHA 2XEPA 1WTHA 3CMA3 1YJ93 1M9GA 1T5YA 2WGQA 4G1MB 2E2VA 3GAXA 3WODG 3B8LA 3T8NA 4GB5A 4CDLA 1IV7A 4WHAA 4HM8B 1O7GB 2W9PA 3BNCA 1OGXA 5EEOA 2P0XA 1U5OA 2BT3A 4OUQA 4N6NB 2Z7AA 2RFRA 3DGMA 4N6MA 4XB5A 5IF6A 3WA2X 2JQ5A 3CPW2 1NB5I 5AIIA 3HZPA 2GXFA 3NM2A 3GZBA 7STDA 3A76A 1RJOA 1YVBI 4WP5A 4HM0B 1NO3A 2QGUA 5TGNA 4FMAA 4N6V0 2CWUA 3FKAA 1LNHA 1Q864 3QRDA 2CC3A 3KSPA 2OCTA 3LTCA 2OQEC 3G4S3 1VQO3 2D42A 1MOLA 3PGBA 5CXOA 1Z1SA 2YFLB 3NX0A 3FSDA 2GBXB 1EKMA 4IPBA 1IK3A 3U97A 1OUNA 2PZVA 2ML5A 3DGLA 2WOHA 1UUVB 3SOAA 1IVVA 1WQLB 2CIUA 3BNBA 2XFTA 4R4KA 1LOXA 1W5ZA 2BHMA 1O7PB 1NDOB 1FGTA 3CME3 4NHFA 3S29A 2QIYA 1ZX2A 4ZM8A 3F14A 5D82A 3SVAA 1JN5B 3X3XA 1VQ93 1JB5A 1STFI 3FG3A 2GEYA 5I97A 3N8BA 3CCQ3 3S5CA 8CHOA 5AEUB 1DVCA 5CF1A 2W56B 5LC6A 4WYKA 1O7HB 3F7SA 2GEXA 3KKGA 1VQM3 2FGTA 1FUWA 3N9HA 3WOEB 1QAKA 2OOVA 3S67A 4O3VA 2CK3H 3EB8A 4STDA 3CC23 3Q2PA 3IPTA 3JUPA 3CC43 3H51A 1VQK3 2BO9B 5IERA 1KQS2 5D81A 5KP3A 1MNLA 2HMJB 4R80A 5AYRB 1GY5A 2FNQA 2Y73A 3PCRA 3LTDA 3E99A 5KP4A 1ROVA 3BLZA 1QJGA 2STDA 1JN5A 2CHCA 3MG2A 1OGZA 4K61A 2WGOA 3LTBA 2SBLA 3NV0B 4Q53A 3OW22 3N54B 2Z6BA 3EN8A 2Z77A 1Q814 3K63A 3EX9A 3BNDA 3CC73 2B24B 2CFKA 1A90A 2CH9A 3QK9A 3X42A 3DMCA 2WOFA 3STDA 3F7XA 3RGAA 4MMYB 1S723 3JUNA 3LMLA 3GWRA 1W6GA 1OACA 3RDEA 1ULJB 1IV9A 3FCSB 1NU3A 1RRLA 1WMPA 4TX4A 1KD14 4X2OA 1VQP3 1LVNA 3V99A 4EBGA 3OX9A 1SJWA 3HI7A 2E2TA 3KFQC 4GL6A 1AVLA 1IDPA 1QMAA 2QEX3 3BNEA 1EG9B 2IUKA 3CPOA 2XGNA 3FGYA 3NV0A 2CFGA 1FGRA 3UB1A 1OHOA 1Q42A 2XGLA 1BUQA 1D6ZA 3X3ZA 3SEDA 5D83A 1E97A 1STDA 1L5GB 3WMDA 2CFWA 5ELJA 1OHSA 1JB4A 2RGQA 1W2B2 2O3OA 3X40A 2W03A 4XDVA 4CCVA 1W6CA 2BMRB 2BMOB 4FMBA 5EQLA 1K8A4 4EC6A 1Q40B 1RKYA 5STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX 3;  3CC2 3;  1VQ5 3;  3CME 3;  1YHQ 3;  3CC4 3;  3CMA 3;  2OTJ 3;  1YJ9 3;  3I56 3;  3CCV 3;  1VQK 3;  3CCS 3;  1S72 3;  1KQS 2;  3CCE 3;  1VQ9 3;  1Q86 4;  1N8R 4;  1K9M 4;  1VQL 3;  2QA4 3;  3G6E 3;  3CCJ 3;  1VQ4 3;  1M1K 4;  3G4S 3;  1VQO 3;  3CCQ 3;  3CXC 2;  1YJW 3;  1YIJ 3;  1KC8 4;  1KD1 4;  3CCL 3;  1VQP 3;  1VQ7 3;  1YIT 3;  1W2B 2;  1Q82 4;  3CCM 3;  1YJN 3;  1QVG 2;  1QVF 2;  1VQN 3;  3CPW 2;  1VQ8 3;  2OTL 3;  1VQM 3;  3CD6 3;  3OW2 2;  3G71 3;  1YI2 3;  1NJI 4;  3CCR 3;  1K8A 4;  1JJ2 2;  1Q81 4;  1M90 4;  1VQ6 3;  3CC7 3;  1Q7Y 4;  3CCU 3;  1K73 4;  3I55 3; 
#chains in the Genus database with same CATH topology
 5AIH A;  2MC8 A;  2CW9 A;  3ZG5 A;  1Y4K A;  1QAF A;  2CFD A;  3CU3 A;  2L1S A;  4HM5 B;  7RNT A;  2OTJ 3;  4X2H A;  2LQV A;  1RRH A;  5A0O B;  5IG0 A;  3URP A;  3NHX A;  3LOY A;  4WYK B;  4HKV B;  1RNB A;  1GD3 A;  1I8V A;  1HU9 A;  2F4Y A;  2HMO B;  2IA7 A;  2KF4 A;  1SII A;  1SPU A;  2P09 A;  5AIF A;  1N9E A;  2INX A;  3D9R A;  2C4B A;  3EBT A;  3MG3 A;  1B3S A;  1BSA A;  1X1X A;  3DM8 A;  3MWZ A;  4FCJ A;  1LRA A;  1MGR A;  2E2U A;  5AYS C;  2LYX A;  1BNG A;  3D3L A;  1TIJ A;  1UGI A;  5IW9 A;  1YI2 3;  5IG4 A;  3CD6 3;  1FA3 A;  3NBR A;  6GSP A;  1ULI B;  3D79 A;  1J2B A;  4K1U A;  1K73 4;  2IMJ A;  1O7M B;  1SQW A;  1N8Q A;  2HMM B;  3F40 A;  1DMQ A;  1LOY A;  3WA3 A;  3I56 3;  1RGA A;  4N6L A;  1GOU A;  1IT8 A;  1E3R A;  2ZDJ A;  4HAA A;  1ISK A;  1V74 A;  1Q40 A;  3GZR A;  1FGO A;  1AY7 A;  3K5T A;  1N8R 4;  3T8U A;  2MF7 A;  1OCV A;  1VQL 3;  2YFI B;  1UI7 A;  1RGG A;  1JV2 B;  3CXC 2;  3EHC A;  3MG1 A;  1EA2 A;  3NBJ A;  1O7N B;  3O8Y A;  4R9L A;  2KXG A;  2P05 A;  3CCL 3;  2HML B;  3EBY A;  3ZFZ A;  3Q1C A;  4IT7 A;  4AEQ A;  1YIT 3;  1QVF 2;  1BVI A;  3J7Y d;  2H0I A;  5JPP A;  4XDW A;  1VQ8 3;  2W2C A;  1RN4 A;  2OTL 3;  1CQS A;  1N5H A;  3MPH A;  5M18 A;  1GY6 A;  1RGE A;  1TUH A;  1LQM B;  2F86 B;  1I70 A;  4LEH A;  1BNE A;  1JKG B;  2RNT A;  4XBX A;  4HM4 B;  5G1K A;  1RDS A;  4BTY A;  2ZHX B;  1BRJ A;  3G0K A;  3K7C A;  3SXX A;  3AGO A;  1W02 A;  3DH2 A;  3WHO A;  3MKI A;  2I9W A;  2QA4 3;  3B4O A;  4RBN A;  1BRI A;  3CNX A;  4KFF A;  7GSP A;  4LGQ A;  3MHE A;  3PS8 A;  5IG5 A;  1QVG 2;  4HM1 B;  4BIR A;  1YJN 3;  1BSC A;  3DXO A;  3BU4 A;  3NXJ A;  4WFO A;  5AI1 A;  3NQY A;  1GMP A;  2Y74 A;  5DRE A;  3OV4 A;  1TRP A;  4R9K A;  1WMN A;  4EYC A;  2XSH B;  2ZL8 A;  2CFL A;  3LZA A;  3LTA A;  4RZM A;  5IEN A;  2P0M A;  1VQ5 3;  3OWS A;  3OWU A;  1AR0 A;  3DGO A;  4J9A A;  5IEO A;  1ZO2 A;  1HKX A;  3NUV A;  3V92 A;  2FXT A;  5AEW B;  5M19 A;  1UW1 A;  1MWS A;  3KII A;  2Z76 A;  2KRT A;  3F9S A;  1JKG A;  3H3H A;  1JRQ A;  1BNF A;  4KFD A;  1JB2 A;  2CWT A;  1GS3 A;  4L7K A;  3UL5 A;  2R41 A;  3LH4 A;  1K41 A;  1UCK A;  1VQ4 3;  1I2G A;  1B27 A;  2D1W A;  1NNV A;  1IQY A;  5DRV A;  1MWU A;  3UL6 A;  3NQZ A;  4ORL A;  4EV2 A;  4N6T A;  4XM4 A;  4HM7 B;  5HOH A;  3FF0 A;  3CNM A;  1HYF A;  3HK4 A;  5BU4 A;  2CKF B;  3CCR 3;  2BMQ B;  4RNT A;  3AHW A;  5ELU A;  4JF8 A;  3UJM A;  2OOV C;  2V1L A;  3EJV A;  1LNI A;  3KE7 A;  2L4V A;  4KT3 B;  4JRF A;  4N3V A;  1W4N A;  1Q7H A;  3JVC A;  3JUO A;  1OHP A;  3OXA A;  4HBR A;  2OQE A;  2A15 A;  6STD A;  1O7W B;  3VGN A;  1G96 A;  5CF2 A;  3G8Z A;  3S27 A;  2IYJ A;  3G6E 3;  3OWY A;  1BRS A;  4KZ1 A;  5JBS A;  4LYL B;  1BSB A;  1RTU A;  3UNL A;  2JDI H;  2KF6 A;  1YGE A;  3M8C A;  4EXR A;  4HZ9 B;  1YIJ 3;  1F8N A;  1JZD A;  1Q82 4;  1FW7 A;  3EQQ B;  1D6Y A;  3JUM A;  1VQN 3;  1IQX A;  2B1X B;  2O9U X;  1CEW I;  2PNC A;  4HYZ A;  4BL3 A;  1M90 4;  4FMC A;  2F98 A;  1FZU A;  1UUG B;  3DGN A;  1DMN A;  3DY5 A;  4K90 B;  3D4A A;  1SIH A;  5G2G A;  4CJN A;  1PU4 A;  3T0U A;  1ZGX A;  1K28 A;  4GHO A;  1GYB A;  1RMS A;  1E3V A;  4HM3 B;  4EW5 A;  2ZA4 A;  4WWU C;  3PZW A;  1W6Y A;  1UCL A;  1B2X A;  1LXE A;  3LYG A;  2HMK B;  1B2M A;  1W00 A;  3JUQ A;  3NBB A;  2W04 A;  4RNZ A;  1YVS A;  2UX0 A;  3EC9 A;  3S28 A;  1TP6 A;  2GU1 A;  3FG1 A;  4NPB A;  3VSY A;  3BB9 A;  1I2E A;  2Q07 A;  4L8O A;  4BL2 A;  1NB3 I;  1UI8 A;  4KVH A;  3X41 A;  4HM6 B;  4AKZ A;  5BXQ A;  2GU3 A;  5HGR A;  2XF3 A;  5RNT A;  1OH0 A;  3ALA A;  4MEI A;  1GSP A;  3G71 3;  5CK6 A;  2K54 A;  1IVU A;  3B4P A;  4U13 A;  1NJI 4;  1BRN L;  1ROA A;  1VZZ A;  4J8T A;  2K0M A;  4DKI A;  4PEJ A;  1BNS A;  4MMZ B;  1VQ6 3;  1B2U A;  1I3F A;  3HIG A;  3FG4 A;  1GOV A;  1UUW B;  4IIA A;  1A2P A;  1AVK A;  2XH9 A;  4N6U A;  2CG1 A;  3V98 A;  2YFJ B;  4OVM A;  5G1L A;  3KN4 A;  3ROB A;  3CCV 3;  2YX9 A;  3DUK A;  3ER7 A;  4FCM A;  3SLU A;  3WOF B;  1D6U A;  1DMM A;  3HX8 A;  1TU5 A;  2W9Q A;  5JPU A;  2CG0 A;  1W01 A;  1V58 A;  3K9M C;  3EN1 B;  3IJE B;  2CWV A;  1OF5 B;  2F99 A;  2WO0 A;  3KSE D;  4J5K A;  1BRK A;  1US1 A;  3ZG0 A;  4MMX B;  4BTX A;  3F8X A;  3GRD A;  5M1A A;  1FYS A;  1RGC A;  1FUS A;  3U1W A;  3FH1 A;  5BIR A;  1BNJ A;  3MYT A;  1IU7 A;  4KFE A;  1A2V A;  1FUT A;  2ML6 A;  1S5A A;  1V57 A;  1DYU A;  3IMA B;  1A2K A;  1RN7 A;  2RCD A;  5LC7 A;  1BAO A;  1UGH I;  1C7H A;  1IVX A;  5CLK A;  3RGR A;  3GZX B;  4K1V A;  3CCS 3;  4RNY A;  4O02 B;  1K9M 4;  1AV4 A;  1WMO A;  3CCJ 3;  2XRX B;  2HMN B;  4EV5 A;  3AMO B;  2KAA A;  3HII A;  4QWT A;  1YJW 3;  2UUG C;  1T3B A;  1WNH A;  2C11 A;  1BIR A;  1VQ7 3;  1PY3 A;  1CH0 A;  2KF5 A;  3CCM 3;  3KZT A;  5FW5 A;  3NM7 A;  2BIR A;  2CX1 A;  3PXM A;  2CX0 A;  4H3U A;  3GSP A;  5KP1 A;  1BRH A;  1N5P A;  1BU4 A;  1I0V A;  3MSO A;  4LMI A;  1OF5 A;  3CCU 3;  4HOH A;  1G0T A;  3LT9 A;  1ASK A;  2C10 A;  3EE1 A;  2W6J H;  1DET A;  4LZI A;  3Q90 A;  1GD4 A;  2IUJ A;  3CCE 3;  2F5W A;  2GBW B;  3G16 A;  1M1X B;  2BNG A;  4FR9 A;  5AIG A;  3SX1 A;  2XSO B;  1IVW A;  4I4K A;  1RGL A;  9RNT A;  1M1K 4;  3FZW A;  3D5I A;  4XBT A;  1BSD A;  1X1U A;  4FMD A;  1UCJ A;  3KCH A;  5BVB A;  1MGW A;  1G02 A;  3D5G A;  4O2H A;  4HVN A;  2XFS A;  1RSN A;  4NRE A;  1TFK A;  3X3Y A;  3DZL A;  3B7C A;  4FCZ A;  4MJD A;  1QAL A;  1BOX A;  1ZS7 A;  4O8S A;  1IQ8 A;  2XR8 B;  1JBT A;  1BAN A;  3L0R A;  1LOW A;  3FLJ A;  1LQG C;  4HZB B;  3PCS A;  1FGQ A;  1I2F A;  3AMO A;  4N6O B;  3LT8 A;  4XBY A;  1U8C B;  2W56 A;  3EF8 A;  3I55 3;  1W2Z A;  3LXU X;  1FGM A;  2R4I A;  3I0Y A;  4BTW A;  1JNQ A;  4HM2 B;  4LSO A;  4GSP A;  3PYJ A;  1YHQ 3;  4R1K A;  1DVD A;  1KWI A;  2RSX A;  4AKY A;  4L8P A;  1OPY A;  1EQK A;  4H61 A;  2W0Q A;  1KSI A;  1Q9E A;  1X1W A;  8RNT A;  1IT7 A;  1CYV A;  1BNI A;  1C54 A;  3FF2 A;  1PFP A;  1CYU A;  1GY7 A;  1NWW A;  6RNT A;  1IYY A;  5GSP A;  1RGF A;  1KC8 4;  1TFO A;  2P38 A;  1RLS A;  5IG3 A;  1R4C A;  1GMR A;  1TTO A;  2OWP A;  1RCK A;  3F8H A;  1N9J A;  3GZY B;  3K0Z A;  3WDG B;  5IEP A;  2M7O A;  1A67 A;  1JJ2 2;  3VF1 A;  1Q7Y 4;  1W7C A;  1B2Z A;  4OK0 A;  3ECF A;  2IY2 A;  2KCD A;  3SOY A;  3TDG A;  4HJL B;  5FGO A;  5EVH A;  2XEP A;  1WTH A;  3CMA 3;  3Q3F A;  1M9G A;  1T5Y A;  1YJ9 3;  2WGQ A;  4G1M B;  2E2V A;  3WR2 A;  3GAX A;  3WOD G;  3B8L A;  3T8N A;  4GB5 A;  4CDL A;  2KF3 A;  1IV7 A;  4WHA A;  4HM8 B;  1O7G B;  2W9P A;  3BNC A;  1OGX A;  5EEO A;  2P0X A;  1U5O A;  2BT3 A;  4OUQ A;  4N6N B;  1B21 A;  2RFR A;  2Z7A A;  3DGM A;  4N6M A;  4XB5 A;  5IF6 A;  3WA2 X;  2JQ5 A;  1RGK A;  3CPW 2;  1NB5 I;  2HOH A;  3HZP A;  4I5Q A;  2H0H A;  5AII A;  3SYU A;  1YGW A;  2GXF A;  3NM2 A;  1MWT A;  3GZB A;  2UGI A;  7STD A;  1EUI C;  3A76 A;  1RJO A;  1YVB I;  4WP5 A;  4HM0 B;  1NO3 A;  2QGU A;  5TGN A;  4FMA A;  4N6V 0;  1I3I A;  2CWU A;  3FKA A;  1LNH A;  1Q86 4;  3QRD A;  2CC3 A;  3KSP A;  2OCT A;  2GSP A;  3LTC A;  2OQE C;  3G4S 3;  1VQO 3;  2D42 A;  1MOL A;  3PGB A;  5CXO A;  1Z1S A;  2YFL B;  3NX0 A;  3FSD A;  2GBX B;  1EKM A;  4IPB A;  1BSE A;  1GOY A;  1IK3 A;  3U97 A;  1OUN A;  2PZV A;  1DE3 A;  2ML5 A;  3DGL A;  4J5G A;  2WOH A;  1UUV B;  1UDI I;  3SOA A;  1IVV A;  1WQL B;  1I0X A;  2CIU A;  3BNB A;  2XFT A;  2F56 A;  4R4K A;  1LOX A;  1RNT A;  1W5Z A;  2BHM A;  1O7P B;  1NDO B;  1FGT A;  3CME 3;  4NHF A;  3S29 A;  2QIY A;  1ZX2 A;  3BIR A;  4ZM8 A;  1RN1 A;  3F14 A;  1MWR A;  2AAD A;  5D82 A;  1JN5 B;  3SVA A;  3X3X A;  2K3D A;  3RNT A;  1VQ9 3;  1JB5 A;  1STF I;  3FG3 A;  1B2S A;  1EEJ A;  2GEY A;  5I97 A;  3N8B A;  3CCQ 3;  3S5C A;  8CHO A;  5AEU B;  1DVC A;  5CF1 A;  2W56 B;  5LC6 A;  4WYK A;  1O7H B;  3F7S A;  2GEX A;  3KKG A;  1T2H A;  1VQM 3;  3AGN A;  2FGT A;  1PYL A;  1FUW A;  2H0G A;  3N9H A;  1QAK A;  2OOV A;  1LOV A;  3WOE B;  3S67 A;  4O3V A;  1B20 A;  1VQQ A;  2CK3 H;  3EB8 A;  4STD A;  3CC2 3;  3Q2P A;  3IPT A;  3JUP A;  1JZO A;  1JBR A;  3CC4 3;  3H51 A;  1VQK 3;  2BO9 B;  1YNV X;  5IER A;  1RCL A;  2F5M A;  3DGY A;  5D81 A;  5KP3 A;  1MNL A;  1KQS 2;  2HMJ B;  4R80 A;  5AYR B;  1GY5 A;  2FNQ A;  2Y73 A;  3PCR A;  3LTD A;  3E99 A;  4CPK A;  5KP4 A;  1ROV A;  3BLZ A;  1QJG A;  2STD A;  1JN5 A;  1BRG A;  2CHC A;  3MG2 A;  1OGZ A;  4K61 A;  2WGO A;  3LTB A;  2SBL A;  3NV0 B;  4Q53 A;  3OW2 2;  2AAE A;  3N54 B;  1RGH A;  2Z6B A;  3EN8 A;  2Z77 A;  1Q81 4;  3K63 A;  3EX9 A;  3BND A;  3CC7 3;  2BU4 A;  2B24 B;  2CFK A;  1A90 A;  2CH9 A;  1UCI A;  3QK9 A;  3X42 A;  3DMC A;  2WOF A;  3STD A;  3F7X A;  3RGA A;  1R4Y A;  1TJD A;  4MMY B;  1T2I A;  1S72 3;  3JUN A;  3LML A;  1X1Y A;  1W6G A;  3GWR A;  1OAC A;  3RDE A;  1SAR A;  1ULJ B;  3HOH A;  1IV9 A;  3FCS B;  1NU3 A;  1RRL A;  1WMP A;  4BU4 A;  4TX4 A;  1KD1 4;  4X2O A;  1VQP 3;  3A5E A;  1LVN A;  3V99 A;  4EBG A;  3OX9 A;  1SJW A;  3HI7 A;  1AQZ A;  2E2T A;  3KFQ C;  2SAR A;  4GL6 A;  1AVL A;  1IDP A;  1QMA A;  1BUJ A;  2QEX 3;  3BNE A;  1EG9 B;  2IUK A;  3CPO A;  2XGN A;  3FGY A;  2J8X B;  3NV0 A;  1HZ1 A;  2CFG A;  1FGR A;  1RHL A;  3UB1 A;  1OHO A;  1Q42 A;  2XGL A;  1BUQ A;  3AHS A;  1D6Z A;  1BGS A;  3SED A;  3X3Z A;  5D83 A;  1E97 A;  1STD A;  1L5G B;  3WMD A;  2CFW A;  5ELJ A;  1OHS A;  1JB4 A;  1TRQ A;  1BNR A;  2RGQ A;  1W2B 2;  2O3O A;  3X40 A;  2W03 A;  1GMQ A;  4XDV A;  4CCV A;  1W6C A;  2BMR B;  2BMO B;  4FMB A;  5EQL A;  2RBI A;  1K8A 4;  4EC6 A;  1Q40 B;  4ILF A;  1JBS A;  1RKY A;  5STD A; 
#chains in the Genus database with same CATH homology
 5AIH A;  2MC8 A;  2CW9 A;  1Y4K A;  1QAF A;  2CFD A;  3CU3 A;  4HM5 B;  2OTJ 3;  4X2H A;  2LQV A;  1RRH A;  5A0O B;  5IG0 A;  3NHX A;  3LOY A;  4WYK B;  4HKV B;  1GD3 A;  1HU9 A;  2HMO B;  2IA7 A;  1SII A;  1SPU A;  2P09 A;  5AIF A;  1N9E A;  2INX A;  3D9R A;  3EBT A;  3MG3 A;  4FCJ A;  3DM8 A;  3MWZ A;  5AYS C;  5AEW B;  5IW9 A;  2E2U A;  3CD6 3;  2LYX A;  1YI2 3;  3D3L A;  1TIJ A;  1FA3 A;  5IG4 A;  3NBR A;  1ULI B;  1J2B A;  4K1U A;  1K73 4;  2IMJ A;  1O7M B;  1SQW A;  1N8Q A;  2HMM B;  3F40 A;  1DMQ A;  3WA3 A;  3I56 3;  4N6L A;  1IT8 A;  1E3R A;  2ZDJ A;  1ISK A;  1V74 A;  1Q40 A;  3GZR A;  1FGO A;  3K5T A;  1N8R 4;  3T8U A;  2MF7 A;  1OCV A;  1VQL 3;  2YFI B;  1UI7 A;  1JV2 B;  3CXC 2;  3EHC A;  3MG1 A;  1EA2 A;  3NBJ A;  1O7N B;  3O8Y A;  4R9L A;  2KXG A;  2P05 A;  3CCL 3;  2HML B;  3EBY A;  1YIT 3;  3Q1C A;  4IT7 A;  4AEQ A;  1QVF 2;  3J7Y d;  5JPP A;  4XDW A;  1VQ8 3;  2W2C A;  2OTL 3;  1CQS A;  1N5H A;  3MPH A;  1GY6 A;  1TUH A;  2F86 B;  4LEH A;  1JKG B;  4XBX A;  4HM4 B;  4BTY A;  3G0K A;  3K7C A;  3SXX A;  1W02 A;  3MKI A;  2I9W A;  2QA4 3;  3B4O A;  4RBN A;  3CNX A;  4KFF A;  4LGQ A;  3MHE A;  3PS8 A;  5IG5 A;  1QVG 2;  4HM1 B;  1YJN 3;  3DXO A;  4WFO A;  3NXJ A;  5AI1 A;  3NQY A;  2Y74 A;  5DRE A;  3OV4 A;  4R9K A;  1WMN A;  4EYC A;  2XSH B;  2ZL8 A;  2CFL A;  3LZA A;  3LTA A;  4RZM A;  5IEN A;  2P0M A;  1VQ5 3;  3OWS A;  3OWU A;  1AR0 A;  3DGO A;  4J9A A;  5IEO A;  1ZO2 A;  1HKX A;  3NUV A;  3V92 A;  2FXT A;  1UW1 A;  3KII A;  2Z76 A;  2KRT A;  3F9S A;  1JKG A;  3H3H A;  1JRQ A;  4KFD A;  1VQ4 3;  1JB2 A;  2CWT A;  1GS3 A;  4L7K A;  3UL5 A;  3LH4 A;  1K41 A;  2D1W A;  1IQY A;  5DRV A;  3UL6 A;  4EV2 A;  3NQZ A;  4ORL A;  4N6T A;  4XM4 A;  4HM7 B;  3FF0 A;  3CNM A;  3HK4 A;  2CKF B;  3CCR 3;  2BMQ B;  5ELU A;  4JF8 A;  3UJM A;  2OOV C;  2V1L A;  3EJV A;  3KE7 A;  2L4V A;  4JRF A;  4N3V A;  1W4N A;  3JVC A;  3JUO A;  1OHP A;  3OXA A;  4HBR A;  2OQE A;  2A15 A;  6STD A;  1O7W B;  3VGN A;  1G96 A;  5CF2 A;  3G8Z A;  3S27 A;  3G6E 3;  3OWY A;  4KZ1 A;  5JBS A;  4EXR A;  3UNL A;  1YIJ 3;  2JDI H;  3M8C A;  1YGE A;  4HZ9 B;  1F8N A;  1Q82 4;  3EQQ B;  1D6Y A;  3JUM A;  1VQN 3;  1IQX A;  2B1X B;  2O9U X;  1CEW I;  2PNC A;  4HYZ A;  1M90 4;  4FMC A;  2F98 A;  3DGN A;  1DMN A;  3DY5 A;  4K90 B;  1SIH A;  5G2G A;  1PU4 A;  3T0U A;  1K28 A;  1GYB A;  1E3V A;  4HM3 B;  4WWU C;  3PZW A;  1W6Y A;  1LXE A;  3LYG A;  2HMK B;  1W00 A;  3JUQ A;  3NBB A;  2W04 A;  4RNZ A;  2UX0 A;  3EC9 A;  3S28 A;  1TP6 A;  2GU1 A;  3FG1 A;  3VSY A;  3BB9 A;  2Q07 A;  4L8O A;  1NB3 I;  1UI8 A;  4KVH A;  3X41 A;  4HM6 B;  4AKZ A;  5BXQ A;  2GU3 A;  5HGR A;  2XF3 A;  1OH0 A;  3ALA A;  4MEI A;  3G71 3;  1NJI 4;  5CK6 A;  2K54 A;  1IVU A;  3B4P A;  4U13 A;  1ROA A;  1VZZ A;  4J8T A;  2K0M A;  4PEJ A;  4MMZ B;  1VQ6 3;  3HIG A;  3FG4 A;  1UUW B;  4IIA A;  2XH9 A;  1AVK A;  4N6U A;  2CG1 A;  3V98 A;  2YFJ B;  4OVM A;  3ROB A;  3KN4 A;  3CCV 3;  2YX9 A;  3DUK A;  3ER7 A;  4FCM A;  3SLU A;  3WOF B;  1D6U A;  1DMM A;  3HX8 A;  1TU5 A;  2W9Q A;  5JPU A;  2CG0 A;  1W01 A;  3K9M C;  3EN1 B;  3IJE B;  2CWV A;  1OF5 B;  2F99 A;  2WO0 A;  3KSE D;  1US1 A;  4MMX B;  4BTX A;  3F8X A;  3GRD A;  3U1W A;  3FH1 A;  3MYT A;  1IU7 A;  4KFE A;  1A2V A;  2ML6 A;  1S5A A;  1DYU A;  3IMA B;  1A2K A;  1RN7 A;  2RCD A;  5LC7 A;  1C7H A;  1IVX A;  5CLK A;  3RGR A;  3GZX B;  4K1V A;  3CCS 3;  4RNY A;  4O02 B;  1K9M 4;  1AV4 A;  1WMO A;  3CCJ 3;  2XRX B;  2HMN B;  4EV5 A;  3AMO B;  3HII A;  1YJW 3;  4QWT A;  2C11 A;  1WNH A;  1VQ7 3;  3CCM 3;  3KZT A;  5FW5 A;  3NM7 A;  3PXM A;  4H3U A;  5KP1 A;  1N5P A;  3MSO A;  4LMI A;  1OF5 A;  3CCU 3;  3LT9 A;  1ASK A;  2C10 A;  3EE1 A;  2W6J H;  4LZI A;  3Q90 A;  1GD4 A;  2IUJ A;  3CCE 3;  2GBW B;  3G16 A;  1M1X B;  2BNG A;  4FR9 A;  5AIG A;  3SX1 A;  2XSO B;  1IVW A;  4I4K A;  1M1K 4;  3FZW A;  4XBT A;  4FMD A;  5BVB A;  4O2H A;  4HVN A;  2XFS A;  4NRE A;  3X3Y A;  1TFK A;  3DZL A;  3B7C A;  4FCZ A;  4MJD A;  1QAL A;  4O8S A;  1IQ8 A;  2XR8 B;  3L0R A;  3FLJ A;  4HZB B;  3PCS A;  1FGQ A;  3AMO A;  4N6O B;  3LT8 A;  4XBY A;  1U8C B;  2W56 A;  3EF8 A;  3I55 3;  1W2Z A;  3LXU X;  1FGM A;  2R4I A;  3I0Y A;  4BTW A;  1JNQ A;  4HM2 B;  4LSO A;  3PYJ A;  1YHQ 3;  4R1K A;  1DVD A;  1KWI A;  2RSX A;  4AKY A;  4L8P A;  1OPY A;  1EQK A;  4H61 A;  2W0Q A;  1KSI A;  1IT7 A;  1CYV A;  3FF2 A;  1PFP A;  1CYU A;  1GY7 A;  1NWW A;  1KC8 4;  1TFO A;  2P38 A;  5IG3 A;  1R4C A;  2OWP A;  3F8H A;  1N9J A;  3GZY B;  3K0Z A;  3WDG B;  5IEP A;  2M7O A;  1A67 A;  1JJ2 2;  3VF1 A;  1Q7Y 4;  1W7C A;  4OK0 A;  3ECF A;  2KCD A;  3SOY A;  3TDG A;  4HJL B;  5FGO A;  5EVH A;  2XEP A;  1WTH A;  3CMA 3;  1YJ9 3;  1M9G A;  1T5Y A;  2WGQ A;  4G1M B;  2E2V A;  3GAX A;  3WOD G;  3B8L A;  3T8N A;  4GB5 A;  4CDL A;  1IV7 A;  4WHA A;  4HM8 B;  1O7G B;  2W9P A;  3BNC A;  1OGX A;  5EEO A;  2P0X A;  1U5O A;  2BT3 A;  4OUQ A;  4N6N B;  2Z7A A;  2RFR A;  3DGM A;  4N6M A;  4XB5 A;  5IF6 A;  3WA2 X;  2JQ5 A;  3CPW 2;  1NB5 I;  5AII A;  3HZP A;  2GXF A;  3NM2 A;  3GZB A;  7STD A;  3A76 A;  1RJO A;  1YVB I;  4WP5 A;  4HM0 B;  1NO3 A;  2QGU A;  5TGN A;  4FMA A;  4N6V 0;  2CWU A;  3FKA A;  1LNH A;  1Q86 4;  3QRD A;  2CC3 A;  3KSP A;  2OCT A;  3LTC A;  2OQE C;  3G4S 3;  1VQO 3;  2D42 A;  1MOL A;  3PGB A;  5CXO A;  1Z1S A;  2YFL B;  3NX0 A;  3FSD A;  2GBX B;  1EKM A;  4IPB A;  1IK3 A;  3U97 A;  1OUN A;  2PZV A;  2ML5 A;  3DGL A;  2WOH A;  1UUV B;  3SOA A;  1IVV A;  1WQL B;  2CIU A;  3BNB A;  2XFT A;  4R4K A;  1LOX A;  1W5Z A;  2BHM A;  1O7P B;  1NDO B;  1FGT A;  3CME 3;  4NHF A;  3S29 A;  2QIY A;  1ZX2 A;  4ZM8 A;  3F14 A;  5D82 A;  3SVA A;  1JN5 B;  3X3X A;  1VQ9 3;  1JB5 A;  1STF I;  3FG3 A;  2GEY A;  5I97 A;  3N8B A;  3CCQ 3;  3S5C A;  8CHO A;  5AEU B;  1DVC A;  5CF1 A;  2W56 B;  5LC6 A;  4WYK A;  1O7H B;  3F7S A;  2GEX A;  3KKG A;  1VQM 3;  2FGT A;  1FUW A;  3N9H A;  3WOE B;  1QAK A;  2OOV A;  3S67 A;  4O3V A;  2CK3 H;  3EB8 A;  4STD A;  3CC2 3;  3Q2P A;  3IPT A;  3JUP A;  3CC4 3;  3H51 A;  1VQK 3;  2BO9 B;  5IER A;  1KQS 2;  5D81 A;  5KP3 A;  1MNL A;  2HMJ B;  4R80 A;  5AYR B;  1GY5 A;  2FNQ A;  2Y73 A;  3PCR A;  3LTD A;  3E99 A;  5KP4 A;  1ROV A;  3BLZ A;  1QJG A;  2STD A;  1JN5 A;  2CHC A;  3MG2 A;  1OGZ A;  4K61 A;  2WGO A;  3LTB A;  2SBL A;  3NV0 B;  4Q53 A;  3OW2 2;  3N54 B;  2Z6B A;  3EN8 A;  2Z77 A;  1Q81 4;  3K63 A;  3EX9 A;  3BND A;  3CC7 3;  2B24 B;  2CFK A;  1A90 A;  2CH9 A;  3QK9 A;  3X42 A;  3DMC A;  2WOF A;  3STD A;  3F7X A;  3RGA A;  4MMY B;  1S72 3;  3JUN A;  3LML A;  3GWR A;  1W6G A;  1OAC A;  3RDE A;  1ULJ B;  1IV9 A;  3FCS B;  1NU3 A;  1RRL A;  1WMP A;  4TX4 A;  1KD1 4;  4X2O A;  1VQP 3;  1LVN A;  3V99 A;  4EBG A;  3OX9 A;  1SJW A;  3HI7 A;  2E2T A;  3KFQ C;  4GL6 A;  1AVL A;  1IDP A;  1QMA A;  2QEX 3;  3BNE A;  1EG9 B;  2IUK A;  3CPO A;  2XGN A;  3FGY A;  3NV0 A;  2CFG A;  1FGR A;  3UB1 A;  1OHO A;  1Q42 A;  2XGL A;  1BUQ A;  1D6Z A;  3X3Z A;  3SED A;  5D83 A;  1E97 A;  1STD A;  1L5G B;  3WMD A;  2CFW A;  5ELJ A;  1OHS A;  1JB4 A;  2RGQ A;  1W2B 2;  2O3O A;  3X40 A;  2W03 A;  4XDV A;  4CCV A;  1W6C A;  2BMR B;  2BMO B;  4FMB A;  5EQL A;  1K8A 4;  4EC6 A;  1Q40 B;  1RKY A;  5STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...