3L0RA

Crystal structure of salivary cystatin from the soft tick ornithodoros moubata
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
IPGGWTRQDPTEARFLELAHFATSSQTEGREFYDTVVTVKEVETQVVAGMNYKLTIEISPSVCKIGEVQYSAEQCVPKDAQQKSTCVAVIYHVPWQNQKSVTSYRCEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-2
publication title Crystal structure and functional characterization of an immunomodulatory salivary cystatin from the soft tick Ornithodoros moubata
pubmed doi rcsb
source organism Ornithodoros moubata
total genus 24
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3l0rA00
4N6NB 3QRDA 5EQLA 1MOLA 3PS8A 4N6UA 3Q2PA 2O9UX 4N6LA 3LH4A 1STFI 1TIJA 5A0OB 2W9QA 4N6OB 3GAXA 3UL5A 3NX0A 1NB3I 1CYVA 1A90A 1KWIA 1R4CA 4IT7A 1RN7A 3KSED 5LC6A 1IV9A 1DVDA 3K9MC 4N6TA 2KXGA 1EQKA 1CEWI 1CYUA 1GD3A 1DVCA 1NB5I 5ELUA 4N6MA 1LXEA 1N5PA 3UL6A 4ZM8A 1WNHA 3MWZA 4CCVA 3SVAA 5ELJA 4N6V0 1A67A 4EYCA 1G96A 1M9GA 1ROAA 3PXMA 1FUWA 2OCTA 2W9PA 1MNLA 1PFPA 1GD4A 1YVBI 1IV7A 3L0RA 3S67A 3PYJA 5LC7A 3IMAB 2CH9A 1FA3A 1N5HA 1N9JA 2BO9B 3KFQC 4LZIA 4TX4A
chains in the Genus database with same CATH superfamily
1OHPA 2RGQA 1UUGB 5I97A 3DH2A 5IG4A 1AQZA 2I9WA 2Q07A 3BLZA 4U13A 5D81A 2MC8A 1J2BA 1QJGA 2PNCA 3AHWA 1ULJB 3A5EA 5AEUB 1W6YA 1K28A 3F9SA 3KIIA 4FMCA 2SBLA 1UCLA 2XEPA 1GMRA 3ALAA 3KSPA 1STFI 2F5WA 5CLKA 4XBXA 3U1WA 1B2MA 1BRJA 1FZUA 3DY5A 2BMQB 3D9RA 3NQZA 5AI1A 3N54B 3G16A 2CWTA 1O7GB 3G8ZA 3V99A 3S28A 2L4VA 4R4KA 3CCR3 3AGNA 3FLJA 2QGUA 3UL5A 2D42A 3WOFB 1BRIA 1YIJ3 4KFFA 2Z77A 1UUWB 2SARA 3ZG0A 1NB3I 4BTXA 4XBTA 3KN4A 3UNLA 2AAEA 1MWSA 1AVLA 2BIRA 1BSBA 2WGQA 1HU9A 3F8HA 1JKGA 1LNHA 3JUMA 1B2SA 4WWUC 1GMQA 3ER7A 2XSOB 1W6CA 4EV2A 1IV9A 1F8NA 3FSDA 4HZ9B 1GY7A 4RNYA 4BTYA 4HM8B 1JBSA 1IVXA 1BNJA 1IU7A 2KXGA 5JPUA 3RGRA 1OF5A 2R41A 3F8XA 1OCVA 4L7KA 2Z76A 1CEWI 1RLSA 3SOYA 4R9KA 2CWVA 4MMXB 2P0MA 3H3HA 4WP5A 1JKGB 3B8LA 2XH9A 3X41A 1I2GA 3K5TA 1AY7A 1LOWA 1GS3A 2CG1A 5AYSC 1VQM3 2JDIH 3GWRA 1QMAA 1RGFA 2CC3A 4J5GA 5IG0A 5BXQA 2FGTA 2BT3A 3UL6A 4ZM8A 1OF5B 3MWZA 1BSEA 5CXOA 2HMMB 2KF5A 3HZPA 1K9M4 2IA7A 1RCKA 4EBGA 1DYUA 2XF3A 4N6V0 3FG4A 2KF4A 3D5GA 1DMNA 1JV2B 3GZXB 4KFEA 1BNIA 3NBBA 2KF3A 1Q7Y4 2HMLB 2RBIA 1VQP3 3LT9A 4CDLA 1D6ZA 1X1UA 2P05A 2R4IA 3X3ZA 1DETA 1NNVA 1VQL3 1NJI4 1M904 4NREA 4IIAA 3BNCA 3FG1A 1VQN3 5HGRA 1VQ63 1Q40B 3EBYA 5AIGA 4O3VA 1PFPA 2H0IA 3IJEB 4H3UA 5AIFA 4EV5A 3NUVA 3AGOA 1VQK3 4FCJA 2W03A 2V1LA 4LYLB 3ECFA 4GSPA 7STDA 5IEPA 2YFJB 1IV7A 3CNMA 1SIIA 1IVVA 2OOVA 1I8VA 3F7SA 1TRQA 1BNEA 4O2HA 4FR9A 3FF2A 2ZHXB 2P38A 1KD14 1ISKA 1OGXA 3OXAA 3JUNA 1VQ93 1W00A 3MG1A 1TRPA 3IMAB 1TU5A 2HMOB 3CC23 3CCE3 3U97A 1MWUA 1WMNA 2Z6BA 5IENA 1RN4A 2WOFA 1N5HA 3FKAA 1RGAA 2BO9B 3PGBA 3T8UA 3VGNA 4LZIA 4TX4A 4BU4A 1PU4A 1N8R4 3EN8A 1JN5A 1QAKA 1T2HA 3PCRA 4RNTA 3CNXA 5AYRB 3BNBA 4KVHA 1I0VA 5JPPA 1IYYA 2A15A 4QWTA 2WO0A 3MHEA 5DREA 2YX9A 4FCZA 4H61A 3X42A 1BSDA 3BB9A 4BIRA 2INXA 1WQLB 3LTDA 4N6LA 2OOVC 2CHCA 2W04A 2C10A 5A0OB 3SXXA 3RNTA 3K0ZA 1IQYA 7GSPA 4R80A 2B24B 1BNSA 1JN5B 4EW5A 2CKFB 3G0KA 2CK3H 1L5GB 3LOYA 3KE7A 3NQYA 2OTL3 2IMJA 3V98A 1SARA 4N3VA 3HOHA 3NX0A 2W2CA 1G02A 5AEWB 3BNDA 3S29A 7RNTA 1KWIA 1A90A 1HZ1A 1PYLA 1RNTA 2C11A 2QIYA 1O7WB 1FYSA 1R4CA 1UCIA 1FGTA 3EN1B 3EC9A 1SJWA 4ILFA 2E2VA 3NBRA 4IT7A 4RNZA 1RKYA 3KSED 2OQEA 1QVG2 3H51A 3CCS3 3MG3A 5CF2A 1GYBA 2B1XB 1UI8A 4N6TA 3HIGA 3FCSB 1QAFA 1YIT3 4HM5B 2GSPA 4O02B 1O7HB 1E3RA 2P0XA 1RGHA 8RNTA 1W4NA 4HM4B 6RNTA 2CFKA 1CYUA 4WYKA 1BANA 3B4PA 3EE1A 3RGAA 2GXFA 1S723 2XFTA 5CK6A 2F86B 1RNBA 3F7XA 1BRGA 3JVCA 1YJW3 1NB5I 2K0MA 2UX0A 1JRQA 5KP3A 2RFRA 4N6MA 3GSPA 3FH1A 3PZWA 4MJDA 5M1AA 2UUGC 3BIRA 4STDA 1NWWA 2Y74A 2CX1A 1BVIA 3V92A 1IDPA 1EA2A 4HYZA 3X3YA 1O7NB 1KQS2 1B27A 2L1SA 2O3OA 1O7PB 1X1YA 2HOHA 1UDII 1KSIA 5JBSA 3D79A 1BOXA 3F40A 3IPTA 4WYKB 5STDA 1BRHA 3ZFZA 2OQEC 1ZS7A 3GZRA 4FCMA 1JB2A 3UB1A 1IVWA 1M9GA 3URPA 3X40A 5GSPA 4AKYA 1W7CA 3KZTA 1G0TA 2HMJB 3HI7A 5M19A 3HIIA 5DRVA 2JQ5A 5IEOA 1M1XB 3FF0A 1UCKA 2LQVA 3HX8A 2HMKB 4BL2A 4J5KA 1W2B2 3NM2A 3CCM3 1YGWA 2J8XB 1YVBI 1BSAA 1D6UA 1BUQA 5BVBA 2GBWB 3CCJ3 3CPOA 5AIHA 2ML6A 4K1UA 3L0RA 3WHOA 3DGNA 3CC43 3CMA3 5CF1A 1HKXA 1DMMA 1NDOB 4R1KA 2CFWA 1O7MB 2FXTA 3GZBA 4Q53A 1LNIA 1N8QA 1NO3A 1UI7A 1BAOA 2WGOA 1A2KA 3LMLA 1BIRA 1GSPA 4GHOA 4KFDA 5RNTA 1D6YA 1ZGXA 1RSNA 1W5ZA 4WFOA 1FA3A 1N9JA 1Y4KA 3LTCA 1YHQ3 1JB5A 3EJVA 4K1VA 2KCDA 3NBJA 1FW7A 3QRDA 4HM1B 4O8SA 2F5MA 1I70A 3N9HA 2IY2A 5EVHA 3OWUA 1TFOA 2YFIB 3PS8A 4LGQA 4AKZA 2ML5A 4BTWA 1A2VA 1AR0A 5G1KA 5EEOA 3MYTA 4LMIA 4JRFA 3Q2PA 1BRNL 4XBYA 1EEJA 3FG3A 3PCSA 1TIJA 1TP6A 3JUOA 1AVKA 3SEDA 4HM2B 1BUJA 1RGKA 2XGLA 1RDSA 3CCQ3 3OW22 4N6OB 3TDGA 3WA3A 3DXOA 1YVSA 1Z1SA 3GAXA 1YI23 2K54A 1E97A 1K41A 5TGNA 2YFLB 1LVNA 2RSXA 1JZDA 4FMBA 3CC73 4HAAA 1T2IA 2K3DA 2XSHB 5D83A 3WA2X 1CYVA 2ZDJA 1ASKA 1BNGA 1MGWA 1UGHI 1VQQA 4I5QA 3Q1CA 1FGMA 2WOHA 3WODG 3FZWA 1SIHA 4HM3B 3LZAA 2OWPA 4K90B 3OV4A 1RRLA 2IUJA 1FGOA 1V57A 2M7OA 1I3IA 1GOVA 2STDA 2Z7AA 3B7CA 5LC6A 1JJ22 2XR8B 1DVDA 1IQXA 3BU4A 4HVNA 4XDVA 1EG9B 4G1MB 1Q42A 3CCL3 1Q9EA 1EQKA 4PEJA 1JBTA 2H0GA 2QEX3 2XGNA 5BU4A 3JUQA 5KP1A 1BNRA 1ULIB 5KP4A 3ZG5A 1SPUA 4R9LA 3VF1A 1DVCA 1FGRA 2MF7A 3LXUX 5ELUA 4FMAA 3OWSA 3GRDA 1Q814 1JB4A 1PY3A 3HK4A 1LXEA 3GZYB 1M1K4 2ZL8A 3NV0A 1VQO3 1OHSA 1W01A 2KF6A 3OX9A 4CCVA 5M18A 2CFGA 3SVAA 1V58A 3CCV3 3LTAA 2GEXA 1B2XA 2PZVA 4MMYB 1X1XA 1T3BA 5ELJA 1RHLA 1ROVA 3CPW2 4JF8A 4EYCA 3O8YA 3WOEB 1G96A 2BU4A 5G2GA 4J8TA 1GOYA 2CG0A 4MEIA 1TTOA 1K8A4 1IT8A 1IQ8A 1BGSA 3LT8A 5IERA 4X2OA 1WMOA 8CHOA 2OCTA 1RMSA 2W9PA 1MNLA 3MG2A 1B2ZA 5G1LA 1OPYA 1GD4A 1GY5A 4XM4A 2W0QA 1BSCA 1OGZA 1VQ83 5FW5A 1RCLA 2D1WA 3D3LA 5IF6A 1A2PA 1B20A 3S67A 2W56A 1NU3A 3PYJA 1CH0A 4CPKA 1QALA 1LQMB 5LC7A 3WMDA 1I0XA 3K7CA 1W02A 1Q7HA 3Q90A 1VQ43 4HM6B 2E2UA 2CH9A 3ROBA 4AEQA 3DUKA 2UGIA 1I2EA 3WDGB 3T0UA 1W6GA 1HYFA 1N9EA 3NM7A 3CXC2 4GB5A 3KFQC 2F4YA 2W56B 3KCHA 4N6NB 1EKMA 5EQLA 1RGGA 2CWUA 1OH0A 1MOLA 1T5YA 1ZX2A 2CIUA 3D5IA 1DE3A 3VSYA 4J9AA 3LTBA 3SYUA 1EUIC 2BNGA 4N6UA 2P09A 4MMZB 2O9UX 4RBNA 3LH4A 4XDWA 1MWTA 3SLUA 2GEYA 3K63A 1V74A 4OK0A 2C4BA 5BIRA 2W9QA 2KRTA 1IK3A 2XRXB 3AMOA 3T8NA 3WR2A 5HOHA 1TFKA 4HKVB 4HOHA 2CFDA 4HZBB 3DMCA 3Q3FA 4EXRA 1IVUA 3SX1A 2OTJ3 4I4KA 3JUPA 1GMPA 1U8CB 3CME3 1I3FA 5IG3A 3OWYA 1YNVX 2W6JH 1KC84 3S27A 1LOXA 4ORLA 3G4S3 1RGCA 1SQWA 4HBRA 2QA43 4CJNA 3DGOA 4HJLB 9RNTA 1YGEA 1FUTA 1GOUA 4DKIA 1B21A 1VQ53 1GY6A 3AHSA 1VQ73 1Q40A 3AMOB 3EHCA 1S5AA 1JNQA 1WTHA 4LSOA 5FGOA 1RN7A 1RGEA 1YJ93 1IT7A 1STDA 3DGLA 3K9MC 3QK9A 1C7HA 1RJOA 3EF8A 3NHXA 3EBTA 2RCDA 3S5CA 4KZ1A 2CW9A 3F14A 3FGYA 4HM0B 1LOYA 1OHOA 1K734 4XB5A 1RTUA 5D82A 1QVF2 1OACA 3N8BA 4X2HA 1Q864 3EB8A 1GD3A 1LOVA 3J7Yd 2ZA4A 2BHMA 1JBRA 3DGMA 1BNFA 1UCJA 4NHFA 3CD63 2XFSA 1W2ZA 2GBXB 3SOAA 2LYXA 1N5PA 2GU1A 2IUKA 1WNHA 2KAAA 3DGYA 6GSPA 3STDA 1JZOA 2F56A 3NXJA 5IG5A 3EQQB 3EX9A 1DMQA 1MWRA 4FMDA 1Q824 2F98A 3CU3A 1B3SA 3I0YA 4GL6A 3D4AA 3KKGA 4KT3B 1A67A 1I2FA 1ROAA 1ZO2A 1YJN3 3PXMA 1LRAA 3I563 1US1A 2CX0A 4WHAA 2AADA 4EC6A 3B4OA 5IW9A 1FUWA 2Y73A 4OUQA 1R4YA 2F99A 3BNEA 2BMRB 1RGLA 5AIIA 1FUSA 2CFLA 1BU4A 1FGQA 3DM8A 4K61A 2H0HA 1BRKA 2BMOB 3MPHA 3I553 3DZLA 3LYGA 3MKIA 1E3VA 1RRHA 2IYJA 4RZMA 3M8CA 1C54A 1WMPA 3UJMA 4NPBA 3CCU3 1CQSA 3MSOA 4IPBA 4HM7B 1RN1A 3G713 3G6E3 4LEHA 1X1WA 1TUHA 1BRSA 1AV4A 1TJDA 3A76A 1MGRA 4L8OA 1UGIA 4L8PA 2GU3A 2FNQA 3E99A 3RDEA 1U5OA 3X3XA 1LQGC 1OUNA 2E2TA 1UW1A 2RNTA 1VZZA 6STDA 3NV0B 1UUVB 2HMNB 1B2UA 4OVMA 4BL3A
chains in the Genus database with same CATH topology
1OHPA 2RGQA 5I97A 5IG4A 5D81A 2I9WA 2Q07A 3BLZA 4U13A 1J2BA 2MC8A 1QJGA 2PNCA 1ULJB 5AEUB 1W6YA 1K28A 3F9SA 3KIIA 4FMCA 2SBLA 2XEPA 3ALAA 3KSPA 1STFI 5CLKA 4XBXA 3U1WA 3DY5A 2BMQB 3D9RA 3NQZA 5AI1A 3N54B 3G16A 2CWTA 1O7GB 3G8ZA 3V99A 3S28A 2L4VA 4R4KA 3CCR3 3FLJA 2QGUA 3UL5A 2D42A 3WOFB 1YIJ3 4KFFA 2Z77A 1UUWB 1NB3I 4BTXA 4XBTA 3KN4A 3UNLA 1AVLA 2WGQA 1HU9A 3F8HA 1JKGA 1LNHA 3JUMA 4WWUC 3ER7A 2XSOB 1W6CA 4EV2A 1IV9A 1F8NA 3FSDA 4HZ9B 1GY7A 4RNYA 4BTYA 4HM8B 1IVXA 1IU7A 2KXGA 5JPUA 3RGRA 1OF5A 3F8XA 1OCVA 4L7KA 2Z76A 1CEWI 3SOYA 4R9KA 2CWVA 4MMXB 2P0MA 3H3HA 4WP5A 1JKGB 3B8LA 2XH9A 3X41A 3K5TA 1GS3A 2CG1A 5AYSC 1VQM3 2JDIH 3GWRA 1QMAA 2CC3A 5IG0A 5BXQA 2FGTA 2BT3A 3UL6A 4ZM8A 1OF5B 3MWZA 5CXOA 2HMMB 3HZPA 1K9M4 2IA7A 4EBGA 1DYUA 2XF3A 4N6V0 3FG4A 1DMNA 1JV2B 3GZXB 4KFEA 3NBBA 1Q7Y4 2HMLB 1VQP3 3LT9A 4CDLA 1D6ZA 2P05A 2R4IA 3X3ZA 1VQL3 1NJI4 1M904 4NREA 4IIAA 3BNCA 3FG1A 1VQN3 5HGRA 1VQ63 1Q40B 3EBYA 5AIGA 4O3VA 1PFPA 3IJEB 4H3UA 5AIFA 4EV5A 3NUVA 1VQK3 4FCJA 2W03A 2V1LA 7STDA 3ECFA 5IEPA 2YFJB 1IV7A 3CNMA 1SIIA 1IVVA 2OOVA 3F7SA 4O2HA 4FR9A 3FF2A 1KD14 2P38A 1ISKA 1OGXA 3OXAA 3JUNA 1VQ93 1W00A 3MG1A 3IMAB 1TU5A 2HMOB 3CC23 3CCE3 3U97A 1WMNA 2Z6BA 5IENA 2WOFA 1N5HA 3FKAA 2BO9B 3PGBA 3T8UA 3VGNA 4LZIA 4TX4A 1PU4A 1N8R4 3EN8A 1JN5A 1QAKA 3PCRA 3CNXA 5AYRB 3BNBA 4KVHA 5JPPA 2A15A 4QWTA 2WO0A 3MHEA 5DREA 2YX9A 4FCZA 4H61A 3X42A 3BB9A 2INXA 1WQLB 3LTDA 4N6LA 2OOVC 2CHCA 2W04A 2C10A 5A0OB 3SXXA 3K0ZA 1IQYA 4R80A 2B24B 1JN5B 2CKFB 3G0KA 2CK3H 1L5GB 3LOYA 3KE7A 3NQYA 2OTL3 2IMJA 3V98A 4N3VA 3NX0A 2W2CA 5AEWB 3BNDA 3S29A 1A90A 1KWIA 2C11A 2QIYA 1O7WB 1R4CA 1FGTA 3EN1B 3EC9A 1SJWA 2E2VA 3NBRA 4IT7A 4RNZA 1RKYA 3KSED 2OQEA 1QVG2 3H51A 3CCS3 3MG3A 5CF2A 1GYBA 2B1XB 1UI8A 4N6TA 3HIGA 3FCSB 1QAFA 1YIT3 4HM5B 4O02B 1O7HB 1E3RA 2P0XA 1W4NA 4HM4B 2CFKA 1CYUA 4WYKA 3B4PA 3EE1A 3RGAA 1S723 2GXFA 2XFTA 5CK6A 2F86B 3F7XA 3JVCA 1YJW3 1NB5I 2K0MA 2UX0A 1JRQA 5KP3A 2RFRA 4N6MA 3FH1A 3PZWA 4MJDA 4STDA 1NWWA 2Y74A 3V92A 1IDPA 1EA2A 4HYZA 3X3YA 1O7NB 1KQS2 2O3OA 1O7PB 1KSIA 5JBSA 3IPTA 3F40A 4WYKB 5STDA 2OQEC 3GZRA 4FCMA 1JB2A 3UB1A 1IVWA 1M9GA 3X40A 4AKYA 1W7CA 3KZTA 2HMJB 3HI7A 3HIIA 5DRVA 2JQ5A 5IEOA 1M1XB 3FF0A 2LQVA 3HX8A 2HMKB 1W2B2 3NM2A 3CCM3 1YVBI 1D6UA 1BUQA 5BVBA 2GBWB 3CCJ3 3CPOA 5AIHA 2ML6A 4K1UA 3L0RA 3DGNA 3CC43 3CMA3 5CF1A 1HKXA 1DMMA 1NDOB 4R1KA 2CFWA 1O7MB 2FXTA 3GZBA 4Q53A 1NO3A 1N8QA 1UI7A 2WGOA 1A2KA 3LMLA 4KFDA 1D6YA 1W5ZA 4WFOA 1FA3A 1N9JA 1Y4KA 3LTCA 1YHQ3 1JB5A 3EJVA 4K1VA 2KCDA 3NBJA 3QRDA 4HM1B 4O8SA 3N9HA 5EVHA 3OWUA 1TFOA 2YFIB 3PS8A 4LGQA 4AKZA 2ML5A 4BTWA 1A2VA 1AR0A 5EEOA 3MYTA 4LMIA 4JRFA 3Q2PA 4XBYA 3FG3A 3PCSA 1TIJA 1TP6A 3JUOA 1AVKA 3SEDA 4HM2B 2XGLA 3CCQ3 3OW22 4N6OB 3TDGA 3WA3A 3DXOA 1Z1SA 3GAXA 1YI23 2K54A 1E97A 1K41A 5TGNA 2YFLB 1LVNA 2RSXA 4FMBA 3CC73 2XSHB 5D83A 3WA2X 1CYVA 2ZDJA 1ASKA 3Q1CA 1FGMA 2WOHA 3WODG 3FZWA 1SIHA 4HM3B 3LZAA 2OWPA 4K90B 3OV4A 1RRLA 2IUJA 1FGOA 2M7OA 2STDA 2Z7AA 5LC6A 3B7CA 1JJ22 2XR8B 1DVDA 1IQXA 4HVNA 4XDVA 1EG9B 4G1MB 1Q42A 3CCL3 1EQKA 4PEJA 2QEX3 2XGNA 5KP1A 3JUQA 1ULIB 5KP4A 1SPUA 4R9LA 3VF1A 1DVCA 1FGRA 2MF7A 3LXUX 5ELUA 4FMAA 3OWSA 3GRDA 1Q814 1JB4A 3HK4A 1M1K4 1LXEA 3GZYB 2ZL8A 3NV0A 1VQO3 1OHSA 1W01A 3OX9A 4CCVA 2CFGA 3SVAA 3CCV3 3LTAA 2GEXA 2PZVA 4MMYB 5ELJA 1ROVA 3CPW2 4JF8A 4EYCA 3O8YA 3WOEB 1G96A 5G2GA 4J8TA 2CG0A 4MEIA 1K8A4 1IT8A 1IQ8A 3LT8A 5IERA 4X2OA 1WMOA 8CHOA 2OCTA 2W9PA 1MNLA 3MG2A 1OPYA 1GD4A 1GY5A 4XM4A 2W0QA 1OGZA 1VQ83 5FW5A 2D1WA 3D3LA 5IF6A 3S67A 2W56A 1NU3A 3PYJA 1QALA 3WMDA 5LC7A 3K7CA 1W02A 1VQ43 3Q90A 4HM6B 2E2UA 2CH9A 3ROBA 4AEQA 3DUKA 3WDGB 3T0UA 1W6GA 1N9EA 3NM7A 3CXC2 4GB5A 3KFQC 2W56B 4N6NB 1EKMA 5EQLA 2CWUA 1OH0A 1MOLA 1T5YA 1ZX2A 2CIUA 3VSYA 4J9AA 3LTBA 4N6UA 2BNGA 2P09A 4MMZB 2O9UX 4RBNA 3LH4A 4XDWA 3SLUA 2GEYA 3K63A 1V74A 4OK0A 2W9QA 2KRTA 1IK3A 2XRXB 3AMOA 3T8NA 1TFKA 4HKVB 4EXRA 2CFDA 4HZBB 3DMCA 1IVUA 3SX1A 2OTJ3 4I4KA 3JUPA 1U8CB 3CME3 5IG3A 3OWYA 2W6JH 1KC84 3S27A 1LOXA 4ORLA 3G4S3 1SQWA 4HBRA 2QA43 3DGOA 4HJLB 1YGEA 1VQ53 1GY6A 1VQ73 1Q40A 3AMOB 3EHCA 1S5AA 1JNQA 1WTHA 4LSOA 5FGOA 1RN7A 1YJ93 1IT7A 1STDA 3DGLA 3K9MC 3QK9A 1C7HA 1RJOA 3EF8A 3NHXA 3EBTA 2RCDA 3S5CA 4KZ1A 2CW9A 3F14A 3FGYA 4HM0B 1OHOA 1K734 4XB5A 5D82A 1QVF2 1OACA 3N8BA 4X2HA 1Q864 3EB8A 1GD3A 3J7Yd 2BHMA 3DGMA 4NHFA 3CD63 2XFSA 1W2ZA 2GBXB 3SOAA 2LYXA 1N5PA 2GU1A 2IUKA 1WNHA 3STDA 3NXJA 5IG5A 3EQQB 3EX9A 1DMQA 4FMDA 1Q824 2F98A 3CU3A 3I0YA 4GL6A 3KKGA 1A67A 1ZO2A 1ROAA 1YJN3 3PXMA 3I563 1US1A 4WHAA 4EC6A 3B4OA 5IW9A 1FUWA 2Y73A 4OUQA 2F99A 3BNEA 2BMRB 5AIIA 2CFLA 1FGQA 3DM8A 4K61A 2BMOB 3MPHA 3I553 3DZLA 3LYGA 3MKIA 1E3VA 1RRHA 4RZMA 3M8CA 1WMPA 3UJMA 3CCU3 1CQSA 3MSOA 4IPBA 4HM7B 3G713 3G6E3 4LEHA 1TUHA 1AV4A 3A76A 4L8OA 4L8PA 3RDEA 2GU3A 2FNQA 3E99A 3X3XA 1U5OA 1OUNA 2E2TA 1UW1A 1VZZA 6STDA 3NV0B 1UUVB 2HMNB 4OVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6N B;  3QRD A;  5EQL A;  1MOL A;  3PS8 A;  4N6U A;  3Q2P A;  2O9U X;  4N6L A;  3LH4 A;  1STF I;  1TIJ A;  5A0O B;  2W9Q A;  4N6O B;  3GAX A;  3UL5 A;  3NX0 A;  1NB3 I;  1CYV A;  1A90 A;  1KWI A;  1R4C A;  4IT7 A;  1RN7 A;  3KSE D;  5LC6 A;  1IV9 A;  1DVD A;  3K9M C;  4N6T A;  2KXG A;  1EQK A;  1CEW I;  1CYU A;  1GD3 A;  1DVC A;  1NB5 I;  5ELU A;  4N6M A;  1LXE A;  1N5P A;  3UL6 A;  4ZM8 A;  1WNH A;  3MWZ A;  4CCV A;  3SVA A;  5ELJ A;  4N6V 0;  1A67 A;  4EYC A;  1G96 A;  1M9G A;  1ROA A;  3PXM A;  1FUW A;  2OCT A;  2W9P A;  1MNL A;  1PFP A;  1GD4 A;  1YVB I;  1IV7 A;  3L0R A;  3S67 A;  3PYJ A;  5LC7 A;  3IMA B;  2CH9 A;  1FA3 A;  1N5H A;  1N9J A;  2BO9 B;  3KFQ C;  4LZI A;  4TX4 A; 
#chains in the Genus database with same CATH topology
 1OHP A;  2RGQ A;  1UUG B;  5I97 A;  3DH2 A;  5IG4 A;  1AQZ A;  2I9W A;  2Q07 A;  3BLZ A;  4U13 A;  5D81 A;  2MC8 A;  1J2B A;  1QJG A;  2PNC A;  3AHW A;  1ULJ B;  3A5E A;  5AEU B;  1W6Y A;  1K28 A;  3F9S A;  3KII A;  4FMC A;  2SBL A;  1UCL A;  2XEP A;  1GMR A;  3ALA A;  3KSP A;  1STF I;  2F5W A;  5CLK A;  4XBX A;  3U1W A;  1B2M A;  1BRJ A;  1FZU A;  3DY5 A;  2BMQ B;  3D9R A;  3NQZ A;  5AI1 A;  3N54 B;  3G16 A;  2CWT A;  1O7G B;  3G8Z A;  3V99 A;  3S28 A;  2L4V A;  4R4K A;  3CCR 3;  3AGN A;  3FLJ A;  2QGU A;  3UL5 A;  2D42 A;  3WOF B;  1BRI A;  1YIJ 3;  4KFF A;  2Z77 A;  1UUW B;  2SAR A;  3ZG0 A;  1NB3 I;  4BTX A;  4XBT A;  3KN4 A;  3UNL A;  2AAE A;  1MWS A;  1AVL A;  2BIR A;  1BSB A;  2WGQ A;  1HU9 A;  3F8H A;  1JKG A;  1LNH A;  3JUM A;  1B2S A;  4WWU C;  1GMQ A;  3ER7 A;  2XSO B;  1W6C A;  4EV2 A;  1IV9 A;  1F8N A;  3FSD A;  4HZ9 B;  1GY7 A;  4RNY A;  4BTY A;  4HM8 B;  1JBS A;  1IVX A;  1BNJ A;  1IU7 A;  2KXG A;  5JPU A;  3RGR A;  1OF5 A;  2R41 A;  3F8X A;  1OCV A;  4L7K A;  2Z76 A;  1CEW I;  1RLS A;  3SOY A;  4R9K A;  2CWV A;  4MMX B;  2P0M A;  3H3H A;  4WP5 A;  1JKG B;  3B8L A;  2XH9 A;  3X41 A;  1I2G A;  3K5T A;  1AY7 A;  1LOW A;  1GS3 A;  2CG1 A;  5AYS C;  1VQM 3;  2JDI H;  3GWR A;  1QMA A;  1RGF A;  2CC3 A;  4J5G A;  5IG0 A;  5BXQ A;  2FGT A;  2BT3 A;  3UL6 A;  4ZM8 A;  1OF5 B;  3MWZ A;  1BSE A;  5CXO A;  2HMM B;  2KF5 A;  3HZP A;  1K9M 4;  2IA7 A;  1RCK A;  4EBG A;  1DYU A;  2XF3 A;  4N6V 0;  3FG4 A;  2KF4 A;  3D5G A;  1DMN A;  1JV2 B;  3GZX B;  4KFE A;  1BNI A;  3NBB A;  2KF3 A;  1Q7Y 4;  2HML B;  2RBI A;  1VQP 3;  3LT9 A;  4CDL A;  1D6Z A;  1X1U A;  2P05 A;  2R4I A;  3X3Z A;  1DET A;  1NNV A;  1VQL 3;  1NJI 4;  1M90 4;  4NRE A;  4IIA A;  3BNC A;  3FG1 A;  1VQN 3;  5HGR A;  1VQ6 3;  1Q40 B;  3EBY A;  5AIG A;  4O3V A;  1PFP A;  2H0I A;  3IJE B;  4H3U A;  5AIF A;  4EV5 A;  3NUV A;  3AGO A;  1VQK 3;  4FCJ A;  2W03 A;  2V1L A;  4LYL B;  3ECF A;  4GSP A;  7STD A;  5IEP A;  2YFJ B;  1IV7 A;  3CNM A;  1SII A;  1IVV A;  2OOV A;  1I8V A;  3F7S A;  1TRQ A;  1BNE A;  4O2H A;  4FR9 A;  3FF2 A;  2ZHX B;  2P38 A;  1KD1 4;  1ISK A;  1OGX A;  3OXA A;  3JUN A;  1VQ9 3;  1W00 A;  3MG1 A;  1TRP A;  3IMA B;  1TU5 A;  2HMO B;  3CC2 3;  3CCE 3;  3U97 A;  1MWU A;  1WMN A;  2Z6B A;  5IEN A;  1RN4 A;  2WOF A;  1N5H A;  3FKA A;  1RGA A;  2BO9 B;  3PGB A;  3T8U A;  3VGN A;  4LZI A;  4TX4 A;  4BU4 A;  1PU4 A;  1N8R 4;  3EN8 A;  1JN5 A;  1QAK A;  1T2H A;  3PCR A;  4RNT A;  3CNX A;  5AYR B;  3BNB A;  4KVH A;  1I0V A;  5JPP A;  1IYY A;  2A15 A;  4QWT A;  2WO0 A;  3MHE A;  5DRE A;  2YX9 A;  4FCZ A;  4H61 A;  3X42 A;  1BSD A;  3BB9 A;  4BIR A;  2INX A;  1WQL B;  3LTD A;  4N6L A;  2OOV C;  2CHC A;  2W04 A;  2C10 A;  5A0O B;  3SXX A;  3RNT A;  3K0Z A;  1IQY A;  7GSP A;  4R80 A;  2B24 B;  1BNS A;  1JN5 B;  4EW5 A;  2CKF B;  3G0K A;  2CK3 H;  1L5G B;  3LOY A;  3KE7 A;  3NQY A;  2OTL 3;  2IMJ A;  3V98 A;  1SAR A;  4N3V A;  3HOH A;  3NX0 A;  2W2C A;  1G02 A;  5AEW B;  3BND A;  3S29 A;  7RNT A;  1KWI A;  1A90 A;  1HZ1 A;  1PYL A;  1RNT A;  2C11 A;  2QIY A;  1O7W B;  1FYS A;  1R4C A;  1UCI A;  1FGT A;  3EN1 B;  3EC9 A;  1SJW A;  4ILF A;  2E2V A;  3NBR A;  4IT7 A;  4RNZ A;  1RKY A;  3KSE D;  2OQE A;  1QVG 2;  3H51 A;  3CCS 3;  3MG3 A;  5CF2 A;  1GYB A;  2B1X B;  1UI8 A;  4N6T A;  3HIG A;  3FCS B;  1QAF A;  1YIT 3;  4HM5 B;  2GSP A;  4O02 B;  1O7H B;  1E3R A;  2P0X A;  1RGH A;  8RNT A;  1W4N A;  4HM4 B;  6RNT A;  2CFK A;  1CYU A;  4WYK A;  1BAN A;  3B4P A;  3EE1 A;  3RGA A;  2GXF A;  1S72 3;  2XFT A;  5CK6 A;  2F86 B;  1RNB A;  3F7X A;  1BRG A;  3JVC A;  1YJW 3;  1NB5 I;  2K0M A;  2UX0 A;  1JRQ A;  5KP3 A;  2RFR A;  4N6M A;  3GSP A;  3FH1 A;  3PZW A;  4MJD A;  5M1A A;  2UUG C;  3BIR A;  4STD A;  1NWW A;  2Y74 A;  2CX1 A;  1BVI A;  3V92 A;  1IDP A;  1EA2 A;  4HYZ A;  3X3Y A;  1O7N B;  1KQS 2;  1B27 A;  2L1S A;  2O3O A;  1O7P B;  1X1Y A;  2HOH A;  1UDI I;  1KSI A;  5JBS A;  3D79 A;  1BOX A;  3F40 A;  3IPT A;  4WYK B;  5STD A;  1BRH A;  3ZFZ A;  2OQE C;  1ZS7 A;  3GZR A;  4FCM A;  1JB2 A;  3UB1 A;  1IVW A;  1M9G A;  3URP A;  3X40 A;  5GSP A;  4AKY A;  1W7C A;  3KZT A;  1G0T A;  2HMJ B;  3HI7 A;  5M19 A;  3HII A;  5DRV A;  2JQ5 A;  5IEO A;  1M1X B;  3FF0 A;  1UCK A;  2LQV A;  3HX8 A;  2HMK B;  4BL2 A;  4J5K A;  1W2B 2;  3NM2 A;  3CCM 3;  1YGW A;  2J8X B;  1YVB I;  1BSA A;  1D6U A;  1BUQ A;  5BVB A;  2GBW B;  3CCJ 3;  3CPO A;  5AIH A;  2ML6 A;  4K1U A;  3L0R A;  3WHO A;  3DGN A;  3CC4 3;  3CMA 3;  5CF1 A;  1HKX A;  1DMM A;  1NDO B;  4R1K A;  2CFW A;  1O7M B;  2FXT A;  3GZB A;  4Q53 A;  1LNI A;  1N8Q A;  1NO3 A;  1UI7 A;  1BAO A;  2WGO A;  1A2K A;  3LML A;  1BIR A;  1GSP A;  4GHO A;  4KFD A;  5RNT A;  1D6Y A;  1ZGX A;  1RSN A;  1W5Z A;  4WFO A;  1FA3 A;  1N9J A;  1Y4K A;  3LTC A;  1YHQ 3;  1JB5 A;  3EJV A;  4K1V A;  2KCD A;  3NBJ A;  1FW7 A;  3QRD A;  4HM1 B;  4O8S A;  2F5M A;  1I70 A;  3N9H A;  2IY2 A;  5EVH A;  3OWU A;  1TFO A;  2YFI B;  3PS8 A;  4LGQ A;  4AKZ A;  2ML5 A;  4BTW A;  1A2V A;  1AR0 A;  5G1K A;  5EEO A;  3MYT A;  4LMI A;  4JRF A;  3Q2P A;  1BRN L;  4XBY A;  1EEJ A;  3FG3 A;  3PCS A;  1TIJ A;  1TP6 A;  3JUO A;  1AVK A;  3SED A;  4HM2 B;  1BUJ A;  1RGK A;  2XGL A;  1RDS A;  3CCQ 3;  3OW2 2;  4N6O B;  3TDG A;  3WA3 A;  3DXO A;  1YVS A;  1Z1S A;  3GAX A;  1YI2 3;  2K54 A;  1E97 A;  1K41 A;  5TGN A;  2YFL B;  1LVN A;  2RSX A;  1JZD A;  4FMB A;  3CC7 3;  4HAA A;  1T2I A;  2K3D A;  2XSH B;  5D83 A;  3WA2 X;  1CYV A;  2ZDJ A;  1ASK A;  1BNG A;  1MGW A;  1UGH I;  1VQQ A;  4I5Q A;  3Q1C A;  1FGM A;  2WOH A;  3WOD G;  3FZW A;  1SIH A;  4HM3 B;  3LZA A;  2OWP A;  4K90 B;  3OV4 A;  1RRL A;  2IUJ A;  1FGO A;  1V57 A;  2M7O A;  1I3I A;  1GOV A;  2STD A;  2Z7A A;  3B7C A;  5LC6 A;  1JJ2 2;  2XR8 B;  1DVD A;  1IQX A;  3BU4 A;  4HVN A;  4XDV A;  1EG9 B;  4G1M B;  1Q42 A;  3CCL 3;  1Q9E A;  1EQK A;  4PEJ A;  1JBT A;  2H0G A;  2QEX 3;  2XGN A;  5BU4 A;  3JUQ A;  5KP1 A;  1BNR A;  1ULI B;  5KP4 A;  3ZG5 A;  1SPU A;  4R9L A;  3VF1 A;  1DVC A;  1FGR A;  2MF7 A;  3LXU X;  5ELU A;  4FMA A;  3OWS A;  3GRD A;  1Q81 4;  1JB4 A;  1PY3 A;  3HK4 A;  1LXE A;  3GZY B;  1M1K 4;  2ZL8 A;  3NV0 A;  1VQO 3;  1OHS A;  1W01 A;  2KF6 A;  3OX9 A;  4CCV A;  5M18 A;  2CFG A;  3SVA A;  1V58 A;  3CCV 3;  3LTA A;  2GEX A;  1B2X A;  2PZV A;  4MMY B;  1X1X A;  1T3B A;  5ELJ A;  1RHL A;  1ROV A;  3CPW 2;  4JF8 A;  4EYC A;  3O8Y A;  3WOE B;  1G96 A;  2BU4 A;  5G2G A;  4J8T A;  1GOY A;  2CG0 A;  4MEI A;  1TTO A;  1K8A 4;  1IT8 A;  1IQ8 A;  1BGS A;  3LT8 A;  5IER A;  4X2O A;  1WMO A;  8CHO A;  2OCT A;  1RMS A;  2W9P A;  1MNL A;  3MG2 A;  1B2Z A;  5G1L A;  1OPY A;  1GD4 A;  1GY5 A;  4XM4 A;  2W0Q A;  1BSC A;  1OGZ A;  1VQ8 3;  5FW5 A;  1RCL A;  2D1W A;  3D3L A;  5IF6 A;  1A2P A;  1B20 A;  3S67 A;  2W56 A;  1NU3 A;  3PYJ A;  1CH0 A;  4CPK A;  1QAL A;  1LQM B;  5LC7 A;  3WMD A;  1I0X A;  3K7C A;  1W02 A;  1Q7H A;  3Q90 A;  1VQ4 3;  4HM6 B;  2E2U A;  2CH9 A;  3ROB A;  4AEQ A;  3DUK A;  2UGI A;  1I2E A;  3WDG B;  3T0U A;  1W6G A;  1HYF A;  1N9E A;  3NM7 A;  3CXC 2;  4GB5 A;  3KFQ C;  2F4Y A;  2W56 B;  3KCH A;  4N6N B;  1EKM A;  5EQL A;  1RGG A;  2CWU A;  1OH0 A;  1MOL A;  1T5Y A;  1ZX2 A;  2CIU A;  3D5I A;  1DE3 A;  3VSY A;  4J9A A;  3LTB A;  3SYU A;  1EUI C;  2BNG A;  4N6U A;  2P09 A;  4MMZ B;  2O9U X;  4RBN A;  3LH4 A;  4XDW A;  1MWT A;  3SLU A;  2GEY A;  3K63 A;  1V74 A;  4OK0 A;  2C4B A;  5BIR A;  2W9Q A;  2KRT A;  1IK3 A;  2XRX B;  3AMO A;  3T8N A;  3WR2 A;  5HOH A;  1TFK A;  4HKV B;  4HOH A;  2CFD A;  4HZB B;  3DMC A;  3Q3F A;  4EXR A;  1IVU A;  3SX1 A;  2OTJ 3;  4I4K A;  3JUP A;  1GMP A;  1U8C B;  3CME 3;  1I3F A;  5IG3 A;  3OWY A;  1YNV X;  2W6J H;  1KC8 4;  3S27 A;  1LOX A;  4ORL A;  3G4S 3;  1RGC A;  1SQW A;  4HBR A;  2QA4 3;  4CJN A;  3DGO A;  4HJL B;  9RNT A;  1YGE A;  1FUT A;  1GOU A;  4DKI A;  1B21 A;  1VQ5 3;  1GY6 A;  3AHS A;  1VQ7 3;  1Q40 A;  3AMO B;  3EHC A;  1S5A A;  1JNQ A;  1WTH A;  4LSO A;  5FGO A;  1RN7 A;  1RGE A;  1YJ9 3;  1IT7 A;  1STD A;  3DGL A;  3K9M C;  3QK9 A;  1C7H A;  1RJO A;  3EF8 A;  3NHX A;  3EBT A;  2RCD A;  3S5C A;  4KZ1 A;  2CW9 A;  3F14 A;  3FGY A;  4HM0 B;  1LOY A;  1OHO A;  1K73 4;  4XB5 A;  1RTU A;  5D82 A;  1QVF 2;  1OAC A;  3N8B A;  4X2H A;  1Q86 4;  3EB8 A;  1GD3 A;  1LOV A;  3J7Y d;  2ZA4 A;  2BHM A;  1JBR A;  3DGM A;  1BNF A;  1UCJ A;  4NHF A;  3CD6 3;  2XFS A;  1W2Z A;  2GBX B;  3SOA A;  2LYX A;  1N5P A;  2GU1 A;  2IUK A;  1WNH A;  2KAA A;  3DGY A;  6GSP A;  3STD A;  1JZO A;  2F56 A;  3NXJ A;  5IG5 A;  3EQQ B;  3EX9 A;  1DMQ A;  1MWR A;  4FMD A;  1Q82 4;  2F98 A;  3CU3 A;  1B3S A;  3I0Y A;  4GL6 A;  3D4A A;  3KKG A;  4KT3 B;  1A67 A;  1I2F A;  1ROA A;  1ZO2 A;  1YJN 3;  3PXM A;  1LRA A;  3I56 3;  1US1 A;  2CX0 A;  4WHA A;  2AAD A;  4EC6 A;  3B4O A;  5IW9 A;  1FUW A;  2Y73 A;  4OUQ A;  1R4Y A;  2F99 A;  3BNE A;  2BMR B;  1RGL A;  5AII A;  1FUS A;  2CFL A;  1BU4 A;  1FGQ A;  3DM8 A;  4K61 A;  2H0H A;  1BRK A;  2BMO B;  3MPH A;  3I55 3;  3DZL A;  3LYG A;  3MKI A;  1E3V A;  1RRH A;  2IYJ A;  4RZM A;  3M8C A;  1C54 A;  1WMP A;  3UJM A;  4NPB A;  3CCU 3;  1CQS A;  3MSO A;  4IPB A;  4HM7 B;  1RN1 A;  3G71 3;  3G6E 3;  4LEH A;  1X1W A;  1TUH A;  1BRS A;  1AV4 A;  1TJD A;  3A76 A;  1MGR A;  4L8O A;  1UGI A;  4L8P A;  2GU3 A;  2FNQ A;  3E99 A;  3RDE A;  1U5O A;  3X3X A;  1LQG C;  1OUN A;  2E2T A;  1UW1 A;  2RNT A;  1VZZ A;  6STD A;  3NV0 B;  1UUV B;  2HMN B;  1B2U A;  4OVM A;  4BL3 A; 
#chains in the Genus database with same CATH homology
 1OHP A;  2RGQ A;  5I97 A;  5IG4 A;  5D81 A;  2I9W A;  2Q07 A;  3BLZ A;  4U13 A;  1J2B A;  2MC8 A;  1QJG A;  2PNC A;  1ULJ B;  5AEU B;  1W6Y A;  1K28 A;  3F9S A;  3KII A;  4FMC A;  2SBL A;  2XEP A;  3ALA A;  3KSP A;  1STF I;  5CLK A;  4XBX A;  3U1W A;  3DY5 A;  2BMQ B;  3D9R A;  3NQZ A;  5AI1 A;  3N54 B;  3G16 A;  2CWT A;  1O7G B;  3G8Z A;  3V99 A;  3S28 A;  2L4V A;  4R4K A;  3CCR 3;  3FLJ A;  2QGU A;  3UL5 A;  2D42 A;  3WOF B;  1YIJ 3;  4KFF A;  2Z77 A;  1UUW B;  1NB3 I;  4BTX A;  4XBT A;  3KN4 A;  3UNL A;  1AVL A;  2WGQ A;  1HU9 A;  3F8H A;  1JKG A;  1LNH A;  3JUM A;  4WWU C;  3ER7 A;  2XSO B;  1W6C A;  4EV2 A;  1IV9 A;  1F8N A;  3FSD A;  4HZ9 B;  1GY7 A;  4RNY A;  4BTY A;  4HM8 B;  1IVX A;  1IU7 A;  2KXG A;  5JPU A;  3RGR A;  1OF5 A;  3F8X A;  1OCV A;  4L7K A;  2Z76 A;  1CEW I;  3SOY A;  4R9K A;  2CWV A;  4MMX B;  2P0M A;  3H3H A;  4WP5 A;  1JKG B;  3B8L A;  2XH9 A;  3X41 A;  3K5T A;  1GS3 A;  2CG1 A;  5AYS C;  1VQM 3;  2JDI H;  3GWR A;  1QMA A;  2CC3 A;  5IG0 A;  5BXQ A;  2FGT A;  2BT3 A;  3UL6 A;  4ZM8 A;  1OF5 B;  3MWZ A;  5CXO A;  2HMM B;  3HZP A;  1K9M 4;  2IA7 A;  4EBG A;  1DYU A;  2XF3 A;  4N6V 0;  3FG4 A;  1DMN A;  1JV2 B;  3GZX B;  4KFE A;  3NBB A;  1Q7Y 4;  2HML B;  1VQP 3;  3LT9 A;  4CDL A;  1D6Z A;  2P05 A;  2R4I A;  3X3Z A;  1VQL 3;  1NJI 4;  1M90 4;  4NRE A;  4IIA A;  3BNC A;  3FG1 A;  1VQN 3;  5HGR A;  1VQ6 3;  1Q40 B;  3EBY A;  5AIG A;  4O3V A;  1PFP A;  3IJE B;  4H3U A;  5AIF A;  4EV5 A;  3NUV A;  1VQK 3;  4FCJ A;  2W03 A;  2V1L A;  7STD A;  3ECF A;  5IEP A;  2YFJ B;  1IV7 A;  3CNM A;  1SII A;  1IVV A;  2OOV A;  3F7S A;  4O2H A;  4FR9 A;  3FF2 A;  1KD1 4;  2P38 A;  1ISK A;  1OGX A;  3OXA A;  3JUN A;  1VQ9 3;  1W00 A;  3MG1 A;  3IMA B;  1TU5 A;  2HMO B;  3CC2 3;  3CCE 3;  3U97 A;  1WMN A;  2Z6B A;  5IEN A;  2WOF A;  1N5H A;  3FKA A;  2BO9 B;  3PGB A;  3T8U A;  3VGN A;  4LZI A;  4TX4 A;  1PU4 A;  1N8R 4;  3EN8 A;  1JN5 A;  1QAK A;  3PCR A;  3CNX A;  5AYR B;  3BNB A;  4KVH A;  5JPP A;  2A15 A;  4QWT A;  2WO0 A;  3MHE A;  5DRE A;  2YX9 A;  4FCZ A;  4H61 A;  3X42 A;  3BB9 A;  2INX A;  1WQL B;  3LTD A;  4N6L A;  2OOV C;  2CHC A;  2W04 A;  2C10 A;  5A0O B;  3SXX A;  3K0Z A;  1IQY A;  4R80 A;  2B24 B;  1JN5 B;  2CKF B;  3G0K A;  2CK3 H;  1L5G B;  3LOY A;  3KE7 A;  3NQY A;  2OTL 3;  2IMJ A;  3V98 A;  4N3V A;  3NX0 A;  2W2C A;  5AEW B;  3BND A;  3S29 A;  1A90 A;  1KWI A;  2C11 A;  2QIY A;  1O7W B;  1R4C A;  1FGT A;  3EN1 B;  3EC9 A;  1SJW A;  2E2V A;  3NBR A;  4IT7 A;  4RNZ A;  1RKY A;  3KSE D;  2OQE A;  1QVG 2;  3H51 A;  3CCS 3;  3MG3 A;  5CF2 A;  1GYB A;  2B1X B;  1UI8 A;  4N6T A;  3HIG A;  3FCS B;  1QAF A;  1YIT 3;  4HM5 B;  4O02 B;  1O7H B;  1E3R A;  2P0X A;  1W4N A;  4HM4 B;  2CFK A;  1CYU A;  4WYK A;  3B4P A;  3EE1 A;  3RGA A;  1S72 3;  2GXF A;  2XFT A;  5CK6 A;  2F86 B;  3F7X A;  3JVC A;  1YJW 3;  1NB5 I;  2K0M A;  2UX0 A;  1JRQ A;  5KP3 A;  2RFR A;  4N6M A;  3FH1 A;  3PZW A;  4MJD A;  4STD A;  1NWW A;  2Y74 A;  3V92 A;  1IDP A;  1EA2 A;  4HYZ A;  3X3Y A;  1O7N B;  1KQS 2;  2O3O A;  1O7P B;  1KSI A;  5JBS A;  3IPT A;  3F40 A;  4WYK B;  5STD A;  2OQE C;  3GZR A;  4FCM A;  1JB2 A;  3UB1 A;  1IVW A;  1M9G A;  3X40 A;  4AKY A;  1W7C A;  3KZT A;  2HMJ B;  3HI7 A;  3HII A;  5DRV A;  2JQ5 A;  5IEO A;  1M1X B;  3FF0 A;  2LQV A;  3HX8 A;  2HMK B;  1W2B 2;  3NM2 A;  3CCM 3;  1YVB I;  1D6U A;  1BUQ A;  5BVB A;  2GBW B;  3CCJ 3;  3CPO A;  5AIH A;  2ML6 A;  4K1U A;  3L0R A;  3DGN A;  3CC4 3;  3CMA 3;  5CF1 A;  1HKX A;  1DMM A;  1NDO B;  4R1K A;  2CFW A;  1O7M B;  2FXT A;  3GZB A;  4Q53 A;  1NO3 A;  1N8Q A;  1UI7 A;  2WGO A;  1A2K A;  3LML A;  4KFD A;  1D6Y A;  1W5Z A;  4WFO A;  1FA3 A;  1N9J A;  1Y4K A;  3LTC A;  1YHQ 3;  1JB5 A;  3EJV A;  4K1V A;  2KCD A;  3NBJ A;  3QRD A;  4HM1 B;  4O8S A;  3N9H A;  5EVH A;  3OWU A;  1TFO A;  2YFI B;  3PS8 A;  4LGQ A;  4AKZ A;  2ML5 A;  4BTW A;  1A2V A;  1AR0 A;  5EEO A;  3MYT A;  4LMI A;  4JRF A;  3Q2P A;  4XBY A;  3FG3 A;  3PCS A;  1TIJ A;  1TP6 A;  3JUO A;  1AVK A;  3SED A;  4HM2 B;  2XGL A;  3CCQ 3;  3OW2 2;  4N6O B;  3TDG A;  3WA3 A;  3DXO A;  1Z1S A;  3GAX A;  1YI2 3;  2K54 A;  1E97 A;  1K41 A;  5TGN A;  2YFL B;  1LVN A;  2RSX A;  4FMB A;  3CC7 3;  2XSH B;  5D83 A;  3WA2 X;  1CYV A;  2ZDJ A;  1ASK A;  3Q1C A;  1FGM A;  2WOH A;  3WOD G;  3FZW A;  1SIH A;  4HM3 B;  3LZA A;  2OWP A;  4K90 B;  3OV4 A;  1RRL A;  2IUJ A;  1FGO A;  2M7O A;  2STD A;  2Z7A A;  5LC6 A;  3B7C A;  1JJ2 2;  2XR8 B;  1DVD A;  1IQX A;  4HVN A;  4XDV A;  1EG9 B;  4G1M B;  1Q42 A;  3CCL 3;  1EQK A;  4PEJ A;  2QEX 3;  2XGN A;  5KP1 A;  3JUQ A;  1ULI B;  5KP4 A;  1SPU A;  4R9L A;  3VF1 A;  1DVC A;  1FGR A;  2MF7 A;  3LXU X;  5ELU A;  4FMA A;  3OWS A;  3GRD A;  1Q81 4;  1JB4 A;  3HK4 A;  1M1K 4;  1LXE A;  3GZY B;  2ZL8 A;  3NV0 A;  1VQO 3;  1OHS A;  1W01 A;  3OX9 A;  4CCV A;  2CFG A;  3SVA A;  3CCV 3;  3LTA A;  2GEX A;  2PZV A;  4MMY B;  5ELJ A;  1ROV A;  3CPW 2;  4JF8 A;  4EYC A;  3O8Y A;  3WOE B;  1G96 A;  5G2G A;  4J8T A;  2CG0 A;  4MEI A;  1K8A 4;  1IT8 A;  1IQ8 A;  3LT8 A;  5IER A;  4X2O A;  1WMO A;  8CHO A;  2OCT A;  2W9P A;  1MNL A;  3MG2 A;  1OPY A;  1GD4 A;  1GY5 A;  4XM4 A;  2W0Q A;  1OGZ A;  1VQ8 3;  5FW5 A;  2D1W A;  3D3L A;  5IF6 A;  3S67 A;  2W56 A;  1NU3 A;  3PYJ A;  1QAL A;  3WMD A;  5LC7 A;  3K7C A;  1W02 A;  1VQ4 3;  3Q90 A;  4HM6 B;  2E2U A;  2CH9 A;  3ROB A;  4AEQ A;  3DUK A;  3WDG B;  3T0U A;  1W6G A;  1N9E A;  3NM7 A;  3CXC 2;  4GB5 A;  3KFQ C;  2W56 B;  4N6N B;  1EKM A;  5EQL A;  2CWU A;  1OH0 A;  1MOL A;  1T5Y A;  1ZX2 A;  2CIU A;  3VSY A;  4J9A A;  3LTB A;  4N6U A;  2BNG A;  2P09 A;  4MMZ B;  2O9U X;  4RBN A;  3LH4 A;  4XDW A;  3SLU A;  2GEY A;  3K63 A;  1V74 A;  4OK0 A;  2W9Q A;  2KRT A;  1IK3 A;  2XRX B;  3AMO A;  3T8N A;  1TFK A;  4HKV B;  4EXR A;  2CFD A;  4HZB B;  3DMC A;  1IVU A;  3SX1 A;  2OTJ 3;  4I4K A;  3JUP A;  1U8C B;  3CME 3;  5IG3 A;  3OWY A;  2W6J H;  1KC8 4;  3S27 A;  1LOX A;  4ORL A;  3G4S 3;  1SQW A;  4HBR A;  2QA4 3;  3DGO A;  4HJL B;  1YGE A;  1VQ5 3;  1GY6 A;  1VQ7 3;  1Q40 A;  3AMO B;  3EHC A;  1S5A A;  1JNQ A;  1WTH A;  4LSO A;  5FGO A;  1RN7 A;  1YJ9 3;  1IT7 A;  1STD A;  3DGL A;  3K9M C;  3QK9 A;  1C7H A;  1RJO A;  3EF8 A;  3NHX A;  3EBT A;  2RCD A;  3S5C A;  4KZ1 A;  2CW9 A;  3F14 A;  3FGY A;  4HM0 B;  1OHO A;  1K73 4;  4XB5 A;  5D82 A;  1QVF 2;  1OAC A;  3N8B A;  4X2H A;  1Q86 4;  3EB8 A;  1GD3 A;  3J7Y d;  2BHM A;  3DGM A;  4NHF A;  3CD6 3;  2XFS A;  1W2Z A;  2GBX B;  3SOA A;  2LYX A;  1N5P A;  2GU1 A;  2IUK A;  1WNH A;  3STD A;  3NXJ A;  5IG5 A;  3EQQ B;  3EX9 A;  1DMQ A;  4FMD A;  1Q82 4;  2F98 A;  3CU3 A;  3I0Y A;  4GL6 A;  3KKG A;  1A67 A;  1ZO2 A;  1ROA A;  1YJN 3;  3PXM A;  3I56 3;  1US1 A;  4WHA A;  4EC6 A;  3B4O A;  5IW9 A;  1FUW A;  2Y73 A;  4OUQ A;  2F99 A;  3BNE A;  2BMR B;  5AII A;  2CFL A;  1FGQ A;  3DM8 A;  4K61 A;  2BMO B;  3MPH A;  3I55 3;  3DZL A;  3LYG A;  3MKI A;  1E3V A;  1RRH A;  4RZM A;  3M8C A;  1WMP A;  3UJM A;  3CCU 3;  1CQS A;  3MSO A;  4IPB A;  4HM7 B;  3G71 3;  3G6E 3;  4LEH A;  1TUH A;  1AV4 A;  3A76 A;  4L8O A;  4L8P A;  3RDE A;  2GU3 A;  2FNQ A;  3E99 A;  3X3X A;  1U5O A;  1OUN A;  2E2T A;  1UW1 A;  1VZZ A;  6STD A;  3NV0 B;  1UUV B;  2HMN B;  4OVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...