3L0RA

Crystal structure of salivary cystatin from the soft tick ornithodoros moubata
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
b'IPGGWTRQDPTEARFLELAHFATSSQTEGREFYDTVVTVKEVETQVVAGMNYKLTIEISPSVCKIGEVQYSAEQCVPKDAQQKSTCVAVIYHVPWQNQKSVTSYRCEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-2
publication title Crystal structure and functional characterization of an immunomodulatory salivary cystatin from the soft tick Ornithodoros moubata
pubmed doi rcsb
source organism Ornithodoros moubata
molecule tags Hydrolase inhibitor
total genus 24
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3l0rA00
3QRDA 4N6MA 4EYCA 1N5PA 1DVCA 2BO9B 1STFI 3UL6A 1KWIA 1M9GA 1N9JA 1MOLA 2O9UX 3LH4A 3KFQC 1R4CA 3IMAB 4CCVA 3S67A 5EQLA 1NB3I 1GD4A 4LZIA 4TX4A 1N5HA 1G96A 1GD3A 5A0OB 4N6OB 4N6UA 3K9MC 3PS8A 4N6NB 4ZM8A 1ROAA 2CH9A 1CEWI 1CYUA 3GAXA 3PXMA 3Q2PA 5LC7A 3SVAA 1IV9A 2W9QA 1EQKA 5ELUA 1YVBI 1NB5I 3NX0A 3UL5A 1CYVA 4N6LA 2W9PA 1TIJA 1A67A 1DVDA 1IV7A 1FA3A 4N6V0 1WNHA 5LC6A 2OCTA 3MWZA 4N6TA 1MNLA 5ELJA 2KXGA 1FUWA 3KSED 1A90A 1RN7A 3L0RA 3PYJA 4IT7A 1LXEA 1PFPA
chains in the Genus database with same CATH superfamily
2HOHA 3X3ZA 4HAAA 3ECFA 3HIIA 1RJOA 4LYLB 1TP6A 2KRTA 3V92A 3GZYB 3MG3A 2F5MA 3PGBA 5D83A 4AEQA 3BIRA 3NHXA 2L1SA 3CU3A 3G713 1VQL3 4R9LA 2CW9A 1HKXA 1W4NA 1TFOA 1DYUA 3FLJA 1WMPA 2O9UX 3EBYA 3FG3A 3LH4A 4CJNA 1Q7Y4 2P09A 3UNLA 3HZPA 4HM5B 5M19A 5BU4A 4DKIA 3EJVA 4AKZA 2HMOB 5JPPA 3K0ZA 1RGCA 4R4KA 1NJI4 1JN5A 6STDA 4LZIA 4TX4A 3CCL3 2OTJ3 5DRVA 1GOVA 1I8VA 2IYJA 2XRXB 2GSPA 1G96A 1ZS7A 4XM4A 3CC43 1FGMA 8CHOA 2Z76A 1AQZA 1X1UA 4N6UA 2D42A 3V98A 4K1VA 1GMRA 3OWUA 2W04A 1SARA 1OF5B 2BU4A 1CYUA 2XSHB 1CQSA 1RGHA 2C11A 3PXMA 3NUVA 3Q2PA 1ROVA 1BNRA 4BTXA 1A2VA 1GYBA 3U1WA 3MHEA 1Q824 1BNSA 1RGAA 1ZGXA 3ZG0A 4BL3A 4XB5A 4OUQA 1BGSA 2Y73A 3K5TA 4HM1B 1YJ93 2BMRB 6GSPA 1BVIA 1FGQA 2GEYA 1YVBI 4WWUC 1TTOA 2QEX3 2P38A 4BIRA 3X3YA 2GEXA 3SLUA 1ULIB 1L5GB 1BAOA 5AEUB 1BUQA 3DM8A 3Q1CA 5FGOA 4KFDA 2RFRA 4LMIA 1KC84 1RNBA 3V99A 1MGWA 3Q90A 3KCHA 1IVWA 3CME3 2STDA 4MMZB 1ZX2A 2F4YA 3JUMA 3MKIA 1FA3A 7GSPA 1X1WA 1UI8A 3FCSB 1AR0A 2I9WA 5M1AA 3MWZA 1IT7A 2P0MA 1IDPA 1RGKA 4I4KA 2OQEC 3OV4A 4HM0B 1EQKA 2YX9A 3CCQ3 3D9RA 1GOUA 4BTWA 3RDEA 3HIGA 3KE7A 5JPUA 1Y4KA 2RNTA 1DMMA 3KSED 2W56B 3KZTA 3WOFB 1LOXA 4RZMA 1OHSA 1LVNA 1D6UA 1BNIA 1T2IA 3H3HA 3E99A 5IERA 3L0RA 2KAAA 1UUVB 2AADA 1IQXA 3EB8A 4RNZA 1JJ22 3HI7A 5AYSC 3HX8A 3SXXA 4WHAA 1VQQA 1BSEA 4HM6B 5BVBA 1RHLA 2D1WA 2HMJB 2W56A 2CC3A 3EBTA 2PZVA 4MEIA 1YI23 2RSXA 3GZRA 2XGNA 5IG0A 1VQ43 3D5GA 2H0HA 3LTDA 2F56A 1TFKA 3QRDA 3J7Yd 3KKGA 3F8HA 2F5WA 1JBSA 4O8SA 1JNQA 1UGIA 4I5QA 4EYCA 1N5PA 4XBTA 3Q3FA 4H3UA 4HM8B 9RNTA 1LRAA 5AI1A 2BIRA 3WODG 4JRFA 1VQ93 2KF4A 3T8UA 1S723 1MOLA 4HKVB 1OHPA 2CG0A 1GY5A 1W2ZA 3WHOA 5M18A 2KF6A 5D81A 3CCE3 3LYGA 3A5EA 1VQN3 3CPOA 1R4CA 1BRHA 1BSBA 2CFWA 3DGNA 5EEOA 3SOAA 5I97A 1JBRA 1BSCA 1RGEA 3IMAB 1GD4A 1T5YA 5GSPA 2HMLB 3F7SA 3NBBA 2HMMB 2ML6A 1LNHA 1RGGA 4GHOA 2Y74A 1RRLA 1QMAA 1JB2A 1W5ZA 4NHFA 1STDA 4O2HA 3AGNA 1FGOA 3G6E3 3FSDA 2W6JH 3LT8A 2RBIA 1C54A 3S28A 1PU4A 2CWUA 4ZM8A 2B24B 3G4S3 1BRJA 2H0GA 2CX0A 1JN5B 2BNGA 3F40A 3GAXA 2OQEA 3TDGA 1YIT3 3T0UA 1JBTA 3CD63 1FGTA 1X1XA 3RNTA 3WOEB 1EEJA 1RDSA 1TJDA 5RNTA 2C10A 5CK6A 1W2B2 1G0TA 2CX1A 2W9QA 4Q53A 3H51A 4X2OA 4CDLA 1T2HA 3HK4A 3F7XA 3BNBA 2CK3H 2XFTA 2R4IA 1Q814 4MMYB 1QALA 1V74A 1WQLB 3D5IA 1VQ83 1YVSA 4EV2A 3NX0A 4K61A 3BLZA 4FMDA 1C7HA 1I3IA 2GBXB 1JKGB 2A15A 2Z77A 3UL5A 1GOYA 3CCM3 4FMBA 1NU3A 1BRIA 4MMXB 4N6LA 5G2GA 2W9PA 1Q40A 4ILFA 3I553 1RNTA 1K41A 1IV7A 2E2UA 2YFIB 4RNYA 5IEPA 2CFKA 3JVCA 2CFGA 1E3RA 1OGZA 2WOHA 1JKGA 1WMOA 1BU4A 2IUJA 1VQ63 5AIGA 2PNCA 3LTCA 4HZ9B 2BHMA 2BT3A 4WYKB 3GWRA 2OCTA 2B1XB 1FZUA 2M7OA 3JUPA 1WTHA 4J5GA 4N6TA 1EA2A 5AIIA 1I2FA 1SQWA 1VZZA 4FR9A 2JDIH 4HM7B 1VQK3 3SOYA 1D6YA 3ZFZA 5JBSA 2UUGC 2UX0A 3MG1A 5CF1A 2KXGA 3CCR3 4ORLA 4WYKA 1LOWA 1YJN3 1KSIA 3NBRA 4MJDA 5IG4A 1IVUA 2OWPA 2HMNB 3KN4A 3PYJA 3JUNA 2ZA4A 1VQ53 5G1LA 3T8NA 2WO0A 2XR8B 2QGUA 1RRHA 2CWVA 3LZAA 5STDA 3LOYA 4HJLB 1RCKA 4J5KA 3ZG5A 1RCLA 1FW7A 5AIHA 3DMCA 1LQGC 3EHCA 1B3SA 3CNMA 4IPBA 3WA3A 5KP1A 1TUHA 1BNGA 3FG4A 1O7HB 3DGYA 1F8NA 3LT9A 2P05A 3AGOA 1Q42A 5FW5A 1I2GA 5CF2A 5AYRB 1U5OA 2FXTA 3G0KA 3MPHA 2QA43 2MF7A 4LSOA 2BO9B 2WOFA 1UCKA 3UL6A 3MSOA 1KWIA 2P0XA 1E3VA 3M8CA 1M9GA 1SPUA 1N9JA 5TGNA 1KD14 3B4OA 1BSDA 3NQZA 1RN1A 7STDA 1VQO3 1BRGA 2SARA 2RGQA 3N54B 2Z6BA 1M1XB 2E2VA 4RBNA 2W2CA 4PEJA 1KQS2 2LQVA 3LTBA 1UGHI 3SX1A 1LQMB 4HZBB 1NB3I 2V1LA 3S67A 3UB1A 3GSPA 3KSPA 3KIIA 5CLKA 1T3BA 1RGFA 2UGIA 3OX9A 3GZXB 3URPA 2JQ5A 1RKYA 2FGTA 2R41A 2Z7AA 5IG5A 4GSPA 1IVXA 2C4BA 1O7PB 4QWTA 3EF8A 4HM4B 1GD3A 4U13A 7RNTA 5D82A 3EN8A 1OHOA 4EW5A 2LYXA 1PY3A 3K9MC 3F14A 1IQ8A 3FF0A 2YFJB 1BRNL 3ER7A 1LOYA 3G16A 1RSNA 1K28A 3DGMA 3IJEB 1N9EA 3S5CA 1W6YA 2CWTA 3A76A 4G1MB 3NM7A 4O02B 2IMJA 2IUKA 1B2UA 1K8A4 2CHCA 3EC9A 4FCJA 2CKFB 4LEHA 4K1UA 1AVKA 2GU1A 4HM3B 1IV9A 1SJWA 3O8YA 4KFFA 1I0XA 2YFLB 1OGXA 3SVAA 4O3VA 1RN4A 1NDOB 1MWTA 1JB5A 1MWSA 2ZDJA 3EE1A 3VF1A 3ROBA 5ELUA 3CCU3 1UUWB 1S5AA 2J8XB 1JZOA 3AMOB 1JV2B 1TU5A 3BB9A 3STDA 3BNEA 4J9AA 1N8R4 1UDII 2F99A 1D6ZA 3CCV3 4FCMA 3OW22 2IA7A 2BMQB 2K54A 4KVHA 3S27A 1G02A 5IEOA 1FGRA 1DVDA 3I0YA 1LOVA 4STDA 3AMOA 1NNVA 4KZ1A 1HYFA 5IENA 1B21A 5HOHA 5KP4A 2K3DA 3F8XA 1RMSA 4N6V0 1WNHA 4NPBA 3X3XA 4IIAA 1I3FA 1J2BA 1YJW3 1V57A 3D79A 4FMAA 4RNTA 3K7CA 1Q40B 3EX9A 1UI7A 3UJMA 4X2HA 1DE3A 3FG1A 1Q864 2O3OA 5DREA 2AAEA 2GXFA 3CNXA 5G1KA 1IVVA 2GBWB 4OVMA 1W6CA 5IG3A 5AEWB 1FUWA 1BRKA 2KCDA 1A90A 1OH0A 4R80A 2CFLA 2OTL3 2IY2A 1B27A 2L4VA 3BU4A 4HM2B 2OOVC 1SIIA 1AVLA 4J8TA 3X41A 1ULJB 1NWWA 1IQYA 1BNFA 4IT7A 3CCS3 1EG9B 3CC73 1TRPA 1GS3A 3OWSA 5HGRA 8RNTA 3CC23 3EN1B 1OCVA 3BNCA 2KF3A 1QAKA 3FGYA 3DUKA 2BMOB 5CXOA 3PCSA 2Q07A 4XBXA 4R9KA 3RGAA 2MC8A 1ASKA 1CH0A 4BU4A 1M1K4 4N6MA 1RTUA 1HU9A 1K734 1QVF2 2F86B 1MGRA 1O7GB 1UCIA 2FNQA 4R1KA 5KP3A 3CXC2 1EUIC 1IU7A 3GZBA 3QK9A 5BIRA 1DVCA 1VQP3 1QJGA 2XFSA 1U8CB 1FUTA 1W02A 1STFI 3FF2A 3DGOA 4H61A 2XH9A 4GL6A 1GMPA 3FKAA 2SBLA 2XSOB 3PZWA 5IF6A 1OPYA 3ALAA 1Q7HA 4HOHA 3KFQC 1OUNA 4N3VA 4XBYA 2CFDA 1BANA 3DZLA 2XEPA 3NXJA 4LGQA 5AIFA 2ML5A 1B2SA 1X1YA 3B7CA 4CCVA 1YGEA 2WGQA 5EQLA 3WDGB 1I0VA 3DXOA 1OF5A 3D3LA 3JUQA 1RLSA 3BNDA 1IT8A 4BTYA 1BRSA 4HBRA 4EXRA 1UW1A 1HZ1A 1N5HA 3LMLA 1UCJA 1B20A 4HYZA 5IW9A 1MWRA 3LXUX 1VQM3 1UCLA 3GRDA 1MWUA 5A0OB 5BXQA 4N6OB 1FYSA 2H0IA 3DGLA 3PS8A 3DH2A 4N6NB 1PYLA 4WP5A 1ROAA 1O7MB 1GY7A 2F98A 3IPTA 1B2XA 4AKYA 2CH9A 2W0QA 1CEWI 1BUJA 3RGRA 3LTAA 1BOXA 4EBGA 2GU3A 1A2KA 1DMNA 1BNEA 1DETA 5LC7A 2HMKB 3FH1A 2CIUA 1Q9EA 4JF8A 4EV5A 1JRQA 1O7NB 1N8QA 1EKMA 1R4YA 2OOVA 1NB5I 1K9M4 1I2EA 3OWYA 3CCJ3 1SIHA 4WFOA 4EC6A 4BL2A 4NREA 1IK3A 2E2TA 3AHWA 3JUOA 3NM2A 3N8BA 2XGLA 1QVG2 2WGOA 1CYVA 3K63A 1V58A 1LNIA 1BSAA 1YHQ3 1ISKA 3MG2A 1TIJA 4CPKA 1IYYA 1TRQA 1A67A 2RCDA 1I70A 3B4PA 1UUGB 3CMA3 3EQQB 4XDVA 1VQ73 3FZWA 1BIRA 1M904 1E97A 1QAFA 1JB4A 2QIYA 1DMQA 1FUSA 1ZO2A 2ZHXB 1W7CA 5LC6A 3WA2X 1A2PA 1GSPA 1W01A 3SYUA 1RGLA 3NV0B 1YNVX 3PCRA 3S29A 1B2ZA 1MNLA 1NO3A 2XF3A 2ZL8A 3B8LA 3HOHA 4K90B 5ELJA 3I563 6RNTA 1Z1SA 4GB5A 1US1A 4L8OA 5EVHA 1YGWA 2K0MA 3VGNA 2CG1A 3WMDA 3F9SA 2W03A 3D4AA 3OXAA 4KFEA 1JZDA 1W00A 3X40A 3NV0A 3CPW2 1W6GA 3VSYA 3SEDA 1RN7A 3U97A 1O7WB 3NBJA 1GY6A 2KF5A 1AY7A 3MYTA 3AHSA 4KT3B 4L7KA 1B2MA 4L8PA 1GMQA 1WMNA 1LXEA 3G8ZA 3N9HA 3NQYA 4FMCA 4HVNA 4OK0A 1AV4A 1BNJA 1OACA 4FCZA 3DY5A 3X42A 1YIJ3 1PFPA 2INXA 4XDWA 3WR2A
chains in the Genus database with same CATH topology
3X3ZA 3ECFA 3HIIA 1RJOA 1TP6A 2KRTA 3V92A 3GZYB 3MG3A 3PGBA 5D83A 4AEQA 3NHXA 3CU3A 3G713 1VQL3 4R9LA 2CW9A 1HKXA 1W4NA 1TFOA 1DYUA 3FLJA 1WMPA 2O9UX 3EBYA 3FG3A 3LH4A 1Q7Y4 2P09A 3UNLA 3HZPA 4HM5B 3EJVA 4AKZA 2HMOB 5JPPA 3K0ZA 4R4KA 1NJI4 1JN5A 6STDA 4LZIA 4TX4A 3CCL3 2OTJ3 5DRVA 2XRXB 1G96A 4XM4A 3CC43 1FGMA 8CHOA 2Z76A 4N6UA 2D42A 3V98A 4K1VA 3OWUA 2W04A 1OF5B 1CYUA 2XSHB 1CQSA 3PXMA 2C11A 3Q2PA 3NUVA 1ROVA 4BTXA 1A2VA 1GYBA 3U1WA 3MHEA 1Q824 4XB5A 4OUQA 2Y73A 3K5TA 4HM1B 1YJ93 2BMRB 1FGQA 2GEYA 1YVBI 4WWUC 2QEX3 2P38A 3X3YA 2GEXA 3SLUA 1ULIB 1L5GB 5AEUB 1BUQA 3DM8A 3Q1CA 5FGOA 4KFDA 2RFRA 4LMIA 1KC84 3V99A 3Q90A 1IVWA 3CME3 2STDA 4MMZB 1ZX2A 3JUMA 3MKIA 1FA3A 1UI8A 3FCSB 1AR0A 2I9WA 3MWZA 1IT7A 2P0MA 1IDPA 4I4KA 2OQEC 3OV4A 4HM0B 2YX9A 3CCQ3 3D9RA 4BTWA 3RDEA 3HIGA 3KE7A 5JPUA 1Y4KA 1DMMA 3KSED 2W56B 3KZTA 3WOFB 1LOXA 4RZMA 1OHSA 1LVNA 1D6UA 5IERA 3H3HA 3E99A 3L0RA 4RNZA 1UUVB 3EB8A 1IQXA 1JJ22 3HI7A 5AYSC 3HX8A 3SXXA 4WHAA 4HM6B 5BVBA 2HMJB 2D1WA 2W56A 4MEIA 2CC3A 3EBTA 2PZVA 1YI23 2RSXA 3GZRA 2XGNA 5IG0A 1VQ43 3LTDA 1TFKA 3QRDA 3J7Yd 3KKGA 3F8HA 4O8SA 1JNQA 4EYCA 1N5PA 4XBTA 4H3UA 4HM8B 5AI1A 3WODG 4JRFA 3T8UA 1S723 1MOLA 4HKVB 1OHPA 2CG0A 1GY5A 1W2ZA 5D81A 3CCE3 3LYGA 1VQN3 3CPOA 1R4CA 2CFWA 3DGNA 5EEOA 3SOAA 5I97A 3IMAB 1GD4A 1T5YA 2HMLB 3F7SA 3NBBA 2HMMB 2ML6A 1LNHA 2Y74A 1RRLA 1QMAA 1JB2A 1W5ZA 4NHFA 1STDA 4O2HA 1FGOA 3G6E3 3FSDA 2W6JH 3LT8A 3S28A 1PU4A 2CWUA 4ZM8A 2B24B 1JN5B 2BNGA 3F40A 3GAXA 2OQEA 3TDGA 1YIT3 3T0UA 3CD63 1FGTA 3WOEB 1W2B2 2C10A 5CK6A 4Q53A 4CDLA 2W9QA 4X2OA 3H51A 1EQKA 3HK4A 3F7XA 3BNBA 2CK3H 2XFTA 2R4IA 1Q814 4MMYB 1QALA 1V74A 1WQLB 1VQ83 4EV2A 3NX0A 4K61A 3BLZA 4FMDA 1C7HA 2GBXB 3UL5A 1JKGB 2A15A 2Z77A 3CCM3 4FMBA 1NU3A 4N6LA 4MMXB 5G2GA 2W9PA 1Q40A 3I553 1K41A 1IV7A 2E2UA 2YFIB 5IEPA 2CFKA 3JVCA 2CFGA 1E3RA 1OGZA 2WOHA 1JKGA 1WMOA 2IUJA 1VQ63 5AIGA 2PNCA 3LTCA 4HZ9B 2BHMA 2BT3A 4WYKB 3GWRA 2OCTA 2B1XB 3JUPA 2M7OA 1WTHA 4N6TA 1EA2A 5AIIA 1SQWA 1VZZA 4FR9A 2JDIH 4HM7B 1VQK3 3SOYA 1D6YA 5JBSA 2UX0A 3MG1A 5CF1A 3CCR3 2KXGA 4ORLA 4WYKA 1YJN3 1KSIA 3NBRA 4MJDA 5IG4A 1IVUA 2OWPA 2HMNB 3KN4A 3PYJA 3JUNA 1VQ53 3T8NA 2WO0A 2XR8B 2QGUA 1RRHA 2CWVA 3LZAA 5STDA 3LOYA 4HJLB 5AIHA 3DMCA 3EHCA 3CNMA 4IPBA 3WA3A 5KP1A 1TUHA 3FG4A 1O7HB 1F8NA 3LT9A 2P05A 1Q42A 5FW5A 5CF2A 5AYRB 1U5OA 2FXTA 3G0KA 3MPHA 2QA43 2MF7A 4LSOA 2BO9B 2WOFA 3UL6A 3MSOA 1KWIA 2P0XA 1E3VA 3M8CA 1M9GA 1SPUA 1N9JA 5TGNA 1KD14 3B4OA 3NQZA 7STDA 1VQO3 2RGQA 3N54B 2Z6BA 1M1XB 2E2VA 4RBNA 2W2CA 4PEJA 1KQS2 2LQVA 3LTBA 3SX1A 4HZBB 1NB3I 2V1LA 3S67A 3UB1A 3KSPA 3KIIA 5CLKA 3OX9A 3GZXB 1RKYA 2JQ5A 2FGTA 2Z7AA 5IG5A 1IVXA 1O7PB 4QWTA 3EF8A 4HM4B 1GD3A 4U13A 5D82A 3EN8A 1OHOA 2LYXA 3K9MC 3F14A 1IQ8A 3FF0A 2YFJB 3ER7A 3G16A 1K28A 3DGMA 3IJEB 1N9EA 3S5CA 1W6YA 2CWTA 3A76A 4G1MB 3NM7A 4O02B 2IMJA 2IUKA 1K8A4 2CHCA 3EC9A 4FCJA 2CKFB 4LEHA 4K1UA 1AVKA 2GU1A 4HM3B 1IV9A 1SJWA 3O8YA 4KFFA 4RNYA 2YFLB 1OGXA 3SVAA 4O3VA 1NDOB 1JB5A 2ZDJA 3EE1A 3VF1A 3ROBA 5ELUA 3CCU3 1UUWB 1S5AA 3AMOB 1JV2B 1TU5A 3BB9A 3STDA 3BNEA 4J9AA 1N8R4 2F99A 1D6ZA 3CCV3 4FCMA 3OW22 2IA7A 2BMQB 2K54A 4KVHA 3S27A 5IEOA 1FGRA 1DVDA 3I0YA 4STDA 3AMOA 4KZ1A 5IENA 5KP4A 3F8XA 4N6V0 1WNHA 3X3XA 4IIAA 1J2BA 1YJW3 4FMAA 3K7CA 1Q40B 3EX9A 1UI7A 3UJMA 4X2HA 3FG1A 1Q864 2O3OA 5DREA 2GXFA 3CNXA 1IVVA 2GBWB 4OVMA 1W6CA 5IG3A 5AEWB 1FUWA 2KCDA 1A90A 1OH0A 4R80A 2CFLA 2OTL3 2L4VA 4HM2B 2OOVC 1SIIA 1AVLA 4J8TA 3X41A 1ULJB 1NWWA 1IQYA 4IT7A 3CCS3 1EG9B 3CC73 1GS3A 3OWSA 5HGRA 3CC23 3EN1B 1OCVA 3BNCA 1QAKA 3FGYA 3DUKA 2BMOB 5CXOA 3PCSA 2Q07A 4XBXA 4R9KA 3RGAA 2MC8A 1ASKA 1M1K4 4N6MA 1K734 1HU9A 1QVF2 2F86B 1O7GB 2FNQA 4R1KA 5KP3A 3CXC2 1IU7A 3GZBA 3QK9A 1VQP3 1DVCA 1QJGA 2XFSA 1U8CB 1W02A 1STFI 3FF2A 3DGOA 4H61A 2XH9A 4GL6A 3FKAA 2SBLA 2XSOB 3PZWA 5IF6A 1OPYA 3ALAA 3KFQC 1OUNA 4N3VA 4XBYA 2CFDA 4LGQA 3DZLA 2XEPA 3NXJA 5AIFA 2ML5A 3B7CA 4CCVA 1YGEA 2WGQA 5EQLA 3WDGB 3DXOA 1OF5A 3D3LA 3JUQA 3BNDA 1IT8A 4BTYA 4EXRA 4HBRA 1UW1A 1N5HA 3LMLA 4HYZA 5IW9A 3LXUX 1VQM3 3GRDA 5A0OB 5BXQA 4N6OB 3PS8A 4N6NB 3DGLA 4WP5A 3G4S3 1ROAA 1O7MB 1GY7A 2F98A 3IPTA 4AKYA 2CH9A 2W0QA 1CEWI 3RGRA 3LTAA 4EBGA 2GU3A 1A2KA 1DMNA 5LC7A 2HMKB 3FH1A 2CIUA 4JF8A 4EV5A 1JRQA 1O7NB 1N8QA 1EKMA 2OOVA 1NB5I 1K9M4 1VQ93 3OWYA 3CCJ3 1SIHA 4WFOA 4EC6A 1IK3A 4NREA 2E2TA 3JUOA 3NM2A 3N8BA 2XGLA 1QVG2 2WGOA 1CYVA 3K63A 1YHQ3 1ISKA 3MG2A 1TIJA 1A67A 2RCDA 3B4PA 3CMA3 3EQQB 4XDVA 1VQ73 3FZWA 1M904 1E97A 1QAFA 1JB4A 2QIYA 1DMQA 1ZO2A 5LC6A 1W7CA 3WA2X 1W01A 3NV0B 3PCRA 3S29A 2XF3A 1MNLA 1NO3A 2ZL8A 3B8LA 4K90B 5ELJA 3I563 1Z1SA 4GB5A 1US1A 4L8OA 5EVHA 2K0MA 3VGNA 2CG1A 3WMDA 3F9SA 2W03A 3OXAA 4KFEA 3X40A 1W00A 3CPW2 3NV0A 1W6GA 3VSYA 3SEDA 1RN7A 3U97A 1O7WB 3NBJA 1GY6A 3MYTA 4L7KA 4L8PA 1WMNA 1LXEA 3G8ZA 3N9HA 3NQYA 4FMCA 4HVNA 4OK0A 1AV4A 1OACA 4FCZA 3DY5A 3X42A 1YIJ3 1PFPA 2INXA 4XDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRD A;  4N6M A;  4EYC A;  1N5P A;  1DVC A;  2BO9 B;  1STF I;  3UL6 A;  1KWI A;  1M9G A;  1N9J A;  1MOL A;  2O9U X;  3LH4 A;  3KFQ C;  1R4C A;  3IMA B;  4CCV A;  3S67 A;  5EQL A;  1NB3 I;  1GD4 A;  4LZI A;  4TX4 A;  1N5H A;  1G96 A;  1GD3 A;  5A0O B;  4N6O B;  4N6U A;  3K9M C;  3PS8 A;  4N6N B;  4ZM8 A;  1ROA A;  2CH9 A;  1CEW I;  1CYU A;  3GAX A;  3PXM A;  3Q2P A;  5LC7 A;  3SVA A;  1IV9 A;  2W9Q A;  1EQK A;  5ELU A;  1YVB I;  1NB5 I;  3NX0 A;  3UL5 A;  1CYV A;  4N6L A;  2W9P A;  1TIJ A;  1A67 A;  1DVD A;  1IV7 A;  1FA3 A;  4N6V 0;  1WNH A;  5LC6 A;  2OCT A;  3MWZ A;  4N6T A;  1MNL A;  5ELJ A;  2KXG A;  1FUW A;  3KSE D;  1A90 A;  1RN7 A;  3L0R A;  3PYJ A;  4IT7 A;  1LXE A;  1PFP A; 
#chains in the Genus database with same CATH topology
 2HOH A;  3X3Z A;  4HAA A;  3ECF A;  3HII A;  1RJO A;  4LYL B;  1TP6 A;  2KRT A;  3V92 A;  3GZY B;  3MG3 A;  2F5M A;  3PGB A;  5D83 A;  4AEQ A;  3BIR A;  3NHX A;  2L1S A;  3CU3 A;  3G71 3;  1VQL 3;  4R9L A;  2CW9 A;  1HKX A;  1W4N A;  1TFO A;  1DYU A;  3FLJ A;  1WMP A;  2O9U X;  3EBY A;  3FG3 A;  3LH4 A;  4CJN A;  1Q7Y 4;  2P09 A;  3UNL A;  3HZP A;  4HM5 B;  5M19 A;  5BU4 A;  4DKI A;  3EJV A;  4AKZ A;  2HMO B;  5JPP A;  3K0Z A;  1RGC A;  4R4K A;  1NJI 4;  1JN5 A;  6STD A;  4LZI A;  4TX4 A;  3CCL 3;  2OTJ 3;  5DRV A;  1GOV A;  1I8V A;  2IYJ A;  2XRX B;  2GSP A;  1G96 A;  1ZS7 A;  4XM4 A;  3CC4 3;  1FGM A;  8CHO A;  2Z76 A;  1AQZ A;  1X1U A;  4N6U A;  2D42 A;  3V98 A;  4K1V A;  1GMR A;  3OWU A;  2W04 A;  1SAR A;  1OF5 B;  2BU4 A;  1CYU A;  2XSH B;  1CQS A;  1RGH A;  2C11 A;  3PXM A;  3NUV A;  3Q2P A;  1ROV A;  1BNR A;  4BTX A;  1A2V A;  1GYB A;  3U1W A;  3MHE A;  1Q82 4;  1BNS A;  1RGA A;  1ZGX A;  3ZG0 A;  4BL3 A;  4XB5 A;  4OUQ A;  1BGS A;  2Y73 A;  3K5T A;  4HM1 B;  1YJ9 3;  2BMR B;  6GSP A;  1BVI A;  1FGQ A;  2GEY A;  1YVB I;  4WWU C;  1TTO A;  2QEX 3;  2P38 A;  4BIR A;  3X3Y A;  2GEX A;  3SLU A;  1ULI B;  1L5G B;  1BAO A;  5AEU B;  1BUQ A;  3DM8 A;  3Q1C A;  5FGO A;  4KFD A;  2RFR A;  4LMI A;  1KC8 4;  1RNB A;  3V99 A;  1MGW A;  3Q90 A;  3KCH A;  1IVW A;  3CME 3;  2STD A;  4MMZ B;  1ZX2 A;  2F4Y A;  3JUM A;  3MKI A;  1FA3 A;  7GSP A;  1X1W A;  1UI8 A;  3FCS B;  1AR0 A;  2I9W A;  5M1A A;  3MWZ A;  1IT7 A;  2P0M A;  1IDP A;  1RGK A;  4I4K A;  2OQE C;  3OV4 A;  4HM0 B;  1EQK A;  2YX9 A;  3CCQ 3;  3D9R A;  1GOU A;  4BTW A;  3RDE A;  3HIG A;  3KE7 A;  5JPU A;  1Y4K A;  2RNT A;  1DMM A;  3KSE D;  2W56 B;  3KZT A;  3WOF B;  1LOX A;  4RZM A;  1OHS A;  1LVN A;  1D6U A;  1BNI A;  1T2I A;  3H3H A;  3E99 A;  5IER A;  3L0R A;  2KAA A;  1UUV B;  2AAD A;  1IQX A;  3EB8 A;  4RNZ A;  1JJ2 2;  3HI7 A;  5AYS C;  3HX8 A;  3SXX A;  4WHA A;  1VQQ A;  1BSE A;  4HM6 B;  5BVB A;  1RHL A;  2D1W A;  2HMJ B;  2W56 A;  2CC3 A;  3EBT A;  2PZV A;  4MEI A;  1YI2 3;  2RSX A;  3GZR A;  2XGN A;  5IG0 A;  1VQ4 3;  3D5G A;  2H0H A;  3LTD A;  2F56 A;  1TFK A;  3QRD A;  3J7Y d;  3KKG A;  3F8H A;  2F5W A;  1JBS A;  4O8S A;  1JNQ A;  1UGI A;  4I5Q A;  4EYC A;  1N5P A;  4XBT A;  3Q3F A;  4H3U A;  4HM8 B;  9RNT A;  1LRA A;  5AI1 A;  2BIR A;  3WOD G;  4JRF A;  1VQ9 3;  2KF4 A;  3T8U A;  1S72 3;  1MOL A;  4HKV B;  1OHP A;  2CG0 A;  1GY5 A;  1W2Z A;  3WHO A;  5M18 A;  2KF6 A;  5D81 A;  3CCE 3;  3LYG A;  3A5E A;  1VQN 3;  3CPO A;  1R4C A;  1BRH A;  1BSB A;  2CFW A;  3DGN A;  5EEO A;  3SOA A;  5I97 A;  1JBR A;  1BSC A;  1RGE A;  3IMA B;  1GD4 A;  1T5Y A;  5GSP A;  2HML B;  3F7S A;  3NBB A;  2HMM B;  2ML6 A;  1LNH A;  1RGG A;  4GHO A;  2Y74 A;  1RRL A;  1QMA A;  1JB2 A;  1W5Z A;  4NHF A;  1STD A;  4O2H A;  3AGN A;  1FGO A;  3G6E 3;  3FSD A;  2W6J H;  3LT8 A;  2RBI A;  1C54 A;  3S28 A;  1PU4 A;  2CWU A;  4ZM8 A;  2B24 B;  3G4S 3;  1BRJ A;  2H0G A;  2CX0 A;  1JN5 B;  2BNG A;  3F40 A;  3GAX A;  2OQE A;  3TDG A;  1YIT 3;  3T0U A;  1JBT A;  3CD6 3;  1FGT A;  1X1X A;  3RNT A;  3WOE B;  1EEJ A;  1RDS A;  1TJD A;  5RNT A;  2C10 A;  5CK6 A;  1W2B 2;  1G0T A;  2CX1 A;  2W9Q A;  4Q53 A;  3H51 A;  4X2O A;  4CDL A;  1T2H A;  3HK4 A;  3F7X A;  3BNB A;  2CK3 H;  2XFT A;  2R4I A;  1Q81 4;  4MMY B;  1QAL A;  1V74 A;  1WQL B;  3D5I A;  1VQ8 3;  1YVS A;  4EV2 A;  3NX0 A;  4K61 A;  3BLZ A;  4FMD A;  1C7H A;  1I3I A;  2GBX B;  1JKG B;  2A15 A;  2Z77 A;  3UL5 A;  1GOY A;  3CCM 3;  4FMB A;  1NU3 A;  1BRI A;  4MMX B;  4N6L A;  5G2G A;  2W9P A;  1Q40 A;  4ILF A;  3I55 3;  1RNT A;  1K41 A;  1IV7 A;  2E2U A;  2YFI B;  4RNY A;  5IEP A;  2CFK A;  3JVC A;  2CFG A;  1E3R A;  1OGZ A;  2WOH A;  1JKG A;  1WMO A;  1BU4 A;  2IUJ A;  1VQ6 3;  5AIG A;  2PNC A;  3LTC A;  4HZ9 B;  2BHM A;  2BT3 A;  4WYK B;  3GWR A;  2OCT A;  2B1X B;  1FZU A;  2M7O A;  3JUP A;  1WTH A;  4J5G A;  4N6T A;  1EA2 A;  5AII A;  1I2F A;  1SQW A;  1VZZ A;  4FR9 A;  2JDI H;  4HM7 B;  1VQK 3;  3SOY A;  1D6Y A;  3ZFZ A;  5JBS A;  2UUG C;  2UX0 A;  3MG1 A;  5CF1 A;  2KXG A;  3CCR 3;  4ORL A;  4WYK A;  1LOW A;  1YJN 3;  1KSI A;  3NBR A;  4MJD A;  5IG4 A;  1IVU A;  2OWP A;  2HMN B;  3KN4 A;  3PYJ A;  3JUN A;  2ZA4 A;  1VQ5 3;  5G1L A;  3T8N A;  2WO0 A;  2XR8 B;  2QGU A;  1RRH A;  2CWV A;  3LZA A;  5STD A;  3LOY A;  4HJL B;  1RCK A;  4J5K A;  3ZG5 A;  1RCL A;  1FW7 A;  5AIH A;  3DMC A;  1LQG C;  3EHC A;  1B3S A;  3CNM A;  4IPB A;  3WA3 A;  5KP1 A;  1TUH A;  1BNG A;  3FG4 A;  1O7H B;  3DGY A;  1F8N A;  3LT9 A;  2P05 A;  3AGO A;  1Q42 A;  5FW5 A;  1I2G A;  5CF2 A;  5AYR B;  1U5O A;  2FXT A;  3G0K A;  3MPH A;  2QA4 3;  2MF7 A;  4LSO A;  2BO9 B;  2WOF A;  1UCK A;  3UL6 A;  3MSO A;  1KWI A;  2P0X A;  1E3V A;  3M8C A;  1M9G A;  1SPU A;  1N9J A;  5TGN A;  1KD1 4;  3B4O A;  1BSD A;  3NQZ A;  1RN1 A;  7STD A;  1VQO 3;  1BRG A;  2SAR A;  2RGQ A;  3N54 B;  2Z6B A;  1M1X B;  2E2V A;  4RBN A;  2W2C A;  4PEJ A;  1KQS 2;  2LQV A;  3LTB A;  1UGH I;  3SX1 A;  1LQM B;  4HZB B;  1NB3 I;  2V1L A;  3S67 A;  3UB1 A;  3GSP A;  3KSP A;  3KII A;  5CLK A;  1T3B A;  1RGF A;  2UGI A;  3OX9 A;  3GZX B;  3URP A;  2JQ5 A;  1RKY A;  2FGT A;  2R41 A;  2Z7A A;  5IG5 A;  4GSP A;  1IVX A;  2C4B A;  1O7P B;  4QWT A;  3EF8 A;  4HM4 B;  1GD3 A;  4U13 A;  7RNT A;  5D82 A;  3EN8 A;  1OHO A;  4EW5 A;  2LYX A;  1PY3 A;  3K9M C;  3F14 A;  1IQ8 A;  3FF0 A;  2YFJ B;  1BRN L;  3ER7 A;  1LOY A;  3G16 A;  1RSN A;  1K28 A;  3DGM A;  3IJE B;  1N9E A;  3S5C A;  1W6Y A;  2CWT A;  3A76 A;  4G1M B;  3NM7 A;  4O02 B;  2IMJ A;  2IUK A;  1B2U A;  1K8A 4;  2CHC A;  3EC9 A;  4FCJ A;  2CKF B;  4LEH A;  4K1U A;  1AVK A;  2GU1 A;  4HM3 B;  1IV9 A;  1SJW A;  3O8Y A;  4KFF A;  1I0X A;  2YFL B;  1OGX A;  3SVA A;  4O3V A;  1RN4 A;  1NDO B;  1MWT A;  1JB5 A;  1MWS A;  2ZDJ A;  3EE1 A;  3VF1 A;  3ROB A;  5ELU A;  3CCU 3;  1UUW B;  1S5A A;  2J8X B;  1JZO A;  3AMO B;  1JV2 B;  1TU5 A;  3BB9 A;  3STD A;  3BNE A;  4J9A A;  1N8R 4;  1UDI I;  2F99 A;  1D6Z A;  3CCV 3;  4FCM A;  3OW2 2;  2IA7 A;  2BMQ B;  2K54 A;  4KVH A;  3S27 A;  1G02 A;  5IEO A;  1FGR A;  1DVD A;  3I0Y A;  1LOV A;  4STD A;  3AMO A;  1NNV A;  4KZ1 A;  1HYF A;  5IEN A;  1B21 A;  5HOH A;  5KP4 A;  2K3D A;  3F8X A;  1RMS A;  4N6V 0;  1WNH A;  4NPB A;  3X3X A;  4IIA A;  1I3F A;  1J2B A;  1YJW 3;  1V57 A;  3D79 A;  4FMA A;  4RNT A;  3K7C A;  1Q40 B;  3EX9 A;  1UI7 A;  3UJM A;  4X2H A;  1DE3 A;  3FG1 A;  1Q86 4;  2O3O A;  5DRE A;  2AAE A;  2GXF A;  3CNX A;  5G1K A;  1IVV A;  2GBW B;  4OVM A;  1W6C A;  5IG3 A;  5AEW B;  1FUW A;  1BRK A;  2KCD A;  1A90 A;  1OH0 A;  4R80 A;  2CFL A;  2OTL 3;  2IY2 A;  1B27 A;  2L4V A;  3BU4 A;  4HM2 B;  2OOV C;  1SII A;  1AVL A;  4J8T A;  3X41 A;  1ULJ B;  1NWW A;  1IQY A;  1BNF A;  4IT7 A;  3CCS 3;  1EG9 B;  3CC7 3;  1TRP A;  1GS3 A;  3OWS A;  5HGR A;  8RNT A;  3CC2 3;  3EN1 B;  1OCV A;  3BNC A;  2KF3 A;  1QAK A;  3FGY A;  3DUK A;  2BMO B;  5CXO A;  3PCS A;  2Q07 A;  4XBX A;  4R9K A;  3RGA A;  2MC8 A;  1ASK A;  1CH0 A;  4BU4 A;  1M1K 4;  4N6M A;  1RTU A;  1HU9 A;  1K73 4;  1QVF 2;  2F86 B;  1MGR A;  1O7G B;  1UCI A;  2FNQ A;  4R1K A;  5KP3 A;  3CXC 2;  1EUI C;  1IU7 A;  3GZB A;  3QK9 A;  5BIR A;  1DVC A;  1VQP 3;  1QJG A;  2XFS A;  1U8C B;  1FUT A;  1W02 A;  1STF I;  3FF2 A;  3DGO A;  4H61 A;  2XH9 A;  4GL6 A;  1GMP A;  3FKA A;  2SBL A;  2XSO B;  3PZW A;  5IF6 A;  1OPY A;  3ALA A;  1Q7H A;  4HOH A;  3KFQ C;  1OUN A;  4N3V A;  4XBY A;  2CFD A;  1BAN A;  3DZL A;  2XEP A;  3NXJ A;  4LGQ A;  5AIF A;  2ML5 A;  1B2S A;  1X1Y A;  3B7C A;  4CCV A;  1YGE A;  2WGQ A;  5EQL A;  3WDG B;  1I0V A;  3DXO A;  1OF5 A;  3D3L A;  3JUQ A;  1RLS A;  3BND A;  1IT8 A;  4BTY A;  1BRS A;  4HBR A;  4EXR A;  1UW1 A;  1HZ1 A;  1N5H A;  3LML A;  1UCJ A;  1B20 A;  4HYZ A;  5IW9 A;  1MWR A;  3LXU X;  1VQM 3;  1UCL A;  3GRD A;  1MWU A;  5A0O B;  5BXQ A;  4N6O B;  1FYS A;  2H0I A;  3DGL A;  3PS8 A;  3DH2 A;  4N6N B;  1PYL A;  4WP5 A;  1ROA A;  1O7M B;  1GY7 A;  2F98 A;  3IPT A;  1B2X A;  4AKY A;  2CH9 A;  2W0Q A;  1CEW I;  1BUJ A;  3RGR A;  3LTA A;  1BOX A;  4EBG A;  2GU3 A;  1A2K A;  1DMN A;  1BNE A;  1DET A;  5LC7 A;  2HMK B;  3FH1 A;  2CIU A;  1Q9E A;  4JF8 A;  4EV5 A;  1JRQ A;  1O7N B;  1N8Q A;  1EKM A;  1R4Y A;  2OOV A;  1NB5 I;  1K9M 4;  1I2E A;  3OWY A;  3CCJ 3;  1SIH A;  4WFO A;  4EC6 A;  4BL2 A;  4NRE A;  1IK3 A;  2E2T A;  3AHW A;  3JUO A;  3NM2 A;  3N8B A;  2XGL A;  1QVG 2;  2WGO A;  1CYV A;  3K63 A;  1V58 A;  1LNI A;  1BSA A;  1YHQ 3;  1ISK A;  3MG2 A;  1TIJ A;  4CPK A;  1IYY A;  1TRQ A;  1A67 A;  2RCD A;  1I70 A;  3B4P A;  1UUG B;  3CMA 3;  3EQQ B;  4XDV A;  1VQ7 3;  3FZW A;  1BIR A;  1M90 4;  1E97 A;  1QAF A;  1JB4 A;  2QIY A;  1DMQ A;  1FUS A;  1ZO2 A;  2ZHX B;  1W7C A;  5LC6 A;  3WA2 X;  1A2P A;  1GSP A;  1W01 A;  3SYU A;  1RGL A;  3NV0 B;  1YNV X;  3PCR A;  3S29 A;  1B2Z A;  1MNL A;  1NO3 A;  2XF3 A;  2ZL8 A;  3B8L A;  3HOH A;  4K90 B;  5ELJ A;  3I56 3;  6RNT A;  1Z1S A;  4GB5 A;  1US1 A;  4L8O A;  5EVH A;  1YGW A;  2K0M A;  3VGN A;  2CG1 A;  3WMD A;  3F9S A;  2W03 A;  3D4A A;  3OXA A;  4KFE A;  1JZD A;  1W00 A;  3X40 A;  3NV0 A;  3CPW 2;  1W6G A;  3VSY A;  3SED A;  1RN7 A;  3U97 A;  1O7W B;  3NBJ A;  1GY6 A;  2KF5 A;  1AY7 A;  3MYT A;  3AHS A;  4KT3 B;  4L7K A;  1B2M A;  4L8P A;  1GMQ A;  1WMN A;  1LXE A;  3G8Z A;  3N9H A;  3NQY A;  4FMC A;  4HVN A;  4OK0 A;  1AV4 A;  1BNJ A;  1OAC A;  4FCZ A;  3DY5 A;  3X42 A;  1YIJ 3;  1PFP A;  2INX A;  4XDW A;  3WR2 A; 
#chains in the Genus database with same CATH homology
 3X3Z A;  3ECF A;  3HII A;  1RJO A;  1TP6 A;  2KRT A;  3V92 A;  3GZY B;  3MG3 A;  3PGB A;  5D83 A;  4AEQ A;  3NHX A;  3CU3 A;  3G71 3;  1VQL 3;  4R9L A;  2CW9 A;  1HKX A;  1W4N A;  1TFO A;  1DYU A;  3FLJ A;  1WMP A;  2O9U X;  3EBY A;  3FG3 A;  3LH4 A;  1Q7Y 4;  2P09 A;  3UNL A;  3HZP A;  4HM5 B;  3EJV A;  4AKZ A;  2HMO B;  5JPP A;  3K0Z A;  4R4K A;  1NJI 4;  1JN5 A;  6STD A;  4LZI A;  4TX4 A;  3CCL 3;  2OTJ 3;  5DRV A;  2XRX B;  1G96 A;  4XM4 A;  3CC4 3;  1FGM A;  8CHO A;  2Z76 A;  4N6U A;  2D42 A;  3V98 A;  4K1V A;  3OWU A;  2W04 A;  1OF5 B;  1CYU A;  2XSH B;  1CQS A;  3PXM A;  2C11 A;  3Q2P A;  3NUV A;  1ROV A;  4BTX A;  1A2V A;  1GYB A;  3U1W A;  3MHE A;  1Q82 4;  4XB5 A;  4OUQ A;  2Y73 A;  3K5T A;  4HM1 B;  1YJ9 3;  2BMR B;  1FGQ A;  2GEY A;  1YVB I;  4WWU C;  2QEX 3;  2P38 A;  3X3Y A;  2GEX A;  3SLU A;  1ULI B;  1L5G B;  5AEU B;  1BUQ A;  3DM8 A;  3Q1C A;  5FGO A;  4KFD A;  2RFR A;  4LMI A;  1KC8 4;  3V99 A;  3Q90 A;  1IVW A;  3CME 3;  2STD A;  4MMZ B;  1ZX2 A;  3JUM A;  3MKI A;  1FA3 A;  1UI8 A;  3FCS B;  1AR0 A;  2I9W A;  3MWZ A;  1IT7 A;  2P0M A;  1IDP A;  4I4K A;  2OQE C;  3OV4 A;  4HM0 B;  2YX9 A;  3CCQ 3;  3D9R A;  4BTW A;  3RDE A;  3HIG A;  3KE7 A;  5JPU A;  1Y4K A;  1DMM A;  3KSE D;  2W56 B;  3KZT A;  3WOF B;  1LOX A;  4RZM A;  1OHS A;  1LVN A;  1D6U A;  5IER A;  3H3H A;  3E99 A;  3L0R A;  4RNZ A;  1UUV B;  3EB8 A;  1IQX A;  1JJ2 2;  3HI7 A;  5AYS C;  3HX8 A;  3SXX A;  4WHA A;  4HM6 B;  5BVB A;  2HMJ B;  2D1W A;  2W56 A;  4MEI A;  2CC3 A;  3EBT A;  2PZV A;  1YI2 3;  2RSX A;  3GZR A;  2XGN A;  5IG0 A;  1VQ4 3;  3LTD A;  1TFK A;  3QRD A;  3J7Y d;  3KKG A;  3F8H A;  4O8S A;  1JNQ A;  4EYC A;  1N5P A;  4XBT A;  4H3U A;  4HM8 B;  5AI1 A;  3WOD G;  4JRF A;  3T8U A;  1S72 3;  1MOL A;  4HKV B;  1OHP A;  2CG0 A;  1GY5 A;  1W2Z A;  5D81 A;  3CCE 3;  3LYG A;  1VQN 3;  3CPO A;  1R4C A;  2CFW A;  3DGN A;  5EEO A;  3SOA A;  5I97 A;  3IMA B;  1GD4 A;  1T5Y A;  2HML B;  3F7S A;  3NBB A;  2HMM B;  2ML6 A;  1LNH A;  2Y74 A;  1RRL A;  1QMA A;  1JB2 A;  1W5Z A;  4NHF A;  1STD A;  4O2H A;  1FGO A;  3G6E 3;  3FSD A;  2W6J H;  3LT8 A;  3S28 A;  1PU4 A;  2CWU A;  4ZM8 A;  2B24 B;  1JN5 B;  2BNG A;  3F40 A;  3GAX A;  2OQE A;  3TDG A;  1YIT 3;  3T0U A;  3CD6 3;  1FGT A;  3WOE B;  1W2B 2;  2C10 A;  5CK6 A;  4Q53 A;  4CDL A;  2W9Q A;  4X2O A;  3H51 A;  1EQK A;  3HK4 A;  3F7X A;  3BNB A;  2CK3 H;  2XFT A;  2R4I A;  1Q81 4;  4MMY B;  1QAL A;  1V74 A;  1WQL B;  1VQ8 3;  4EV2 A;  3NX0 A;  4K61 A;  3BLZ A;  4FMD A;  1C7H A;  2GBX B;  3UL5 A;  1JKG B;  2A15 A;  2Z77 A;  3CCM 3;  4FMB A;  1NU3 A;  4N6L A;  4MMX B;  5G2G A;  2W9P A;  1Q40 A;  3I55 3;  1K41 A;  1IV7 A;  2E2U A;  2YFI B;  5IEP A;  2CFK A;  3JVC A;  2CFG A;  1E3R A;  1OGZ A;  2WOH A;  1JKG A;  1WMO A;  2IUJ A;  1VQ6 3;  5AIG A;  2PNC A;  3LTC A;  4HZ9 B;  2BHM A;  2BT3 A;  4WYK B;  3GWR A;  2OCT A;  2B1X B;  3JUP A;  2M7O A;  1WTH A;  4N6T A;  1EA2 A;  5AII A;  1SQW A;  1VZZ A;  4FR9 A;  2JDI H;  4HM7 B;  1VQK 3;  3SOY A;  1D6Y A;  5JBS A;  2UX0 A;  3MG1 A;  5CF1 A;  3CCR 3;  2KXG A;  4ORL A;  4WYK A;  1YJN 3;  1KSI A;  3NBR A;  4MJD A;  5IG4 A;  1IVU A;  2OWP A;  2HMN B;  3KN4 A;  3PYJ A;  3JUN A;  1VQ5 3;  3T8N A;  2WO0 A;  2XR8 B;  2QGU A;  1RRH A;  2CWV A;  3LZA A;  5STD A;  3LOY A;  4HJL B;  5AIH A;  3DMC A;  3EHC A;  3CNM A;  4IPB A;  3WA3 A;  5KP1 A;  1TUH A;  3FG4 A;  1O7H B;  1F8N A;  3LT9 A;  2P05 A;  1Q42 A;  5FW5 A;  5CF2 A;  5AYR B;  1U5O A;  2FXT A;  3G0K A;  3MPH A;  2QA4 3;  2MF7 A;  4LSO A;  2BO9 B;  2WOF A;  3UL6 A;  3MSO A;  1KWI A;  2P0X A;  1E3V A;  3M8C A;  1M9G A;  1SPU A;  1N9J A;  5TGN A;  1KD1 4;  3B4O A;  3NQZ A;  7STD A;  1VQO 3;  2RGQ A;  3N54 B;  2Z6B A;  1M1X B;  2E2V A;  4RBN A;  2W2C A;  4PEJ A;  1KQS 2;  2LQV A;  3LTB A;  3SX1 A;  4HZB B;  1NB3 I;  2V1L A;  3S67 A;  3UB1 A;  3KSP A;  3KII A;  5CLK A;  3OX9 A;  3GZX B;  1RKY A;  2JQ5 A;  2FGT A;  2Z7A A;  5IG5 A;  1IVX A;  1O7P B;  4QWT A;  3EF8 A;  4HM4 B;  1GD3 A;  4U13 A;  5D82 A;  3EN8 A;  1OHO A;  2LYX A;  3K9M C;  3F14 A;  1IQ8 A;  3FF0 A;  2YFJ B;  3ER7 A;  3G16 A;  1K28 A;  3DGM A;  3IJE B;  1N9E A;  3S5C A;  1W6Y A;  2CWT A;  3A76 A;  4G1M B;  3NM7 A;  4O02 B;  2IMJ A;  2IUK A;  1K8A 4;  2CHC A;  3EC9 A;  4FCJ A;  2CKF B;  4LEH A;  4K1U A;  1AVK A;  2GU1 A;  4HM3 B;  1IV9 A;  1SJW A;  3O8Y A;  4KFF A;  4RNY A;  2YFL B;  1OGX A;  3SVA A;  4O3V A;  1NDO B;  1JB5 A;  2ZDJ A;  3EE1 A;  3VF1 A;  3ROB A;  5ELU A;  3CCU 3;  1UUW B;  1S5A A;  3AMO B;  1JV2 B;  1TU5 A;  3BB9 A;  3STD A;  3BNE A;  4J9A A;  1N8R 4;  2F99 A;  1D6Z A;  3CCV 3;  4FCM A;  3OW2 2;  2IA7 A;  2BMQ B;  2K54 A;  4KVH A;  3S27 A;  5IEO A;  1FGR A;  1DVD A;  3I0Y A;  4STD A;  3AMO A;  4KZ1 A;  5IEN A;  5KP4 A;  3F8X A;  4N6V 0;  1WNH A;  3X3X A;  4IIA A;  1J2B A;  1YJW 3;  4FMA A;  3K7C A;  1Q40 B;  3EX9 A;  1UI7 A;  3UJM A;  4X2H A;  3FG1 A;  1Q86 4;  2O3O A;  5DRE A;  2GXF A;  3CNX A;  1IVV A;  2GBW B;  4OVM A;  1W6C A;  5IG3 A;  5AEW B;  1FUW A;  2KCD A;  1A90 A;  1OH0 A;  4R80 A;  2CFL A;  2OTL 3;  2L4V A;  4HM2 B;  2OOV C;  1SII A;  1AVL A;  4J8T A;  3X41 A;  1ULJ B;  1NWW A;  1IQY A;  4IT7 A;  3CCS 3;  1EG9 B;  3CC7 3;  1GS3 A;  3OWS A;  5HGR A;  3CC2 3;  3EN1 B;  1OCV A;  3BNC A;  1QAK A;  3FGY A;  3DUK A;  2BMO B;  5CXO A;  3PCS A;  2Q07 A;  4XBX A;  4R9K A;  3RGA A;  2MC8 A;  1ASK A;  1M1K 4;  4N6M A;  1K73 4;  1HU9 A;  1QVF 2;  2F86 B;  1O7G B;  2FNQ A;  4R1K A;  5KP3 A;  3CXC 2;  1IU7 A;  3GZB A;  3QK9 A;  1VQP 3;  1DVC A;  1QJG A;  2XFS A;  1U8C B;  1W02 A;  1STF I;  3FF2 A;  3DGO A;  4H61 A;  2XH9 A;  4GL6 A;  3FKA A;  2SBL A;  2XSO B;  3PZW A;  5IF6 A;  1OPY A;  3ALA A;  3KFQ C;  1OUN A;  4N3V A;  4XBY A;  2CFD A;  4LGQ A;  3DZL A;  2XEP A;  3NXJ A;  5AIF A;  2ML5 A;  3B7C A;  4CCV A;  1YGE A;  2WGQ A;  5EQL A;  3WDG B;  3DXO A;  1OF5 A;  3D3L A;  3JUQ A;  3BND A;  1IT8 A;  4BTY A;  4EXR A;  4HBR A;  1UW1 A;  1N5H A;  3LML A;  4HYZ A;  5IW9 A;  3LXU X;  1VQM 3;  3GRD A;  5A0O B;  5BXQ A;  4N6O B;  3PS8 A;  4N6N B;  3DGL A;  4WP5 A;  3G4S 3;  1ROA A;  1O7M B;  1GY7 A;  2F98 A;  3IPT A;  4AKY A;  2CH9 A;  2W0Q A;  1CEW I;  3RGR A;  3LTA A;  4EBG A;  2GU3 A;  1A2K A;  1DMN A;  5LC7 A;  2HMK B;  3FH1 A;  2CIU A;  4JF8 A;  4EV5 A;  1JRQ A;  1O7N B;  1N8Q A;  1EKM A;  2OOV A;  1NB5 I;  1K9M 4;  1VQ9 3;  3OWY A;  3CCJ 3;  1SIH A;  4WFO A;  4EC6 A;  1IK3 A;  4NRE A;  2E2T A;  3JUO A;  3NM2 A;  3N8B A;  2XGL A;  1QVG 2;  2WGO A;  1CYV A;  3K63 A;  1YHQ 3;  1ISK A;  3MG2 A;  1TIJ A;  1A67 A;  2RCD A;  3B4P A;  3CMA 3;  3EQQ B;  4XDV A;  1VQ7 3;  3FZW A;  1M90 4;  1E97 A;  1QAF A;  1JB4 A;  2QIY A;  1DMQ A;  1ZO2 A;  5LC6 A;  1W7C A;  3WA2 X;  1W01 A;  3NV0 B;  3PCR A;  3S29 A;  2XF3 A;  1MNL A;  1NO3 A;  2ZL8 A;  3B8L A;  4K90 B;  5ELJ A;  3I56 3;  1Z1S A;  4GB5 A;  1US1 A;  4L8O A;  5EVH A;  2K0M A;  3VGN A;  2CG1 A;  3WMD A;  3F9S A;  2W03 A;  3OXA A;  4KFE A;  3X40 A;  1W00 A;  3CPW 2;  3NV0 A;  1W6G A;  3VSY A;  3SED A;  1RN7 A;  3U97 A;  1O7W B;  3NBJ A;  1GY6 A;  3MYT A;  4L7K A;  4L8P A;  1WMN A;  1LXE A;  3G8Z A;  3N9H A;  3NQY A;  4FMC A;  4HVN A;  4OK0 A;  1AV4 A;  1OAC A;  4FCZ A;  3DY5 A;  3X42 A;  1YIJ 3;  1PFP A;  2INX A;  4XDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...