4BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
total genus 27
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4bu4A00
1X1UA 1B2MA 6GSPA 2C4BA 1I2GA 1FZUA 2F4YA 1I8VA 1BANA 1CH0A 1B21A 1YGWA 3KCHA 1BNSA 4J5GA 1B2UA 1BRGA 1GMRA 3HOHA 1I70A 1LRAA 3D5IA 1YNVX 3URPA 1BU4A 1BRIA 5BU4A 1BAOA 1X1XA 1RGHA 2SARA 1RCLA 1I2EA 2ZA4A 1YVSA 1RGGA 1FUTA 3Q3FA 1RDSA 1BSBA 1I0XA 1RGKA 1PY3A 1TTOA 4GHOA 3AHWA 3D4AA 9RNTA 3DGYA 2BIRA 1JBRA 1I0VA 1I3FA 1MGWA 4RNTA 1B27A 5RNTA 2RBIA 1BNGA 1X1WA 3DH2A 1GMQA 7RNTA 3RNTA 1B2XA 1BSEA 3BU4A 4J5KA 1Q9EA 1RNTA 4HOHA 1DETA 1LOYA 1GOVA 1BSDA 1BSAA 1RNBA 1LNIA 1B2ZA 1UCIA 3WHOA 1HYFA 2KF5A 1BNJA 1X1YA 3BIRA 1JBTA 8RNTA 1RSNA 1BGSA 1BNRA 1RMSA 4GSPA 3AGOA 1BVIA 1RTUA 1GSPA 3A5EA 6RNTA 5BIRA 3WR2A 1GOUA 3AGNA 1RHLA 1RGEA 3AHSA 1B20A 1B2SA 1ZGXA 1BNEA 1LOWA 1SARA 3D5GA 1TRQA 1T2HA 1DE3A 1BOXA 1RGLA 1UCJA 2GSPA 1BUJA 4BIRA 1GOYA 1UCKA 5HOHA 1BNFA 1LOVA 1G02A 2KAAA 2RNTA 2KF4A 1FYSA 1GMPA 1BNIA 1A2PA 1MGRA 2KF3A 1RN4A 1RGAA 2F5WA 3GSPA 1B3SA 2KF6A 1BIRA 1RLSA 1TRPA 2AAEA 5GSPA 1AY7A 1BSCA 1RGCA 2F5MA 1BRSA 1RGFA 2AADA 1FUSA 1I2FA 1UCLA 1C54A 1RN1A 3SYUA 2BU4A 7GSPA 1AQZA 1BRHA 2F56A 1PYLA 1IYYA 1T2IA 2HOHA 1I3IA 1BRJA 1BRKA 4BU4A 1RCKA 1R4YA 1BRNL 1JBSA 4HAAA 1FW7A 1HZ1A
chains in the Genus database with same CATH superfamily
1OCVA 1B2MA 4BTWA 2C4BA 5AIHA 1ZO2A 1GS3A 3NV0B 1UI7A 1GD4A 1M1K4 2XF3A 1FGOA 3KSPA 5AYRB 3ZG0A 1CQSA 3FF2A 3KCHA 5BXQA 3H51A 6STDA 3NV0A 4O2HA 1DYUA 4QWTA 1PU4A 1O7HB 1GMRA 4N6LA 4HM2B 2Y74A 3SX1A 2F98A 2OTL3 3URPA 1BU4A 4TX4A 1TU5A 5BU4A 1MNLA 4MJDA 3PS8A 4L8OA 1NJI4 3UB1A 1LNHA 1YVBI 3H3HA 2FGTA 1E3VA 2RFRA 1RDSA 1MWUA 5AYSC 4N6V0 3FLJA 4FR9A 2YFIB 2H0GA 1RJOA 3GZXB 1UI8A 1N8QA 3DGOA 4AKYA 2FNQA 3CME3 1EEJA 4O8SA 1IDPA 3F14A 1VQ93 3GZBA 1O7GB 2W9PA 2BIRA 1JBRA 3CCS3 1I3FA 1GY6A 1GY7A 3PYJA 1GMQA 3UJMA 2HMNB 3F7SA 4STDA 1B2XA 3RNTA 3DGMA 3NM2A 2CFDA 1K8A4 1VQ43 2W56A 2UX0A 2WOFA 4MMYB 4HKVB 1QAKA 1RNTA 1W01A 2Y73A 3NXJA 4HOHA 1VQK3 3B4OA 1LQGC 1T5YA 3EQQB 1FGTA 1VQ63 2W56B 1NDOB 3OWUA 3WOFB 5CF1A 1OF5B 2IA7A 1ASKA 4HM1B 5ELUA 1IV7A 4BL2A 1JBTA 4RNZA 4EW5A 3HX8A 1CEWI 1RSNA 3VSYA 2OCTA 3RDEA 1EUIC 4OK0A 1KSIA 3Q1CA 2ZHXB 2H0IA 5DRVA 4LSOA 3G713 2E2VA 2O9UX 4KT3B 1K9M4 1GY5A 1QAFA 3JUNA 1HKXA 2P0XA 2W03A 3HK4A 1GSPA 1OHOA 6RNTA 2E2UA 3MYTA 3Q90A 1W2B2 3T8UA 1VQL3 3AGNA 2YFJB 1Z1SA 3BNEA 3D5GA 4OUQA 2CK3H 2INXA 4H61A 1N5HA 4AKZA 1LVNA 1QJGA 2YFLB 3LTAA 1VQ83 1E97A 5CK6A 1JKGB 2HMMB 3K0ZA 1CYUA 3IJEB 3U1WA 1FYSA 1WMOA 3FKAA 3SVAA 3O8YA 3KE7A 4HM0B 2Z6BA 3G8ZA 5KP3A 3CXC2 1RGAA 3EB8A 3F8HA 1FUWA 2GU3A 2KF6A 2CFKA 1BIRA 3D9RA 2XFSA 3ALAA 3EN1B 3X42A 4EYCA 3MPHA 3F40A 2AAEA 2J8XB 1W2ZA 4EV5A 1LOXA 2F5MA 3ZFZA 3CCM3 3Q2PA 2QA43 1FUSA 3BNBA 2XEPA 5CF2A 3FG4A 1RN1A 3SYUA 1YJN3 3X41A 4NREA 2F56A 3BB9A 4R4KA 1QMAA 1I3IA 1BRJA 1OHPA 4LEHA 1TIJA 1RCKA 1IQYA 2XFTA 5D82A 4ORLA 2HMLB 4HAAA 5KP1A 3NQZA 1N9EA 1FW7A 3A76A 3JVCA 5IG5A 1VQM3 6GSPA 4FMDA 1E3RA 2ZL8A 1UUGB 3DMCA 3K7CA 1L5GB 2JDIH 2JQ5A 1M9GA 4XM4A 1Q814 2W6JH 2LYXA 1BNSA 5D83A 1U5OA 1JZOA 1KWIA 1FA3A 3LYGA 1VQN3 2UUGC 3HOHA 4I5QA 1I70A 1NO3A 3CPOA 3FZWA 3SLUA 3EX9A 3X3ZA 1G0TA 1GD3A 1JN5A 3CCJ3 2IY2A 1X1XA 4N6OB 4CDLA 1NU3A 1I2EA 2ZA4A 3MHEA 1JJ22 5HGRA 4XBXA 3LMLA 1WQLB 4XB5A 4HZ9B 4KVHA 1Y4KA 1BUQA 3T0UA 3EBYA 1HU9A 3T8NA 4WYKB 1D6UA 3JUQA 2BMQB 1PY3A 2HMKB 4GHOA 4BL3A 3J7Yd 3D4AA 5LC6A 1YHQ3 1OGXA 5A0OB 4CCVA 3LT8A 4WYKA 5AIFA 3CC23 1YI23 1OF5A 1J2BA 4RNTA 1DMMA 3GWRA 5JBSA 2BMOB 2ML5A 3DGNA 1BNGA 1EA2A 3EF8A 1FGMA 2M7OA 1BSEA 4J5KA 1UUWB 2IUJA 5IG3A 2MF7A 1W6CA 1WMPA 4I4KA 2PNCA 2HMOB 4G1MB 2GBXB 3GRDA 4O02B 4N6NB 1BSDA 3EJVA 1BSAA 4Q53A 3D3LA 4WWUC 5G1KA 3D79A 1SJWA 1UCIA 3E99A 2P38A 1HYFA 2KF5A 1GYBA 2I9WA 5I97A 2A15A 1D6YA 1TP6A 2D1WA 4HM3B 3NM7A 4K1UA 1RMSA 3FGYA 3LH4A 3KSED 1IT7A 2K3DA 3WA2X 5ELJA 3WA3A 3WDGB 3NQYA 1AR0A 3MKIA 1TFOA 2OWPA 1QVG2 2KRTA 3OX9A 4OVMA 3U97A 3WR2A 1IVXA 4GB5A 3UL5A 1RHLA 4EC6A 4ZM8A 1B2SA 1LOWA 1ULIB 5IEOA 1WTHA 3PGBA 1T2HA 3NBJA 4AEQA 1DE3A 1IQXA 4R1KA 4FMBA 1BUJA 4NPBA 3DGLA 1W02A 5IEPA 1UCKA 3ROBA 1A90A 1O7PB 3LXUX 1G02A 1LOVA 2KAAA 3I0YA 5STDA 3CNMA 1SIIA 3NHXA 4FCMA 3L0RA 1MGRA 3FF0A 1RN4A 4HZBB 5TGNA 1VQ53 2F5WA 3MWZA 4LYLB 3B7CA 3GAXA 1MWRA 1VZZA 2C10A 2CH9A 3RGAA 2GXFA 5JPPA 5GSPA 1NWWA 3NX0A 4O3VA 3CNXA 3NBBA 1D6ZA 4PEJA 1KD14 1UCLA 3V98A 4R9KA 1JKGA 2R4IA 3AMOB 4MEIA 3X40A 1C54A 3PZWA 5AI1A 7GSPA 1VQO3 3LOYA 1BRHA 1FGQA 2WO0A 3MSOA 1T2IA 2HOHA 3N8BA 3CC73 4BU4A 3AMOA 4HM8B 1SQWA 3CMA3 3S28A 2C11A 2B1XB 1HZ1A 2CFLA 3DXOA 4BTYA 1W5ZA 2O3OA 1FZUA 3OWYA 5LC7A 2BO9B 1OPYA 2BMRB 3BLZA 1I8VA 1ROAA 2P05A 1BANA 3UNLA 3G6E3 1IVUA 3SXXA 1B21A 1VQ73 4X2HA 4J5GA 1B2UA 3EE1A 2CWUA 1RN7A 3HIIA 3SOAA 4HM5B 1VQP3 5DREA 2GEXA 1R4CA 2W2CA 5FW5A 3CC43 4LMIA 1BRIA 4N6TA 2CHCA 3ER7A 3OW22 1RGHA 1RCLA 1AV4A 3HZPA 1YVSA 1ZX2A 1K41A 1RGGA 1FUTA 2FXTA 3GZRA 1AVKA 3PCRA 3Q3FA 3DY5A 1O7WB 1YIT3 3IMAB 1W7CA 2E2TA 1BSBA 1I0XA 3QRDA 1UGIA 3KFQC 1TTOA 3AHWA 2CC3A 3S29A 3BNDA 4XBYA 5AIGA 2CX0A 3S67A 1IV9A 2XGLA 3EBTA 9RNTA 4N3VA 1IQ8A 1IT8A 5G2GA 8CHOA 1Q7HA 1I0VA 5CXOA 1U8CB 1LXEA 1RRLA 3WMDA 2ZDJA 2XSHB 3UL6A 1W6GA 2STDA 3EHCA 2RBIA 3DH2A 1NB5I 1VQQA 1PFPA 3LZAA 7RNTA 5M18A 2H0HA 3KIIA 2PZVA 4R9LA 1W4NA 1EKMA 1TFKA 3EN8A 1UGHI 3BU4A 5IW9A 4JRFA 4EXRA 2IUKA 3NUVA 4FCZA 5AEUB 3CCU3 2P09A 1DETA 1LOYA 3PCSA 1KQS2 1JZDA 4KFDA 2MC8A 1B2ZA 1Q40B 4L7KA 3WHOA 1CYVA 3K5TA 1QALA 1BNJA 4IPBA 3BIRA 2F99A 4XBTA 8RNTA 3LT9A 2V1LA 1O7NB 3GZYB 1BNRA 2WGOA 2WOHA 1Q40A 3ZG5A 3KZTA 4DKIA 3KN4A 2CWVA 1ZS7A 3JUOA 2B24B 1BVIA 1RTUA 1EG9B 3A5EA 2WGQA 4HM6B 4WFOA 4RNYA 1YJW3 1US1A 5FGOA 1LQMB 4U13A 5EQLA 1W00A 1WMNA 1TRQA 2CX1A 4X2OA 1BOXA 2GEYA 2Z77A 2BHMA 3KKGA 4FCJA 4HJLB 4BIRA 2XR8B 5IG0A 1GOYA 3NBRA 3FG1A 1K28A 4HM4B 3SOYA 2RNTA 4IIAA 5IERA 1GMPA 1FGRA 5IENA 1BNIA 3VF1A 1A2PA 2L4VA 2KF3A 3PXMA 1DVDA 3GSPA 2Z76A 3HIGA 2HMJB 4MMXB 1JB5A 3FCSB 1SPUA 1TRPA 1AY7A 1BSCA 2UGIA 1RGCA 1JV2B 1T3BA 1DMNA 3HI7A 1O7MB 1I2FA 4KFEA 4XDWA 4KZ1A 3B4PA 1SIHA 2L1SA 5CLKA 2BU4A 2CWTA 2LQVA 3FSDA 3K63A 1KC84 1JRQA 3STDA 2OTJ3 1A67A 3TDGA 1IYYA 5EVHA 2RCDA 2D42A 1R4YA 1OUNA 1M904 1C7HA 1JBSA 1BRNL 3ECFA 1X1UA 1TJDA 1I2GA 2Q07A 2SBLA 2XH9A 4GL6A 5M1AA 2F4YA 3LTCA 4R80A 2OQEA 1QVF2 5AIIA 1CH0A 1NB3I 1YGWA 3MG2A 4HM7B 1W6YA 1DVCA 1BRGA 3WODG 4J8TA 2CKFB 4K1VA 3F7XA 3OWSA 2F86B 1LRAA 3D5IA 1YNVX 4N6MA 2OOVA 1YJ93 2CG1A 1BAOA 4CJNA 2KXGA 2SARA 1V57A 2RGQA 3S5CA 1Q864 3DM8A 2R41A 1A2KA 2XGNA 4CPKA 3CCE3 3CCQ3 2BT3A 2ML6A 1F8NA 1IVWA 3JUMA 4HBRA 1RGKA 3VGNA 1AVLA 1ISKA 4FMAA 4MMZB 3DUKA 4J9AA 5M19A 3DGYA 1N8R4 3RGRA 3S27A 5IF6A 1IK3A 1MGWA 2GU1A 1UUVB 1OGZA 7STDA 1YIJ3 3M8CA 1B27A 3N54B 4NHFA 4EV2A 2P0MA 5RNTA 1X1WA 2CFGA 1OH0A 2OQEC 3V92A 1N5PA 1K734 2CFWA 5KP4A 3CPW2 4RBNA 3CCV3 1V58A 1Q9EA 4WP5A 3X3XA 1N9JA 4HVNA 1JB2A 4XDVA 1V74A 1GOVA 1IU7A 2IYJA 2RSXA 3DZLA 1RNBA 5AEWB 3MG3A 1LNIA 2OOVC 5BVBA 2KCDA 3X3YA 3WOEB 2CG0A 1TUHA 1A2VA 1X1YA 1UDII 3V99A 3F8XA 3N9HA 3CCL3 1STFI 1BGSA 1S723 4RZMA 4GSPA 2QEX3 1JNQA 1IVVA 5IG4A 3AGOA 4HYZA 2W0QA 4K90B 3IPTA 4ILFA 3K9MC 4IT7A 1WNHA 5D81A 3I553 1MWTA 5BIRA 4N6UA 2QIYA 3G4S3 1GOUA 1STDA 4LGQA 1RGEA 3AHSA 3LTBA 1B20A 1ZGXA 1BNEA 1SARA 3CU3A 1OHSA 3I563 1EQKA 4JF8A 1YGEA 2XSOB 4L8PA 2GBWB 1RGLA 2GSPA 4KFFA 5G1LA 1G96A 1Q824 1ROVA 4FMCA 4EBGA 2Z7AA 4H3UA 3OXAA 5HOHA 3G16A 1BNFA 4LZIA 3MG1A 1MWSA 2KF4A 3QK9A 2XRXB 3CCR3 3B8LA 2YX9A 1B3SA 1M1XB 1RLSA 3G0KA 1OACA 1JB4A 5EEOA 1ULJB 2W9QA 2CW9A 2K54A 3CD63 1RRHA 1BRSA 3JUPA 1RGFA 3SEDA 2AADA 2K0MA 1DMQA 3FG3A 1UW1A 1MOLA 1RKYA 1AQZA 1NNVA 1PYLA 3EC9A 1Q7Y4 4BTXA 2IMJA 1S5AA 5JPUA 3F9SA 1BRKA 3FH1A 2CIUA 3BNCA 2QGUA 2BNGA 4K61A 4WHAA 1Q42A 1JN5B 2W04A 1UCJA 3OV4A 3LTDA
chains in the Genus database with same CATH topology
1X1UA 1B2MA 6GSPA 2C4BA 1I2GA 1FZUA 2F4YA 1I8VA 1BANA 1CH0A 1B21A 1YGWA 3KCHA 1BNSA 4J5GA 1B2UA 1BRGA 1GMRA 3HOHA 1I70A 1LRAA 3D5IA 1YNVX 3URPA 1BU4A 1BRIA 5BU4A 1BAOA 1X1XA 1RGHA 2SARA 1RCLA 1I2EA 2ZA4A 1YVSA 1RGGA 1FUTA 3Q3FA 1RDSA 1BSBA 1I0XA 1RGKA 1PY3A 1TTOA 4GHOA 3AHWA 3D4AA 9RNTA 3DGYA 2BIRA 1JBRA 1I0VA 1I3FA 1MGWA 4RNTA 1B27A 5RNTA 2RBIA 1BNGA 1X1WA 3DH2A 1GMQA 7RNTA 3RNTA 1B2XA 1BSEA 3BU4A 4J5KA 1Q9EA 1RNTA 4HOHA 1DETA 1LOYA 1GOVA 1BSDA 1BSAA 1RNBA 1LNIA 1B2ZA 1UCIA 3WHOA 1HYFA 2KF5A 1BNJA 1X1YA 3BIRA 1JBTA 8RNTA 1RSNA 1BGSA 1BNRA 1RMSA 4GSPA 3AGOA 1BVIA 1RTUA 1GSPA 3A5EA 6RNTA 5BIRA 3WR2A 1GOUA 3AGNA 1RHLA 1RGEA 3AHSA 1B20A 1B2SA 1ZGXA 1BNEA 1LOWA 1SARA 3D5GA 1TRQA 1T2HA 1DE3A 1BOXA 1RGLA 1UCJA 2GSPA 1BUJA 4BIRA 1GOYA 1UCKA 5HOHA 1BNFA 1LOVA 1G02A 2KAAA 2RNTA 2KF4A 1FYSA 1GMPA 1BNIA 1A2PA 1MGRA 2KF3A 1RN4A 1RGAA 2F5WA 3GSPA 1B3SA 2KF6A 1BIRA 1RLSA 1TRPA 2AAEA 5GSPA 1AY7A 1BSCA 1RGCA 2F5MA 1BRSA 1RGFA 2AADA 1FUSA 1I2FA 1UCLA 1C54A 1RN1A 3SYUA 2BU4A 7GSPA 1AQZA 1BRHA 2F56A 1PYLA 1IYYA 1T2IA 2HOHA 1I3IA 1BRJA 1BRKA 4BU4A 1RCKA 1R4YA 1BRNL 1JBSA 4HAAA 1FW7A 1HZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1U A;  1B2M A;  6GSP A;  2C4B A;  1I2G A;  1FZU A;  2F4Y A;  1I8V A;  1BAN A;  1CH0 A;  1B21 A;  1YGW A;  3KCH A;  1BNS A;  4J5G A;  1B2U A;  1BRG A;  1GMR A;  3HOH A;  1I70 A;  1LRA A;  3D5I A;  1YNV X;  3URP A;  1BU4 A;  1BRI A;  5BU4 A;  1BAO A;  1X1X A;  1RGH A;  2SAR A;  1RCL A;  1I2E A;  2ZA4 A;  1YVS A;  1RGG A;  1FUT A;  3Q3F A;  1RDS A;  1BSB A;  1I0X A;  1RGK A;  1PY3 A;  1TTO A;  4GHO A;  3AHW A;  3D4A A;  9RNT A;  3DGY A;  2BIR A;  1JBR A;  1I0V A;  1I3F A;  1MGW A;  4RNT A;  1B27 A;  5RNT A;  2RBI A;  1BNG A;  1X1W A;  3DH2 A;  1GMQ A;  7RNT A;  3RNT A;  1B2X A;  1BSE A;  3BU4 A;  4J5K A;  1Q9E A;  1RNT A;  4HOH A;  1DET A;  1LOY A;  1GOV A;  1BSD A;  1BSA A;  1RNB A;  1LNI A;  1B2Z A;  1UCI A;  3WHO A;  1HYF A;  2KF5 A;  1BNJ A;  1X1Y A;  3BIR A;  1JBT A;  8RNT A;  1RSN A;  1BGS A;  1BNR A;  1RMS A;  4GSP A;  3AGO A;  1BVI A;  1RTU A;  1GSP A;  3A5E A;  6RNT A;  5BIR A;  3WR2 A;  1GOU A;  3AGN A;  1RHL A;  1RGE A;  3AHS A;  1B20 A;  1B2S A;  1ZGX A;  1BNE A;  1LOW A;  1SAR A;  3D5G A;  1TRQ A;  1T2H A;  1DE3 A;  1BOX A;  1RGL A;  1UCJ A;  2GSP A;  1BUJ A;  4BIR A;  1GOY A;  1UCK A;  5HOH A;  1BNF A;  1LOV A;  1G02 A;  2KAA A;  2RNT A;  2KF4 A;  1FYS A;  1GMP A;  1BNI A;  1A2P A;  1MGR A;  2KF3 A;  1RN4 A;  1RGA A;  2F5W A;  3GSP A;  1B3S A;  2KF6 A;  1BIR A;  1RLS A;  1TRP A;  2AAE A;  5GSP A;  1AY7 A;  1BSC A;  1RGC A;  2F5M A;  1BRS A;  1RGF A;  2AAD A;  1FUS A;  1I2F A;  1UCL A;  1C54 A;  1RN1 A;  3SYU A;  2BU4 A;  7GSP A;  1AQZ A;  1BRH A;  2F56 A;  1PYL A;  1IYY A;  1T2I A;  2HOH A;  1I3I A;  1BRJ A;  1BRK A;  4BU4 A;  1RCK A;  1R4Y A;  1BRN L;  1JBS A;  4HAA A;  1FW7 A;  1HZ1 A; 
#chains in the Genus database with same CATH topology
 1OCV A;  1B2M A;  4BTW A;  2C4B A;  5AIH A;  1ZO2 A;  1GS3 A;  3NV0 B;  1UI7 A;  1GD4 A;  1M1K 4;  2XF3 A;  1FGO A;  3KSP A;  5AYR B;  3ZG0 A;  1CQS A;  3FF2 A;  3KCH A;  5BXQ A;  3H51 A;  6STD A;  3NV0 A;  4O2H A;  1DYU A;  4QWT A;  1PU4 A;  1O7H B;  1GMR A;  4N6L A;  4HM2 B;  2Y74 A;  3SX1 A;  2F98 A;  2OTL 3;  3URP A;  1BU4 A;  4TX4 A;  1TU5 A;  5BU4 A;  1MNL A;  4MJD A;  3PS8 A;  4L8O A;  1NJI 4;  3UB1 A;  1LNH A;  1YVB I;  3H3H A;  2FGT A;  1E3V A;  2RFR A;  1RDS A;  1MWU A;  5AYS C;  4N6V 0;  3FLJ A;  4FR9 A;  2YFI B;  2H0G A;  1RJO A;  3GZX B;  1UI8 A;  1N8Q A;  3DGO A;  4AKY A;  2FNQ A;  3CME 3;  1EEJ A;  4O8S A;  1IDP A;  3F14 A;  1VQ9 3;  3GZB A;  1O7G B;  2W9P A;  2BIR A;  1JBR A;  3CCS 3;  1I3F A;  1GY6 A;  1GY7 A;  3PYJ A;  1GMQ A;  3UJM A;  2HMN B;  3F7S A;  4STD A;  1B2X A;  3RNT A;  3DGM A;  3NM2 A;  2CFD A;  1K8A 4;  1VQ4 3;  2W56 A;  2UX0 A;  2WOF A;  4MMY B;  4HKV B;  1QAK A;  1RNT A;  1W01 A;  2Y73 A;  3NXJ A;  4HOH A;  1VQK 3;  3B4O A;  1LQG C;  1T5Y A;  3EQQ B;  1FGT A;  1VQ6 3;  2W56 B;  1NDO B;  3OWU A;  3WOF B;  5CF1 A;  1OF5 B;  2IA7 A;  1ASK A;  4HM1 B;  5ELU A;  1IV7 A;  4BL2 A;  1JBT A;  4RNZ A;  4EW5 A;  3HX8 A;  1CEW I;  1RSN A;  3VSY A;  2OCT A;  3RDE A;  1EUI C;  4OK0 A;  1KSI A;  3Q1C A;  2ZHX B;  2H0I A;  5DRV A;  4LSO A;  3G71 3;  2E2V A;  2O9U X;  4KT3 B;  1K9M 4;  1GY5 A;  1QAF A;  3JUN A;  1HKX A;  2P0X A;  2W03 A;  3HK4 A;  1GSP A;  1OHO A;  6RNT A;  2E2U A;  3MYT A;  3Q90 A;  1W2B 2;  3T8U A;  1VQL 3;  3AGN A;  2YFJ B;  1Z1S A;  3BNE A;  3D5G A;  4OUQ A;  2CK3 H;  2INX A;  4H61 A;  1N5H A;  4AKZ A;  1LVN A;  1QJG A;  2YFL B;  3LTA A;  1VQ8 3;  1E97 A;  5CK6 A;  1JKG B;  2HMM B;  3K0Z A;  1CYU A;  3IJE B;  3U1W A;  1FYS A;  1WMO A;  3FKA A;  3SVA A;  3O8Y A;  3KE7 A;  4HM0 B;  2Z6B A;  3G8Z A;  5KP3 A;  3CXC 2;  1RGA A;  3EB8 A;  3F8H A;  1FUW A;  2GU3 A;  2KF6 A;  2CFK A;  1BIR A;  3D9R A;  2XFS A;  3ALA A;  3EN1 B;  3X42 A;  4EYC A;  3MPH A;  3F40 A;  2AAE A;  2J8X B;  1W2Z A;  4EV5 A;  1LOX A;  2F5M A;  3ZFZ A;  3CCM 3;  3Q2P A;  2QA4 3;  1FUS A;  3BNB A;  2XEP A;  5CF2 A;  3FG4 A;  1RN1 A;  3SYU A;  1YJN 3;  3X41 A;  4NRE A;  2F56 A;  3BB9 A;  4R4K A;  1QMA A;  1I3I A;  1BRJ A;  1OHP A;  4LEH A;  1TIJ A;  1RCK A;  1IQY A;  2XFT A;  5D82 A;  4ORL A;  2HML B;  4HAA A;  5KP1 A;  3NQZ A;  1N9E A;  1FW7 A;  3A76 A;  3JVC A;  5IG5 A;  1VQM 3;  6GSP A;  4FMD A;  1E3R A;  2ZL8 A;  1UUG B;  3DMC A;  3K7C A;  1L5G B;  2JDI H;  2JQ5 A;  1M9G A;  4XM4 A;  1Q81 4;  2W6J H;  2LYX A;  1BNS A;  5D83 A;  1U5O A;  1JZO A;  1KWI A;  1FA3 A;  3LYG A;  1VQN 3;  2UUG C;  3HOH A;  4I5Q A;  1I70 A;  1NO3 A;  3CPO A;  3FZW A;  3SLU A;  3EX9 A;  3X3Z A;  1G0T A;  1GD3 A;  1JN5 A;  3CCJ 3;  2IY2 A;  1X1X A;  4N6O B;  4CDL A;  1NU3 A;  1I2E A;  2ZA4 A;  3MHE A;  1JJ2 2;  5HGR A;  4XBX A;  3LML A;  1WQL B;  4XB5 A;  4HZ9 B;  4KVH A;  1Y4K A;  1BUQ A;  3T0U A;  3EBY A;  1HU9 A;  3T8N A;  4WYK B;  1D6U A;  3JUQ A;  2BMQ B;  1PY3 A;  2HMK B;  4GHO A;  4BL3 A;  3J7Y d;  3D4A A;  5LC6 A;  1YHQ 3;  1OGX A;  5A0O B;  4CCV A;  3LT8 A;  4WYK A;  5AIF A;  3CC2 3;  1YI2 3;  1OF5 A;  1J2B A;  4RNT A;  1DMM A;  3GWR A;  5JBS A;  2BMO B;  2ML5 A;  3DGN A;  1BNG A;  1EA2 A;  3EF8 A;  1FGM A;  2M7O A;  1BSE A;  4J5K A;  1UUW B;  2IUJ A;  5IG3 A;  2MF7 A;  1W6C A;  1WMP A;  4I4K A;  2PNC A;  2HMO B;  4G1M B;  2GBX B;  3GRD A;  4O02 B;  4N6N B;  1BSD A;  3EJV A;  1BSA A;  4Q53 A;  3D3L A;  4WWU C;  5G1K A;  3D79 A;  1SJW A;  1UCI A;  3E99 A;  2P38 A;  1HYF A;  2KF5 A;  1GYB A;  2I9W A;  5I97 A;  2A15 A;  1D6Y A;  1TP6 A;  2D1W A;  4HM3 B;  3NM7 A;  4K1U A;  1RMS A;  3FGY A;  3LH4 A;  3KSE D;  1IT7 A;  2K3D A;  3WA2 X;  5ELJ A;  3WA3 A;  3WDG B;  3NQY A;  1AR0 A;  3MKI A;  1TFO A;  2OWP A;  1QVG 2;  2KRT A;  3OX9 A;  4OVM A;  3U97 A;  3WR2 A;  1IVX A;  4GB5 A;  3UL5 A;  1RHL A;  4EC6 A;  4ZM8 A;  1B2S A;  1LOW A;  1ULI B;  5IEO A;  1WTH A;  3PGB A;  1T2H A;  3NBJ A;  4AEQ A;  1DE3 A;  1IQX A;  4R1K A;  4FMB A;  1BUJ A;  4NPB A;  3DGL A;  1W02 A;  5IEP A;  1UCK A;  3ROB A;  1A90 A;  1O7P B;  3LXU X;  1G02 A;  1LOV A;  2KAA A;  3I0Y A;  5STD A;  3CNM A;  1SII A;  3NHX A;  4FCM A;  3L0R A;  1MGR A;  3FF0 A;  1RN4 A;  4HZB B;  5TGN A;  1VQ5 3;  2F5W A;  3MWZ A;  4LYL B;  3B7C A;  3GAX A;  1MWR A;  1VZZ A;  2C10 A;  2CH9 A;  3RGA A;  2GXF A;  5JPP A;  5GSP A;  1NWW A;  3NX0 A;  4O3V A;  3CNX A;  3NBB A;  1D6Z A;  4PEJ A;  1KD1 4;  1UCL A;  3V98 A;  4R9K A;  1JKG A;  2R4I A;  3AMO B;  4MEI A;  3X40 A;  1C54 A;  3PZW A;  5AI1 A;  7GSP A;  1VQO 3;  3LOY A;  1BRH A;  1FGQ A;  2WO0 A;  3MSO A;  1T2I A;  2HOH A;  3N8B A;  3CC7 3;  4BU4 A;  3AMO A;  4HM8 B;  1SQW A;  3CMA 3;  3S28 A;  2C11 A;  2B1X B;  1HZ1 A;  2CFL A;  3DXO A;  4BTY A;  1W5Z A;  2O3O A;  1FZU A;  3OWY A;  5LC7 A;  2BO9 B;  1OPY A;  2BMR B;  3BLZ A;  1I8V A;  1ROA A;  2P05 A;  1BAN A;  3UNL A;  3G6E 3;  1IVU A;  3SXX A;  1B21 A;  1VQ7 3;  4X2H A;  4J5G A;  1B2U A;  3EE1 A;  2CWU A;  1RN7 A;  3HII A;  3SOA A;  4HM5 B;  1VQP 3;  5DRE A;  2GEX A;  1R4C A;  2W2C A;  5FW5 A;  3CC4 3;  4LMI A;  1BRI A;  4N6T A;  2CHC A;  3ER7 A;  3OW2 2;  1RGH A;  1RCL A;  1AV4 A;  3HZP A;  1YVS A;  1ZX2 A;  1K41 A;  1RGG A;  1FUT A;  2FXT A;  3GZR A;  1AVK A;  3PCR A;  3Q3F A;  3DY5 A;  1O7W B;  1YIT 3;  3IMA B;  1W7C A;  2E2T A;  1BSB A;  1I0X A;  3QRD A;  1UGI A;  3KFQ C;  1TTO A;  3AHW A;  2CC3 A;  3S29 A;  3BND A;  4XBY A;  5AIG A;  2CX0 A;  3S67 A;  1IV9 A;  2XGL A;  3EBT A;  9RNT A;  4N3V A;  1IQ8 A;  1IT8 A;  5G2G A;  8CHO A;  1Q7H A;  1I0V A;  5CXO A;  1U8C B;  1LXE A;  1RRL A;  3WMD A;  2ZDJ A;  2XSH B;  3UL6 A;  1W6G A;  2STD A;  3EHC A;  2RBI A;  3DH2 A;  1NB5 I;  1VQQ A;  1PFP A;  3LZA A;  7RNT A;  5M18 A;  2H0H A;  3KII A;  2PZV A;  4R9L A;  1W4N A;  1EKM A;  1TFK A;  3EN8 A;  1UGH I;  3BU4 A;  5IW9 A;  4JRF A;  4EXR A;  2IUK A;  3NUV A;  4FCZ A;  5AEU B;  3CCU 3;  2P09 A;  1DET A;  1LOY A;  3PCS A;  1KQS 2;  1JZD A;  4KFD A;  2MC8 A;  1B2Z A;  1Q40 B;  4L7K A;  3WHO A;  1CYV A;  3K5T A;  1QAL A;  1BNJ A;  4IPB A;  3BIR A;  2F99 A;  4XBT A;  8RNT A;  3LT9 A;  2V1L A;  1O7N B;  3GZY B;  1BNR A;  2WGO A;  2WOH A;  1Q40 A;  3ZG5 A;  3KZT A;  4DKI A;  3KN4 A;  2CWV A;  1ZS7 A;  3JUO A;  2B24 B;  1BVI A;  1RTU A;  1EG9 B;  3A5E A;  2WGQ A;  4HM6 B;  4WFO A;  4RNY A;  1YJW 3;  1US1 A;  5FGO A;  1LQM B;  4U13 A;  5EQL A;  1W00 A;  1WMN A;  1TRQ A;  2CX1 A;  4X2O A;  1BOX A;  2GEY A;  2Z77 A;  2BHM A;  3KKG A;  4FCJ A;  4HJL B;  4BIR A;  2XR8 B;  5IG0 A;  1GOY A;  3NBR A;  3FG1 A;  1K28 A;  4HM4 B;  3SOY A;  2RNT A;  4IIA A;  5IER A;  1GMP A;  1FGR A;  5IEN A;  1BNI A;  3VF1 A;  1A2P A;  2L4V A;  2KF3 A;  3PXM A;  1DVD A;  3GSP A;  2Z76 A;  3HIG A;  2HMJ B;  4MMX B;  1JB5 A;  3FCS B;  1SPU A;  1TRP A;  1AY7 A;  1BSC A;  2UGI A;  1RGC A;  1JV2 B;  1T3B A;  1DMN A;  3HI7 A;  1O7M B;  1I2F A;  4KFE A;  4XDW A;  4KZ1 A;  3B4P A;  1SIH A;  2L1S A;  5CLK A;  2BU4 A;  2CWT A;  2LQV A;  3FSD A;  3K63 A;  1KC8 4;  1JRQ A;  3STD A;  2OTJ 3;  1A67 A;  3TDG A;  1IYY A;  5EVH A;  2RCD A;  2D42 A;  1R4Y A;  1OUN A;  1M90 4;  1C7H A;  1JBS A;  1BRN L;  3ECF A;  1X1U A;  1TJD A;  1I2G A;  2Q07 A;  2SBL A;  2XH9 A;  4GL6 A;  5M1A A;  2F4Y A;  3LTC A;  4R80 A;  2OQE A;  1QVF 2;  5AII A;  1CH0 A;  1NB3 I;  1YGW A;  3MG2 A;  4HM7 B;  1W6Y A;  1DVC A;  1BRG A;  3WOD G;  4J8T A;  2CKF B;  4K1V A;  3F7X A;  3OWS A;  2F86 B;  1LRA A;  3D5I A;  1YNV X;  4N6M A;  2OOV A;  1YJ9 3;  2CG1 A;  1BAO A;  4CJN A;  2KXG A;  2SAR A;  1V57 A;  2RGQ A;  3S5C A;  1Q86 4;  3DM8 A;  2R41 A;  1A2K A;  2XGN A;  4CPK A;  3CCE 3;  3CCQ 3;  2BT3 A;  2ML6 A;  1F8N A;  1IVW A;  3JUM A;  4HBR A;  1RGK A;  3VGN A;  1AVL A;  1ISK A;  4FMA A;  4MMZ B;  3DUK A;  4J9A A;  5M19 A;  3DGY A;  1N8R 4;  3RGR A;  3S27 A;  5IF6 A;  1IK3 A;  1MGW A;  2GU1 A;  1UUV B;  1OGZ A;  7STD A;  1YIJ 3;  3M8C A;  1B27 A;  3N54 B;  4NHF A;  4EV2 A;  2P0M A;  5RNT A;  1X1W A;  2CFG A;  1OH0 A;  2OQE C;  3V92 A;  1N5P A;  1K73 4;  2CFW A;  5KP4 A;  3CPW 2;  4RBN A;  3CCV 3;  1V58 A;  1Q9E A;  4WP5 A;  3X3X A;  1N9J A;  4HVN A;  1JB2 A;  4XDV A;  1V74 A;  1GOV A;  1IU7 A;  2IYJ A;  2RSX A;  3DZL A;  1RNB A;  5AEW B;  3MG3 A;  1LNI A;  2OOV C;  5BVB A;  2KCD A;  3X3Y A;  3WOE B;  2CG0 A;  1TUH A;  1A2V A;  1X1Y A;  1UDI I;  3V99 A;  3F8X A;  3N9H A;  3CCL 3;  1STF I;  1BGS A;  1S72 3;  4RZM A;  4GSP A;  2QEX 3;  1JNQ A;  1IVV A;  5IG4 A;  3AGO A;  4HYZ A;  2W0Q A;  4K90 B;  3IPT A;  4ILF A;  3K9M C;  4IT7 A;  1WNH A;  5D81 A;  3I55 3;  1MWT A;  5BIR A;  4N6U A;  2QIY A;  3G4S 3;  1GOU A;  1STD A;  4LGQ A;  1RGE A;  3AHS A;  3LTB A;  1B20 A;  1ZGX A;  1BNE A;  1SAR A;  3CU3 A;  1OHS A;  3I56 3;  1EQK A;  4JF8 A;  1YGE A;  2XSO B;  4L8P A;  2GBW B;  1RGL A;  2GSP A;  4KFF A;  5G1L A;  1G96 A;  1Q82 4;  1ROV A;  4FMC A;  4EBG A;  2Z7A A;  4H3U A;  3OXA A;  5HOH A;  3G16 A;  1BNF A;  4LZI A;  3MG1 A;  1MWS A;  2KF4 A;  3QK9 A;  2XRX B;  3CCR 3;  3B8L A;  2YX9 A;  1B3S A;  1M1X B;  1RLS A;  3G0K A;  1OAC A;  1JB4 A;  5EEO A;  1ULJ B;  2W9Q A;  2CW9 A;  2K54 A;  3CD6 3;  1RRH A;  1BRS A;  3JUP A;  1RGF A;  3SED A;  2AAD A;  2K0M A;  1DMQ A;  3FG3 A;  1UW1 A;  1MOL A;  1RKY A;  1AQZ A;  1NNV A;  1PYL A;  3EC9 A;  1Q7Y 4;  4BTX A;  2IMJ A;  1S5A A;  5JPU A;  3F9S A;  1BRK A;  3FH1 A;  2CIU A;  3BNC A;  2QGU A;  2BNG A;  4K61 A;  4WHA A;  1Q42 A;  1JN5 B;  2W04 A;  1UCJ A;  3OV4 A;  3LTD A; 
#chains in the Genus database with same CATH homology
 1X1U A;  1B2M A;  6GSP A;  2C4B A;  1I2G A;  1FZU A;  2F4Y A;  1I8V A;  1BAN A;  1CH0 A;  1B21 A;  1YGW A;  3KCH A;  1BNS A;  4J5G A;  1B2U A;  1BRG A;  1GMR A;  3HOH A;  1I70 A;  1LRA A;  3D5I A;  1YNV X;  3URP A;  1BU4 A;  1BRI A;  5BU4 A;  1BAO A;  1X1X A;  1RGH A;  2SAR A;  1RCL A;  1I2E A;  2ZA4 A;  1YVS A;  1RGG A;  1FUT A;  3Q3F A;  1RDS A;  1BSB A;  1I0X A;  1RGK A;  1PY3 A;  1TTO A;  4GHO A;  3AHW A;  3D4A A;  9RNT A;  3DGY A;  2BIR A;  1JBR A;  1I0V A;  1I3F A;  1MGW A;  4RNT A;  1B27 A;  5RNT A;  2RBI A;  1BNG A;  1X1W A;  3DH2 A;  1GMQ A;  7RNT A;  3RNT A;  1B2X A;  1BSE A;  3BU4 A;  4J5K A;  1Q9E A;  1RNT A;  4HOH A;  1DET A;  1LOY A;  1GOV A;  1BSD A;  1BSA A;  1RNB A;  1LNI A;  1B2Z A;  1UCI A;  3WHO A;  1HYF A;  2KF5 A;  1BNJ A;  1X1Y A;  3BIR A;  1JBT A;  8RNT A;  1RSN A;  1BGS A;  1BNR A;  1RMS A;  4GSP A;  3AGO A;  1BVI A;  1RTU A;  1GSP A;  3A5E A;  6RNT A;  5BIR A;  3WR2 A;  1GOU A;  3AGN A;  1RHL A;  1RGE A;  3AHS A;  1B20 A;  1B2S A;  1ZGX A;  1BNE A;  1LOW A;  1SAR A;  3D5G A;  1TRQ A;  1T2H A;  1DE3 A;  1BOX A;  1RGL A;  1UCJ A;  2GSP A;  1BUJ A;  4BIR A;  1GOY A;  1UCK A;  5HOH A;  1BNF A;  1LOV A;  1G02 A;  2KAA A;  2RNT A;  2KF4 A;  1FYS A;  1GMP A;  1BNI A;  1A2P A;  1MGR A;  2KF3 A;  1RN4 A;  1RGA A;  2F5W A;  3GSP A;  1B3S A;  2KF6 A;  1BIR A;  1RLS A;  1TRP A;  2AAE A;  5GSP A;  1AY7 A;  1BSC A;  1RGC A;  2F5M A;  1BRS A;  1RGF A;  2AAD A;  1FUS A;  1I2F A;  1UCL A;  1C54 A;  1RN1 A;  3SYU A;  2BU4 A;  7GSP A;  1AQZ A;  1BRH A;  2F56 A;  1PYL A;  1IYY A;  1T2I A;  2HOH A;  1I3I A;  1BRJ A;  1BRK A;  4BU4 A;  1RCK A;  1R4Y A;  1BRN L;  1JBS A;  4HAA A;  1FW7 A;  1HZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...