4BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 27
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4bu4A00
1TTOA 3A5EA 1B2SA 1B21A 1LRAA 1GSPA 1JBTA 1LOWA 1JBSA 1T2IA 1GOUA 1RGFA 2F4YA 1BNGA 1BSCA 1I70A 1YVSA 4HOHA 1FUTA 3DGYA 1BSBA 3WHOA 1GMPA 2SARA 9RNTA 2BU4A 1FYSA 3HOHA 1RN4A 1I0XA 1LNIA 1GMRA 1TRPA 8RNTA 1BANA 1B2ZA 1GOVA 1RGKA 1BRJA 2RBIA 3URPA 1BNRA 1LOYA 4GSPA 1I3IA 1I2FA 1BRIA 3Q3FA 1BUJA 1RCKA 1BNJA 1GOYA 3D5GA 1IYYA 7GSPA 1UCLA 1X1UA 3DH2A 2KAAA 2C4BA 1RCLA 1RSNA 1R4YA 1YNVX 3KCHA 2HOHA 1C54A 3D5IA 1FW7A 3GSPA 3AGOA 1UCKA 3AGNA 1DETA 5BU4A 1RNBA 1HYFA 1RGCA 2F5WA 1UCIA 5HOHA 1BAOA 1LOVA 1BRSA 1B2XA 1BNIA 1UCJA 1BVIA 1HZ1A 1FZUA 1BU4A 1TRQA 2F56A 1RGEA 3D4AA 4BU4A 2AAEA 1FUSA 1BNFA 1RGAA 1B2MA 1AY7A 1B27A 1B2UA 1T2HA 2GSPA 4HAAA 3AHSA 1BGSA 2KF4A 1X1XA 1MGWA 1X1YA 1JBRA 1BNSA 1RGHA 2BIRA 1DE3A 6RNTA 3BU4A 1B3SA 1YGWA 1ZGXA 1PYLA 1BRNL 1BNEA 1RHLA 2RNTA 2ZA4A 2KF6A 1BRKA 1BRGA 1RGGA 1PY3A 1BRHA 2AADA 1RTUA 3BIRA 1AQZA 6GSPA 4RNTA 4BIRA 1I3FA 1CH0A 2KF5A 1A2PA 4J5KA 7RNTA 1RDSA 1I2EA 1BSDA 1RNTA 2F5MA 3SYUA 1MGRA 1GMQA 1RGLA 1RLSA 2KF3A 1BSAA 1B20A 1I2GA 1X1WA 3AHWA 3WR2A 3RNTA 5GSPA 1RN1A 1Q9EA 4J5GA 4GHOA 5BIRA 1SARA 1G02A 1BIRA 1I8VA 1RMSA 5RNTA 1I0VA 1BOXA 1BSEA
chains in the Genus database with same CATH superfamily
3ECFA 4WYKA 1TTOA 1B21A 1YJW3 1RRHA 3HIGA 5AIGA 1GOUA 4PEJA 2Y73A 1I70A 3SOAA 4HOHA 1OF5B 1JNQA 1RN7A 3U97A 1BSBA 1GYBA 1OPYA 3OWUA 4FCZA 2QGUA 4O2HA 1V58A 4R1KA 3WODG 3UB1A 2GBWB 3B4PA 4CCVA 1EQKA 3ER7A 1LNIA 1S5AA 1TRPA 1C7HA 2WO0A 2RFRA 3LTBA 2CHCA 3GZBA 3KN4A 1BRJA 1OGZA 3MWZA 3EJVA 4GL6A 3URPA 1BNRA 5EEOA 4Q53A 5AEUB 1I2FA 1E3RA 4I4KA 4LGQA 3Q3FA 2BNGA 3LH4A 1BNJA 1ULJB 2INXA 3A76A 7STDA 1YHQ3 3FKAA 4EV5A 5G1KA 1IYYA 1CEWI 1JKGB 2QIYA 1JRQA 2CC3A 3F9SA 3JUQA 3CCU3 1Q814 3N9HA 2KAAA 5STDA 2HMOB 1RSNA 1EA2A 3CNMA 1YNVX 4R4KA 2HOHA 5KP1A 3G4S3 2CW9A 1C54A 4U13A 1PFPA 1CYUA 1FGTA 2ML5A 3U1WA 3QRDA 2Z76A 1LQMB 1GY5A 3S5CA 4H3UA 4N6TA 3VSYA 1UCIA 1ZO2A 4CPKA 1O7WB 2GXFA 1SPUA 3NQZA 3CCR3 2GBXB 1BVIA 1OHPA 2W2CA 2XH9A 3GZXB 3IMAB 1NNVA 1TRQA 1YVBI 2GU3A 4WP5A 2F56A 1RGEA 5EVHA 1IDPA 1Q7HA 3EBYA 5D82A 3CME3 4BU4A 3Q1CA 1JZDA 2AAEA 3E99A 3EB8A 4JRFA 3JUPA 1FUSA 1QAKA 2C11A 3G0KA 1AY7A 1B2UA 1VQQA 2GSPA 2M7OA 4HKVB 3K7CA 3H3HA 3OXAA 2KF4A 2W6JH 1LNHA 1X1XA 4AKZA 5I97A 1PU4A 4NREA 1VQ63 4WHAA 5IERA 1X1YA 1D6ZA 3BB9A 5JBSA 4EC6A 3WA3A 3DMCA 1JBRA 1DE3A 3BU4A 3O8YA 1ROVA 1ZGXA 1SIIA 2XGNA 3B7CA 1VQ93 3KSED 3CC73 1BRKA 1Q40B 1BUQA 1HU9A 5IG3A 1UI7A 4XBXA 2CWTA 1W6CA 1RTUA 2YFLB 4HM6B 1SQWA 1QVG2 3QK9A 3GZYB 5LC6A 1N9EA 3LYGA 1LXEA 3MSOA 1U5OA 2H0IA 1KWIA 1I3FA 1A2PA 3D3LA 1IQ8A 1RDSA 1IVXA 5BXQA 1GD4A 2F5MA 3SYUA 1VQK3 2OTJ3 2B24B 1DYUA 1GMQA 2L4VA 2Z7AA 2CG1A 2FXTA 1VQM3 1W01A 1IU7A 2Z6BA 1ASKA 3WOFB 5GSPA 3HX8A 2P0XA 3NM2A 1Q9EA 4J5GA 4MJDA 5LC7A 1M1XB 5ELJA 2ML6A 3MG1A 3CC43 2BO9B 2R41A 5A0OB 1QVF2 3EHCA 2CFWA 2XSHB 4K61A 3HK4A 5KP4A 2CK3H 1NB5I 1RKYA 5D83A 1LQGC 1LRAA 1JBTA 1GSPA 3BLZA 3K5TA 1LOWA 4NPBA 1T2IA 3L0RA 1TP6A 2OQEA 1BSCA 3JVCA 3FCSB 1IV9A 1K28A 3WHOA 3M8CA 3BNDA 1CYVA 2P09A 2P0MA 1EEJA 2E2UA 5D81A 5AEWB 1FYSA 4BTXA 1N8R4 3F7XA 4XDWA 2W0QA 4N6MA 1W00A 3LMLA 2IUJA 2YX9A 1MWSA 3BNBA 2RBIA 1A2VA 2BHMA 1VQ83 3EN8A 3LXUX 1DMQA 3FZWA 3I553 2GEYA 5DRVA 3GAXA 2H0GA 2KRTA 3PYJA 4RBNA 3X42A 1VQP3 1A90A 1T5YA 1UUVB 3D5GA 1KQS2 1W5ZA 3EC9A 4HM2B 1NDOB 3J7Yd 1QMAA 5IG4A 1X1UA 3CCV3 3NHXA 3UJMA 4CJNA 3AMOB 3KCHA 4FCJA 1CQSA 4FR9A 3D5IA 4LSOA 1N8QA 3WDGB 4DKIA 3ALAA 3PGBA 4EYCA 3AGOA 1RNBA 1DETA 3NX0A 4XDVA 5BVBA 1HYFA 1RGCA 3CCE3 5AYRB 1LOVA 4KVHA 4K1UA 1BNIA 3G6E3 2SBLA 2HMMB 2YFIB 3CXC2 3K9MC 5AIHA 4L8OA 1JZOA 1VQ43 1GD3A 1RGAA 3B8LA 3NXJA 5IG5A 3RDEA 5IW9A 3PZWA 4HAAA 3AHSA 3CCQ3 1YIJ3 4BTYA 1VZZA 5AIIA 3F8HA 2MC8A 3STDA 1K9M4 1K41A 2FNQA 2W9PA 1JB5A 2BMQB 1L5GB 2W56A 2BIRA 2RCDA 1JN5A 1YGWA 1OUNA 2CWUA 1RHLA 4MMZB 1UGHI 3N54B 2HMKB 1O7HB 3CCJ3 3G8ZA 2BMOB 3PS8A 1PY3A 1J2BA 2BMRB 1BRHA 1FGMA 2AADA 1AQZA 4R9LA 3KE7A 1E97A 4OVMA 6GSPA 2JQ5A 4RNTA 4WFOA 2E2TA 3CCM3 4BIRA 1EUIC 4HYZA 2WGQA 1CH0A 1AVKA 2B1XB 2KF5A 3G16A 4HM0B 5M1AA 3V98A 2GU1A 1I2EA 1RNTA 5JPUA 4N6OB 4RNZA 1OGXA 1HKXA 1A67A 3WR2A 1X1WA 1Q824 3NUVA 2HMJB 2UGIA 4IIAA 1IT7A 1DVCA 3NV0A 1RN1A 2IUKA 4KZ1A 3T8NA 1Y4KA 4GHOA 1NU3A 3V92A 1SARA 5BIRA 1BIRA 1N9JA 4BL2A 2F99A 4MMYB 3DXOA 3CC23 2W04A 2W9QA 1GS3A 3X3ZA 4NHFA 5AYSC 1KD14 2OOVA 1OF5A 2I9WA 3KIIA 4R9KA 1F8NA 8CHOA 3SLUA 4N3VA 2V1LA 4OUQA 1MWTA 3X41A 1B2SA 1R4CA 1IVVA 2HMNB 1JBSA 2C10A 5CK6A 2CWVA 2F4YA 1UGIA 1BNGA 3LTAA 3HIIA 3LTCA 5DREA 4L7KA 2XFTA 1K8A4 3DGYA 5TGNA 1GMPA 4WYKB 2SARA 3S67A 3SXXA 3VGNA 9RNTA 4WWUC 1WQLB 4AKYA 1G96A 1RN4A 4GB5A 2R4IA 1GMRA 1ZX2A 3DZLA 1YI23 4LZIA 1BANA 1B2ZA 3OW22 4HM8B 2F98A 4HM3B 1FGOA 1JKGA 1W02A 3ZFZA 1YJ93 2KXGA 3CPW2 3PXMA 2OCTA 5ELUA 1BRIA 5AIFA 5JPPA 1JB2A 1RCKA 1VQN3 3MYTA 4J8TA 2XFSA 2KCDA 2K3DA 3LT9A 4N6NB 5CF1A 2A15A 7GSPA 2E2VA 3B4OA 1DMMA 1UCLA 4STDA 1M904 1W7CA 4CDLA 3KKGA 2LQVA 1NJI4 1ZS7A 1U8CB 4IPBA 3OWSA 2XR8B 3BNCA 3CPOA 4H61A 1R4YA 2RGQA 3HI7A 4EXRA 2IYJA 1W4NA 4N6V0 1ROAA 1SIHA 4IT7A 1YGEA 1K734 3DM8A 1M9GA 1UCKA 2LYXA 2D42A 1LOXA 2F5WA 4HBRA 5HOHA 3CD63 1BAOA 4RNYA 1BRSA 1TU5A 1B2XA 5KP3A 3FG3A 1HZ1A 1N5PA 2W56B 4FMDA 3WA2X 1NWWA 2CFLA 2D1WA 3D4AA 3K0ZA 3CCS3 3KZTA 3HZPA 2H0HA 4HM1B 3CCL3 3FLJA 3BNEA 1OHOA 4KFFA 3H51A 1IVWA 3F8XA 3Q90A 4LMIA 4OK0A 1GY6A 1B2MA 4FMAA 3GWRA 4N6LA 1JJ22 1EKMA 1UUWB 1EG9B 5IF6A 3NBJA 1O7GB 1TUHA 3S29A 3FG1A 1Z1SA 1Q42A 3T8UA 4R80A 1MGWA 3D79A 2F86B 3F40A 1BNSA 1RGHA 4J9AA 3IJEB 4XB5A 2ZL8A 1D6YA 3IPTA 1JB4A 1PYLA 4FMCA 1A2KA 3F14A 1BNEA 1FUWA 3DGOA 1AR0A 2RNTA 3CU3A 4KFEA 4QWTA 3JUMA 1MWUA 3EE1A 2KF6A 3X40A 3NBBA 4HM7B 3UNLA 1RGGA 2IY2A 3LT8A 1TFKA 3PCRA 1IK3A 3NM7A 1FGQA 3K63A 3MG3A 4HVNA 3BIRA 1UI8A 2K0MA 2PNCA 4K1VA 1KC84 1E3VA 1LVNA 1IQYA 1WTHA 5IG0A 1US1A 3FG4A 4HZ9B 1SJWA 1UUGB 2OQEC 3V99A 1W2B2 4LYLB 4X2OA 4TX4A 4ILFA 1BSDA 2CX1A 1MGRA 4K90B 1JV2B 1N5HA 1RGLA 1RLSA 1RJOA 1BSAA 2FGTA 3AHWA 3RGAA 2YFJB 2Z77A 1ISKA 1FGRA 3EBTA 2CFGA 2XF3A 3ROBA 3SEDA 4KFDA 4HM4B 3FF2A 2Q07A 3I0YA 3MG2A 3FGYA 1RMSA 4G1MB 2O3OA 3VF1A 3UL5A 2HMLB 3NQYA 1QJGA 2ZDJA 4MEIA 1OH0A 4HZBB 3A5EA 5FW5A 1W6YA 2L1SA 3OV4A 1M1K4 1RGFA 3D9RA 1RRLA 4AEQA 3SVAA 4FCMA 1YVSA 3F7SA 5FGOA 3X3YA 1FUTA 3LTDA 5G2GA 3I563 4ZM8A 2WOFA 3RGRA 1OCVA 2WGOA 1Q7Y4 1VQO3 2BU4A 1AV4A 3HOHA 1UW1A 1I0XA 1D6UA 3LZAA 4XM4A 2Y74A 8RNTA 4HM5B 1W2ZA 1GOVA 1RGKA 4RZMA 3JUNA 5CXOA 2RSXA 2BT3A 4N6UA 3EN1B 1LOYA 1ULIB 4GSPA 3NBRA 1I3IA 2CH9A 1MNLA 3OX9A 1BUJA 1QALA 1STFI 3AMOA 1GOYA 3DY5A 5CF2A 1WMNA 3FSDA 3WMDA 2CIUA 3DH2A 3MPHA 4EV2A 2C4BA 1IT8A 1RCLA 2MF7A 3DUKA 1IQXA 2UUGC 3GRDA 5HGRA 5M18A 1TJDA 2ZHXB 1FW7A 3GSPA 3AGNA 5BU4A 4KT3B 1TFOA 3WOEB 3LOYA 2XGLA 2K54A 1W6GA 3T0UA 2GEXA 1UCJA 3KSPA 4I5QA 2PZVA 1FZUA 1BU4A 2OTL3 2CKFB 3KFQC 5EQLA 4X2HA 4BTWA 3SOYA 4BL3A 1FA3A 4EBGA 1G0TA 4MMXB 1O7PB 1BNFA 2P05A 2P38A 1B27A 4O8SA 1T2HA 3PCSA 1VQ53 1IVUA 1NB3I 1QAFA 1KSIA 1BGSA 2CX0A 2OWPA 5G1LA 3EF8A 4ORLA 5AI1A 2QEX3 4O02B 3UL6A 3G713 4XBYA 1V57A 6RNTA 1NO3A 2IMJA 1B3SA 3N8BA 1VQL3 3TDGA 1DVDA 3DGNA 1BRNL 4FMBA 2J8XB 2XEPA 3ZG5A 2JDIH 2ZA4A 1JN5B 4O3VA 1V74A 1WNHA 1O7MB 2XSOB 5IEPA 2CFKA 3DGLA 1BRGA 4LEHA 3OWYA 1MOLA 1Q864 2UX0A 2O9UX 1VQ73 1UDII 1MWRA 2OOVC 1AVLA 1T3BA 4JF8A 4EW5A 2IA7A 2QA43 1YIT3 5IEOA 2WOHA 1OACA 7RNTA 2CFDA 3MKIA 4J5KA 5CLKA 3EQQB 3FH1A 3FF0A 3CNXA 2KF3A 4XBTA 1B20A 1I2GA 3ZG0A 3EX9A 3S28A 1O7NB 1TIJA 1IV7A 3JUOA 1Q40A 5IENA 3RNTA 5M19A 1YJN3 1WMOA 1WMPA 3GZRA 6STDA 4HJLB 3DGMA 3X3XA 1STDA 2XRXB 1G02A 1DMNA 3MHEA 1I8VA 5RNTA 4L8PA 2CG0A 1I0VA 1S723 2W03A 1BOXA 1GY7A 2STDA 3NV0B 1BSEA 3S27A 3CMA3 3SX1A 1OHSA 3Q2PA
chains in the Genus database with same CATH topology
1TTOA 3A5EA 1B2SA 1B21A 1LRAA 1GSPA 1JBTA 1LOWA 1JBSA 1T2IA 1GOUA 1RGFA 2F4YA 1BNGA 1BSCA 1I70A 1YVSA 4HOHA 1FUTA 3DGYA 1BSBA 3WHOA 1GMPA 2SARA 9RNTA 2BU4A 1FYSA 3HOHA 1RN4A 1I0XA 1LNIA 1GMRA 1TRPA 8RNTA 1BANA 1B2ZA 1GOVA 1RGKA 1BRJA 2RBIA 3URPA 1BNRA 1LOYA 4GSPA 1I3IA 1I2FA 1BRIA 3Q3FA 1BUJA 1RCKA 1BNJA 1GOYA 3D5GA 1IYYA 7GSPA 1UCLA 1X1UA 3DH2A 2KAAA 2C4BA 1RCLA 1RSNA 1R4YA 1YNVX 3KCHA 2HOHA 1C54A 3D5IA 1FW7A 3GSPA 3AGOA 1UCKA 3AGNA 1DETA 5BU4A 1RNBA 1HYFA 1RGCA 2F5WA 1UCIA 5HOHA 1BAOA 1LOVA 1BRSA 1B2XA 1BNIA 1UCJA 1BVIA 1HZ1A 1FZUA 1BU4A 1TRQA 2F56A 1RGEA 3D4AA 4BU4A 2AAEA 1FUSA 1BNFA 1RGAA 1B2MA 1AY7A 1B27A 1B2UA 1T2HA 2GSPA 4HAAA 3AHSA 1BGSA 2KF4A 1X1XA 1MGWA 1X1YA 1JBRA 1BNSA 1RGHA 2BIRA 1DE3A 6RNTA 3BU4A 1B3SA 1YGWA 1ZGXA 1PYLA 1BRNL 1BNEA 1RHLA 2RNTA 2ZA4A 2KF6A 1BRKA 1BRGA 1RGGA 1PY3A 1BRHA 2AADA 1RTUA 3BIRA 1AQZA 6GSPA 4RNTA 4BIRA 1I3FA 1CH0A 2KF5A 1A2PA 4J5KA 7RNTA 1RDSA 1I2EA 1BSDA 1RNTA 2F5MA 3SYUA 1MGRA 1GMQA 1RGLA 1RLSA 2KF3A 1BSAA 1B20A 1I2GA 1X1WA 3AHWA 3WR2A 3RNTA 5GSPA 1RN1A 1Q9EA 4J5GA 4GHOA 5BIRA 1SARA 1G02A 1BIRA 1I8VA 1RMSA 5RNTA 1I0VA 1BOXA 1BSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTO A;  3A5E A;  1B2S A;  1B21 A;  1LRA A;  1GSP A;  1JBT A;  1LOW A;  1JBS A;  1T2I A;  1GOU A;  1RGF A;  2F4Y A;  1BNG A;  1BSC A;  1I70 A;  1YVS A;  4HOH A;  1FUT A;  3DGY A;  1BSB A;  3WHO A;  1GMP A;  2SAR A;  9RNT A;  2BU4 A;  1FYS A;  3HOH A;  1RN4 A;  1I0X A;  1LNI A;  1GMR A;  1TRP A;  8RNT A;  1BAN A;  1B2Z A;  1GOV A;  1RGK A;  1BRJ A;  2RBI A;  3URP A;  1BNR A;  1LOY A;  4GSP A;  1I3I A;  1I2F A;  1BRI A;  3Q3F A;  1BUJ A;  1RCK A;  1BNJ A;  1GOY A;  3D5G A;  1IYY A;  7GSP A;  1UCL A;  1X1U A;  3DH2 A;  2KAA A;  2C4B A;  1RCL A;  1RSN A;  1R4Y A;  1YNV X;  3KCH A;  2HOH A;  1C54 A;  3D5I A;  1FW7 A;  3GSP A;  3AGO A;  1UCK A;  3AGN A;  1DET A;  5BU4 A;  1RNB A;  1HYF A;  1RGC A;  2F5W A;  1UCI A;  5HOH A;  1BAO A;  1LOV A;  1BRS A;  1B2X A;  1BNI A;  1UCJ A;  1BVI A;  1HZ1 A;  1FZU A;  1BU4 A;  1TRQ A;  2F56 A;  1RGE A;  3D4A A;  4BU4 A;  2AAE A;  1FUS A;  1BNF A;  1RGA A;  1B2M A;  1AY7 A;  1B27 A;  1B2U A;  1T2H A;  2GSP A;  4HAA A;  3AHS A;  1BGS A;  2KF4 A;  1X1X A;  1MGW A;  1X1Y A;  1JBR A;  1BNS A;  1RGH A;  2BIR A;  1DE3 A;  6RNT A;  3BU4 A;  1B3S A;  1YGW A;  1ZGX A;  1PYL A;  1BRN L;  1BNE A;  1RHL A;  2RNT A;  2ZA4 A;  2KF6 A;  1BRK A;  1BRG A;  1RGG A;  1PY3 A;  1BRH A;  2AAD A;  1RTU A;  3BIR A;  1AQZ A;  6GSP A;  4RNT A;  4BIR A;  1I3F A;  1CH0 A;  2KF5 A;  1A2P A;  4J5K A;  7RNT A;  1RDS A;  1I2E A;  1BSD A;  1RNT A;  2F5M A;  3SYU A;  1MGR A;  1GMQ A;  1RGL A;  1RLS A;  2KF3 A;  1BSA A;  1B20 A;  1I2G A;  1X1W A;  3AHW A;  3WR2 A;  3RNT A;  5GSP A;  1RN1 A;  1Q9E A;  4J5G A;  4GHO A;  5BIR A;  1SAR A;  1G02 A;  1BIR A;  1I8V A;  1RMS A;  5RNT A;  1I0V A;  1BOX A;  1BSE A; 
#chains in the Genus database with same CATH topology
 3ECF A;  4WYK A;  1TTO A;  1B21 A;  1YJW 3;  1RRH A;  3HIG A;  5AIG A;  1GOU A;  4PEJ A;  2Y73 A;  1I70 A;  3SOA A;  4HOH A;  1OF5 B;  1JNQ A;  1RN7 A;  3U97 A;  1BSB A;  1GYB A;  1OPY A;  3OWU A;  4FCZ A;  2QGU A;  4O2H A;  1V58 A;  4R1K A;  3WOD G;  3UB1 A;  2GBW B;  3B4P A;  4CCV A;  1EQK A;  3ER7 A;  1LNI A;  1S5A A;  1TRP A;  1C7H A;  2WO0 A;  2RFR A;  3LTB A;  2CHC A;  3GZB A;  3KN4 A;  1BRJ A;  1OGZ A;  3MWZ A;  3EJV A;  4GL6 A;  3URP A;  1BNR A;  5EEO A;  4Q53 A;  5AEU B;  1I2F A;  1E3R A;  4I4K A;  4LGQ A;  3Q3F A;  2BNG A;  3LH4 A;  1BNJ A;  1ULJ B;  2INX A;  3A76 A;  7STD A;  1YHQ 3;  3FKA A;  4EV5 A;  5G1K A;  1IYY A;  1CEW I;  1JKG B;  2QIY A;  1JRQ A;  2CC3 A;  3F9S A;  3JUQ A;  3CCU 3;  1Q81 4;  3N9H A;  2KAA A;  5STD A;  2HMO B;  1RSN A;  1EA2 A;  3CNM A;  1YNV X;  4R4K A;  2HOH A;  5KP1 A;  3G4S 3;  2CW9 A;  1C54 A;  4U13 A;  1PFP A;  1CYU A;  1FGT A;  2ML5 A;  3U1W A;  3QRD A;  2Z76 A;  1LQM B;  1GY5 A;  3S5C A;  4H3U A;  4N6T A;  3VSY A;  1UCI A;  1ZO2 A;  4CPK A;  1O7W B;  2GXF A;  1SPU A;  3NQZ A;  3CCR 3;  2GBX B;  1BVI A;  1OHP A;  2W2C A;  2XH9 A;  3GZX B;  3IMA B;  1NNV A;  1TRQ A;  1YVB I;  2GU3 A;  4WP5 A;  2F56 A;  1RGE A;  5EVH A;  1IDP A;  1Q7H A;  3EBY A;  5D82 A;  3CME 3;  4BU4 A;  3Q1C A;  1JZD A;  2AAE A;  3E99 A;  3EB8 A;  4JRF A;  3JUP A;  1FUS A;  1QAK A;  2C11 A;  3G0K A;  1AY7 A;  1B2U A;  1VQQ A;  2GSP A;  2M7O A;  4HKV B;  3K7C A;  3H3H A;  3OXA A;  2KF4 A;  2W6J H;  1LNH A;  1X1X A;  4AKZ A;  5I97 A;  1PU4 A;  4NRE A;  1VQ6 3;  4WHA A;  5IER A;  1X1Y A;  1D6Z A;  3BB9 A;  5JBS A;  4EC6 A;  3WA3 A;  3DMC A;  1JBR A;  1DE3 A;  3BU4 A;  3O8Y A;  1ROV A;  1ZGX A;  1SII A;  2XGN A;  3B7C A;  1VQ9 3;  3KSE D;  3CC7 3;  1BRK A;  1Q40 B;  1BUQ A;  1HU9 A;  5IG3 A;  1UI7 A;  4XBX A;  2CWT A;  1W6C A;  1RTU A;  2YFL B;  4HM6 B;  1SQW A;  1QVG 2;  3QK9 A;  3GZY B;  5LC6 A;  1N9E A;  3LYG A;  1LXE A;  3MSO A;  1U5O A;  2H0I A;  1KWI A;  1I3F A;  1A2P A;  3D3L A;  1IQ8 A;  1RDS A;  1IVX A;  5BXQ A;  1GD4 A;  2F5M A;  3SYU A;  1VQK 3;  2OTJ 3;  2B24 B;  1DYU A;  1GMQ A;  2L4V A;  2Z7A A;  2CG1 A;  2FXT A;  1VQM 3;  1W01 A;  1IU7 A;  2Z6B A;  1ASK A;  3WOF B;  5GSP A;  3HX8 A;  2P0X A;  3NM2 A;  1Q9E A;  4J5G A;  4MJD A;  5LC7 A;  1M1X B;  5ELJ A;  2ML6 A;  3MG1 A;  3CC4 3;  2BO9 B;  2R41 A;  5A0O B;  1QVF 2;  3EHC A;  2CFW A;  2XSH B;  4K61 A;  3HK4 A;  5KP4 A;  2CK3 H;  1NB5 I;  1RKY A;  5D83 A;  1LQG C;  1LRA A;  1JBT A;  1GSP A;  3BLZ A;  3K5T A;  1LOW A;  4NPB A;  1T2I A;  3L0R A;  1TP6 A;  2OQE A;  1BSC A;  3JVC A;  3FCS B;  1IV9 A;  1K28 A;  3WHO A;  3M8C A;  3BND A;  1CYV A;  2P09 A;  2P0M A;  1EEJ A;  2E2U A;  5D81 A;  5AEW B;  1FYS A;  4BTX A;  1N8R 4;  3F7X A;  4XDW A;  2W0Q A;  4N6M A;  1W00 A;  3LML A;  2IUJ A;  2YX9 A;  1MWS A;  3BNB A;  2RBI A;  1A2V A;  2BHM A;  1VQ8 3;  3EN8 A;  3LXU X;  1DMQ A;  3FZW A;  3I55 3;  2GEY A;  5DRV A;  3GAX A;  2H0G A;  2KRT A;  3PYJ A;  4RBN A;  3X42 A;  1VQP 3;  1A90 A;  1T5Y A;  1UUV B;  3D5G A;  1KQS 2;  1W5Z A;  3EC9 A;  4HM2 B;  1NDO B;  3J7Y d;  1QMA A;  5IG4 A;  1X1U A;  3CCV 3;  3NHX A;  3UJM A;  4CJN A;  3AMO B;  3KCH A;  4FCJ A;  1CQS A;  4FR9 A;  3D5I A;  4LSO A;  1N8Q A;  3WDG B;  4DKI A;  3ALA A;  3PGB A;  4EYC A;  3AGO A;  1RNB A;  1DET A;  3NX0 A;  4XDV A;  5BVB A;  1HYF A;  1RGC A;  3CCE 3;  5AYR B;  1LOV A;  4KVH A;  4K1U A;  1BNI A;  3G6E 3;  2SBL A;  2HMM B;  2YFI B;  3CXC 2;  3K9M C;  5AIH A;  4L8O A;  1JZO A;  1VQ4 3;  1GD3 A;  1RGA A;  3B8L A;  3NXJ A;  5IG5 A;  3RDE A;  5IW9 A;  3PZW A;  4HAA A;  3AHS A;  3CCQ 3;  1YIJ 3;  4BTY A;  1VZZ A;  5AII A;  3F8H A;  2MC8 A;  3STD A;  1K9M 4;  1K41 A;  2FNQ A;  2W9P A;  1JB5 A;  2BMQ B;  1L5G B;  2W56 A;  2BIR A;  2RCD A;  1JN5 A;  1YGW A;  1OUN A;  2CWU A;  1RHL A;  4MMZ B;  1UGH I;  3N54 B;  2HMK B;  1O7H B;  3CCJ 3;  3G8Z A;  2BMO B;  3PS8 A;  1PY3 A;  1J2B A;  2BMR B;  1BRH A;  1FGM A;  2AAD A;  1AQZ A;  4R9L A;  3KE7 A;  1E97 A;  4OVM A;  6GSP A;  2JQ5 A;  4RNT A;  4WFO A;  2E2T A;  3CCM 3;  4BIR A;  1EUI C;  4HYZ A;  2WGQ A;  1CH0 A;  1AVK A;  2B1X B;  2KF5 A;  3G16 A;  4HM0 B;  5M1A A;  3V98 A;  2GU1 A;  1I2E A;  1RNT A;  5JPU A;  4N6O B;  4RNZ A;  1OGX A;  1HKX A;  1A67 A;  3WR2 A;  1X1W A;  1Q82 4;  3NUV A;  2HMJ B;  2UGI A;  4IIA A;  1IT7 A;  1DVC A;  3NV0 A;  1RN1 A;  2IUK A;  4KZ1 A;  3T8N A;  1Y4K A;  4GHO A;  1NU3 A;  3V92 A;  1SAR A;  5BIR A;  1BIR A;  1N9J A;  4BL2 A;  2F99 A;  4MMY B;  3DXO A;  3CC2 3;  2W04 A;  2W9Q A;  1GS3 A;  3X3Z A;  4NHF A;  5AYS C;  1KD1 4;  2OOV A;  1OF5 A;  2I9W A;  3KII A;  4R9K A;  1F8N A;  8CHO A;  3SLU A;  4N3V A;  2V1L A;  4OUQ A;  1MWT A;  3X41 A;  1B2S A;  1R4C A;  1IVV A;  2HMN B;  1JBS A;  2C10 A;  5CK6 A;  2CWV A;  2F4Y A;  1UGI A;  1BNG A;  3LTA A;  3HII A;  3LTC A;  5DRE A;  4L7K A;  2XFT A;  1K8A 4;  3DGY A;  5TGN A;  1GMP A;  4WYK B;  2SAR A;  3S67 A;  3SXX A;  3VGN A;  9RNT A;  4WWU C;  1WQL B;  4AKY A;  1G96 A;  1RN4 A;  4GB5 A;  2R4I A;  1GMR A;  1ZX2 A;  3DZL A;  1YI2 3;  4LZI A;  1BAN A;  1B2Z A;  3OW2 2;  4HM8 B;  2F98 A;  4HM3 B;  1FGO A;  1JKG A;  1W02 A;  3ZFZ A;  1YJ9 3;  2KXG A;  3CPW 2;  3PXM A;  2OCT A;  5ELU A;  1BRI A;  5AIF A;  5JPP A;  1JB2 A;  1RCK A;  1VQN 3;  3MYT A;  4J8T A;  2XFS A;  2KCD A;  2K3D A;  3LT9 A;  4N6N B;  5CF1 A;  2A15 A;  7GSP A;  2E2V A;  3B4O A;  1DMM A;  1UCL A;  4STD A;  1M90 4;  1W7C A;  4CDL A;  3KKG A;  2LQV A;  1NJI 4;  1ZS7 A;  1U8C B;  4IPB A;  3OWS A;  2XR8 B;  3BNC A;  3CPO A;  4H61 A;  1R4Y A;  2RGQ A;  3HI7 A;  4EXR A;  2IYJ A;  1W4N A;  4N6V 0;  1ROA A;  1SIH A;  4IT7 A;  1YGE A;  1K73 4;  3DM8 A;  1M9G A;  1UCK A;  2LYX A;  2D42 A;  1LOX A;  2F5W A;  4HBR A;  5HOH A;  3CD6 3;  1BAO A;  4RNY A;  1BRS A;  1TU5 A;  1B2X A;  5KP3 A;  3FG3 A;  1HZ1 A;  1N5P A;  2W56 B;  4FMD A;  3WA2 X;  1NWW A;  2CFL A;  2D1W A;  3D4A A;  3K0Z A;  3CCS 3;  3KZT A;  3HZP A;  2H0H A;  4HM1 B;  3CCL 3;  3FLJ A;  3BNE A;  1OHO A;  4KFF A;  3H51 A;  1IVW A;  3F8X A;  3Q90 A;  4LMI A;  4OK0 A;  1GY6 A;  1B2M A;  4FMA A;  3GWR A;  4N6L A;  1JJ2 2;  1EKM A;  1UUW B;  1EG9 B;  5IF6 A;  3NBJ A;  1O7G B;  1TUH A;  3S29 A;  3FG1 A;  1Z1S A;  1Q42 A;  3T8U A;  4R80 A;  1MGW A;  3D79 A;  2F86 B;  3F40 A;  1BNS A;  1RGH A;  4J9A A;  3IJE B;  4XB5 A;  2ZL8 A;  1D6Y A;  3IPT A;  1JB4 A;  1PYL A;  4FMC A;  1A2K A;  3F14 A;  1BNE A;  1FUW A;  3DGO A;  1AR0 A;  2RNT A;  3CU3 A;  4KFE A;  4QWT A;  3JUM A;  1MWU A;  3EE1 A;  2KF6 A;  3X40 A;  3NBB A;  4HM7 B;  3UNL A;  1RGG A;  2IY2 A;  3LT8 A;  1TFK A;  3PCR A;  1IK3 A;  3NM7 A;  1FGQ A;  3K63 A;  3MG3 A;  4HVN A;  3BIR A;  1UI8 A;  2K0M A;  2PNC A;  4K1V A;  1KC8 4;  1E3V A;  1LVN A;  1IQY A;  1WTH A;  5IG0 A;  1US1 A;  3FG4 A;  4HZ9 B;  1SJW A;  1UUG B;  2OQE C;  3V99 A;  1W2B 2;  4LYL B;  4X2O A;  4TX4 A;  4ILF A;  1BSD A;  2CX1 A;  1MGR A;  4K90 B;  1JV2 B;  1N5H A;  1RGL A;  1RLS A;  1RJO A;  1BSA A;  2FGT A;  3AHW A;  3RGA A;  2YFJ B;  2Z77 A;  1ISK A;  1FGR A;  3EBT A;  2CFG A;  2XF3 A;  3ROB A;  3SED A;  4KFD A;  4HM4 B;  3FF2 A;  2Q07 A;  3I0Y A;  3MG2 A;  3FGY A;  1RMS A;  4G1M B;  2O3O A;  3VF1 A;  3UL5 A;  2HML B;  3NQY A;  1QJG A;  2ZDJ A;  4MEI A;  1OH0 A;  4HZB B;  3A5E A;  5FW5 A;  1W6Y A;  2L1S A;  3OV4 A;  1M1K 4;  1RGF A;  3D9R A;  1RRL A;  4AEQ A;  3SVA A;  4FCM A;  1YVS A;  3F7S A;  5FGO A;  3X3Y A;  1FUT A;  3LTD A;  5G2G A;  3I56 3;  4ZM8 A;  2WOF A;  3RGR A;  1OCV A;  2WGO A;  1Q7Y 4;  1VQO 3;  2BU4 A;  1AV4 A;  3HOH A;  1UW1 A;  1I0X A;  1D6U A;  3LZA A;  4XM4 A;  2Y74 A;  8RNT A;  4HM5 B;  1W2Z A;  1GOV A;  1RGK A;  4RZM A;  3JUN A;  5CXO A;  2RSX A;  2BT3 A;  4N6U A;  3EN1 B;  1LOY A;  1ULI B;  4GSP A;  3NBR A;  1I3I A;  2CH9 A;  1MNL A;  3OX9 A;  1BUJ A;  1QAL A;  1STF I;  3AMO A;  1GOY A;  3DY5 A;  5CF2 A;  1WMN A;  3FSD A;  3WMD A;  2CIU A;  3DH2 A;  3MPH A;  4EV2 A;  2C4B A;  1IT8 A;  1RCL A;  2MF7 A;  3DUK A;  1IQX A;  2UUG C;  3GRD A;  5HGR A;  5M18 A;  1TJD A;  2ZHX B;  1FW7 A;  3GSP A;  3AGN A;  5BU4 A;  4KT3 B;  1TFO A;  3WOE B;  3LOY A;  2XGL A;  2K54 A;  1W6G A;  3T0U A;  2GEX A;  1UCJ A;  3KSP A;  4I5Q A;  2PZV A;  1FZU A;  1BU4 A;  2OTL 3;  2CKF B;  3KFQ C;  5EQL A;  4X2H A;  4BTW A;  3SOY A;  4BL3 A;  1FA3 A;  4EBG A;  1G0T A;  4MMX B;  1O7P B;  1BNF A;  2P05 A;  2P38 A;  1B27 A;  4O8S A;  1T2H A;  3PCS A;  1VQ5 3;  1IVU A;  1NB3 I;  1QAF A;  1KSI A;  1BGS A;  2CX0 A;  2OWP A;  5G1L A;  3EF8 A;  4ORL A;  5AI1 A;  2QEX 3;  4O02 B;  3UL6 A;  3G71 3;  4XBY A;  1V57 A;  6RNT A;  1NO3 A;  2IMJ A;  1B3S A;  3N8B A;  1VQL 3;  3TDG A;  1DVD A;  3DGN A;  1BRN L;  4FMB A;  2J8X B;  2XEP A;  3ZG5 A;  2JDI H;  2ZA4 A;  1JN5 B;  4O3V A;  1V74 A;  1WNH A;  1O7M B;  2XSO B;  5IEP A;  2CFK A;  3DGL A;  1BRG A;  4LEH A;  3OWY A;  1MOL A;  1Q86 4;  2UX0 A;  2O9U X;  1VQ7 3;  1UDI I;  1MWR A;  2OOV C;  1AVL A;  1T3B A;  4JF8 A;  4EW5 A;  2IA7 A;  2QA4 3;  1YIT 3;  5IEO A;  2WOH A;  1OAC A;  7RNT A;  2CFD A;  3MKI A;  4J5K A;  5CLK A;  3EQQ B;  3FH1 A;  3FF0 A;  3CNX A;  2KF3 A;  4XBT A;  1B20 A;  1I2G A;  3ZG0 A;  3EX9 A;  3S28 A;  1O7N B;  1TIJ A;  1IV7 A;  3JUO A;  1Q40 A;  5IEN A;  3RNT A;  5M19 A;  1YJN 3;  1WMO A;  1WMP A;  3GZR A;  6STD A;  4HJL B;  3DGM A;  3X3X A;  1STD A;  2XRX B;  1G02 A;  1DMN A;  3MHE A;  1I8V A;  5RNT A;  4L8P A;  2CG0 A;  1I0V A;  1S72 3;  2W03 A;  1BOX A;  1GY7 A;  2STD A;  3NV0 B;  1BSE A;  3S27 A;  3CMA 3;  3SX1 A;  1OHS A;  3Q2P A; 
#chains in the Genus database with same CATH homology
 1TTO A;  3A5E A;  1B2S A;  1B21 A;  1LRA A;  1GSP A;  1JBT A;  1LOW A;  1JBS A;  1T2I A;  1GOU A;  1RGF A;  2F4Y A;  1BNG A;  1BSC A;  1I70 A;  1YVS A;  4HOH A;  1FUT A;  3DGY A;  1BSB A;  3WHO A;  1GMP A;  2SAR A;  9RNT A;  2BU4 A;  1FYS A;  3HOH A;  1RN4 A;  1I0X A;  1LNI A;  1GMR A;  1TRP A;  8RNT A;  1BAN A;  1B2Z A;  1GOV A;  1RGK A;  1BRJ A;  2RBI A;  3URP A;  1BNR A;  1LOY A;  4GSP A;  1I3I A;  1I2F A;  1BRI A;  3Q3F A;  1BUJ A;  1RCK A;  1BNJ A;  1GOY A;  3D5G A;  1IYY A;  7GSP A;  1UCL A;  1X1U A;  3DH2 A;  2KAA A;  2C4B A;  1RCL A;  1RSN A;  1R4Y A;  1YNV X;  3KCH A;  2HOH A;  1C54 A;  3D5I A;  1FW7 A;  3GSP A;  3AGO A;  1UCK A;  3AGN A;  1DET A;  5BU4 A;  1RNB A;  1HYF A;  1RGC A;  2F5W A;  1UCI A;  5HOH A;  1BAO A;  1LOV A;  1BRS A;  1B2X A;  1BNI A;  1UCJ A;  1BVI A;  1HZ1 A;  1FZU A;  1BU4 A;  1TRQ A;  2F56 A;  1RGE A;  3D4A A;  4BU4 A;  2AAE A;  1FUS A;  1BNF A;  1RGA A;  1B2M A;  1AY7 A;  1B27 A;  1B2U A;  1T2H A;  2GSP A;  4HAA A;  3AHS A;  1BGS A;  2KF4 A;  1X1X A;  1MGW A;  1X1Y A;  1JBR A;  1BNS A;  1RGH A;  2BIR A;  1DE3 A;  6RNT A;  3BU4 A;  1B3S A;  1YGW A;  1ZGX A;  1PYL A;  1BRN L;  1BNE A;  1RHL A;  2RNT A;  2ZA4 A;  2KF6 A;  1BRK A;  1BRG A;  1RGG A;  1PY3 A;  1BRH A;  2AAD A;  1RTU A;  3BIR A;  1AQZ A;  6GSP A;  4RNT A;  4BIR A;  1I3F A;  1CH0 A;  2KF5 A;  1A2P A;  4J5K A;  7RNT A;  1RDS A;  1I2E A;  1BSD A;  1RNT A;  2F5M A;  3SYU A;  1MGR A;  1GMQ A;  1RGL A;  1RLS A;  2KF3 A;  1BSA A;  1B20 A;  1I2G A;  1X1W A;  3AHW A;  3WR2 A;  3RNT A;  5GSP A;  1RN1 A;  1Q9E A;  4J5G A;  4GHO A;  5BIR A;  1SAR A;  1G02 A;  1BIR A;  1I8V A;  1RMS A;  5RNT A;  1I0V A;  1BOX A;  1BSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...