4BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 27
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4bu4A00
1BIRA 1GOUA 1HYFA 1I3FA 3WR2A 6GSPA 1BRSA 3BIRA 1RGHA 5BU4A 7RNTA 2F56A 1BRNL 1I8VA 1TRQA 1FYSA 1TTOA 3HOHA 1LOYA 3AHWA 3GSPA 1AQZA 1YNVX 5HOHA 1JBSA 2F5WA 1RGGA 3AGNA 1RDSA 1BSBA 1RMSA 1LOWA 3DGYA 1B2ZA 1BNSA 1I0VA 1BANA 1T2HA 1GOVA 1B2SA 3AGOA 3URPA 1MGRA 3BU4A 2AADA 1BSEA 1BNIA 1R4YA 1BU4A 4HAAA 5GSPA 1MGWA 1RGCA 4GSPA 2SARA 5BIRA 1C54A 1B2XA 1BUJA 1GMPA 1BNGA 1B2UA 1RNBA 4J5KA 2C4BA 1RHLA 2F4YA 1GMRA 1RGAA 1CH0A 3KCHA 4HOHA 1BRJA 1RLSA 1I2GA 1FW7A 1GOYA 3SYUA 1RGKA 1RGFA 1LNIA 1G02A 1B27A 1DE3A 1BNEA 1HZ1A 1RCKA 1I2EA 4GHOA 3WHOA 1T2IA 1X1WA 1YGWA 1ZGXA 1BSDA 1I2FA 1B3SA 3D5IA 1RGLA 1BRKA 1BVIA 1UCLA 2HOHA 1UCIA 2F5MA 1GSPA 3D4AA 1BRHA 5RNTA 1B20A 7GSPA 1RN4A 1B21A 1Q9EA 1X1YA 1PYLA 3Q3FA 4BIRA 1UCKA 1I3IA 1FUTA 3D5GA 4J5GA 3DH2A 1RSNA 1X1XA 1TRPA 3A5EA 2KF5A 1PY3A 1I70A 1FZUA 3AHSA 2BIRA 1BNJA 1RNTA 1RTUA 2KF4A 1DETA 2AAEA 1I0XA 2BU4A 1BSCA 1BNFA 1FUSA 1JBTA 2KAAA 1LOVA 1BGSA 4RNTA 1UCJA 1LRAA 9RNTA 1RGEA 1SARA 1IYYA 1RN1A 1BRGA 2GSPA 1BAOA 4BU4A 1JBRA 1X1UA 1AY7A 2RBIA 8RNTA 2ZA4A 2KF6A 1A2PA 1BSAA 1GMQA 3RNTA 1BRIA 1BOXA 1YVSA 1BNRA 2KF3A 6RNTA 1RCLA 1B2MA 2RNTA
chains in the Genus database with same CATH superfamily
1IQ8A 3UNLA 5JPPA 2RSXA 1BRSA 2Z7AA 3BIRA 1RGHA 1E3RA 4N6OB 1BRNL 2WOFA 3STDA 4HM8B 4CPKA 3X42A 2Z76A 1IT8A 5KP1A 3GZXB 1LOYA 3NM2A 1NJI4 3NBRA 1N9EA 1IVUA 3EN1B 2ZDJA 3GZRA 4L7KA 3CU3A 1MOLA 3ECFA 3CC23 1K9M4 1D6ZA 3EB8A 3NBBA 4R4KA 2RFRA 3EJVA 3NHXA 1GS3A 4EV5A 1ZS7A 4R80A 4FR9A 3F8HA 3LT8A 3QRDA 3X41A 1T2HA 5TGNA 1B2SA 4BTYA 3AGOA 2GBXB 3RDEA 4AKYA 5AEWB 2XH9A 8CHOA 3URPA 1MGRA 3FCSB 5A0OB 5IF6A 2CFWA 1Z1SA 2L4VA 1BNIA 4HZ9B 3CD63 1R4YA 1RRLA 4HKVB 3EC9A 1OCVA 4NPBA 1NB3I 1RGCA 1VZZA 4L8OA 1U5OA 4XDVA 5CLKA 5BIRA 5AYRB 1EEJA 4R1KA 3MWZA 3JUNA 5G1KA 1HU9A 3CNXA 4X2HA 1AVLA 5CK6A 1GY6A 3WA3A 2JDIH 3FSDA 2XF3A 1UGIA 3SEDA 3A76A 4I5QA 1G96A 1NB5I 1RHLA 3GWRA 4N6LA 1U8CB 5BXQA 3JUQA 1GMRA 4LSOA 1CH0A 3HIGA 3IJEB 4PEJA 1RLSA 5IG4A 1WTHA 2R4IA 3CC73 1Q7Y4 1FW7A 3LTCA 1RGKA 4AEQA 3G8ZA 2XGLA 1J2BA 1HZ1A 1O7NB 3WHOA 1QMAA 4G1MB 5AIGA 1GY5A 1T2IA 5CXOA 1X1WA 2RCDA 3NUVA 1ZGXA 4WYKA 3OX9A 5FGOA 1B3SA 3D5IA 3G6E3 7STDA 4ORLA 1GSPA 3WDGB 1BRHA 3GAXA 3CCS3 3FF0A 2W9QA 1IK3A 1UUVB 1RN4A 3FH1A 3MYTA 3X40A 2CWUA 3OW22 3Q3FA 1TIJA 4RZMA 5DRVA 1VQ93 2OOVA 1UCKA 2P0XA 3VGNA 2W2CA 1OGXA 1X1XA 3A5EA 3WOEB 4CDLA 5AIHA 3EE1A 3BNEA 1SPUA 5IG0A 3B8LA 3SOAA 1KC84 3AHSA 1JKGA 1RNTA 1JB4A 4LMIA 1LQMB 1DVCA 1I0XA 1N9JA 3TDGA 1V57A 1TP6A 1VQP3 3PZWA 2KAAA 2WGOA 1LOVA 4RNZA 3FF2A 1WMPA 2W0QA 1ULIB 1UCJA 1UGHI 1JB5A 2W6JH 1SARA 3EQQB 1RN1A 2PNCA 2F86B 3EBTA 2ML5A 2L1SA 1W00A 4KFEA 4STDA 2BT3A 4OUQA 4K61A 2ZA4A 1LNHA 1GD4A 4BTWA 2KF6A 4J9AA 2GEXA 1JJ22 2OTJ3 1O7GB 3HIIA 3HZPA 1OUNA 2XRXB 3HX8A 2CX1A 1GOUA 2Z6BA 1RN7A 3FZWA 3L0RA 2K54A 3PS8A 5DREA 3GZYB 3WR2A 2IMJA 2Y74A 3G16A 6GSPA 1W7CA 3BNCA 3LZAA 3NXJA 1YI23 1STDA 3D3LA 1MNLA 1TTOA 1FYSA 2CKFB 3KSED 2CWTA 1IU7A 1Q40A 3MG1A 4XB5A 1FGMA 1NU3A 2OOVC 1JRQA 3RGAA 1AQZA 3V98A 1RGGA 2ZL8A 1RDSA 1BSBA 3AMOA 4HM2B 3DGYA 1JKGB 1JZOA 1VQK3 1Q814 1NO3A 2WOHA 3UL6A 2WO0A 1OHPA 1T5YA 1V58A 2IUKA 3K63A 2XFTA 3T8NA 4FMCA 3DM8A 3EN8A 1WMNA 1LXEA 2CWVA 5D82A 2H0IA 2ML6A 1BU4A 5GSPA 4IPBA 1Y4KA 3UB1A 4BTXA 1STFI 1B2XA 1C54A 1ZX2A 3DZLA 2GU1A 4AKZA 3CCV3 3FGYA 4N6UA 1A90A 1BUJA 1TU5A 1BNGA 3F7SA 1JB2A 2BMRB 4H61A 1RNBA 4J5KA 2F98A 2O9UX 1LVNA 2C4BA 5CF1A 1YIJ3 2F4YA 5IEPA 2CFKA 5AIIA 1VQL3 3G4S3 3KCHA 4JF8A 2CFGA 3CPOA 4HOHA 1VQN3 2QEX3 1D6UA 2P38A 3CC43 2P05A 1VQ83 4RBNA 3K7CA 4CJNA 1B27A 1LOXA 3KSPA 2W9PA 1I2EA 4GHOA 4R9LA 1DE3A 4EXRA 1IQYA 2Q07A 1YGWA 1Q40B 2P09A 3X3XA 2CG1A 3G713 2F99A 3LT9A 1O7WB 2D1WA 1BRKA 1OHOA 2HOHA 2INXA 1UCIA 2F5MA 3OXAA 4HZBB 3UJMA 3DY5A 1A67A 2P0MA 2YFIB 2E2UA 2IY2A 3AMOB 3IMAB 4IIAA 7GSPA 1W02A 5KP4A 3NQZA 5AYSC 1IT7A 2FGTA 3F40A 1I3IA 3N9HA 3D5GA 3I563 3DH2A 3LXUX 1SQWA 1Q824 2I9WA 2E2TA 3F14A 4HJLB 2CC3A 3HI7A 4R9KA 4O8SA 2XR8B 1FZUA 1W4NA 5EEOA 3ZFZA 2KF4A 3N54B 1FA3A 1VQQA 3MPHA 5M1AA 3SX1A 1BSCA 3DGNA 3NBJA 3WMDA 1JBTA 3OWUA 1BGSA 4LYLB 1ASKA 3BLZA 5ELJA 4MJDA 1QVG2 3SOYA 3LTBA 2YX9A 4NREA 1IYYA 3X3YA 1BAOA 2E2VA 4TX4A 1DMMA 1X1UA 2W03A 4HYZA 1AY7A 2UUGC 4L8PA 3X3ZA 1D6YA 3OWYA 3H3HA 3QK9A 2RBIA 1V74A 3ZG5A 1IVXA 3CCU3 2FXTA 1A2PA 4HM6B 3J7Yd 1FUWA 1BNRA 1TFOA 2HMOB 4XM4A 1VQ73 3B4OA 1US1A 3E99A 5IG3A 1YHQ3 2RNTA 1B2MA 1HYFA 3GZBA 4FCMA 1AV4A 2M7OA 1UDII 2F56A 1W2ZA 3BNDA 3JUPA 3OWSA 5IEOA 3WODG 1K8A4 1I8VA 1K41A 4O2HA 3ZG0A 1EQKA 1QJGA 2B24B 3AHWA 3PGBA 4HM7B 3S29A 3DGOA 4WWUC 5LC7A 1W6GA 1YNVX 1JBSA 2F5WA 5D81A 1BUQA 1A2VA 4QWTA 2OWPA 1RMSA 1LOWA 6RNTA 1B2ZA 1O7MB 4MMYB 1PU4A 1G0TA 3NX0A 1I0VA 4K90B 4GL6A 5JPUA 3UL5A 1GOVA 1Q42A 2XEPA 2PZVA 4EYCA 4LZIA 1K734 1OPYA 1FGTA 1BSEA 2AADA 2V1LA 2W56B 2Y73A 4N3VA 4HAAA 4Q53A 4KZ1A 3ROBA 3CCL3 1MGWA 1N5PA 2UGIA 4GSPA 4EV2A 3H51A 3N8BA 3KN4A 1IQXA 1QVF2 1S723 2IUJA 3LYGA 3PCRA 1KD14 1GMPA 1CYVA 1UI7A 1W6YA 4HM3B 2SBLA 1SIIA 4N6MA 1WNHA 2KRTA 4X2OA 3MG3A 1PFPA 2LQVA 1RGAA 2KCDA 4EC6A 2STDA 1JN5A 1UUGB 2BMQB 1BRJA 4CCVA 1I2GA 2C10A 3GRDA 3RGRA 1GOYA 1L5GB 1OACA 3D79A 1RGFA 3K0ZA 4MMZB 1LNIA 3DGLA 1G02A 1TJDA 4NHFA 1BNEA 2OQEA 1FGQA 1RCKA 3T0UA 2MF7A 4HM5B 3CMA3 1FGOA 3KE7A 5D83A 3VF1A 2A15A 2UX0A 1BVIA 1OHSA 1M9GA 1UCLA 3CME3 1IVVA 2KXGA 1VQ53 3EX9A 1SJWA 3LH4A 3JUMA 1SIHA 1B21A 1Q9EA 1X1YA 3NV0A 3MHEA 4K1VA 3EBYA 2B1XB 2GEYA 5HGRA 1MWTA 3M8CA 2CW9A 1RRHA 4WP5A 4KFFA 5AEUB 3ER7A 1FUTA 1UW1A 2XGNA 2XFSA 2OCTA 2R41A 1A2KA 1RSNA 4U13A 1EKMA 1K28A 1F8NA 3V92A 2BHMA 2KF5A 1CEWI 1VQO3 1YJW3 2GBWB 3FG3A 1BNJA 1AR0A 1IDPA 1ROVA 2AAEA 4LEHA 3F9SA 1ZO2A 1RJOA 2CH9A 4HBRA 1BNFA 1FUSA 1W2B2 2CFDA 1NWWA 3PYJA 3IPTA 3B4PA 9RNTA 3SVAA 3NM7A 5JBSA 5M19A 1EUIC 1JN5B 1TFKA 2GSPA 1N8R4 4BU4A 1QAFA 1JBRA 4FMAA 4KT3B 2XSOB 3KIIA 4FMDA 2D42A 2CIUA 1JNQA 5EVHA 3ALAA 8RNTA 3CCQ3 3S5CA 1JV2B 2IYJA 2GXFA 1O7HB 1BSAA 3RNTA 1HKXA 1CQSA 1R4CA 2OQEC 3DXOA 3I0YA 1NNVA 1M1K4 3NQYA 5STDA 1RCLA 1MWUA 2HMJB 1IVWA 1IV7A 1BIRA 3U1WA 4EBGA 2OTL3 1ROAA 1WMOA 3LTAA 3FKAA 4XBYA 3HK4A 1FGRA 3FG4A 1I3FA 4FCZA 1W01A 2QGUA 1W6CA 2C11A 1E97A 2CFLA 3NV0B 5FW5A 5BU4A 3T8UA 7RNTA 3CCJ3 3S27A 1TRQA 3S28A 1N8QA 1MWSA 2W56A 4LGQA 3HOHA 3BNBA 4BL3A 1YVBI 2YFJB 3GSPA 3LTDA 3SXXA 3O8YA 4HVNA 4EW5A 4WFOA 3VSYA 3BB9A 5HOHA 3AGNA 2J8XB 1YIT3 1KQS2 1EG9B 5IERA 3CCE3 3U97A 2BO9B 1OF5A 2O3OA 1TUHA 5G1LA 1BNSA 3EHCA 4OK0A 6STDA 1EA2A 1BANA 1VQM3 4BL2A 3CNMA 2GU3A 2RGQA 1RKYA 2Z77A 3K9MC 2CHCA 3BU4A 3Q2PA 1T3BA 3LMLA 1YJ93 3MKIA 1S5AA 2SARA 3S67A 4OVMA 1YJN3 1YGEA 2HMLB 3FLJA 4JRFA 5EQLA 1GYBA 1DMQA 1OH0A 1B2UA 2HMNB 1UI8A 2ZHXB 2QA43 3JVCA 3KZTA 4FMBA 2YFLB 3PXMA 1DYUA 1QAKA 3WOFB 3WA2X 4J8TA 4ZM8A 4KFDA 1ISKA 3SYUA 2H0GA 1ULJB 2LYXA 5BVBA 3CXC2 3G0KA 1KSIA 1NDOB 4HM0B 2XSHB 2MC8A 5AIFA 1BSDA 1I2FA 3KFQC 5CF2A 1RGLA 4GB5A 1DVDA 1E3VA 4MEIA 4DKIA 1N5HA 3V99A 3D4AA 5RNTA 4WHAA 3B7CA 1B20A 3PCSA 5IW9A 1OF5B 1PYLA 1WQLB 1JZDA 2W04A 2WGQA 3D9RA 3LOYA 4BIRA 5AI1A 4K1UA 3OV4A 2QIYA 3CCR3 2HMMB 4N6TA 5ELUA 3Q90A 4J5GA 4KVHA 3FG1A 4O3VA 4XBTA 2JQ5A 4XBXA 1C7HA 3JUOA 5I97A 4N6V0 5IENA 1TRPA 4WYKB 1VQ63 1PY3A 1QALA 1AVKA 1I70A 4XDWA 2BIRA 1RTUA 1DETA 1Q864 4ILFA 1O7PB 3MSOA 2BU4A 4H3UA 1LQGC 2BNGA 2HMKB 1Q7HA 3MG2A 4HM1B 2CK3H 2FNQA 3CCM3 2IA7A 4RNTA 3Q1CA 1CYUA 4HM4B 3DUKA 4FCJA 3F8XA 3SLUA 1MWRA 1LRAA 1KWIA 2K0MA 4N6NB 1M904 1RGEA 5G2GA 1IV9A 1W5ZA 1BRGA 2CG0A 5LC6A 3EF8A 4I4KA 3F7XA 4IT7A 4O02B 1DMNA 1OGZA 3DGMA 3K5TA 4MMXB 1VQ43 5IG5A 1GD3A 5M18A 3I553 2BMOB 3DMCA 1GMQA 1UUWB 3CPW2 1BRIA 1GY7A 1BOXA 1M1XB 1YVSA 2CX0A 3KKGA 5KP3A 2KF3A 4RNYA 2H0HA 2K3DA
chains in the Genus database with same CATH topology
1BIRA 1GOUA 1HYFA 1I3FA 3WR2A 6GSPA 1BRSA 3BIRA 1RGHA 5BU4A 7RNTA 2F56A 1BRNL 1I8VA 1TRQA 1FYSA 1TTOA 3HOHA 1LOYA 3AHWA 3GSPA 1AQZA 1YNVX 5HOHA 1JBSA 2F5WA 1RGGA 3AGNA 1RDSA 1BSBA 1RMSA 1LOWA 3DGYA 1B2ZA 1BNSA 1I0VA 1BANA 1T2HA 1GOVA 1B2SA 3AGOA 3URPA 1MGRA 3BU4A 2AADA 1BSEA 1BNIA 1R4YA 1BU4A 4HAAA 5GSPA 1MGWA 1RGCA 4GSPA 2SARA 5BIRA 1C54A 1B2XA 1BUJA 1GMPA 1BNGA 1B2UA 1RNBA 4J5KA 2C4BA 1RHLA 2F4YA 1GMRA 1RGAA 1CH0A 3KCHA 4HOHA 1BRJA 1RLSA 1I2GA 1FW7A 1GOYA 3SYUA 1RGKA 1RGFA 1LNIA 1G02A 1B27A 1DE3A 1BNEA 1HZ1A 1RCKA 1I2EA 4GHOA 3WHOA 1T2IA 1X1WA 1YGWA 1ZGXA 1BSDA 1I2FA 1B3SA 3D5IA 1RGLA 1BRKA 1BVIA 1UCLA 2HOHA 1UCIA 2F5MA 1GSPA 3D4AA 1BRHA 5RNTA 1B20A 7GSPA 1RN4A 1B21A 1Q9EA 1X1YA 1PYLA 3Q3FA 4BIRA 1UCKA 1I3IA 1FUTA 3D5GA 4J5GA 3DH2A 1RSNA 1X1XA 1TRPA 3A5EA 2KF5A 1PY3A 1I70A 1FZUA 3AHSA 2BIRA 1BNJA 1RNTA 1RTUA 2KF4A 1DETA 2AAEA 1I0XA 2BU4A 1BSCA 1BNFA 1FUSA 1JBTA 2KAAA 1LOVA 1BGSA 4RNTA 1UCJA 1LRAA 9RNTA 1RGEA 1SARA 1IYYA 1RN1A 1BRGA 2GSPA 1BAOA 4BU4A 1JBRA 1X1UA 1AY7A 2RBIA 8RNTA 2ZA4A 2KF6A 1A2PA 1BSAA 1GMQA 3RNTA 1BRIA 1BOXA 1YVSA 1BNRA 2KF3A 6RNTA 1RCLA 1B2MA 2RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIR A;  1GOU A;  1HYF A;  1I3F A;  3WR2 A;  6GSP A;  1BRS A;  3BIR A;  1RGH A;  5BU4 A;  7RNT A;  2F56 A;  1BRN L;  1I8V A;  1TRQ A;  1FYS A;  1TTO A;  3HOH A;  1LOY A;  3AHW A;  3GSP A;  1AQZ A;  1YNV X;  5HOH A;  1JBS A;  2F5W A;  1RGG A;  3AGN A;  1RDS A;  1BSB A;  1RMS A;  1LOW A;  3DGY A;  1B2Z A;  1BNS A;  1I0V A;  1BAN A;  1T2H A;  1GOV A;  1B2S A;  3AGO A;  3URP A;  1MGR A;  3BU4 A;  2AAD A;  1BSE A;  1BNI A;  1R4Y A;  1BU4 A;  4HAA A;  5GSP A;  1MGW A;  1RGC A;  4GSP A;  2SAR A;  5BIR A;  1C54 A;  1B2X A;  1BUJ A;  1GMP A;  1BNG A;  1B2U A;  1RNB A;  4J5K A;  2C4B A;  1RHL A;  2F4Y A;  1GMR A;  1RGA A;  1CH0 A;  3KCH A;  4HOH A;  1BRJ A;  1RLS A;  1I2G A;  1FW7 A;  1GOY A;  3SYU A;  1RGK A;  1RGF A;  1LNI A;  1G02 A;  1B27 A;  1DE3 A;  1BNE A;  1HZ1 A;  1RCK A;  1I2E A;  4GHO A;  3WHO A;  1T2I A;  1X1W A;  1YGW A;  1ZGX A;  1BSD A;  1I2F A;  1B3S A;  3D5I A;  1RGL A;  1BRK A;  1BVI A;  1UCL A;  2HOH A;  1UCI A;  2F5M A;  1GSP A;  3D4A A;  1BRH A;  5RNT A;  1B20 A;  7GSP A;  1RN4 A;  1B21 A;  1Q9E A;  1X1Y A;  1PYL A;  3Q3F A;  4BIR A;  1UCK A;  1I3I A;  1FUT A;  3D5G A;  4J5G A;  3DH2 A;  1RSN A;  1X1X A;  1TRP A;  3A5E A;  2KF5 A;  1PY3 A;  1I70 A;  1FZU A;  3AHS A;  2BIR A;  1BNJ A;  1RNT A;  1RTU A;  2KF4 A;  1DET A;  2AAE A;  1I0X A;  2BU4 A;  1BSC A;  1BNF A;  1FUS A;  1JBT A;  2KAA A;  1LOV A;  1BGS A;  4RNT A;  1UCJ A;  1LRA A;  9RNT A;  1RGE A;  1SAR A;  1IYY A;  1RN1 A;  1BRG A;  2GSP A;  1BAO A;  4BU4 A;  1JBR A;  1X1U A;  1AY7 A;  2RBI A;  8RNT A;  2ZA4 A;  2KF6 A;  1A2P A;  1BSA A;  1GMQ A;  3RNT A;  1BRI A;  1BOX A;  1YVS A;  1BNR A;  2KF3 A;  6RNT A;  1RCL A;  1B2M A;  2RNT A; 
#chains in the Genus database with same CATH topology
 1IQ8 A;  3UNL A;  5JPP A;  2RSX A;  1BRS A;  2Z7A A;  3BIR A;  1RGH A;  1E3R A;  4N6O B;  1BRN L;  2WOF A;  3STD A;  4HM8 B;  4CPK A;  3X42 A;  2Z76 A;  1IT8 A;  5KP1 A;  3GZX B;  1LOY A;  3NM2 A;  1NJI 4;  3NBR A;  1N9E A;  1IVU A;  3EN1 B;  2ZDJ A;  3GZR A;  4L7K A;  3CU3 A;  1MOL A;  3ECF A;  3CC2 3;  1K9M 4;  1D6Z A;  3EB8 A;  3NBB A;  4R4K A;  2RFR A;  3EJV A;  3NHX A;  1GS3 A;  4EV5 A;  1ZS7 A;  4R80 A;  4FR9 A;  3F8H A;  3LT8 A;  3QRD A;  3X41 A;  1T2H A;  5TGN A;  1B2S A;  4BTY A;  3AGO A;  2GBX B;  3RDE A;  4AKY A;  5AEW B;  2XH9 A;  8CHO A;  3URP A;  1MGR A;  3FCS B;  5A0O B;  5IF6 A;  2CFW A;  1Z1S A;  2L4V A;  1BNI A;  4HZ9 B;  3CD6 3;  1R4Y A;  1RRL A;  4HKV B;  3EC9 A;  1OCV A;  4NPB A;  1NB3 I;  1RGC A;  1VZZ A;  4L8O A;  1U5O A;  4XDV A;  5CLK A;  5BIR A;  5AYR B;  1EEJ A;  4R1K A;  3MWZ A;  3JUN A;  5G1K A;  1HU9 A;  3CNX A;  4X2H A;  1AVL A;  5CK6 A;  1GY6 A;  3WA3 A;  2JDI H;  3FSD A;  2XF3 A;  1UGI A;  3SED A;  3A76 A;  4I5Q A;  1G96 A;  1NB5 I;  1RHL A;  3GWR A;  4N6L A;  1U8C B;  5BXQ A;  3JUQ A;  1GMR A;  4LSO A;  1CH0 A;  3HIG A;  3IJE B;  4PEJ A;  1RLS A;  5IG4 A;  1WTH A;  2R4I A;  3CC7 3;  1Q7Y 4;  1FW7 A;  3LTC A;  1RGK A;  4AEQ A;  3G8Z A;  2XGL A;  1J2B A;  1HZ1 A;  1O7N B;  3WHO A;  1QMA A;  4G1M B;  5AIG A;  1GY5 A;  1T2I A;  5CXO A;  1X1W A;  2RCD A;  3NUV A;  1ZGX A;  4WYK A;  3OX9 A;  5FGO A;  1B3S A;  3D5I A;  3G6E 3;  7STD A;  4ORL A;  1GSP A;  3WDG B;  1BRH A;  3GAX A;  3CCS 3;  3FF0 A;  2W9Q A;  1IK3 A;  1UUV B;  1RN4 A;  3FH1 A;  3MYT A;  3X40 A;  2CWU A;  3OW2 2;  3Q3F A;  1TIJ A;  4RZM A;  5DRV A;  1VQ9 3;  2OOV A;  1UCK A;  2P0X A;  3VGN A;  2W2C A;  1OGX A;  1X1X A;  3A5E A;  3WOE B;  4CDL A;  5AIH A;  3EE1 A;  3BNE A;  1SPU A;  5IG0 A;  3B8L A;  3SOA A;  1KC8 4;  3AHS A;  1JKG A;  1RNT A;  1JB4 A;  4LMI A;  1LQM B;  1DVC A;  1I0X A;  1N9J A;  3TDG A;  1V57 A;  1TP6 A;  1VQP 3;  3PZW A;  2KAA A;  2WGO A;  1LOV A;  4RNZ A;  3FF2 A;  1WMP A;  2W0Q A;  1ULI B;  1UCJ A;  1UGH I;  1JB5 A;  2W6J H;  1SAR A;  3EQQ B;  1RN1 A;  2PNC A;  2F86 B;  3EBT A;  2ML5 A;  2L1S A;  1W00 A;  4KFE A;  4STD A;  2BT3 A;  4OUQ A;  4K61 A;  2ZA4 A;  1LNH A;  1GD4 A;  4BTW A;  2KF6 A;  4J9A A;  2GEX A;  1JJ2 2;  2OTJ 3;  1O7G B;  3HII A;  3HZP A;  1OUN A;  2XRX B;  3HX8 A;  2CX1 A;  1GOU A;  2Z6B A;  1RN7 A;  3FZW A;  3L0R A;  2K54 A;  3PS8 A;  5DRE A;  3GZY B;  3WR2 A;  2IMJ A;  2Y74 A;  3G16 A;  6GSP A;  1W7C A;  3BNC A;  3LZA A;  3NXJ A;  1YI2 3;  1STD A;  3D3L A;  1MNL A;  1TTO A;  1FYS A;  2CKF B;  3KSE D;  2CWT A;  1IU7 A;  1Q40 A;  3MG1 A;  4XB5 A;  1FGM A;  1NU3 A;  2OOV C;  1JRQ A;  3RGA A;  1AQZ A;  3V98 A;  1RGG A;  2ZL8 A;  1RDS A;  1BSB A;  3AMO A;  4HM2 B;  3DGY A;  1JKG B;  1JZO A;  1VQK 3;  1Q81 4;  1NO3 A;  2WOH A;  3UL6 A;  2WO0 A;  1OHP A;  1T5Y A;  1V58 A;  2IUK A;  3K63 A;  2XFT A;  3T8N A;  4FMC A;  3DM8 A;  3EN8 A;  1WMN A;  1LXE A;  2CWV A;  5D82 A;  2H0I A;  2ML6 A;  1BU4 A;  5GSP A;  4IPB A;  1Y4K A;  3UB1 A;  4BTX A;  1STF I;  1B2X A;  1C54 A;  1ZX2 A;  3DZL A;  2GU1 A;  4AKZ A;  3CCV 3;  3FGY A;  4N6U A;  1A90 A;  1BUJ A;  1TU5 A;  1BNG A;  3F7S A;  1JB2 A;  2BMR B;  4H61 A;  1RNB A;  4J5K A;  2F98 A;  2O9U X;  1LVN A;  2C4B A;  5CF1 A;  1YIJ 3;  2F4Y A;  5IEP A;  2CFK A;  5AII A;  1VQL 3;  3G4S 3;  3KCH A;  4JF8 A;  2CFG A;  3CPO A;  4HOH A;  1VQN 3;  2QEX 3;  1D6U A;  2P38 A;  3CC4 3;  2P05 A;  1VQ8 3;  4RBN A;  3K7C A;  4CJN A;  1B27 A;  1LOX A;  3KSP A;  2W9P A;  1I2E A;  4GHO A;  4R9L A;  1DE3 A;  4EXR A;  1IQY A;  2Q07 A;  1YGW A;  1Q40 B;  2P09 A;  3X3X A;  2CG1 A;  3G71 3;  2F99 A;  3LT9 A;  1O7W B;  2D1W A;  1BRK A;  1OHO A;  2HOH A;  2INX A;  1UCI A;  2F5M A;  3OXA A;  4HZB B;  3UJM A;  3DY5 A;  1A67 A;  2P0M A;  2YFI B;  2E2U A;  2IY2 A;  3AMO B;  3IMA B;  4IIA A;  7GSP A;  1W02 A;  5KP4 A;  3NQZ A;  5AYS C;  1IT7 A;  2FGT A;  3F40 A;  1I3I A;  3N9H A;  3D5G A;  3I56 3;  3DH2 A;  3LXU X;  1SQW A;  1Q82 4;  2I9W A;  2E2T A;  3F14 A;  4HJL B;  2CC3 A;  3HI7 A;  4R9K A;  4O8S A;  2XR8 B;  1FZU A;  1W4N A;  5EEO A;  3ZFZ A;  2KF4 A;  3N54 B;  1FA3 A;  1VQQ A;  3MPH A;  5M1A A;  3SX1 A;  1BSC A;  3DGN A;  3NBJ A;  3WMD A;  1JBT A;  3OWU A;  1BGS A;  4LYL B;  1ASK A;  3BLZ A;  5ELJ A;  4MJD A;  1QVG 2;  3SOY A;  3LTB A;  2YX9 A;  4NRE A;  1IYY A;  3X3Y A;  1BAO A;  2E2V A;  4TX4 A;  1DMM A;  1X1U A;  2W03 A;  4HYZ A;  1AY7 A;  2UUG C;  4L8P A;  3X3Z A;  1D6Y A;  3OWY A;  3H3H A;  3QK9 A;  2RBI A;  1V74 A;  3ZG5 A;  1IVX A;  3CCU 3;  2FXT A;  1A2P A;  4HM6 B;  3J7Y d;  1FUW A;  1BNR A;  1TFO A;  2HMO B;  4XM4 A;  1VQ7 3;  3B4O A;  1US1 A;  3E99 A;  5IG3 A;  1YHQ 3;  2RNT A;  1B2M A;  1HYF A;  3GZB A;  4FCM A;  1AV4 A;  2M7O A;  1UDI I;  2F56 A;  1W2Z A;  3BND A;  3JUP A;  3OWS A;  5IEO A;  3WOD G;  1K8A 4;  1I8V A;  1K41 A;  4O2H A;  3ZG0 A;  1EQK A;  1QJG A;  2B24 B;  3AHW A;  3PGB A;  4HM7 B;  3S29 A;  3DGO A;  4WWU C;  5LC7 A;  1W6G A;  1YNV X;  1JBS A;  2F5W A;  5D81 A;  1BUQ A;  1A2V A;  4QWT A;  2OWP A;  1RMS A;  1LOW A;  6RNT A;  1B2Z A;  1O7M B;  4MMY B;  1PU4 A;  1G0T A;  3NX0 A;  1I0V A;  4K90 B;  4GL6 A;  5JPU A;  3UL5 A;  1GOV A;  1Q42 A;  2XEP A;  2PZV A;  4EYC A;  4LZI A;  1K73 4;  1OPY A;  1FGT A;  1BSE A;  2AAD A;  2V1L A;  2W56 B;  2Y73 A;  4N3V A;  4HAA A;  4Q53 A;  4KZ1 A;  3ROB A;  3CCL 3;  1MGW A;  1N5P A;  2UGI A;  4GSP A;  4EV2 A;  3H51 A;  3N8B A;  3KN4 A;  1IQX A;  1QVF 2;  1S72 3;  2IUJ A;  3LYG A;  3PCR A;  1KD1 4;  1GMP A;  1CYV A;  1UI7 A;  1W6Y A;  4HM3 B;  2SBL A;  1SII A;  4N6M A;  1WNH A;  2KRT A;  4X2O A;  3MG3 A;  1PFP A;  2LQV A;  1RGA A;  2KCD A;  4EC6 A;  2STD A;  1JN5 A;  1UUG B;  2BMQ B;  1BRJ A;  4CCV A;  1I2G A;  2C10 A;  3GRD A;  3RGR A;  1GOY A;  1L5G B;  1OAC A;  3D79 A;  1RGF A;  3K0Z A;  4MMZ B;  1LNI A;  3DGL A;  1G02 A;  1TJD A;  4NHF A;  1BNE A;  2OQE A;  1FGQ A;  1RCK A;  3T0U A;  2MF7 A;  4HM5 B;  3CMA 3;  1FGO A;  3KE7 A;  5D83 A;  3VF1 A;  2A15 A;  2UX0 A;  1BVI A;  1OHS A;  1M9G A;  1UCL A;  3CME 3;  1IVV A;  2KXG A;  1VQ5 3;  3EX9 A;  1SJW A;  3LH4 A;  3JUM A;  1SIH A;  1B21 A;  1Q9E A;  1X1Y A;  3NV0 A;  3MHE A;  4K1V A;  3EBY A;  2B1X B;  2GEY A;  5HGR A;  1MWT A;  3M8C A;  2CW9 A;  1RRH A;  4WP5 A;  4KFF A;  5AEU B;  3ER7 A;  1FUT A;  1UW1 A;  2XGN A;  2XFS A;  2OCT A;  2R41 A;  1A2K A;  1RSN A;  4U13 A;  1EKM A;  1K28 A;  1F8N A;  3V92 A;  2BHM A;  2KF5 A;  1CEW I;  1VQO 3;  1YJW 3;  2GBW B;  3FG3 A;  1BNJ A;  1AR0 A;  1IDP A;  1ROV A;  2AAE A;  4LEH A;  3F9S A;  1ZO2 A;  1RJO A;  2CH9 A;  4HBR A;  1BNF A;  1FUS A;  1W2B 2;  2CFD A;  1NWW A;  3PYJ A;  3IPT A;  3B4P A;  9RNT A;  3SVA A;  3NM7 A;  5JBS A;  5M19 A;  1EUI C;  1JN5 B;  1TFK A;  2GSP A;  1N8R 4;  4BU4 A;  1QAF A;  1JBR A;  4FMA A;  4KT3 B;  2XSO B;  3KII A;  4FMD A;  2D42 A;  2CIU A;  1JNQ A;  5EVH A;  3ALA A;  8RNT A;  3CCQ 3;  3S5C A;  1JV2 B;  2IYJ A;  2GXF A;  1O7H B;  1BSA A;  3RNT A;  1HKX A;  1CQS A;  1R4C A;  2OQE C;  3DXO A;  3I0Y A;  1NNV A;  1M1K 4;  3NQY A;  5STD A;  1RCL A;  1MWU A;  2HMJ B;  1IVW A;  1IV7 A;  1BIR A;  3U1W A;  4EBG A;  2OTL 3;  1ROA A;  1WMO A;  3LTA A;  3FKA A;  4XBY A;  3HK4 A;  1FGR A;  3FG4 A;  1I3F A;  4FCZ A;  1W01 A;  2QGU A;  1W6C A;  2C11 A;  1E97 A;  2CFL A;  3NV0 B;  5FW5 A;  5BU4 A;  3T8U A;  7RNT A;  3CCJ 3;  3S27 A;  1TRQ A;  3S28 A;  1N8Q A;  1MWS A;  2W56 A;  4LGQ A;  3HOH A;  3BNB A;  4BL3 A;  1YVB I;  2YFJ B;  3GSP A;  3LTD A;  3SXX A;  3O8Y A;  4HVN A;  4EW5 A;  4WFO A;  3VSY A;  3BB9 A;  5HOH A;  3AGN A;  2J8X B;  1YIT 3;  1KQS 2;  1EG9 B;  5IER A;  3CCE 3;  3U97 A;  2BO9 B;  1OF5 A;  2O3O A;  1TUH A;  5G1L A;  1BNS A;  3EHC A;  4OK0 A;  6STD A;  1EA2 A;  1BAN A;  1VQM 3;  4BL2 A;  3CNM A;  2GU3 A;  2RGQ A;  1RKY A;  2Z77 A;  3K9M C;  2CHC A;  3BU4 A;  3Q2P A;  1T3B A;  3LML A;  1YJ9 3;  3MKI A;  1S5A A;  2SAR A;  3S67 A;  4OVM A;  1YJN 3;  1YGE A;  2HML B;  3FLJ A;  4JRF A;  5EQL A;  1GYB A;  1DMQ A;  1OH0 A;  1B2U A;  2HMN B;  1UI8 A;  2ZHX B;  2QA4 3;  3JVC A;  3KZT A;  4FMB A;  2YFL B;  3PXM A;  1DYU A;  1QAK A;  3WOF B;  3WA2 X;  4J8T A;  4ZM8 A;  4KFD A;  1ISK A;  3SYU A;  2H0G A;  1ULJ B;  2LYX A;  5BVB A;  3CXC 2;  3G0K A;  1KSI A;  1NDO B;  4HM0 B;  2XSH B;  2MC8 A;  5AIF A;  1BSD A;  1I2F A;  3KFQ C;  5CF2 A;  1RGL A;  4GB5 A;  1DVD A;  1E3V A;  4MEI A;  4DKI A;  1N5H A;  3V99 A;  3D4A A;  5RNT A;  4WHA A;  3B7C A;  1B20 A;  3PCS A;  5IW9 A;  1OF5 B;  1PYL A;  1WQL B;  1JZD A;  2W04 A;  2WGQ A;  3D9R A;  3LOY A;  4BIR A;  5AI1 A;  4K1U A;  3OV4 A;  2QIY A;  3CCR 3;  2HMM B;  4N6T A;  5ELU A;  3Q90 A;  4J5G A;  4KVH A;  3FG1 A;  4O3V A;  4XBT A;  2JQ5 A;  4XBX A;  1C7H A;  3JUO A;  5I97 A;  4N6V 0;  5IEN A;  1TRP A;  4WYK B;  1VQ6 3;  1PY3 A;  1QAL A;  1AVK A;  1I70 A;  4XDW A;  2BIR A;  1RTU A;  1DET A;  1Q86 4;  4ILF A;  1O7P B;  3MSO A;  2BU4 A;  4H3U A;  1LQG C;  2BNG A;  2HMK B;  1Q7H A;  3MG2 A;  4HM1 B;  2CK3 H;  2FNQ A;  3CCM 3;  2IA7 A;  4RNT A;  3Q1C A;  1CYU A;  4HM4 B;  3DUK A;  4FCJ A;  3F8X A;  3SLU A;  1MWR A;  1LRA A;  1KWI A;  2K0M A;  4N6N B;  1M90 4;  1RGE A;  5G2G A;  1IV9 A;  1W5Z A;  1BRG A;  2CG0 A;  5LC6 A;  3EF8 A;  4I4K A;  3F7X A;  4IT7 A;  4O02 B;  1DMN A;  1OGZ A;  3DGM A;  3K5T A;  4MMX B;  1VQ4 3;  5IG5 A;  1GD3 A;  5M18 A;  3I55 3;  2BMO B;  3DMC A;  1GMQ A;  1UUW B;  3CPW 2;  1BRI A;  1GY7 A;  1BOX A;  1M1X B;  1YVS A;  2CX0 A;  3KKG A;  5KP3 A;  2KF3 A;  4RNY A;  2H0H A;  2K3D A; 
#chains in the Genus database with same CATH homology
 1BIR A;  1GOU A;  1HYF A;  1I3F A;  3WR2 A;  6GSP A;  1BRS A;  3BIR A;  1RGH A;  5BU4 A;  7RNT A;  2F56 A;  1BRN L;  1I8V A;  1TRQ A;  1FYS A;  1TTO A;  3HOH A;  1LOY A;  3AHW A;  3GSP A;  1AQZ A;  1YNV X;  5HOH A;  1JBS A;  2F5W A;  1RGG A;  3AGN A;  1RDS A;  1BSB A;  1RMS A;  1LOW A;  3DGY A;  1B2Z A;  1BNS A;  1I0V A;  1BAN A;  1T2H A;  1GOV A;  1B2S A;  3AGO A;  3URP A;  1MGR A;  3BU4 A;  2AAD A;  1BSE A;  1BNI A;  1R4Y A;  1BU4 A;  4HAA A;  5GSP A;  1MGW A;  1RGC A;  4GSP A;  2SAR A;  5BIR A;  1C54 A;  1B2X A;  1BUJ A;  1GMP A;  1BNG A;  1B2U A;  1RNB A;  4J5K A;  2C4B A;  1RHL A;  2F4Y A;  1GMR A;  1RGA A;  1CH0 A;  3KCH A;  4HOH A;  1BRJ A;  1RLS A;  1I2G A;  1FW7 A;  1GOY A;  3SYU A;  1RGK A;  1RGF A;  1LNI A;  1G02 A;  1B27 A;  1DE3 A;  1BNE A;  1HZ1 A;  1RCK A;  1I2E A;  4GHO A;  3WHO A;  1T2I A;  1X1W A;  1YGW A;  1ZGX A;  1BSD A;  1I2F A;  1B3S A;  3D5I A;  1RGL A;  1BRK A;  1BVI A;  1UCL A;  2HOH A;  1UCI A;  2F5M A;  1GSP A;  3D4A A;  1BRH A;  5RNT A;  1B20 A;  7GSP A;  1RN4 A;  1B21 A;  1Q9E A;  1X1Y A;  1PYL A;  3Q3F A;  4BIR A;  1UCK A;  1I3I A;  1FUT A;  3D5G A;  4J5G A;  3DH2 A;  1RSN A;  1X1X A;  1TRP A;  3A5E A;  2KF5 A;  1PY3 A;  1I70 A;  1FZU A;  3AHS A;  2BIR A;  1BNJ A;  1RNT A;  1RTU A;  2KF4 A;  1DET A;  2AAE A;  1I0X A;  2BU4 A;  1BSC A;  1BNF A;  1FUS A;  1JBT A;  2KAA A;  1LOV A;  1BGS A;  4RNT A;  1UCJ A;  1LRA A;  9RNT A;  1RGE A;  1SAR A;  1IYY A;  1RN1 A;  1BRG A;  2GSP A;  1BAO A;  4BU4 A;  1JBR A;  1X1U A;  1AY7 A;  2RBI A;  8RNT A;  2ZA4 A;  2KF6 A;  1A2P A;  1BSA A;  1GMQ A;  3RNT A;  1BRI A;  1BOX A;  1YVS A;  1BNR A;  2KF3 A;  6RNT A;  1RCL A;  1B2M A;  2RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...