1IV7A

Crystal structure of single chain monellin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Monellin
publication title The Effect of Single Chain Derivatization on the Structure and Stability of the Monellin
rcsb
source organism Dioscoreophyllum cumminsii
total genus 19
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1iv7A00
3KSED 1LXEA 3GAXA 3UL6A 1RN7A 5ELJA 1A67A 1FA3A 4LZIA 5A0OB 3KFQC 1MOLA 1NB5I 3PS8A 1IV9A 1DVCA 1YVBI 1GD4A 3S67A 1N5PA 1IV7A 3PXMA 1N5HA 3QRDA 4TX4A 1G96A 1KWIA 1PFPA 3SVAA 4N6MA 3K9MC 4N6UA 4N6NB 4CCVA 1MNLA 4N6TA 1M9GA 2W9QA 5ELUA 1FUWA 1CYVA 1CEWI 3MWZA 2CH9A 5LC7A 3IMAB 2BO9B 1A90A 2O9UX 3NX0A 2W9PA 4EYCA 4IT7A 2OCTA 4N6V0 1GD3A 1R4CA 3L0RA 1N9JA 3LH4A 5LC6A 3Q2PA 1ROAA 3PYJA 1NB3I 1TIJA 2KXGA 4N6OB 1DVDA 1CYUA 4N6LA 4ZM8A 1EQKA 5EQLA 1WNHA 3UL5A 1STFI
chains in the Genus database with same CATH superfamily
3IPTA 1OUNA 3URPA 3UL6A 5G1KA 1Q40A 5CK6A 3EJVA 4ORLA 3FCSB 2C11A 3UB1A 5BVBA 1AVLA 2CFLA 3UNLA 1FA3A 4FMDA 3CCJ3 1VQO3 4WYKA 3X41A 1BGSA 3OWSA 2WGQA 3KFQC 4MEIA 3UJMA 3KZTA 1BSDA 1LRAA 5BXQA 1IV9A 3DH2A 1JNQA 1QAKA 1GMQA 2INXA 3GZBA 3CC73 4I5QA 1JBSA 5KP4A 3K0ZA 1B2SA 3FF0A 3WR2A 4BTYA 1IV7A 5BU4A 1RTUA 1A2PA 2Z76A 9RNTA 3IJEB 1AVKA 1BSAA 2CX1A 1W01A 3EF8A 2GBWB 3DUKA 1W5ZA 3PXMA 1N5HA 1UUVB 5M1AA 2F98A 3CNMA 3NXJA 4H3UA 3NQZA 2XGLA 4PEJA 1O7PB 4HOHA 4RBNA 1PYLA 1IVVA 2ZL8A 1MWRA 1KWIA 3PGBA 2PNCA 3SVAA 3KE7A 4KVHA 5CXOA 3CCV3 1YJ93 2QGUA 4N6MA 1Q824 3K9MC 5AIIA 1VZZA 2Z7AA 3NBJA 1Q9EA 3MSOA 4N6NB 3ROBA 1MNLA 1BUJA 4HVNA 1I70A 1BSEA 1SIIA 2W9QA 3G0KA 4FMAA 4OUQA 1AY7A 4Q53A 1OGXA 1RMSA 4K90B 1FUWA 3WOFB 1T2IA 2AAEA 3K63A 2CHCA 1ROVA 5KP1A 1U8CB 1OPYA 3AGOA 3NM7A 1V74A 1ZX2A 3DM8A 4K61A 4OVMA 4BL2A 2CH9A 3GZYB 3MG2A 1AV4A 3F7SA 4N3VA 2OTJ3 2IUKA 1BRKA 3MG3A 3ECFA 3FLJA 1B2ZA 4HZBB 4O02B 4R1KA 3NBBA 1LOVA 3D79A 4IPBA 2BO9B 4HM2B 1VQ43 2IY2A 3EX9A 1RKYA 4HYZA 3G713 2J8XB 1U5OA 3EN1B 5IG3A 5EEOA 1WMOA 1BAOA 2Z6BA 3OWUA 4HM6B 4J9AA 1GD3A 1GOUA 4O2HA 3Q1CA 3STDA 4MJDA 1BNIA 2FXTA 2BT3A 5DRVA 4AEQA 2Z77A 2WOHA 2OQEC 2W2CA 1X1YA 3BNCA 1EUIC 3LH4A 5LC6A 2F86B 2I9WA 3N9HA 3LTAA 4XBXA 3X3YA 3PYJA 1BIRA 2W0QA 1C54A 2QIYA 1BRIA 3KIIA 1FGTA 3D5IA 3T8NA 4HM3B 1ULIB 3CME3 1BUQA 1O7NB 1VQQA 2JQ5A 2KXGA 2W03A 3PCSA 4N6OB 4J8TA 1YGWA 1RRLA 3FSDA 2HMLB 4JRFA 5IEOA 4O3VA 1N8R4 1UUGB 1OACA 1VQ73 2WGOA 3D4AA 4HM8B 4L8PA 3O8YA 2Y73A 3EBTA 3H51A 2UGIA 3OV4A 3OXAA 1TRQA 3UL5A 3X40A 5IF6A 4LZIA 3GZRA 4HBRA 7GSPA 3KSED 3GAXA 3FG1A 1VQ83 3D5GA 4WP5A 2KCDA 5FW5A 1BU4A 2GU1A 4KFEA 1W00A 4WHAA 2STDA 3Q3FA 3DGLA 4HM4B 3SYUA 1RNBA 1HZ1A 1UUWB 3BIRA 1A67A 1IVWA 5AYRB 2KF4A 2P0XA 3NHXA 6GSPA 1WMNA 1TU5A 1Q7Y4 1B2MA 1SIHA 3G4S3 3BNEA 3F7XA 4NREA 1G02A 1NB5I 3EHCA 1IQ8A 3PS8A 3S5CA 1YVBI 3A5EA 3FG4A 3K5TA 4NHFA 2L1SA 4R9LA 1K734 5GSPA 3WHOA 3NQYA 1US1A 1E97A 1D6YA 1PY3A 3F14A 2RGQA 5IEPA 1EG9B 1W6YA 1A2VA 1YVSA 1IT8A 2KF3A 3VF1A 1CH0A 4GL6A 1YIT3 2OOVA 4HKVB 1B21A 5IENA 1L5GB 1RCKA 1FUTA 3F8XA 4KT3B 1EA2A 4R9KA 4XBTA 1TTOA 1JN5B 2C4BA 2RFRA 4GHOA 1YHQ3 1UDII 3EQQB 1T2HA 3NBRA 1QVF2 1Q7HA 1KC84 1MGWA 4RZMA 2RCDA 3WODG 1FYSA 3WA3A 3AGNA 4NPBA 4HM7B 1V58A 1OHSA 1OHPA 4XDVA 5AEWB 5EVHA 1O7WB 2BMRB 3VSYA 1MWUA 2YFLB 1BRSA 2E2UA 2V1LA 1IDPA 4HJLB 1QVG2 3CD63 1I8VA 1Q40B 3CPW2 3HOHA 1ZGXA 1PU4A 3FG3A 3QK9A 1BOXA 1O7GB 1G0TA 4LSOA 2GBXB 3MHEA 1VQP3 1JZOA 2HMNB 1GMRA 2P0MA 3FF2A 3GZXB 4WYKB 1KQS2 3JUQA 2K0MA 1JB4A 1NO3A 2CC3A 2KF5A 3BU4A 2QA43 3EN8A 3BNBA 1IQXA 4CJNA 1JB2A 1W4NA 3DGOA 3PZWA 1IYYA 2O9UX 1RGKA 2W9PA 3OX9A 1E3VA 5IG4A 2CFGA 3B4OA 3EC9A 1JKGA 4OK0A 5JBSA 2OCTA 2IA7A 2GSPA 3JUOA 3X3XA 4CPKA 3NV0A 1NJI4 3KN4A 1IT7A 4N6V0 2YX9A 1YI23 3HX8A 5HGRA 1R4CA 5HOHA 1KD14 1JV2B 1YNVX 3KKGA 1B2UA 1VQ53 2K3DA 2P38A 3EB8A 3NUVA 2F5MA 5RNTA 2CWUA 2CWVA 4AKYA 3LZAA 1BVIA 1MWSA 2UUGC 5DREA 1RDSA 2CX0A 2XFSA 1DETA 3SOYA 1IVUA 1LOWA 1TIJA 1EEJA 3RDEA 3N8BA 1OHOA 4G1MB 1BNGA 1YJW3 5G1LA 1I2FA 4EXRA 1K9M4 4N6LA 1RN1A 3JUPA 1JKGB 4HAAA 4DKIA 1YGEA 2CK3H 1S723 2E2VA 1IVXA 4STDA 1ULJB 1FZUA 2HMOB 4L8OA 3TDGA 1FGRA 4BTWA 1I2GA 3OW22 3G6E3 3CCR3 1AQZA 2OWPA 1Q864 1RN7A 4L7KA 4XDWA 1OH0A 1DMQA 3CPOA 5ELJA 3GSPA 1NNVA 2JDIH 3U97A 1Q42A 2SBLA 2PZVA 1OF5A 1WMPA 2XH9A 4XBYA 5A0OB 1D6UA 1OCVA 5STDA 3JVCA 1TFKA 1DMNA 2IMJA 2XFTA 1M1K4 1DVCA 2K54A 2WOFA 1I3FA 3V98A 2XSOB 3JUNA 2W6JH 4HZ9B 2XF3A 1VQ93 2OTL3 1JBRA 1J2BA 2XRXB 3CU3A 1JJ22 3D9RA 1N5PA 1TUHA 1UCLA 3MKIA 4I4KA 3S67A 5CF1A 3CCQ3 3SLUA 1TFOA 2ML5A 5AIHA 1RGGA 1SARA 1JRQA 3EBYA 1C7HA 1RGFA 3AMOA 4U13A 1UCIA 3DGMA 5JPUA 3PCRA 1N9EA 3LYGA 1GSPA 2CKFB 3FZWA 5D83A 4R4KA 4RNZA 1BNFA 5AEUB 1Y4KA 2XR8B 2HOHA 2H0IA 4MMZB 2R41A 4FMBA 2XGNA 1BNSA 3I563 1BRNL 1T5YA 1I3IA 3SX1A 4CCVA 1RGCA 1B2XA 3MPHA 4N6TA 4JF8A 4EBGA 4EC6A 2KF6A 5IG5A 3GWRA 5ELUA 4J5GA 1Q814 3DGYA 1IQYA 3DXOA 3SOAA 3X3ZA 5D81A 2P05A 3MG1A 6STDA 1RJOA 2IYJA 3B8LA 3WA2X 4BL3A 3BNDA 1CQSA 1W6GA 1BSBA 3B7CA 1TRPA 2ZHXB 3LMLA 3LTCA 5LC7A 1UCJA 1X1XA 1NU3A 2B24B 3ER7A 3ALAA 3H3HA 3NX0A 4IIAA 4EYCA 2M7OA 3CCM3 2BU4A 3A76A 1ISKA 1UGIA 4IT7A 1LVNA 1B3SA 1O7HB 3HIIA 2MF7A 2ML6A 4BU4A 4ILFA 5CLKA 5M18A 1VQ63 3I553 1W2B2 2C10A 3LT9A 2W04A 1ZS7A 3E99A 4H61A 3BB9A 3T0UA 3L0RA 3Q90A 3RNTA 4EW5A 2HMMB 1N9JA 1NDOB 1LQMB 3U1WA 1LNHA 2F5WA 4BIRA 3Q2PA 2D42A 3KCHA 8RNTA 1VQK3 1GS3A 1UCKA 1B20A 3DY5A 2YFIB 1HKXA 3G8ZA 2OQEA 1VQM3 3D3LA 1FGOA 1NB3I 5AIGA 5BIRA 1DVDA 1YIJ3 1RGLA 2P09A 1CYUA 5IERA 1IK3A 3S29A 4ZM8A 3CCL3 3S27A 3CC43 1HYFA 2BMQB 1GMPA 1T3BA 5EQLA 1JZDA 2H0HA 3ZG5A 1WTHA 3S28A 3WOEB 2F4YA 3KSPA 2CG1A 2HMKB 1V57A 3F8HA 3DZLA 5D82A 2BHMA 3GRDA 4RNTA 4R80A 4BTXA 2A15A 1LXEA 4K1VA 1BNRA 3HK4A 2L4VA 1N8QA 4MMYB 2QEX3 1I2EA 1FGQA 1LNIA 2F99A 1E3RA 2WO0A 2YFJB 2ZDJA 3F40A 1I0VA 3JUMA 2RBIA 5TGNA 3T8UA 1M904 3SXXA 3X42A 1GY5A 2R4IA 1ZO2A 5FGOA 2E2TA 1RNTA 3FH1A 4XB5A 3DMCA 1DMMA 3F9SA 1SJWA 1B27A 3B4PA 3FKAA 4O8SA 4LYLB 2MC8A 1W2ZA 2RNTA 4FMCA 1MOLA 1RLSA 1F8NA 1BRJA 5G2GA 1RRHA 2GEXA 4EV2A 1LOXA 2D1WA 2CWTA 3FGYA 1X1UA 7RNTA 2Y74A 4FCMA 1GD4A 2GEYA 2CIUA 2CW9A 2BIRA 2IUJA 3NV0B 1GOYA 3OWYA 3MYTA 3EE1A 1FGMA 1DE3A 1BRGA 1SQWA 2H0GA 2CFDA 1OGZA 2OOVC 2RSXA 3CCE3 1UI8A 1KSIA 1O7MB 1SPUA 1VQL3 3HIGA 3ZFZA 3I0YA 5AYSC 3V99A 3J7Yd 1EKMA 1GYBA 3ZG0A 5KP3A 4HM0B 2KAAA 1DYUA 2GXFA 2HMJB 1K8A4 4LEHA 3CNXA 3QRDA 1BSCA 1TP6A 4TX4A 4X2HA 1UGHI 4K1UA 3CMA3 1W6CA 3M8CA 1RGAA 3G16A 1RGHA 4LGQA 1G96A 2W56A 2FGTA 2XEPA 1BNEA 1WQLB 1PFPA 3BLZA 1FW7A 4WWUC 1AR0A 4FCZA 1S5AA 3HI7A 2CFKA 1JBTA 1QAFA 4GB5A 3LT8A 4N6UA 4KZ1A 1GY7A 3SEDA 5AI1A 1BANA 1M9GA 3CC23 1ASKA 2UX0A 4FCJA 3CCS3 2GU3A 2KRTA 4WFOA 1MWTA 1TJDA 1CYVA 3VGNA 1RN4A 3AHSA 3RGAA 5M19A 2F56A 1CEWI 3NM2A 3CCU3 1LOYA 1OF5B 2XSHB 1D6ZA 3MWZA 4AKZA 2SARA 2B1XB 1K41A 2W56B 4GSPA 5IG0A 1LQGC 4RNYA 2Q07A 1RCLA 1QALA 1JB5A 1W7CA 1MGRA 2CG0A 2O3OA 8CHOA 3IMAB 2FNQA 1Z1SA 6RNTA 4HM1B 1A90A 4KFFA 1M1XB 1QJGA 2BMOB 3WDGB 3V92A 4HM5B 5AIFA 1YJN3 3CXC2 3LTBA 3LTDA 1VQN3 7STDA 1NWWA 3HZPA 4LMIA 2LQVA 3LXUX 2CFWA 4EV5A 3AMOB 3WMDA 1RHLA 4MMXB 4QWTA 1FUSA 1R4YA 1BRHA 1ROAA 1STFI 3AHWA 1UW1A 1HU9A 2BNGA 1I0XA 5JPPA 1RGEA 1JN5A 3RGRA 5IW9A 1X1WA 1GY6A 1UI7A 4FR9A 1RSNA 1GOVA 1STDA 1BNJA 4J5KA 4CDLA 2ZA4A 3N54B 5CF2A 1EQKA 4KFDA 2AADA 1K28A 4XM4A 5I97A 3LOYA 4X2OA 1QMAA 1IU7A 3DGNA 1WNHA 1A2KA 1W02A 3K7CA 2LYXA
chains in the Genus database with same CATH topology
3IPTA 1OUNA 3UL6A 1Q40A 5CK6A 3EJVA 4ORLA 3FCSB 2C11A 3UB1A 5BVBA 1AVLA 2CFLA 3UNLA 1FA3A 4FMDA 3CCJ3 1VQO3 4WYKA 3X41A 3OWSA 2WGQA 3KFQC 4MEIA 3UJMA 3KZTA 5BXQA 1IV9A 1JNQA 1QAKA 2INXA 3GZBA 3CC73 5KP4A 3K0ZA 3FF0A 4BTYA 1IV7A 2Z76A 3IJEB 1AVKA 1W01A 3EF8A 2GBWB 3DUKA 1W5ZA 3PXMA 1N5HA 1UUVB 2F98A 3CNMA 3NXJA 4H3UA 3NQZA 2XGLA 4PEJA 1O7PB 4RBNA 1IVVA 2ZL8A 1KWIA 3PGBA 2PNCA 3SVAA 3KE7A 4KVHA 5CXOA 3CCV3 1YJ93 2QGUA 4N6MA 1Q824 3K9MC 5AIIA 1VZZA 2Z7AA 3NBJA 3MSOA 4N6NB 3ROBA 1MNLA 4HVNA 1SIIA 2W9QA 3G0KA 4FMAA 4OUQA 4Q53A 1OGXA 4K90B 1FUWA 3WOFB 3K63A 2CHCA 1ROVA 5KP1A 1U8CB 1OPYA 3NM7A 1V74A 1ZX2A 3DM8A 4K61A 4OVMA 2CH9A 3GZYB 3MG2A 1AV4A 3F7SA 4N3VA 2OTJ3 2IUKA 3MG3A 4O02B 3ECFA 3FLJA 4HZBB 4R1KA 3NBBA 4IPBA 2BO9B 4HM2B 1VQ43 3EX9A 1RKYA 4HYZA 3G713 1U5OA 3EN1B 5IG3A 5EEOA 1WMOA 2Z6BA 3OWUA 4HM6B 4J9AA 1GD3A 4O2HA 3Q1CA 3STDA 4MJDA 2FXTA 2BT3A 5DRVA 4AEQA 2Z77A 2WOHA 2OQEC 2W2CA 3BNCA 3LH4A 5LC6A 3X3YA 2F86B 2I9WA 3N9HA 3LTAA 4XBXA 3PYJA 2W0QA 2QIYA 3KIIA 1FGTA 3T8NA 4HM3B 1ULIB 3CME3 1BUQA 1O7NB 2JQ5A 2KXGA 2W03A 3PCSA 4N6OB 4J8TA 1RRLA 3FSDA 2HMLB 4JRFA 5IEOA 4O3VA 1N8R4 1OACA 1VQ73 2WGOA 4HM8B 4L8PA 3O8YA 2Y73A 3EBTA 3H51A 3OXAA 3OV4A 3UL5A 3X40A 5IF6A 4LZIA 3GZRA 4HBRA 3KSED 3GAXA 3FG1A 1VQ83 4WP5A 2KCDA 5FW5A 2GU1A 4KFEA 1W00A 4WHAA 2STDA 3DGLA 4HM4B 1UUWB 1A67A 1IVWA 5AYRB 2P0XA 3NHXA 1WMNA 1TU5A 1Q7Y4 1SIHA 3G4S3 3BNEA 3F7XA 4NREA 1NB5I 3EHCA 1IQ8A 3PS8A 3S5CA 1YVBI 3FG4A 3K5TA 4NHFA 4R9LA 1K734 3NQYA 1US1A 1E97A 1D6YA 3F14A 2RGQA 5IEPA 1EG9B 1W6YA 1A2VA 1IT8A 3VF1A 4GL6A 1YIT3 2OOVA 4HKVB 5IENA 1L5GB 3F8XA 1EA2A 4R9KA 4XBTA 1JN5B 1YHQ3 2RFRA 3EQQB 3NBRA 1QVF2 1KC84 4RZMA 2RCDA 3WODG 3WA3A 4HM7B 1OHSA 1OHPA 4XDVA 5AEWB 5EVHA 1O7WB 2BMRB 3VSYA 2YFLB 2E2UA 2V1LA 1IDPA 4HJLB 1QVG2 3CD63 1Q40B 3CPW2 1PU4A 3FG3A 3QK9A 1O7GB 4LSOA 2GBXB 3MHEA 1VQP3 2HMNB 2P0MA 3FF2A 3GZXB 4WYKB 3JUQA 2K0MA 1JB4A 1NO3A 2CC3A 2QA43 3EN8A 3BNBA 1IQXA 1JB2A 1W4NA 3DGOA 3PZWA 2O9UX 2W9PA 3OX9A 1E3VA 5IG4A 2CFGA 3B4OA 3EC9A 1JKGA 4OK0A 5JBSA 2OCTA 2IA7A 3JUOA 3X3XA 3NV0A 1NJI4 3KN4A 1IT7A 4N6V0 2YX9A 1YI23 3HX8A 5HGRA 1R4CA 1KD14 1JV2B 3KKGA 1VQ53 2P38A 3EB8A 3NUVA 2CWUA 2CWVA 4AKYA 3LZAA 5DREA 2XFSA 3SOYA 1IVUA 1TIJA 3RDEA 3N8BA 1OHOA 4G1MB 1YJW3 1K9M4 4EXRA 4N6LA 3JUPA 1JKGB 1YGEA 2CK3H 1S723 2E2VA 1IVXA 4STDA 1ULJB 2HMOB 4L8OA 3TDGA 4BTWA 1FGRA 3OW22 3G6E3 3CCR3 2OWPA 1Q864 1RN7A 4L7KA 4XDWA 1OH0A 1DMQA 3CPOA 5ELJA 2JDIH 3U97A 1Q42A 2SBLA 2PZVA 1OF5A 1WMPA 2XH9A 4XBYA 5A0OB 1D6UA 1OCVA 5STDA 3JVCA 1TFKA 1DMNA 2IMJA 2XFTA 1M1K4 1DVCA 2K54A 2WOFA 3V98A 2XSOB 3JUNA 2W6JH 4HZ9B 2XF3A 1VQ93 2OTL3 1J2BA 2XRXB 3CU3A 1JJ22 3D9RA 1N5PA 1TUHA 3MKIA 4I4KA 3S67A 5CF1A 3CCQ3 3SLUA 1TFOA 2ML5A 5AIHA 3EBYA 1JRQA 1C7HA 3AMOA 4U13A 3DGMA 5JPUA 3PCRA 1N9EA 3LYGA 2CKFB 3FZWA 5D83A 4R4KA 4RNZA 5AEUB 1Y4KA 2XR8B 4MMZB 4FMBA 2XGNA 3I563 1T5YA 3SX1A 4CCVA 3MPHA 4N6TA 4JF8A 4EBGA 4EC6A 5IG5A 3GWRA 5ELUA 1Q814 3SOAA 1IQYA 3DXOA 3X3ZA 5D81A 2P05A 3MG1A 6STDA 1RJOA 3B8LA 3WA2X 3BNDA 1CQSA 1W6GA 3B7CA 3LMLA 3LTCA 5LC7A 1NU3A 2B24B 3ER7A 3ALAA 3H3HA 3NX0A 4IIAA 4EYCA 2M7OA 3CCM3 3A76A 1ISKA 4IT7A 1LVNA 1O7HB 3HIIA 2MF7A 2ML6A 5CLKA 1VQ63 3I553 1W2B2 2C10A 3LT9A 2W04A 3E99A 4H61A 3BB9A 3T0UA 3L0RA 3Q90A 2HMMB 1N9JA 1NDOB 3U1WA 1LNHA 3Q2PA 2D42A 1VQK3 1GS3A 3DY5A 2YFIB 1HKXA 3G8ZA 2OQEA 1VQM3 3D3LA 1FGOA 1NB3I 5AIGA 1DVDA 1YIJ3 2P09A 1CYUA 5IERA 1IK3A 3S29A 4ZM8A 3CCL3 3S27A 3CC43 2BMQB 5EQLA 1WTHA 3S28A 3WOEB 3KSPA 2CG1A 1KQS2 2HMKB 3F8HA 3DZLA 5D82A 2BHMA 3GRDA 4BTXA 4R80A 2A15A 1LXEA 4K1VA 3HK4A 2L4VA 1N8QA 4MMYB 2QEX3 2F99A 1FGQA 2YFJB 2WO0A 1E3RA 3F40A 3JUMA 2ZDJA 4HM5B 3T8UA 1M904 5TGNA 3SXXA 3X42A 1GY5A 2R4IA 1ZO2A 5FGOA 2E2TA 3FH1A 4XB5A 3DMCA 1DMMA 3F9SA 1SJWA 3B4PA 3FKAA 4O8SA 2MC8A 1W2ZA 4FMCA 1MOLA 1F8NA 5G2GA 1RRHA 2GEXA 4EV2A 1LOXA 2D1WA 2CWTA 3FGYA 2Y74A 4FCMA 1GD4A 2GEYA 2CIUA 2CW9A 2IUJA 3NV0B 3OWYA 3MYTA 3EE1A 1FGMA 1SQWA 2OOVC 2CFDA 1OGZA 3CCE3 2RSXA 1UI8A 1KSIA 1O7MB 1SPUA 1VQL3 3HIGA 3I0YA 5AYSC 3V99A 3J7Yd 1EKMA 1GYBA 1K8A4 5KP3A 4HM0B 1DYUA 2GXFA 2HMJB 4LEHA 3CNXA 3QRDA 4X2HA 1TP6A 4TX4A 3CMA3 4K1UA 1W6CA 3M8CA 3G16A 4LGQA 1G96A 2W56A 2FGTA 2XEPA 1WQLB 1PFPA 3BLZA 4WWUC 1AR0A 4FCZA 1S5AA 3HI7A 2CFKA 1QAFA 4GB5A 3LT8A 4N6UA 4KZ1A 1GY7A 3SEDA 5AI1A 3CC23 1M9GA 1ASKA 2UX0A 4FCJA 3CCS3 2GU3A 2KRTA 4WFOA 1CYVA 3VGNA 3RGAA 1CEWI 3NM2A 3CCU3 1OF5B 2XSHB 1D6ZA 3MWZA 4AKZA 2B1XB 1K41A 2W56B 5IG0A 4RNYA 2Q07A 1QALA 1JB5A 1W7CA 8CHOA 2CG0A 2O3OA 3IMAB 2FNQA 1Z1SA 4HM1B 1A90A 4KFFA 1M1XB 1QJGA 2BMOB 3WDGB 3V92A 5AIFA 1YJN3 3CXC2 3LTBA 3LTDA 1VQN3 7STDA 1NWWA 3HZPA 4LMIA 2LQVA 3LXUX 2CFWA 4EV5A 3AMOB 3WMDA 4MMXB 4QWTA 1ROAA 1STFI 1UW1A 1HU9A 2BNGA 5JPPA 1JN5A 3RGRA 5IW9A 1GY6A 1UI7A 4FR9A 1STDA 4CDLA 3N54B 5CF2A 1EQKA 4KFDA 4XM4A 1K28A 5I97A 3LOYA 4X2OA 1QMAA 1IU7A 3DGNA 1WNHA 1A2KA 1W02A 3K7CA 2LYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSE D;  1LXE A;  3GAX A;  3UL6 A;  1RN7 A;  5ELJ A;  1A67 A;  1FA3 A;  4LZI A;  5A0O B;  3KFQ C;  1MOL A;  1NB5 I;  3PS8 A;  1IV9 A;  1DVC A;  1YVB I;  1GD4 A;  3S67 A;  1N5P A;  1IV7 A;  3PXM A;  1N5H A;  3QRD A;  4TX4 A;  1G96 A;  1KWI A;  1PFP A;  3SVA A;  4N6M A;  3K9M C;  4N6U A;  4N6N B;  4CCV A;  1MNL A;  4N6T A;  1M9G A;  2W9Q A;  5ELU A;  1FUW A;  1CYV A;  1CEW I;  3MWZ A;  2CH9 A;  5LC7 A;  3IMA B;  2BO9 B;  1A90 A;  2O9U X;  3NX0 A;  2W9P A;  4EYC A;  4IT7 A;  2OCT A;  4N6V 0;  1GD3 A;  1R4C A;  3L0R A;  1N9J A;  3LH4 A;  5LC6 A;  3Q2P A;  1ROA A;  3PYJ A;  1NB3 I;  1TIJ A;  2KXG A;  4N6O B;  1DVD A;  1CYU A;  4N6L A;  4ZM8 A;  1EQK A;  5EQL A;  1WNH A;  3UL5 A;  1STF I; 
#chains in the Genus database with same CATH topology
 3IPT A;  1OUN A;  3URP A;  3UL6 A;  5G1K A;  1Q40 A;  5CK6 A;  3EJV A;  4ORL A;  3FCS B;  2C11 A;  3UB1 A;  5BVB A;  1AVL A;  2CFL A;  3UNL A;  1FA3 A;  4FMD A;  3CCJ 3;  1VQO 3;  4WYK A;  3X41 A;  1BGS A;  3OWS A;  2WGQ A;  3KFQ C;  4MEI A;  3UJM A;  3KZT A;  1BSD A;  1LRA A;  5BXQ A;  1IV9 A;  3DH2 A;  1JNQ A;  1QAK A;  1GMQ A;  2INX A;  3GZB A;  3CC7 3;  4I5Q A;  1JBS A;  5KP4 A;  3K0Z A;  1B2S A;  3FF0 A;  3WR2 A;  4BTY A;  1IV7 A;  5BU4 A;  1RTU A;  1A2P A;  2Z76 A;  9RNT A;  3IJE B;  1AVK A;  1BSA A;  2CX1 A;  1W01 A;  3EF8 A;  2GBW B;  3DUK A;  1W5Z A;  3PXM A;  1N5H A;  1UUV B;  5M1A A;  2F98 A;  3CNM A;  3NXJ A;  4H3U A;  3NQZ A;  2XGL A;  4PEJ A;  1O7P B;  4HOH A;  4RBN A;  1PYL A;  1IVV A;  2ZL8 A;  1MWR A;  1KWI A;  3PGB A;  2PNC A;  3SVA A;  3KE7 A;  4KVH A;  5CXO A;  3CCV 3;  1YJ9 3;  2QGU A;  4N6M A;  1Q82 4;  3K9M C;  5AII A;  1VZZ A;  2Z7A A;  3NBJ A;  1Q9E A;  3MSO A;  4N6N B;  3ROB A;  1MNL A;  1BUJ A;  4HVN A;  1I70 A;  1BSE A;  1SII A;  2W9Q A;  3G0K A;  4FMA A;  4OUQ A;  1AY7 A;  4Q53 A;  1OGX A;  1RMS A;  4K90 B;  1FUW A;  3WOF B;  1T2I A;  2AAE A;  3K63 A;  2CHC A;  1ROV A;  5KP1 A;  1U8C B;  1OPY A;  3AGO A;  3NM7 A;  1V74 A;  1ZX2 A;  3DM8 A;  4K61 A;  4OVM A;  4BL2 A;  2CH9 A;  3GZY B;  3MG2 A;  1AV4 A;  3F7S A;  4N3V A;  2OTJ 3;  2IUK A;  1BRK A;  3MG3 A;  3ECF A;  3FLJ A;  1B2Z A;  4HZB B;  4O02 B;  4R1K A;  3NBB A;  1LOV A;  3D79 A;  4IPB A;  2BO9 B;  4HM2 B;  1VQ4 3;  2IY2 A;  3EX9 A;  1RKY A;  4HYZ A;  3G71 3;  2J8X B;  1U5O A;  3EN1 B;  5IG3 A;  5EEO A;  1WMO A;  1BAO A;  2Z6B A;  3OWU A;  4HM6 B;  4J9A A;  1GD3 A;  1GOU A;  4O2H A;  3Q1C A;  3STD A;  4MJD A;  1BNI A;  2FXT A;  2BT3 A;  5DRV A;  4AEQ A;  2Z77 A;  2WOH A;  2OQE C;  2W2C A;  1X1Y A;  3BNC A;  1EUI C;  3LH4 A;  5LC6 A;  2F86 B;  2I9W A;  3N9H A;  3LTA A;  4XBX A;  3X3Y A;  3PYJ A;  1BIR A;  2W0Q A;  1C54 A;  2QIY A;  1BRI A;  3KII A;  1FGT A;  3D5I A;  3T8N A;  4HM3 B;  1ULI B;  3CME 3;  1BUQ A;  1O7N B;  1VQQ A;  2JQ5 A;  2KXG A;  2W03 A;  3PCS A;  4N6O B;  4J8T A;  1YGW A;  1RRL A;  3FSD A;  2HML B;  4JRF A;  5IEO A;  4O3V A;  1N8R 4;  1UUG B;  1OAC A;  1VQ7 3;  2WGO A;  3D4A A;  4HM8 B;  4L8P A;  3O8Y A;  2Y73 A;  3EBT A;  3H51 A;  2UGI A;  3OV4 A;  3OXA A;  1TRQ A;  3UL5 A;  3X40 A;  5IF6 A;  4LZI A;  3GZR A;  4HBR A;  7GSP A;  3KSE D;  3GAX A;  3FG1 A;  1VQ8 3;  3D5G A;  4WP5 A;  2KCD A;  5FW5 A;  1BU4 A;  2GU1 A;  4KFE A;  1W00 A;  4WHA A;  2STD A;  3Q3F A;  3DGL A;  4HM4 B;  3SYU A;  1RNB A;  1HZ1 A;  1UUW B;  3BIR A;  1A67 A;  1IVW A;  5AYR B;  2KF4 A;  2P0X A;  3NHX A;  6GSP A;  1WMN A;  1TU5 A;  1Q7Y 4;  1B2M A;  1SIH A;  3G4S 3;  3BNE A;  3F7X A;  4NRE A;  1G02 A;  1NB5 I;  3EHC A;  1IQ8 A;  3PS8 A;  3S5C A;  1YVB I;  3A5E A;  3FG4 A;  3K5T A;  4NHF A;  2L1S A;  4R9L A;  1K73 4;  5GSP A;  3WHO A;  3NQY A;  1US1 A;  1E97 A;  1D6Y A;  1PY3 A;  3F14 A;  2RGQ A;  5IEP A;  1EG9 B;  1W6Y A;  1A2V A;  1YVS A;  1IT8 A;  2KF3 A;  3VF1 A;  1CH0 A;  4GL6 A;  1YIT 3;  2OOV A;  4HKV B;  1B21 A;  5IEN A;  1L5G B;  1RCK A;  1FUT A;  3F8X A;  4KT3 B;  1EA2 A;  4R9K A;  4XBT A;  1TTO A;  1JN5 B;  2C4B A;  2RFR A;  4GHO A;  1YHQ 3;  1UDI I;  3EQQ B;  1T2H A;  3NBR A;  1QVF 2;  1Q7H A;  1KC8 4;  1MGW A;  4RZM A;  2RCD A;  3WOD G;  1FYS A;  3WA3 A;  3AGN A;  4NPB A;  4HM7 B;  1V58 A;  1OHS A;  1OHP A;  4XDV A;  5AEW B;  5EVH A;  1O7W B;  2BMR B;  3VSY A;  1MWU A;  2YFL B;  1BRS A;  2E2U A;  2V1L A;  1IDP A;  4HJL B;  1QVG 2;  3CD6 3;  1I8V A;  1Q40 B;  3CPW 2;  3HOH A;  1ZGX A;  1PU4 A;  3FG3 A;  3QK9 A;  1BOX A;  1O7G B;  1G0T A;  4LSO A;  2GBX B;  3MHE A;  1VQP 3;  1JZO A;  2HMN B;  1GMR A;  2P0M A;  3FF2 A;  3GZX B;  4WYK B;  1KQS 2;  3JUQ A;  2K0M A;  1JB4 A;  1NO3 A;  2CC3 A;  2KF5 A;  3BU4 A;  2QA4 3;  3EN8 A;  3BNB A;  1IQX A;  4CJN A;  1JB2 A;  1W4N A;  3DGO A;  3PZW A;  1IYY A;  2O9U X;  1RGK A;  2W9P A;  3OX9 A;  1E3V A;  5IG4 A;  2CFG A;  3B4O A;  3EC9 A;  1JKG A;  4OK0 A;  5JBS A;  2OCT A;  2IA7 A;  2GSP A;  3JUO A;  3X3X A;  4CPK A;  3NV0 A;  1NJI 4;  3KN4 A;  1IT7 A;  4N6V 0;  2YX9 A;  1YI2 3;  3HX8 A;  5HGR A;  1R4C A;  5HOH A;  1KD1 4;  1JV2 B;  1YNV X;  3KKG A;  1B2U A;  1VQ5 3;  2K3D A;  2P38 A;  3EB8 A;  3NUV A;  2F5M A;  5RNT A;  2CWU A;  2CWV A;  4AKY A;  3LZA A;  1BVI A;  1MWS A;  2UUG C;  5DRE A;  1RDS A;  2CX0 A;  2XFS A;  1DET A;  3SOY A;  1IVU A;  1LOW A;  1TIJ A;  1EEJ A;  3RDE A;  3N8B A;  1OHO A;  4G1M B;  1BNG A;  1YJW 3;  5G1L A;  1I2F A;  4EXR A;  1K9M 4;  4N6L A;  1RN1 A;  3JUP A;  1JKG B;  4HAA A;  4DKI A;  1YGE A;  2CK3 H;  1S72 3;  2E2V A;  1IVX A;  4STD A;  1ULJ B;  1FZU A;  2HMO B;  4L8O A;  3TDG A;  1FGR A;  4BTW A;  1I2G A;  3OW2 2;  3G6E 3;  3CCR 3;  1AQZ A;  2OWP A;  1Q86 4;  1RN7 A;  4L7K A;  4XDW A;  1OH0 A;  1DMQ A;  3CPO A;  5ELJ A;  3GSP A;  1NNV A;  2JDI H;  3U97 A;  1Q42 A;  2SBL A;  2PZV A;  1OF5 A;  1WMP A;  2XH9 A;  4XBY A;  5A0O B;  1D6U A;  1OCV A;  5STD A;  3JVC A;  1TFK A;  1DMN A;  2IMJ A;  2XFT A;  1M1K 4;  1DVC A;  2K54 A;  2WOF A;  1I3F A;  3V98 A;  2XSO B;  3JUN A;  2W6J H;  4HZ9 B;  2XF3 A;  1VQ9 3;  2OTL 3;  1JBR A;  1J2B A;  2XRX B;  3CU3 A;  1JJ2 2;  3D9R A;  1N5P A;  1TUH A;  1UCL A;  3MKI A;  4I4K A;  3S67 A;  5CF1 A;  3CCQ 3;  3SLU A;  1TFO A;  2ML5 A;  5AIH A;  1RGG A;  1SAR A;  1JRQ A;  3EBY A;  1C7H A;  1RGF A;  3AMO A;  4U13 A;  1UCI A;  3DGM A;  5JPU A;  3PCR A;  1N9E A;  3LYG A;  1GSP A;  2CKF B;  3FZW A;  5D83 A;  4R4K A;  4RNZ A;  1BNF A;  5AEU B;  1Y4K A;  2XR8 B;  2HOH A;  2H0I A;  4MMZ B;  2R41 A;  4FMB A;  2XGN A;  1BNS A;  3I56 3;  1BRN L;  1T5Y A;  1I3I A;  3SX1 A;  4CCV A;  1RGC A;  1B2X A;  3MPH A;  4N6T A;  4JF8 A;  4EBG A;  4EC6 A;  2KF6 A;  5IG5 A;  3GWR A;  5ELU A;  4J5G A;  1Q81 4;  3DGY A;  1IQY A;  3DXO A;  3SOA A;  3X3Z A;  5D81 A;  2P05 A;  3MG1 A;  6STD A;  1RJO A;  2IYJ A;  3B8L A;  3WA2 X;  4BL3 A;  3BND A;  1CQS A;  1W6G A;  1BSB A;  3B7C A;  1TRP A;  2ZHX B;  3LML A;  3LTC A;  5LC7 A;  1UCJ A;  1X1X A;  1NU3 A;  2B24 B;  3ER7 A;  3ALA A;  3H3H A;  3NX0 A;  4IIA A;  4EYC A;  2M7O A;  3CCM 3;  2BU4 A;  3A76 A;  1ISK A;  1UGI A;  4IT7 A;  1LVN A;  1B3S A;  1O7H B;  3HII A;  2MF7 A;  2ML6 A;  4BU4 A;  4ILF A;  5CLK A;  5M18 A;  1VQ6 3;  3I55 3;  1W2B 2;  2C10 A;  3LT9 A;  2W04 A;  1ZS7 A;  3E99 A;  4H61 A;  3BB9 A;  3T0U A;  3L0R A;  3Q90 A;  3RNT A;  4EW5 A;  2HMM B;  1N9J A;  1NDO B;  1LQM B;  3U1W A;  1LNH A;  2F5W A;  4BIR A;  3Q2P A;  2D42 A;  3KCH A;  8RNT A;  1VQK 3;  1GS3 A;  1UCK A;  1B20 A;  3DY5 A;  2YFI B;  1HKX A;  3G8Z A;  2OQE A;  1VQM 3;  3D3L A;  1FGO A;  1NB3 I;  5AIG A;  5BIR A;  1DVD A;  1YIJ 3;  1RGL A;  2P09 A;  1CYU A;  5IER A;  1IK3 A;  3S29 A;  4ZM8 A;  3CCL 3;  3S27 A;  3CC4 3;  1HYF A;  2BMQ B;  1GMP A;  1T3B A;  5EQL A;  1JZD A;  2H0H A;  3ZG5 A;  1WTH A;  3S28 A;  3WOE B;  2F4Y A;  3KSP A;  2CG1 A;  2HMK B;  1V57 A;  3F8H A;  3DZL A;  5D82 A;  2BHM A;  3GRD A;  4RNT A;  4R80 A;  4BTX A;  2A15 A;  1LXE A;  4K1V A;  1BNR A;  3HK4 A;  2L4V A;  1N8Q A;  4MMY B;  2QEX 3;  1I2E A;  1FGQ A;  1LNI A;  2F99 A;  1E3R A;  2WO0 A;  2YFJ B;  2ZDJ A;  3F40 A;  1I0V A;  3JUM A;  2RBI A;  5TGN A;  3T8U A;  1M90 4;  3SXX A;  3X42 A;  1GY5 A;  2R4I A;  1ZO2 A;  5FGO A;  2E2T A;  1RNT A;  3FH1 A;  4XB5 A;  3DMC A;  1DMM A;  3F9S A;  1SJW A;  1B27 A;  3B4P A;  3FKA A;  4O8S A;  4LYL B;  2MC8 A;  1W2Z A;  2RNT A;  4FMC A;  1MOL A;  1RLS A;  1F8N A;  1BRJ A;  5G2G A;  1RRH A;  2GEX A;  4EV2 A;  1LOX A;  2D1W A;  2CWT A;  3FGY A;  1X1U A;  7RNT A;  2Y74 A;  4FCM A;  1GD4 A;  2GEY A;  2CIU A;  2CW9 A;  2BIR A;  2IUJ A;  3NV0 B;  1GOY A;  3OWY A;  3MYT A;  3EE1 A;  1FGM A;  1DE3 A;  1BRG A;  1SQW A;  2H0G A;  2CFD A;  1OGZ A;  2OOV C;  2RSX A;  3CCE 3;  1UI8 A;  1KSI A;  1O7M B;  1SPU A;  1VQL 3;  3HIG A;  3ZFZ A;  3I0Y A;  5AYS C;  3V99 A;  3J7Y d;  1EKM A;  1GYB A;  3ZG0 A;  5KP3 A;  4HM0 B;  2KAA A;  1DYU A;  2GXF A;  2HMJ B;  1K8A 4;  4LEH A;  3CNX A;  3QRD A;  1BSC A;  1TP6 A;  4TX4 A;  4X2H A;  1UGH I;  4K1U A;  3CMA 3;  1W6C A;  3M8C A;  1RGA A;  3G16 A;  1RGH A;  4LGQ A;  1G96 A;  2W56 A;  2FGT A;  2XEP A;  1BNE A;  1WQL B;  1PFP A;  3BLZ A;  1FW7 A;  4WWU C;  1AR0 A;  4FCZ A;  1S5A A;  3HI7 A;  2CFK A;  1JBT A;  1QAF A;  4GB5 A;  3LT8 A;  4N6U A;  4KZ1 A;  1GY7 A;  3SED A;  5AI1 A;  1BAN A;  1M9G A;  3CC2 3;  1ASK A;  2UX0 A;  4FCJ A;  3CCS 3;  2GU3 A;  2KRT A;  4WFO A;  1MWT A;  1TJD A;  1CYV A;  3VGN A;  1RN4 A;  3AHS A;  3RGA A;  5M19 A;  2F56 A;  1CEW I;  3NM2 A;  3CCU 3;  1LOY A;  1OF5 B;  2XSH B;  1D6Z A;  3MWZ A;  4AKZ A;  2SAR A;  2B1X B;  1K41 A;  2W56 B;  4GSP A;  5IG0 A;  1LQG C;  4RNY A;  2Q07 A;  1RCL A;  1QAL A;  1JB5 A;  1W7C A;  1MGR A;  2CG0 A;  2O3O A;  8CHO A;  3IMA B;  2FNQ A;  1Z1S A;  6RNT A;  4HM1 B;  1A90 A;  4KFF A;  1M1X B;  1QJG A;  2BMO B;  3WDG B;  3V92 A;  4HM5 B;  5AIF A;  1YJN 3;  3CXC 2;  3LTB A;  3LTD A;  1VQN 3;  7STD A;  1NWW A;  3HZP A;  4LMI A;  2LQV A;  3LXU X;  2CFW A;  4EV5 A;  3AMO B;  3WMD A;  1RHL A;  4MMX B;  4QWT A;  1FUS A;  1R4Y A;  1BRH A;  1ROA A;  1STF I;  3AHW A;  1UW1 A;  1HU9 A;  2BNG A;  1I0X A;  5JPP A;  1RGE A;  1JN5 A;  3RGR A;  5IW9 A;  1X1W A;  1GY6 A;  1UI7 A;  4FR9 A;  1RSN A;  1GOV A;  1STD A;  1BNJ A;  4J5K A;  4CDL A;  2ZA4 A;  3N54 B;  5CF2 A;  1EQK A;  4KFD A;  2AAD A;  1K28 A;  4XM4 A;  5I97 A;  3LOY A;  4X2O A;  1QMA A;  1IU7 A;  3DGN A;  1WNH A;  1A2K A;  1W02 A;  3K7C A;  2LYX A; 
#chains in the Genus database with same CATH homology
 3IPT A;  1OUN A;  3UL6 A;  1Q40 A;  5CK6 A;  3EJV A;  4ORL A;  3FCS B;  2C11 A;  3UB1 A;  5BVB A;  1AVL A;  2CFL A;  3UNL A;  1FA3 A;  4FMD A;  3CCJ 3;  1VQO 3;  4WYK A;  3X41 A;  3OWS A;  2WGQ A;  3KFQ C;  4MEI A;  3UJM A;  3KZT A;  5BXQ A;  1IV9 A;  1JNQ A;  1QAK A;  2INX A;  3GZB A;  3CC7 3;  5KP4 A;  3K0Z A;  3FF0 A;  4BTY A;  1IV7 A;  2Z76 A;  3IJE B;  1AVK A;  1W01 A;  3EF8 A;  2GBW B;  3DUK A;  1W5Z A;  3PXM A;  1N5H A;  1UUV B;  2F98 A;  3CNM A;  3NXJ A;  4H3U A;  3NQZ A;  2XGL A;  4PEJ A;  1O7P B;  4RBN A;  1IVV A;  2ZL8 A;  1KWI A;  3PGB A;  2PNC A;  3SVA A;  3KE7 A;  4KVH A;  5CXO A;  3CCV 3;  1YJ9 3;  2QGU A;  4N6M A;  1Q82 4;  3K9M C;  5AII A;  1VZZ A;  2Z7A A;  3NBJ A;  3MSO A;  4N6N B;  3ROB A;  1MNL A;  4HVN A;  1SII A;  2W9Q A;  3G0K A;  4FMA A;  4OUQ A;  4Q53 A;  1OGX A;  4K90 B;  1FUW A;  3WOF B;  3K63 A;  2CHC A;  1ROV A;  5KP1 A;  1U8C B;  1OPY A;  3NM7 A;  1V74 A;  1ZX2 A;  3DM8 A;  4K61 A;  4OVM A;  2CH9 A;  3GZY B;  3MG2 A;  1AV4 A;  3F7S A;  4N3V A;  2OTJ 3;  2IUK A;  3MG3 A;  4O02 B;  3ECF A;  3FLJ A;  4HZB B;  4R1K A;  3NBB A;  4IPB A;  2BO9 B;  4HM2 B;  1VQ4 3;  3EX9 A;  1RKY A;  4HYZ A;  3G71 3;  1U5O A;  3EN1 B;  5IG3 A;  5EEO A;  1WMO A;  2Z6B A;  3OWU A;  4HM6 B;  4J9A A;  1GD3 A;  4O2H A;  3Q1C A;  3STD A;  4MJD A;  2FXT A;  2BT3 A;  5DRV A;  4AEQ A;  2Z77 A;  2WOH A;  2OQE C;  2W2C A;  3BNC A;  3LH4 A;  5LC6 A;  3X3Y A;  2F86 B;  2I9W A;  3N9H A;  3LTA A;  4XBX A;  3PYJ A;  2W0Q A;  2QIY A;  3KII A;  1FGT A;  3T8N A;  4HM3 B;  1ULI B;  3CME 3;  1BUQ A;  1O7N B;  2JQ5 A;  2KXG A;  2W03 A;  3PCS A;  4N6O B;  4J8T A;  1RRL A;  3FSD A;  2HML B;  4JRF A;  5IEO A;  4O3V A;  1N8R 4;  1OAC A;  1VQ7 3;  2WGO A;  4HM8 B;  4L8P A;  3O8Y A;  2Y73 A;  3EBT A;  3H51 A;  3OXA A;  3OV4 A;  3UL5 A;  3X40 A;  5IF6 A;  4LZI A;  3GZR A;  4HBR A;  3KSE D;  3GAX A;  3FG1 A;  1VQ8 3;  4WP5 A;  2KCD A;  5FW5 A;  2GU1 A;  4KFE A;  1W00 A;  4WHA A;  2STD A;  3DGL A;  4HM4 B;  1UUW B;  1A67 A;  1IVW A;  5AYR B;  2P0X A;  3NHX A;  1WMN A;  1TU5 A;  1Q7Y 4;  1SIH A;  3G4S 3;  3BNE A;  3F7X A;  4NRE A;  1NB5 I;  3EHC A;  1IQ8 A;  3PS8 A;  3S5C A;  1YVB I;  3FG4 A;  3K5T A;  4NHF A;  4R9L A;  1K73 4;  3NQY A;  1US1 A;  1E97 A;  1D6Y A;  3F14 A;  2RGQ A;  5IEP A;  1EG9 B;  1W6Y A;  1A2V A;  1IT8 A;  3VF1 A;  4GL6 A;  1YIT 3;  2OOV A;  4HKV B;  5IEN A;  1L5G B;  3F8X A;  1EA2 A;  4R9K A;  4XBT A;  1JN5 B;  1YHQ 3;  2RFR A;  3EQQ B;  3NBR A;  1QVF 2;  1KC8 4;  4RZM A;  2RCD A;  3WOD G;  3WA3 A;  4HM7 B;  1OHS A;  1OHP A;  4XDV A;  5AEW B;  5EVH A;  1O7W B;  2BMR B;  3VSY A;  2YFL B;  2E2U A;  2V1L A;  1IDP A;  4HJL B;  1QVG 2;  3CD6 3;  1Q40 B;  3CPW 2;  1PU4 A;  3FG3 A;  3QK9 A;  1O7G B;  4LSO A;  2GBX B;  3MHE A;  1VQP 3;  2HMN B;  2P0M A;  3FF2 A;  3GZX B;  4WYK B;  3JUQ A;  2K0M A;  1JB4 A;  1NO3 A;  2CC3 A;  2QA4 3;  3EN8 A;  3BNB A;  1IQX A;  1JB2 A;  1W4N A;  3DGO A;  3PZW A;  2O9U X;  2W9P A;  3OX9 A;  1E3V A;  5IG4 A;  2CFG A;  3B4O A;  3EC9 A;  1JKG A;  4OK0 A;  5JBS A;  2OCT A;  2IA7 A;  3JUO A;  3X3X A;  3NV0 A;  1NJI 4;  3KN4 A;  1IT7 A;  4N6V 0;  2YX9 A;  1YI2 3;  3HX8 A;  5HGR A;  1R4C A;  1KD1 4;  1JV2 B;  3KKG A;  1VQ5 3;  2P38 A;  3EB8 A;  3NUV A;  2CWU A;  2CWV A;  4AKY A;  3LZA A;  5DRE A;  2XFS A;  3SOY A;  1IVU A;  1TIJ A;  3RDE A;  3N8B A;  1OHO A;  4G1M B;  1YJW 3;  1K9M 4;  4EXR A;  4N6L A;  3JUP A;  1JKG B;  1YGE A;  2CK3 H;  1S72 3;  2E2V A;  1IVX A;  4STD A;  1ULJ B;  2HMO B;  4L8O A;  3TDG A;  4BTW A;  1FGR A;  3OW2 2;  3G6E 3;  3CCR 3;  2OWP A;  1Q86 4;  1RN7 A;  4L7K A;  4XDW A;  1OH0 A;  1DMQ A;  3CPO A;  5ELJ A;  2JDI H;  3U97 A;  1Q42 A;  2SBL A;  2PZV A;  1OF5 A;  1WMP A;  2XH9 A;  4XBY A;  5A0O B;  1D6U A;  1OCV A;  5STD A;  3JVC A;  1TFK A;  1DMN A;  2IMJ A;  2XFT A;  1M1K 4;  1DVC A;  2K54 A;  2WOF A;  3V98 A;  2XSO B;  3JUN A;  2W6J H;  4HZ9 B;  2XF3 A;  1VQ9 3;  2OTL 3;  1J2B A;  2XRX B;  3CU3 A;  1JJ2 2;  3D9R A;  1N5P A;  1TUH A;  3MKI A;  4I4K A;  3S67 A;  5CF1 A;  3CCQ 3;  3SLU A;  1TFO A;  2ML5 A;  5AIH A;  3EBY A;  1JRQ A;  1C7H A;  3AMO A;  4U13 A;  3DGM A;  5JPU A;  3PCR A;  1N9E A;  3LYG A;  2CKF B;  3FZW A;  5D83 A;  4R4K A;  4RNZ A;  5AEU B;  1Y4K A;  2XR8 B;  4MMZ B;  4FMB A;  2XGN A;  3I56 3;  1T5Y A;  3SX1 A;  4CCV A;  3MPH A;  4N6T A;  4JF8 A;  4EBG A;  4EC6 A;  5IG5 A;  3GWR A;  5ELU A;  1Q81 4;  3SOA A;  1IQY A;  3DXO A;  3X3Z A;  5D81 A;  2P05 A;  3MG1 A;  6STD A;  1RJO A;  3B8L A;  3WA2 X;  3BND A;  1CQS A;  1W6G A;  3B7C A;  3LML A;  3LTC A;  5LC7 A;  1NU3 A;  2B24 B;  3ER7 A;  3ALA A;  3H3H A;  3NX0 A;  4IIA A;  4EYC A;  2M7O A;  3CCM 3;  3A76 A;  1ISK A;  4IT7 A;  1LVN A;  1O7H B;  3HII A;  2MF7 A;  2ML6 A;  5CLK A;  1VQ6 3;  3I55 3;  1W2B 2;  2C10 A;  3LT9 A;  2W04 A;  3E99 A;  4H61 A;  3BB9 A;  3T0U A;  3L0R A;  3Q90 A;  2HMM B;  1N9J A;  1NDO B;  3U1W A;  1LNH A;  3Q2P A;  2D42 A;  1VQK 3;  1GS3 A;  3DY5 A;  2YFI B;  1HKX A;  3G8Z A;  2OQE A;  1VQM 3;  3D3L A;  1FGO A;  1NB3 I;  5AIG A;  1DVD A;  1YIJ 3;  2P09 A;  1CYU A;  5IER A;  1IK3 A;  3S29 A;  4ZM8 A;  3CCL 3;  3S27 A;  3CC4 3;  2BMQ B;  5EQL A;  1WTH A;  3S28 A;  3WOE B;  3KSP A;  2CG1 A;  1KQS 2;  2HMK B;  3F8H A;  3DZL A;  5D82 A;  2BHM A;  3GRD A;  4BTX A;  4R80 A;  2A15 A;  1LXE A;  4K1V A;  3HK4 A;  2L4V A;  1N8Q A;  4MMY B;  2QEX 3;  2F99 A;  1FGQ A;  2YFJ B;  2WO0 A;  1E3R A;  3F40 A;  3JUM A;  2ZDJ A;  4HM5 B;  3T8U A;  1M90 4;  5TGN A;  3SXX A;  3X42 A;  1GY5 A;  2R4I A;  1ZO2 A;  5FGO A;  2E2T A;  3FH1 A;  4XB5 A;  3DMC A;  1DMM A;  3F9S A;  1SJW A;  3B4P A;  3FKA A;  4O8S A;  2MC8 A;  1W2Z A;  4FMC A;  1MOL A;  1F8N A;  5G2G A;  1RRH A;  2GEX A;  4EV2 A;  1LOX A;  2D1W A;  2CWT A;  3FGY A;  2Y74 A;  4FCM A;  1GD4 A;  2GEY A;  2CIU A;  2CW9 A;  2IUJ A;  3NV0 B;  3OWY A;  3MYT A;  3EE1 A;  1FGM A;  1SQW A;  2OOV C;  2CFD A;  1OGZ A;  3CCE 3;  2RSX A;  1UI8 A;  1KSI A;  1O7M B;  1SPU A;  1VQL 3;  3HIG A;  3I0Y A;  5AYS C;  3V99 A;  3J7Y d;  1EKM A;  1GYB A;  1K8A 4;  5KP3 A;  4HM0 B;  1DYU A;  2GXF A;  2HMJ B;  4LEH A;  3CNX A;  3QRD A;  4X2H A;  1TP6 A;  4TX4 A;  3CMA 3;  4K1U A;  1W6C A;  3M8C A;  3G16 A;  4LGQ A;  1G96 A;  2W56 A;  2FGT A;  2XEP A;  1WQL B;  1PFP A;  3BLZ A;  4WWU C;  1AR0 A;  4FCZ A;  1S5A A;  3HI7 A;  2CFK A;  1QAF A;  4GB5 A;  3LT8 A;  4N6U A;  4KZ1 A;  1GY7 A;  3SED A;  5AI1 A;  3CC2 3;  1M9G A;  1ASK A;  2UX0 A;  4FCJ A;  3CCS 3;  2GU3 A;  2KRT A;  4WFO A;  1CYV A;  3VGN A;  3RGA A;  1CEW I;  3NM2 A;  3CCU 3;  1OF5 B;  2XSH B;  1D6Z A;  3MWZ A;  4AKZ A;  2B1X B;  1K41 A;  2W56 B;  5IG0 A;  4RNY A;  2Q07 A;  1QAL A;  1JB5 A;  1W7C A;  8CHO A;  2CG0 A;  2O3O A;  3IMA B;  2FNQ A;  1Z1S A;  4HM1 B;  1A90 A;  4KFF A;  1M1X B;  1QJG A;  2BMO B;  3WDG B;  3V92 A;  5AIF A;  1YJN 3;  3CXC 2;  3LTB A;  3LTD A;  1VQN 3;  7STD A;  1NWW A;  3HZP A;  4LMI A;  2LQV A;  3LXU X;  2CFW A;  4EV5 A;  3AMO B;  3WMD A;  4MMX B;  4QWT A;  1ROA A;  1STF I;  1UW1 A;  1HU9 A;  2BNG A;  5JPP A;  1JN5 A;  3RGR A;  5IW9 A;  1GY6 A;  1UI7 A;  4FR9 A;  1STD A;  4CDL A;  3N54 B;  5CF2 A;  1EQK A;  4KFD A;  4XM4 A;  1K28 A;  5I97 A;  3LOY A;  4X2O A;  1QMA A;  1IU7 A;  3DGN A;  1WNH A;  1A2K A;  1W02 A;  3K7C A;  2LYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...