1QMAA

Nuclear transport factor 2 (ntf2) w7a mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
GDKPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title Interaction Betweeen Ntf2 and Xfxfg-Containing Nucleoporins is Required to Mediate Nuclear Import of Ran-Gdp
pubmed doi rcsb
source organism Rattus norvegicus
total genus 35
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1qmaA00
1OUNA 2IMJA 2F99A 1OF5A 2XRXB 3DZLA 3HX8A 3EN8A 5D81A 3JUPA 5CLKA 3JUOA 4R9LA 3VSYA 4WWUC 4H3UA 4HM1B 4Q53A 1JB5A 1VZZA 3OWSA 4FCJA 1OHSA 3CNMA 4XBXA 2OWPA 2BMOB 4J9AA 1W6YA 2Z76A 5G2GA 4U13A 2HMLB 3B4PA 1OGZA 2PZVA 2R4IA 4XBTA 3EF8A 3ER7A 1NWWA 5BXQA 3H3HA 4OVMA 1NDOB 1DMNA 1A2KA 3OWYA 1C7HA 1IDPA 3JUQA 1JB4A 3F8HA 3GWRA 5IERA 3NUVA 1O7WB 2K54A 4OUQA 3KZTA 3JUNA 3A76A 3MSOA 2XSOB 4I4KA 3H51A 2UX0A 1W02A 1OF5B 1ZO2A 3ROBA 3SOYA 2QGUA 3F14A 3VGNA 4ORLA 2JQ5A 3MG3A 4KVHA 3CU3A 3DMCA 5HGRA 2I9WA 4LGQA 5CF1A 3K0ZA 4HKVB 3G16A 2GBWB 3E99A 1GY5A 2B24B 4XDVA 5AEWB 1STDA 3UNLA 3FF0A 1EA2A 1TUHA 2YFLB 1AR0A 1E3VA 4PEJA 2XR8B 3B7CA 4WP5A 4K1UA 1BUQA 4WYKA 1HKXA 3HK4A 4HM4B 3FLJA 3F7XA 3M8CA 1OGXA 3FSDA 2RFRA 4XB5A 4CDLA 1SJWA 2GBXB 5IG4A 2GEXA 1EG9B 3Q90A 5KP1A 7STDA 3KSPA 1OCVA 4HM6B 3FZWA 2BNGA 3ECFA 3D9RA 1ULJB 3MHEA 4HM7B 1NU3A 5JPUA 3NV0A 6STDA 1ASKA 1W01A 1W00A 4N3VA 1QJGA 4WYKB 2B1XB 4LMIA 3FGYA 4R9KA 1OH0A 1U5OA 2STDA 1GYBA 1JKGA 4HZBB 2QIYA 3NXJA 2HMKB 3HZPA 1JN5A 3CNXA 4RZMA 1ULIB 3EX9A 5KP4A 2GEYA 3SEDA 3LZAA 2YFIB 3GZXB 3RGAA 5IENA 3FKAA 5CF2A 5FW5A 3EJVA 1Q40A 2A15A 2F86B 1OHPA 1ZX2A 1TP6A 5CK6A 3F40A 2BMRB 2RGQA 3JUMA 3B4OA 3GZYB 3GRDA 4LEHA 3T8UA 3NV0B 3IPTA 5BVBA 1GS3A 3B8LA 5IG5A 3OXAA 1JKGB 5TGNA 4MJDA 5IF6A 3EBTA 2W2CA 4J8TA 4R1KA 3SOAA 3GZBA 1JN5B 3BB9A 3CPOA 1Z1SA 3BLZA 1O7NB 4GB5A 1E3RA 3EQQB 3OV4A 3MG2A 2YFJB 3K7CA 1GY7A 2HMMB 4HVNA 2INXA 3EN1B 4HM8B 1Q40B 5AIFA 1Q42A 3KKGA 4L7KA 1GY6A 1DMQA 4XBYA 4STDA 3F7SA 1O7HB 3LYGA 4X2HA 3KE7A 4XDWA 5AIIA 3FH1A 2BMQB 4FCMA 1CQSA 1UUWB 4HM0B 1WQLB 4HZ9B 5IG3A 2F98A 5IEPA 5D83A 4X2OA 1OHOA 1O7GB 3G8ZA 1K41A 1UUVB 5IEOA 3RGRA 2XSHB 3MKIA 2HMNB 3I0YA 8CHOA 4K1VA 4L8PA 3NBRA 5IG0A 5AI1A 3F8XA 3EHCA 3GZRA 4IIAA 1OPYA 1JB2A 2CKFB 1O7MB 3OX9A 2HMOB 3MYTA 4XM4A 3EBYA 4L8OA 2CHCA 4HM2B 3S5CA 4HM3B 4HM5B 5KP3A 3F9SA 1ISKA 5STDA 3NM2A 5AIHA 3FF2A 3OWUA 3EC9A 1E97A 2RCDA 5AEUB 5EVHA 2GXFA 3G0KA 1QMAA 3STDA 3MG1A 5DREA 5AIGA 1S5AA 1O7PB 1DMMA 4HJLB 3DM8A 3WMDA 3NHXA 5JPPA 3DUKA 5D82A 2Z77A 3T8NA 2HMJB 5DRVA 3UJMA 3DXOA 5CXOA 2Z7AA
chains in the Genus database with same CATH superfamily
1OUNA 2IMJA 4FMCA 1YIJ3 2D42A 1IVVA 3CC43 2CK3H 3X41A 4NREA 2F99A 4OK0A 2K0MA 3N8BA 1BNFA 1OF5A 2XRXB 3DZLA 1N5HA 3HX8A 1BUJA 1SARA 3EN8A 5D81A 2RBIA 2OOVA 3JUPA 5CLKA 2OCTA 1UCIA 2M7OA 3JUOA 4R9LA 3VSYA 1JBSA 4WWUC 4H3UA 4HM1B 4Q53A 1DVDA 1JB5A 1MGWA 1V74A 1VZZA 1SIIA 2C4BA 1BOXA 2KF4A 3IJEB 3OWSA 1NO3A 4FCJA 2OTJ3 1BNIA 1RRLA 1OHSA 3AMOA 1VQM3 5FGOA 1BRJA 3CNMA 4XBXA 2OWPA 4I5QA 1WMNA 2BMOB 4J9AA 1CYVA 1EUIC 1RNTA 2XGLA 4QWTA 1W6YA 2Z76A 4U13A 5G2GA 2HMLB 3B4PA 3X42A 1OGZA 2PZVA 3L0RA 2R4IA 3V98A 1NJI4 2FNQA 4IPBA 1C54A 1NNVA 1KC84 1TTOA 2E2TA 3LMLA 4XBTA 3V99A 2WO0A 3DGYA 4EC6A 4BTYA 3EF8A 4KFEA 2BIRA 1NWWA 3ER7A 3I563 3HOHA 1PYLA 1FGOA 3EE1A 1W4NA 5BXQA 1DE3A 1QVG2 3I553 3H3HA 3TDGA 4OVMA 4MMYB 1NDOB 1DMNA 1Q7HA 1MWRA 1Q814 3CCE3 1VQ53 1VQN3 1A2KA 3OWYA 7GSPA 1RGEA 4WHAA 5ELJA 1C7HA 1RGAA 3BNEA 1IDPA 5ELUA 3JUQA 1JB4A 3F8HA 4MMXB 3CCQ3 2KCDA 3EB8A 4CPKA 3GWRA 3CCL3 3MPHA 5IERA 3NUVA 1O7WB 2K54A 2CFWA 2CH9A 4OUQA 3KZTA 3JUNA 2H0GA 3S67A 1QAFA 2E2VA 5M1AA 1YGWA 1RLSA 3A76A 1A2VA 5EQLA 1W2B2 1IQXA 4GL6A 2KF6A 3MSOA 2XSOB 2KAAA 3BNBA 1BRSA 1RDSA 1RRHA 4G1MB 2CX0A 4I4KA 3H51A 1JZDA 1B2ZA 1FGMA 2UX0A 1I8VA 1W02A 3LH4A 1OF5B 2XFSA 1NB3I 1ZO2A 4O8SA 1VQ83 2WGQA 2E2UA 3SX1A 3ROBA 3SOYA 2ZHXB 1D6ZA 1UUGB 2HOHA 3KN4A 4AKZA 5G1KA 4BL2A 2QGUA 3F14A 2WOFA 3VGNA 1RCKA 1N5PA 4ORLA 2JQ5A 1YVSA 4N6LA 1IT8A 3MG3A 4KVHA 1RCLA 3AMOB 3CU3A 1K8A4 3DMCA 1I0VA 2XEPA 5HGRA 1CYUA 3CPW2 2I9WA 1B2SA 2CWUA 3FG4A 1GD3A 1GMQA 3GSPA 4LGQA 1JBTA 3WOFB 5CF1A 1RGFA 3K0ZA 4CJNA 1Q824 1Y4KA 1Q9EA 3D5GA 4HKVB 1QVF2 2QEX3 1MWUA 3CCR3 1I70A 3G16A 1IYYA 2GBWB 1B27A 1GSPA 3E99A 3K9MC 3QRDA 1GY5A 2O9UX 2B24B 4XDVA 1M1K4 5A0OB 5AEWB 1STDA 2BO9B 3UNLA 3FF0A 3T0UA 1YHQ3 1LVNA 1K9M4 3WDGB 2F4YA 4LSOA 1EA2A 1TUHA 1UCLA 1MWSA 2YFLB 2ZA4A 4N6NB 1AR0A 1E3VA 1WMOA 2CX1A 1LQMB 2XR8B 1BNSA 3B7CA 3LXUX 4PEJA 4WP5A 4K1UA 2ML5A 1BUQA 1RGKA 3PYJA 4WYKA 3NQYA 4FR9A 1HKXA 4HOHA 6RNTA 2SARA 5LC6A 1DETA 2OQEA 4K90B 3HK4A 3ZFZA 4HM4B 4BU4A 1RNBA 2Q07A 2AAEA 3FLJA 4RNYA 3CMA3 5M18A 3F7XA 2C11A 3M8CA 1TRQA 1SIHA 3NX0A 3U97A 1OGXA 3FSDA 1RGLA 4EV2A 3CC23 1M904 2RFRA 3LTDA 4XB5A 4AKYA 4CDLA 1SJWA 4GSPA 3JVCA 1BRNL 2BU4A 3KFQC 3BNDA 2GBXB 1GOYA 3AGOA 1LOXA 5IG4A 5I97A 3K5TA 1UDII 2GEXA 3DGMA 3PS8A 1BRHA 2F5MA 4MMZB 1EG9B 1TRPA 2UUGC 4LYLB 4RBNA 1UI7A 1UGHI 2BT3A 3Q90A 3DGLA 1PU4A 1D6UA 1JNQA 5KP1A 9RNTA 7STDA 2P0MA 2H0HA 3WODG 3KSPA 1HU9A 1OCVA 1OACA 4HM6B 1B20A 3FZWA 4O2HA 1UW1A 2BNGA 1LNHA 3LT8A 3BIRA 2OOVC 2CG0A 2FXTA 3ECFA 3N9HA 3WA2X 3NBBA 4EYCA 2F56A 3V92A 3D9RA 1I2GA 4EXRA 3D5IA 1ULJB 3MHEA 1BSCA 4HM7B 3FG1A 3D3LA 1MNLA 3CCJ3 1NU3A 5JPUA 3CCU3 2J8XB 1V58A 3NV0A 2KF3A 1IVUA 1IQ8A 5AYRB 1W6CA 6STDA 1S723 1BRKA 1LOWA 1RN7A 1ASKA 1W01A 1EQKA 1B2UA 1W00A 4N3VA 3PCSA 4J5KA 1QJGA 1X1YA 1B2MA 1M9GA 4WYKB 2B1XB 4LMIA 3ZG5A 3FGYA 4R9KA 4FCZA 5HOHA 1OH0A 1VQ63 1YIT3 3NQZA 1FZUA 1EKMA 1U5OA 2STDA 3G713 1GOUA 1GYBA 1JKGA 1YGEA 4HZBB 3LTBA 1IVWA 2QIYA 3NXJA 3AGNA 2HMKB 3HZPA 1JN5A 3CNXA 1WNHA 3LTCA 1RTUA 3PCRA 4RZMA 1ULIB 2Z6BA 3EX9A 5KP4A 1PY3A 2GEYA 1BIRA 3SEDA 3UL6A 3LZAA 2RSXA 1AV4A 1FGRA 2YFIB 3WA3A 3GZXB 1M1XB 2L1SA 1UI8A 3RGAA 5IENA 2UGIA 1UCJA 1VQ93 3FKAA 1I0XA 5CF2A 1BNGA 1QALA 1LRAA 1TU5A 5FW5A 4BIRA 2Y73A 4KFFA 3EJVA 2C10A 1YJN3 2GU3A 1B21A 4RNTA 1Q40A 2K3DA 2A15A 1BRGA 2F86B 4CCVA 3HIGA 1OHPA 1ZX2A 1TP6A 2GSPA 5CK6A 3CME3 1FUWA 4R4KA 2XF3A 3URPA 1KQS2 1UGIA 1IV9A 3F40A 1IU7A 3KSED 3SVAA 4BTXA 2RNTA 2IY2A 1RJOA 1ZGXA 4O3VA 1ZS7A 2BMRB 3A5EA 5BIRA 2RGQA 3JUMA 3B4OA 3QK9A 3GZYB 3S28A 1Q7Y4 4EW5A 3GRDA 4LEHA 3T8UA 1AVLA 3NV0B 1BSEA 3LTAA 3D4AA 1N9JA 3IPTA 3WHOA 1AQZA 1RGGA 1JBRA 2XFTA 4ZM8A 5BVBA 1B2XA 1GS3A 3B8LA 1YJW3 1FA3A 2V1LA 1BGSA 5IG5A 2CWTA 3MWZA 1X1XA 3DY5A 3OXAA 1QAKA 1BANA 1TFOA 1VQ73 3OW22 1BU4A 1JKGB 5TGNA 4MJDA 4TX4A 3EBTA 2W2CA 1R4YA 4J8TA 4R1KA 1TFKA 3S29A 3SOAA 3CCV3 3FG3A 1LOVA 1BAOA 3Q3FA 3GZBA 1JZOA 1JN5B 3BB9A 3CPOA 3HI7A 1JJ22 2FGTA 3AHSA 1KWIA 1Z1SA 4KT3B 2W0QA 1O7NB 3BLZA 1R4CA 4J5GA 2OQEC 4NPBA 3X3XA 4GB5A 4IT7A 1B3SA 1E3RA 3EQQB 3OV4A 1W6GA 3CD63 3CCM3 1A90A 3MG2A 7RNTA 1I3FA 2YFJB 3X40A 3K7CA 1CH0A 1GY7A 2CC3A 2HMMB 1G02A 2W04A 2F5WA 1W7CA 2SBLA 4HVNA 1RN1A 4DKIA 1BVIA 2P38A 1VQL3 2XH9A 1STFI 3PGBA 2INXA 3EN1B 1T2HA 4HM8B 3VF1A 1SPUA 1X1UA 1PFPA 2CFDA 3GAXA 1F8NA 1K28A 1Q40B 1RSNA 5AIFA 3D79A 4NHFA 3ALAA 4N6V0 1Q42A 3X3YA 2LQVA 3KKGA 4L7KA 4EV5A 1BSAA 4WFOA 2CIUA 3PZWA 1GY6A 1DMQA 4XBYA 3CXC2 1FGTA 2CFKA 1SQWA 3K63A 4STDA 3F7SA 3G6E3 1YVBI 3AHWA 1MOLA 1HZ1A 1GMRA 1BNEA 5GSPA 1I3IA 1O7HB 1VQQA 4KZ1A 4N6MA 2W56A 3LYGA 1A2PA 1YI23 4MEIA 4X2HA 1RKYA 3KE7A 4XDWA 5AIIA 3FH1A 1IV7A 3UL5A 3J7Yd 1MWTA 2BMQB 4FCMA 1UUWB 1GMPA 1CQSA 1T2IA 2L4VA 3BU4A 2P0XA 1DYUA 1LQGC 1RMSA 4HM0B 5M19A 1FUTA 1RHLA 1WQLB 3S27A 4HZ9B 1JRQA 1ROAA 2BHMA 3CCS3 5IG3A 1N8QA 1ISKA 2F98A 5IEPA 5D83A 1IT7A 4X2OA 3UB1A 1LNIA 1KD14 1AVKA 1OHOA 1O7GB 2KRTA 3G8ZA 1L5GB 1VQO3 1K41A 3HIIA 1UUVB 4BL3A 2O3OA 5IEOA 1RN4A 2D1WA 2IUJA 3SLUA 2CW9A 3RGRA 2XSHB 3SXXA 3MKIA 2HMNB 5AYSC 3KCHA 3U1WA 1KSIA 2W6JH 3I0YA 5G1LA 1D6YA 8CHOA 3DGOA 3RNTA 4K1VA 3WR2A 1N8R4 4L8PA 4KFDA 1BRIA 2JDIH 3WOEB 1YNVX 3NBRA 1I2EA 1W5ZA 5IG0A 5AI1A 1U8CB 3F8XA 3IMAB 1LOYA 2CFLA 1K734 3EHCA 2GU1A 3Q1CA 3GZRA 2CFGA 3PXMA 2PNCA 4IIAA 1OPYA 2XGNA 1JB2A 1A67A 1V57A 1W2ZA 4JF8A 4N6TA 2KF5A 1ROVA 1FYSA 1CEWI 1O7MB 2CKFB 2H0IA 2HMOB 3OX9A 3MYTA 5EEOA 8RNTA 4XM4A 1NB5I 3EBYA 4LZIA 1EEJA 1BSDA 4HYZA 2W03A 1I2FA 4L8OA 2ZL8A 1RGCA 2WOHA 5LC7A 2CHCA 4HM2B 3S5CA 1YJ93 1LXEA 4HM3B 1G96A 3BNCA 3NM7A 4BTWA 2IYJA 4HM5B 3CC73 4EBGA 5KP3A 5RNTA 3F9SA 1FUSA 4GHOA 1WMPA 4HBRA 3ZG0A 4AEQA 2MF7A 5STDA 3NM2A 5AIHA 3FF2A 3OWUA 2IUKA 4K61A 3NBJA 5IF6A 1TIJA 1E97A 3EC9A 2WGOA 2MC8A 2W56B 5IW9A 1AY7A 2RCDA 5AEUB 3G4S3 1DVCA 5EVHA 3SYUA 2GXFA 1BNRA 1T5YA 1RGHA 3G0KA 3O8YA 1IK3A 1IVXA 1WTHA 1BSBA 1QMAA 4H61A 2QA43 3STDA 1FW7A 1TJDA 4FMDA 3MG1A 2ML6A 5JBSA 3KIIA 2IA7A 5DREA 2ZDJA 5AIGA 2AADA 1G0TA 1S5AA 2CG1A 3DGNA 2YX9A 2OTL3 4ILFA 4N6UA 4RNZA 1O7PB 1MGRA 1GD4A 3FCSB 1VQK3 1VQP3 1X1WA 1VQ43 1BNJA 2KXGA 4O02B 4R80A 2Y74A 1DMMA 4HJLB 4JRFA 3DM8A 2P05A 3WMDA 1T3BA 3LOYA 2W9PA 3DH2A 2W9QA 2CWVA 6GSPA 4FMAA 1UCKA 3Q2PA 3NHXA 5BU4A 1HYFA 1N9EA 3N54B 3X3ZA 3DUKA 5JPPA 5D82A 2R41A 2LYXA 2Z77A 3T8NA 4N6OB 3RDEA 1US1A 2HMJB 1GOVA 5DRVA 4FMBA 1JV2B 3DXOA 3UJMA 1J2BA 1IQYA 1Q864 1FGQA 5CXOA 2Z7AA 4HAAA 2P09A 3LT9A
chains in the Genus database with same CATH topology
1OUNA 2IMJA 4FMCA 1YIJ3 2D42A 1IVVA 3CC43 2CK3H 3X41A 4NREA 2F99A 4OK0A 2K0MA 3N8BA 1OF5A 2XRXB 3DZLA 1N5HA 3HX8A 3EN8A 5D81A 2OOVA 3JUPA 5CLKA 2OCTA 2M7OA 3JUOA 4R9LA 3VSYA 4WWUC 4H3UA 4HM1B 4Q53A 1DVDA 1JB5A 1V74A 1VZZA 1SIIA 3IJEB 3OWSA 1NO3A 4FCJA 2OTJ3 1RRLA 3AMOA 1OHSA 1VQM3 5FGOA 3CNMA 4XBXA 2OWPA 1WMNA 2BMOB 4J9AA 1CYVA 2XGLA 4QWTA 1W6YA 2Z76A 4U13A 5G2GA 2HMLB 3B4PA 3X42A 1OGZA 2PZVA 3L0RA 2R4IA 3V98A 1NJI4 2FNQA 4IPBA 1KC84 2E2TA 3LMLA 4XBTA 3V99A 2WO0A 4EC6A 4BTYA 3EF8A 4KFEA 3ER7A 1NWWA 3I563 3EE1A 1FGOA 5BXQA 1W4NA 1QVG2 3I553 3H3HA 3TDGA 4OVMA 4MMYB 1NDOB 1DMNA 1VQN3 1Q814 3CCE3 1VQ53 1A2KA 3OWYA 4WHAA 5ELJA 1C7HA 3BNEA 1IDPA 5ELUA 3JUQA 1JB4A 3F8HA 4MMXB 3CCQ3 2KCDA 3EB8A 3CCL3 3GWRA 3MPHA 5IERA 3NUVA 1O7WB 2K54A 2CFWA 2CH9A 4OUQA 3KZTA 3JUNA 3S67A 1QAFA 2E2VA 3A76A 1A2VA 5EQLA 1W2B2 1IQXA 4GL6A 3MSOA 2XSOB 3BNBA 1RRHA 4G1MB 4I4KA 3H51A 1FGMA 2UX0A 3LH4A 1W02A 1OF5B 2XFSA 1NB3I 1ZO2A 4O8SA 1VQ83 2WGQA 2E2UA 3SX1A 3ROBA 3SOYA 1D6ZA 3KN4A 4AKZA 2QGUA 3F14A 2WOFA 3VGNA 1N5PA 4ORLA 2JQ5A 4N6LA 1IT8A 3MG3A 4KVHA 3AMOB 3CU3A 1K8A4 3DMCA 2XEPA 5HGRA 1CYUA 3CPW2 2I9WA 2CWUA 3FG4A 1GD3A 4LGQA 3WOFB 5CF1A 3K0ZA 1Q824 1Y4KA 4HKVB 1QVF2 2QEX3 3CCR3 3G16A 2GBWB 3E99A 3K9MC 3QRDA 1GY5A 2O9UX 2B24B 4XDVA 1M1K4 5A0OB 5AEWB 1STDA 2BO9B 3UNLA 3FF0A 3T0UA 1YHQ3 1LVNA 1K9M4 3WDGB 4LSOA 1EA2A 1TUHA 2YFLB 4N6NB 1AR0A 1E3VA 1WMOA 3LXUX 2XR8B 4PEJA 3B7CA 4WP5A 4K1UA 2ML5A 1BUQA 3PYJA 4WYKA 3NQYA 4FR9A 1HKXA 5LC6A 2OQEA 4K90B 3HK4A 4HM4B 2Q07A 3FLJA 4RNYA 3CMA3 3F7XA 2C11A 3M8CA 3NX0A 1SIHA 3U97A 1OGXA 3FSDA 4EV2A 3CC23 1M904 2RFRA 3LTDA 4XB5A 4AKYA 4CDLA 1SJWA 3JVCA 3KFQC 3BNDA 2GBXB 5IG4A 1LOXA 5I97A 3K5TA 2GEXA 3DGMA 3PS8A 4MMZB 1EG9B 4RBNA 1UI7A 2BT3A 3Q90A 3DGLA 1PU4A 1D6UA 1JNQA 5KP1A 7STDA 2P0MA 3WODG 3KSPA 1HU9A 1OCVA 1OACA 4HM6B 3FZWA 4O2HA 1UW1A 2BNGA 1LNHA 3LT8A 2OOVC 2CG0A 2FXTA 3ECFA 3N9HA 3WA2X 3NBBA 4EYCA 3V92A 3D9RA 4EXRA 1ULJB 3MHEA 4HM7B 3FG1A 3D3LA 1MNLA 3CCJ3 1NU3A 5JPUA 3CCU3 3NV0A 1IVUA 1IQ8A 5AYRB 1W6CA 6STDA 1S723 1RN7A 1ASKA 1W01A 1EQKA 1W00A 4N3VA 3PCSA 1QJGA 1M9GA 4WYKB 2B1XB 4LMIA 3FGYA 4R9KA 4FCZA 1OH0A 1VQ63 1YIT3 3NQZA 1EKMA 1U5OA 2STDA 3G713 1GYBA 1JKGA 1YGEA 4HZBB 3LTBA 1IVWA 2QIYA 3NXJA 2HMKB 3HZPA 1JN5A 3CNXA 1WNHA 3LTCA 3PCRA 4RZMA 1ULIB 2Z6BA 3EX9A 5KP4A 2GEYA 3SEDA 3UL6A 3LZAA 2RSXA 1AV4A 1FGRA 2YFIB 3WA3A 3GZXB 1M1XB 1UI8A 3RGAA 5IENA 1VQ93 3FKAA 5CF2A 1QALA 1TU5A 5FW5A 2Y73A 4KFFA 3EJVA 2C10A 1YJN3 2GU3A 1Q40A 2A15A 2F86B 4CCVA 3HIGA 1OHPA 1ZX2A 1TP6A 3CME3 5CK6A 1FUWA 4R4KA 2XF3A 1KQS2 1IV9A 3F40A 1IU7A 3KSED 3SVAA 4BTXA 1RJOA 4O3VA 2BMRB 2RGQA 3JUMA 3B4OA 3QK9A 3GZYB 3S28A 1Q7Y4 3GRDA 4LEHA 3T8UA 1AVLA 3NV0B 3LTAA 1N9JA 3IPTA 2XFTA 4ZM8A 5BVBA 1GS3A 3B8LA 1YJW3 1FA3A 2V1LA 5IG5A 2CWTA 3MWZA 3DY5A 3OXAA 1QAKA 1VQ73 1TFOA 3OW22 1JKGB 5TGNA 4MJDA 4TX4A 3EBTA 2W2CA 4J8TA 4R1KA 3S29A 1TFKA 3SOAA 3CCV3 3FG3A 3GZBA 1JN5B 3BB9A 3CPOA 3HI7A 1JJ22 2FGTA 1KWIA 1Z1SA 2W0QA 1O7NB 3BLZA 1R4CA 3X3XA 2OQEC 4GB5A 4IT7A 1E3RA 3EQQB 3OV4A 1W6GA 3CD63 3CCM3 1A90A 3MG2A 2YFJB 3X40A 3K7CA 1GY7A 2CC3A 2HMMB 2W04A 1W7CA 2SBLA 4HVNA 2P38A 1VQL3 2XH9A 1STFI 3PGBA 2INXA 3EN1B 4HM8B 3VF1A 1SPUA 2CFDA 1PFPA 3GAXA 1F8NA 1K28A 1Q40B 5AIFA 4NHFA 3ALAA 4N6V0 1Q42A 3X3YA 2LQVA 3KKGA 4L7KA 4EV5A 4WFOA 2CIUA 3PZWA 1GY6A 1DMQA 4XBYA 3CXC2 1FGTA 2CFKA 1SQWA 3K63A 4STDA 3F7SA 3G6E3 1YVBI 1MOLA 1O7HB 4KZ1A 4N6MA 2W56A 3LYGA 1YI23 4MEIA 4X2HA 1RKYA 3KE7A 4XDWA 5AIIA 3FH1A 1IV7A 3UL5A 3J7Yd 2BMQB 4FCMA 2L4VA 1UUWB 1CQSA 3CCS3 2P0XA 1DYUA 4HM0B 1WQLB 3S27A 4HZ9B 1JRQA 1ROAA 2BHMA 5IG3A 1N8QA 2F98A 5IEPA 5D83A 1IT7A 4X2OA 3UB1A 1KD14 1AVKA 1OHOA 1O7GB 2KRTA 3G8ZA 1L5GB 1VQO3 1K41A 3HIIA 1UUVB 2O3OA 5IEOA 2D1WA 2IUJA 3SLUA 2CW9A 3RGRA 2XSHB 3SXXA 3MKIA 2HMNB 5AYSC 3U1WA 1KSIA 2W6JH 3I0YA 1D6YA 8CHOA 3DGOA 4K1VA 1N8R4 4L8PA 4KFDA 2JDIH 3WOEB 3NBRA 1W5ZA 5IG0A 5AI1A 1U8CB 3F8XA 3IMAB 2CFLA 1K734 3EHCA 2GU1A 3Q1CA 3GZRA 2CFGA 3PXMA 2PNCA 4IIAA 1OPYA 2XGNA 1JB2A 1A67A 1W2ZA 4JF8A 4N6TA 1ROVA 2CKFB 1CEWI 1O7MB 3OX9A 5EEOA 2HMOB 3MYTA 4XM4A 1NB5I 3EBYA 4LZIA 4HYZA 2W03A 4L8OA 2ZL8A 2WOHA 5LC7A 2CHCA 4HM2B 3S5CA 1YJ93 1LXEA 4HM3B 1G96A 3BNCA 3NM7A 4BTWA 4HM5B 3CC73 4EBGA 5KP3A 3F9SA 4AEQA 1WMPA 4HBRA 1ISKA 2MF7A 5STDA 3NM2A 5AIHA 3FF2A 3OWUA 2IUKA 4K61A 3NBJA 5IF6A 1TIJA 1E97A 3EC9A 2WGOA 2MC8A 2W56B 5IW9A 2RCDA 5AEUB 3G4S3 1DVCA 5EVHA 2GXFA 1T5YA 3G0KA 3O8YA 1IK3A 1IVXA 1WTHA 1QMAA 4H61A 2QA43 3STDA 4FMDA 3MG1A 2ML6A 5JBSA 3KIIA 2IA7A 5DREA 2ZDJA 5AIGA 1S5AA 2CG1A 3DGNA 2YX9A 2OTL3 4N6UA 4RNZA 1O7PB 3FCSB 1GD4A 1VQK3 1VQP3 1VQ43 2KXGA 4O02B 4R80A 2Y74A 1DMMA 4HJLB 4JRFA 3DM8A 2P05A 3WMDA 3LOYA 2W9PA 2W9QA 2CWVA 4FMAA 3Q2PA 3NHXA 1N9EA 3N54B 3X3ZA 3DUKA 5JPPA 5D82A 2Z77A 2LYXA 3T8NA 4N6OB 3RDEA 1US1A 2HMJB 5DRVA 4FMBA 1JV2B 3DXOA 3UJMA 1J2BA 1IQYA 1Q864 1FGQA 5CXOA 2Z7AA 2P09A 3LT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUN A;  2IMJ A;  2F99 A;  1OF5 A;  2XRX B;  3DZL A;  3HX8 A;  3EN8 A;  5D81 A;  3JUP A;  5CLK A;  3JUO A;  4R9L A;  3VSY A;  4WWU C;  4H3U A;  4HM1 B;  4Q53 A;  1JB5 A;  1VZZ A;  3OWS A;  4FCJ A;  1OHS A;  3CNM A;  4XBX A;  2OWP A;  2BMO B;  4J9A A;  1W6Y A;  2Z76 A;  5G2G A;  4U13 A;  2HML B;  3B4P A;  1OGZ A;  2PZV A;  2R4I A;  4XBT A;  3EF8 A;  3ER7 A;  1NWW A;  5BXQ A;  3H3H A;  4OVM A;  1NDO B;  1DMN A;  1A2K A;  3OWY A;  1C7H A;  1IDP A;  3JUQ A;  1JB4 A;  3F8H A;  3GWR A;  5IER A;  3NUV A;  1O7W B;  2K54 A;  4OUQ A;  3KZT A;  3JUN A;  3A76 A;  3MSO A;  2XSO B;  4I4K A;  3H51 A;  2UX0 A;  1W02 A;  1OF5 B;  1ZO2 A;  3ROB A;  3SOY A;  2QGU A;  3F14 A;  3VGN A;  4ORL A;  2JQ5 A;  3MG3 A;  4KVH A;  3CU3 A;  3DMC A;  5HGR A;  2I9W A;  4LGQ A;  5CF1 A;  3K0Z A;  4HKV B;  3G16 A;  2GBW B;  3E99 A;  1GY5 A;  2B24 B;  4XDV A;  5AEW B;  1STD A;  3UNL A;  3FF0 A;  1EA2 A;  1TUH A;  2YFL B;  1AR0 A;  1E3V A;  4PEJ A;  2XR8 B;  3B7C A;  4WP5 A;  4K1U A;  1BUQ A;  4WYK A;  1HKX A;  3HK4 A;  4HM4 B;  3FLJ A;  3F7X A;  3M8C A;  1OGX A;  3FSD A;  2RFR A;  4XB5 A;  4CDL A;  1SJW A;  2GBX B;  5IG4 A;  2GEX A;  1EG9 B;  3Q90 A;  5KP1 A;  7STD A;  3KSP A;  1OCV A;  4HM6 B;  3FZW A;  2BNG A;  3ECF A;  3D9R A;  1ULJ B;  3MHE A;  4HM7 B;  1NU3 A;  5JPU A;  3NV0 A;  6STD A;  1ASK A;  1W01 A;  1W00 A;  4N3V A;  1QJG A;  4WYK B;  2B1X B;  4LMI A;  3FGY A;  4R9K A;  1OH0 A;  1U5O A;  2STD A;  1GYB A;  1JKG A;  4HZB B;  2QIY A;  3NXJ A;  2HMK B;  3HZP A;  1JN5 A;  3CNX A;  4RZM A;  1ULI B;  3EX9 A;  5KP4 A;  2GEY A;  3SED A;  3LZA A;  2YFI B;  3GZX B;  3RGA A;  5IEN A;  3FKA A;  5CF2 A;  5FW5 A;  3EJV A;  1Q40 A;  2A15 A;  2F86 B;  1OHP A;  1ZX2 A;  1TP6 A;  5CK6 A;  3F40 A;  2BMR B;  2RGQ A;  3JUM A;  3B4O A;  3GZY B;  3GRD A;  4LEH A;  3T8U A;  3NV0 B;  3IPT A;  5BVB A;  1GS3 A;  3B8L A;  5IG5 A;  3OXA A;  1JKG B;  5TGN A;  4MJD A;  5IF6 A;  3EBT A;  2W2C A;  4J8T A;  4R1K A;  3SOA A;  3GZB A;  1JN5 B;  3BB9 A;  3CPO A;  1Z1S A;  3BLZ A;  1O7N B;  4GB5 A;  1E3R A;  3EQQ B;  3OV4 A;  3MG2 A;  2YFJ B;  3K7C A;  1GY7 A;  2HMM B;  4HVN A;  2INX A;  3EN1 B;  4HM8 B;  1Q40 B;  5AIF A;  1Q42 A;  3KKG A;  4L7K A;  1GY6 A;  1DMQ A;  4XBY A;  4STD A;  3F7S A;  1O7H B;  3LYG A;  4X2H A;  3KE7 A;  4XDW A;  5AII A;  3FH1 A;  2BMQ B;  4FCM A;  1CQS A;  1UUW B;  4HM0 B;  1WQL B;  4HZ9 B;  5IG3 A;  2F98 A;  5IEP A;  5D83 A;  4X2O A;  1OHO A;  1O7G B;  3G8Z A;  1K41 A;  1UUV B;  5IEO A;  3RGR A;  2XSH B;  3MKI A;  2HMN B;  3I0Y A;  8CHO A;  4K1V A;  4L8P A;  3NBR A;  5IG0 A;  5AI1 A;  3F8X A;  3EHC A;  3GZR A;  4IIA A;  1OPY A;  1JB2 A;  2CKF B;  1O7M B;  3OX9 A;  2HMO B;  3MYT A;  4XM4 A;  3EBY A;  4L8O A;  2CHC A;  4HM2 B;  3S5C A;  4HM3 B;  4HM5 B;  5KP3 A;  3F9S A;  1ISK A;  5STD A;  3NM2 A;  5AIH A;  3FF2 A;  3OWU A;  3EC9 A;  1E97 A;  2RCD A;  5AEU B;  5EVH A;  2GXF A;  3G0K A;  1QMA A;  3STD A;  3MG1 A;  5DRE A;  5AIG A;  1S5A A;  1O7P B;  1DMM A;  4HJL B;  3DM8 A;  3WMD A;  3NHX A;  5JPP A;  3DUK A;  5D82 A;  2Z77 A;  3T8N A;  2HMJ B;  5DRV A;  3UJM A;  3DXO A;  5CXO A;  2Z7A A; 
#chains in the Genus database with same CATH topology
 1OUN A;  2IMJ A;  4FMC A;  1YIJ 3;  2D42 A;  1IVV A;  3CC4 3;  2CK3 H;  3X41 A;  4NRE A;  2F99 A;  4OK0 A;  2K0M A;  3N8B A;  1BNF A;  1OF5 A;  2XRX B;  3DZL A;  1N5H A;  3HX8 A;  1BUJ A;  1SAR A;  3EN8 A;  5D81 A;  2RBI A;  2OOV A;  3JUP A;  5CLK A;  2OCT A;  1UCI A;  2M7O A;  3JUO A;  4R9L A;  3VSY A;  1JBS A;  4WWU C;  4H3U A;  4HM1 B;  4Q53 A;  1DVD A;  1JB5 A;  1MGW A;  1V74 A;  1VZZ A;  1SII A;  2C4B A;  1BOX A;  2KF4 A;  3IJE B;  3OWS A;  1NO3 A;  4FCJ A;  2OTJ 3;  1BNI A;  1RRL A;  1OHS A;  3AMO A;  1VQM 3;  5FGO A;  1BRJ A;  3CNM A;  4XBX A;  2OWP A;  4I5Q A;  1WMN A;  2BMO B;  4J9A A;  1CYV A;  1EUI C;  1RNT A;  2XGL A;  4QWT A;  1W6Y A;  2Z76 A;  4U13 A;  5G2G A;  2HML B;  3B4P A;  3X42 A;  1OGZ A;  2PZV A;  3L0R A;  2R4I A;  3V98 A;  1NJI 4;  2FNQ A;  4IPB A;  1C54 A;  1NNV A;  1KC8 4;  1TTO A;  2E2T A;  3LML A;  4XBT A;  3V99 A;  2WO0 A;  3DGY A;  4EC6 A;  4BTY A;  3EF8 A;  4KFE A;  2BIR A;  1NWW A;  3ER7 A;  3I56 3;  3HOH A;  1PYL A;  1FGO A;  3EE1 A;  1W4N A;  5BXQ A;  1DE3 A;  1QVG 2;  3I55 3;  3H3H A;  3TDG A;  4OVM A;  4MMY B;  1NDO B;  1DMN A;  1Q7H A;  1MWR A;  1Q81 4;  3CCE 3;  1VQ5 3;  1VQN 3;  1A2K A;  3OWY A;  7GSP A;  1RGE A;  4WHA A;  5ELJ A;  1C7H A;  1RGA A;  3BNE A;  1IDP A;  5ELU A;  3JUQ A;  1JB4 A;  3F8H A;  4MMX B;  3CCQ 3;  2KCD A;  3EB8 A;  4CPK A;  3GWR A;  3CCL 3;  3MPH A;  5IER A;  3NUV A;  1O7W B;  2K54 A;  2CFW A;  2CH9 A;  4OUQ A;  3KZT A;  3JUN A;  2H0G A;  3S67 A;  1QAF A;  2E2V A;  5M1A A;  1YGW A;  1RLS A;  3A76 A;  1A2V A;  5EQL A;  1W2B 2;  1IQX A;  4GL6 A;  2KF6 A;  3MSO A;  2XSO B;  2KAA A;  3BNB A;  1BRS A;  1RDS A;  1RRH A;  4G1M B;  2CX0 A;  4I4K A;  3H51 A;  1JZD A;  1B2Z A;  1FGM A;  2UX0 A;  1I8V A;  1W02 A;  3LH4 A;  1OF5 B;  2XFS A;  1NB3 I;  1ZO2 A;  4O8S A;  1VQ8 3;  2WGQ A;  2E2U A;  3SX1 A;  3ROB A;  3SOY A;  2ZHX B;  1D6Z A;  1UUG B;  2HOH A;  3KN4 A;  4AKZ A;  5G1K A;  4BL2 A;  2QGU A;  3F14 A;  2WOF A;  3VGN A;  1RCK A;  1N5P A;  4ORL A;  2JQ5 A;  1YVS A;  4N6L A;  1IT8 A;  3MG3 A;  4KVH A;  1RCL A;  3AMO B;  3CU3 A;  1K8A 4;  3DMC A;  1I0V A;  2XEP A;  5HGR A;  1CYU A;  3CPW 2;  2I9W A;  1B2S A;  2CWU A;  3FG4 A;  1GD3 A;  1GMQ A;  3GSP A;  4LGQ A;  1JBT A;  3WOF B;  5CF1 A;  1RGF A;  3K0Z A;  4CJN A;  1Q82 4;  1Y4K A;  1Q9E A;  3D5G A;  4HKV B;  1QVF 2;  2QEX 3;  1MWU A;  3CCR 3;  1I70 A;  3G16 A;  1IYY A;  2GBW B;  1B27 A;  1GSP A;  3E99 A;  3K9M C;  3QRD A;  1GY5 A;  2O9U X;  2B24 B;  4XDV A;  1M1K 4;  5A0O B;  5AEW B;  1STD A;  2BO9 B;  3UNL A;  3FF0 A;  3T0U A;  1YHQ 3;  1LVN A;  1K9M 4;  3WDG B;  2F4Y A;  4LSO A;  1EA2 A;  1TUH A;  1UCL A;  1MWS A;  2YFL B;  2ZA4 A;  4N6N B;  1AR0 A;  1E3V A;  1WMO A;  2CX1 A;  1LQM B;  2XR8 B;  1BNS A;  3B7C A;  3LXU X;  4PEJ A;  4WP5 A;  4K1U A;  2ML5 A;  1BUQ A;  1RGK A;  3PYJ A;  4WYK A;  3NQY A;  4FR9 A;  1HKX A;  4HOH A;  6RNT A;  2SAR A;  5LC6 A;  1DET A;  2OQE A;  4K90 B;  3HK4 A;  3ZFZ A;  4HM4 B;  4BU4 A;  1RNB A;  2Q07 A;  2AAE A;  3FLJ A;  4RNY A;  3CMA 3;  5M18 A;  3F7X A;  2C11 A;  3M8C A;  1TRQ A;  1SIH A;  3NX0 A;  3U97 A;  1OGX A;  3FSD A;  1RGL A;  4EV2 A;  3CC2 3;  1M90 4;  2RFR A;  3LTD A;  4XB5 A;  4AKY A;  4CDL A;  1SJW A;  4GSP A;  3JVC A;  1BRN L;  2BU4 A;  3KFQ C;  3BND A;  2GBX B;  1GOY A;  3AGO A;  1LOX A;  5IG4 A;  5I97 A;  3K5T A;  1UDI I;  2GEX A;  3DGM A;  3PS8 A;  1BRH A;  2F5M A;  4MMZ B;  1EG9 B;  1TRP A;  2UUG C;  4LYL B;  4RBN A;  1UI7 A;  1UGH I;  2BT3 A;  3Q90 A;  3DGL A;  1PU4 A;  1D6U A;  1JNQ A;  5KP1 A;  9RNT A;  7STD A;  2P0M A;  2H0H A;  3WOD G;  3KSP A;  1HU9 A;  1OCV A;  1OAC A;  4HM6 B;  1B20 A;  3FZW A;  4O2H A;  1UW1 A;  2BNG A;  1LNH A;  3LT8 A;  3BIR A;  2OOV C;  2CG0 A;  2FXT A;  3ECF A;  3N9H A;  3WA2 X;  3NBB A;  4EYC A;  2F56 A;  3V92 A;  3D9R A;  1I2G A;  4EXR A;  3D5I A;  1ULJ B;  3MHE A;  1BSC A;  4HM7 B;  3FG1 A;  3D3L A;  1MNL A;  3CCJ 3;  1NU3 A;  5JPU A;  3CCU 3;  2J8X B;  1V58 A;  3NV0 A;  2KF3 A;  1IVU A;  1IQ8 A;  5AYR B;  1W6C A;  6STD A;  1S72 3;  1BRK A;  1LOW A;  1RN7 A;  1ASK A;  1W01 A;  1EQK A;  1B2U A;  1W00 A;  4N3V A;  3PCS A;  4J5K A;  1QJG A;  1X1Y A;  1B2M A;  1M9G A;  4WYK B;  2B1X B;  4LMI A;  3ZG5 A;  3FGY A;  4R9K A;  4FCZ A;  5HOH A;  1OH0 A;  1VQ6 3;  1YIT 3;  3NQZ A;  1FZU A;  1EKM A;  1U5O A;  2STD A;  3G71 3;  1GOU A;  1GYB A;  1JKG A;  1YGE A;  4HZB B;  3LTB A;  1IVW A;  2QIY A;  3NXJ A;  3AGN A;  2HMK B;  3HZP A;  1JN5 A;  3CNX A;  1WNH A;  3LTC A;  1RTU A;  3PCR A;  4RZM A;  1ULI B;  2Z6B A;  3EX9 A;  5KP4 A;  1PY3 A;  2GEY A;  1BIR A;  3SED A;  3UL6 A;  3LZA A;  2RSX A;  1AV4 A;  1FGR A;  2YFI B;  3WA3 A;  3GZX B;  1M1X B;  2L1S A;  1UI8 A;  3RGA A;  5IEN A;  2UGI A;  1UCJ A;  1VQ9 3;  3FKA A;  1I0X A;  5CF2 A;  1BNG A;  1QAL A;  1LRA A;  1TU5 A;  5FW5 A;  4BIR A;  2Y73 A;  4KFF A;  3EJV A;  2C10 A;  1YJN 3;  2GU3 A;  1B21 A;  4RNT A;  1Q40 A;  2K3D A;  2A15 A;  1BRG A;  2F86 B;  4CCV A;  3HIG A;  1OHP A;  1ZX2 A;  1TP6 A;  2GSP A;  5CK6 A;  3CME 3;  1FUW A;  4R4K A;  2XF3 A;  3URP A;  1KQS 2;  1UGI A;  1IV9 A;  3F40 A;  1IU7 A;  3KSE D;  3SVA A;  4BTX A;  2RNT A;  2IY2 A;  1RJO A;  1ZGX A;  4O3V A;  1ZS7 A;  2BMR B;  3A5E A;  5BIR A;  2RGQ A;  3JUM A;  3B4O A;  3QK9 A;  3GZY B;  3S28 A;  1Q7Y 4;  4EW5 A;  3GRD A;  4LEH A;  3T8U A;  1AVL A;  3NV0 B;  1BSE A;  3LTA A;  3D4A A;  1N9J A;  3IPT A;  3WHO A;  1AQZ A;  1RGG A;  1JBR A;  2XFT A;  4ZM8 A;  5BVB A;  1B2X A;  1GS3 A;  3B8L A;  1YJW 3;  1FA3 A;  2V1L A;  1BGS A;  5IG5 A;  2CWT A;  3MWZ A;  1X1X A;  3DY5 A;  3OXA A;  1QAK A;  1BAN A;  1TFO A;  1VQ7 3;  3OW2 2;  1BU4 A;  1JKG B;  5TGN A;  4MJD A;  4TX4 A;  3EBT A;  2W2C A;  1R4Y A;  4J8T A;  4R1K A;  1TFK A;  3S29 A;  3SOA A;  3CCV 3;  3FG3 A;  1LOV A;  1BAO A;  3Q3F A;  3GZB A;  1JZO A;  1JN5 B;  3BB9 A;  3CPO A;  3HI7 A;  1JJ2 2;  2FGT A;  3AHS A;  1KWI A;  1Z1S A;  4KT3 B;  2W0Q A;  1O7N B;  3BLZ A;  1R4C A;  4J5G A;  2OQE C;  4NPB A;  3X3X A;  4GB5 A;  4IT7 A;  1B3S A;  1E3R A;  3EQQ B;  3OV4 A;  1W6G A;  3CD6 3;  3CCM 3;  1A90 A;  3MG2 A;  7RNT A;  1I3F A;  2YFJ B;  3X40 A;  3K7C A;  1CH0 A;  1GY7 A;  2CC3 A;  2HMM B;  1G02 A;  2W04 A;  2F5W A;  1W7C A;  2SBL A;  4HVN A;  1RN1 A;  4DKI A;  1BVI A;  2P38 A;  1VQL 3;  2XH9 A;  1STF I;  3PGB A;  2INX A;  3EN1 B;  1T2H A;  4HM8 B;  3VF1 A;  1SPU A;  1X1U A;  1PFP A;  2CFD A;  3GAX A;  1F8N A;  1K28 A;  1Q40 B;  1RSN A;  5AIF A;  3D79 A;  4NHF A;  3ALA A;  4N6V 0;  1Q42 A;  3X3Y A;  2LQV A;  3KKG A;  4L7K A;  4EV5 A;  1BSA A;  4WFO A;  2CIU A;  3PZW A;  1GY6 A;  1DMQ A;  4XBY A;  3CXC 2;  1FGT A;  2CFK A;  1SQW A;  3K63 A;  4STD A;  3F7S A;  3G6E 3;  1YVB I;  3AHW A;  1MOL A;  1HZ1 A;  1GMR A;  1BNE A;  5GSP A;  1I3I A;  1O7H B;  1VQQ A;  4KZ1 A;  4N6M A;  2W56 A;  3LYG A;  1A2P A;  1YI2 3;  4MEI A;  4X2H A;  1RKY A;  3KE7 A;  4XDW A;  5AII A;  3FH1 A;  1IV7 A;  3UL5 A;  3J7Y d;  1MWT A;  2BMQ B;  4FCM A;  1UUW B;  1GMP A;  1CQS A;  1T2I A;  2L4V A;  3BU4 A;  2P0X A;  1DYU A;  1LQG C;  1RMS A;  4HM0 B;  5M19 A;  1FUT A;  1RHL A;  1WQL B;  3S27 A;  4HZ9 B;  1JRQ A;  1ROA A;  2BHM A;  3CCS 3;  5IG3 A;  1N8Q A;  1ISK A;  2F98 A;  5IEP A;  5D83 A;  1IT7 A;  4X2O A;  3UB1 A;  1LNI A;  1KD1 4;  1AVK A;  1OHO A;  1O7G B;  2KRT A;  3G8Z A;  1L5G B;  1VQO 3;  1K41 A;  3HII A;  1UUV B;  4BL3 A;  2O3O A;  5IEO A;  1RN4 A;  2D1W A;  2IUJ A;  3SLU A;  2CW9 A;  3RGR A;  2XSH B;  3SXX A;  3MKI A;  2HMN B;  5AYS C;  3KCH A;  3U1W A;  1KSI A;  2W6J H;  3I0Y A;  5G1L A;  1D6Y A;  8CHO A;  3DGO A;  3RNT A;  4K1V A;  3WR2 A;  1N8R 4;  4L8P A;  4KFD A;  1BRI A;  2JDI H;  3WOE B;  1YNV X;  3NBR A;  1I2E A;  1W5Z A;  5IG0 A;  5AI1 A;  1U8C B;  3F8X A;  3IMA B;  1LOY A;  2CFL A;  1K73 4;  3EHC A;  2GU1 A;  3Q1C A;  3GZR A;  2CFG A;  3PXM A;  2PNC A;  4IIA A;  1OPY A;  2XGN A;  1JB2 A;  1A67 A;  1V57 A;  1W2Z A;  4JF8 A;  4N6T A;  2KF5 A;  1ROV A;  1FYS A;  1CEW I;  1O7M B;  2CKF B;  2H0I A;  2HMO B;  3OX9 A;  3MYT A;  5EEO A;  8RNT A;  4XM4 A;  1NB5 I;  3EBY A;  4LZI A;  1EEJ A;  1BSD A;  4HYZ A;  2W03 A;  1I2F A;  4L8O A;  2ZL8 A;  1RGC A;  2WOH A;  5LC7 A;  2CHC A;  4HM2 B;  3S5C A;  1YJ9 3;  1LXE A;  4HM3 B;  1G96 A;  3BNC A;  3NM7 A;  4BTW A;  2IYJ A;  4HM5 B;  3CC7 3;  4EBG A;  5KP3 A;  5RNT A;  3F9S A;  1FUS A;  4GHO A;  1WMP A;  4HBR A;  3ZG0 A;  4AEQ A;  2MF7 A;  5STD A;  3NM2 A;  5AIH A;  3FF2 A;  3OWU A;  2IUK A;  4K61 A;  3NBJ A;  5IF6 A;  1TIJ A;  1E97 A;  3EC9 A;  2WGO A;  2MC8 A;  2W56 B;  5IW9 A;  1AY7 A;  2RCD A;  5AEU B;  3G4S 3;  1DVC A;  5EVH A;  3SYU A;  2GXF A;  1BNR A;  1T5Y A;  1RGH A;  3G0K A;  3O8Y A;  1IK3 A;  1IVX A;  1WTH A;  1BSB A;  1QMA A;  4H61 A;  2QA4 3;  3STD A;  1FW7 A;  1TJD A;  4FMD A;  3MG1 A;  2ML6 A;  5JBS A;  3KII A;  2IA7 A;  5DRE A;  2ZDJ A;  5AIG A;  2AAD A;  1G0T A;  1S5A A;  2CG1 A;  3DGN A;  2YX9 A;  2OTL 3;  4ILF A;  4N6U A;  4RNZ A;  1O7P B;  1MGR A;  1GD4 A;  3FCS B;  1VQK 3;  1VQP 3;  1X1W A;  1VQ4 3;  1BNJ A;  2KXG A;  4O02 B;  4R80 A;  2Y74 A;  1DMM A;  4HJL B;  4JRF A;  3DM8 A;  2P05 A;  3WMD A;  1T3B A;  3LOY A;  2W9P A;  3DH2 A;  2W9Q A;  2CWV A;  6GSP A;  4FMA A;  1UCK A;  3Q2P A;  3NHX A;  5BU4 A;  1HYF A;  1N9E A;  3N54 B;  3X3Z A;  3DUK A;  5JPP A;  5D82 A;  2R41 A;  2LYX A;  2Z77 A;  3T8N A;  4N6O B;  3RDE A;  1US1 A;  2HMJ B;  1GOV A;  5DRV A;  4FMB A;  1JV2 B;  3DXO A;  3UJM A;  1J2B A;  1IQY A;  1Q86 4;  1FGQ A;  5CXO A;  2Z7A A;  4HAA A;  2P09 A;  3LT9 A; 
#chains in the Genus database with same CATH homology
 1OUN A;  2IMJ A;  4FMC A;  1YIJ 3;  2D42 A;  1IVV A;  3CC4 3;  2CK3 H;  3X41 A;  4NRE A;  2F99 A;  4OK0 A;  2K0M A;  3N8B A;  1OF5 A;  2XRX B;  3DZL A;  1N5H A;  3HX8 A;  3EN8 A;  5D81 A;  2OOV A;  3JUP A;  5CLK A;  2OCT A;  2M7O A;  3JUO A;  4R9L A;  3VSY A;  4WWU C;  4H3U A;  4HM1 B;  4Q53 A;  1DVD A;  1JB5 A;  1V74 A;  1VZZ A;  1SII A;  3IJE B;  3OWS A;  1NO3 A;  4FCJ A;  2OTJ 3;  1RRL A;  3AMO A;  1OHS A;  1VQM 3;  5FGO A;  3CNM A;  4XBX A;  2OWP A;  1WMN A;  2BMO B;  4J9A A;  1CYV A;  2XGL A;  4QWT A;  1W6Y A;  2Z76 A;  4U13 A;  5G2G A;  2HML B;  3B4P A;  3X42 A;  1OGZ A;  2PZV A;  3L0R A;  2R4I A;  3V98 A;  1NJI 4;  2FNQ A;  4IPB A;  1KC8 4;  2E2T A;  3LML A;  4XBT A;  3V99 A;  2WO0 A;  4EC6 A;  4BTY A;  3EF8 A;  4KFE A;  3ER7 A;  1NWW A;  3I56 3;  3EE1 A;  1FGO A;  5BXQ A;  1W4N A;  1QVG 2;  3I55 3;  3H3H A;  3TDG A;  4OVM A;  4MMY B;  1NDO B;  1DMN A;  1VQN 3;  1Q81 4;  3CCE 3;  1VQ5 3;  1A2K A;  3OWY A;  4WHA A;  5ELJ A;  1C7H A;  3BNE A;  1IDP A;  5ELU A;  3JUQ A;  1JB4 A;  3F8H A;  4MMX B;  3CCQ 3;  2KCD A;  3EB8 A;  3CCL 3;  3GWR A;  3MPH A;  5IER A;  3NUV A;  1O7W B;  2K54 A;  2CFW A;  2CH9 A;  4OUQ A;  3KZT A;  3JUN A;  3S67 A;  1QAF A;  2E2V A;  3A76 A;  1A2V A;  5EQL A;  1W2B 2;  1IQX A;  4GL6 A;  3MSO A;  2XSO B;  3BNB A;  1RRH A;  4G1M B;  4I4K A;  3H51 A;  1FGM A;  2UX0 A;  3LH4 A;  1W02 A;  1OF5 B;  2XFS A;  1NB3 I;  1ZO2 A;  4O8S A;  1VQ8 3;  2WGQ A;  2E2U A;  3SX1 A;  3ROB A;  3SOY A;  1D6Z A;  3KN4 A;  4AKZ A;  2QGU A;  3F14 A;  2WOF A;  3VGN A;  1N5P A;  4ORL A;  2JQ5 A;  4N6L A;  1IT8 A;  3MG3 A;  4KVH A;  3AMO B;  3CU3 A;  1K8A 4;  3DMC A;  2XEP A;  5HGR A;  1CYU A;  3CPW 2;  2I9W A;  2CWU A;  3FG4 A;  1GD3 A;  4LGQ A;  3WOF B;  5CF1 A;  3K0Z A;  1Q82 4;  1Y4K A;  4HKV B;  1QVF 2;  2QEX 3;  3CCR 3;  3G16 A;  2GBW B;  3E99 A;  3K9M C;  3QRD A;  1GY5 A;  2O9U X;  2B24 B;  4XDV A;  1M1K 4;  5A0O B;  5AEW B;  1STD A;  2BO9 B;  3UNL A;  3FF0 A;  3T0U A;  1YHQ 3;  1LVN A;  1K9M 4;  3WDG B;  4LSO A;  1EA2 A;  1TUH A;  2YFL B;  4N6N B;  1AR0 A;  1E3V A;  1WMO A;  3LXU X;  2XR8 B;  4PEJ A;  3B7C A;  4WP5 A;  4K1U A;  2ML5 A;  1BUQ A;  3PYJ A;  4WYK A;  3NQY A;  4FR9 A;  1HKX A;  5LC6 A;  2OQE A;  4K90 B;  3HK4 A;  4HM4 B;  2Q07 A;  3FLJ A;  4RNY A;  3CMA 3;  3F7X A;  2C11 A;  3M8C A;  3NX0 A;  1SIH A;  3U97 A;  1OGX A;  3FSD A;  4EV2 A;  3CC2 3;  1M90 4;  2RFR A;  3LTD A;  4XB5 A;  4AKY A;  4CDL A;  1SJW A;  3JVC A;  3KFQ C;  3BND A;  2GBX B;  5IG4 A;  1LOX A;  5I97 A;  3K5T A;  2GEX A;  3DGM A;  3PS8 A;  4MMZ B;  1EG9 B;  4RBN A;  1UI7 A;  2BT3 A;  3Q90 A;  3DGL A;  1PU4 A;  1D6U A;  1JNQ A;  5KP1 A;  7STD A;  2P0M A;  3WOD G;  3KSP A;  1HU9 A;  1OCV A;  1OAC A;  4HM6 B;  3FZW A;  4O2H A;  1UW1 A;  2BNG A;  1LNH A;  3LT8 A;  2OOV C;  2CG0 A;  2FXT A;  3ECF A;  3N9H A;  3WA2 X;  3NBB A;  4EYC A;  3V92 A;  3D9R A;  4EXR A;  1ULJ B;  3MHE A;  4HM7 B;  3FG1 A;  3D3L A;  1MNL A;  3CCJ 3;  1NU3 A;  5JPU A;  3CCU 3;  3NV0 A;  1IVU A;  1IQ8 A;  5AYR B;  1W6C A;  6STD A;  1S72 3;  1RN7 A;  1ASK A;  1W01 A;  1EQK A;  1W00 A;  4N3V A;  3PCS A;  1QJG A;  1M9G A;  4WYK B;  2B1X B;  4LMI A;  3FGY A;  4R9K A;  4FCZ A;  1OH0 A;  1VQ6 3;  1YIT 3;  3NQZ A;  1EKM A;  1U5O A;  2STD A;  3G71 3;  1GYB A;  1JKG A;  1YGE A;  4HZB B;  3LTB A;  1IVW A;  2QIY A;  3NXJ A;  2HMK B;  3HZP A;  1JN5 A;  3CNX A;  1WNH A;  3LTC A;  3PCR A;  4RZM A;  1ULI B;  2Z6B A;  3EX9 A;  5KP4 A;  2GEY A;  3SED A;  3UL6 A;  3LZA A;  2RSX A;  1AV4 A;  1FGR A;  2YFI B;  3WA3 A;  3GZX B;  1M1X B;  1UI8 A;  3RGA A;  5IEN A;  1VQ9 3;  3FKA A;  5CF2 A;  1QAL A;  1TU5 A;  5FW5 A;  2Y73 A;  4KFF A;  3EJV A;  2C10 A;  1YJN 3;  2GU3 A;  1Q40 A;  2A15 A;  2F86 B;  4CCV A;  3HIG A;  1OHP A;  1ZX2 A;  1TP6 A;  3CME 3;  5CK6 A;  1FUW A;  4R4K A;  2XF3 A;  1KQS 2;  1IV9 A;  3F40 A;  1IU7 A;  3KSE D;  3SVA A;  4BTX A;  1RJO A;  4O3V A;  2BMR B;  2RGQ A;  3JUM A;  3B4O A;  3QK9 A;  3GZY B;  3S28 A;  1Q7Y 4;  3GRD A;  4LEH A;  3T8U A;  1AVL A;  3NV0 B;  3LTA A;  1N9J A;  3IPT A;  2XFT A;  4ZM8 A;  5BVB A;  1GS3 A;  3B8L A;  1YJW 3;  1FA3 A;  2V1L A;  5IG5 A;  2CWT A;  3MWZ A;  3DY5 A;  3OXA A;  1QAK A;  1VQ7 3;  1TFO A;  3OW2 2;  1JKG B;  5TGN A;  4MJD A;  4TX4 A;  3EBT A;  2W2C A;  4J8T A;  4R1K A;  3S29 A;  1TFK A;  3SOA A;  3CCV 3;  3FG3 A;  3GZB A;  1JN5 B;  3BB9 A;  3CPO A;  3HI7 A;  1JJ2 2;  2FGT A;  1KWI A;  1Z1S A;  2W0Q A;  1O7N B;  3BLZ A;  1R4C A;  3X3X A;  2OQE C;  4GB5 A;  4IT7 A;  1E3R A;  3EQQ B;  3OV4 A;  1W6G A;  3CD6 3;  3CCM 3;  1A90 A;  3MG2 A;  2YFJ B;  3X40 A;  3K7C A;  1GY7 A;  2CC3 A;  2HMM B;  2W04 A;  1W7C A;  2SBL A;  4HVN A;  2P38 A;  1VQL 3;  2XH9 A;  1STF I;  3PGB A;  2INX A;  3EN1 B;  4HM8 B;  3VF1 A;  1SPU A;  2CFD A;  1PFP A;  3GAX A;  1F8N A;  1K28 A;  1Q40 B;  5AIF A;  4NHF A;  3ALA A;  4N6V 0;  1Q42 A;  3X3Y A;  2LQV A;  3KKG A;  4L7K A;  4EV5 A;  4WFO A;  2CIU A;  3PZW A;  1GY6 A;  1DMQ A;  4XBY A;  3CXC 2;  1FGT A;  2CFK A;  1SQW A;  3K63 A;  4STD A;  3F7S A;  3G6E 3;  1YVB I;  1MOL A;  1O7H B;  4KZ1 A;  4N6M A;  2W56 A;  3LYG A;  1YI2 3;  4MEI A;  4X2H A;  1RKY A;  3KE7 A;  4XDW A;  5AII A;  3FH1 A;  1IV7 A;  3UL5 A;  3J7Y d;  2BMQ B;  4FCM A;  2L4V A;  1UUW B;  1CQS A;  3CCS 3;  2P0X A;  1DYU A;  4HM0 B;  1WQL B;  3S27 A;  4HZ9 B;  1JRQ A;  1ROA A;  2BHM A;  5IG3 A;  1N8Q A;  2F98 A;  5IEP A;  5D83 A;  1IT7 A;  4X2O A;  3UB1 A;  1KD1 4;  1AVK A;  1OHO A;  1O7G B;  2KRT A;  3G8Z A;  1L5G B;  1VQO 3;  1K41 A;  3HII A;  1UUV B;  2O3O A;  5IEO A;  2D1W A;  2IUJ A;  3SLU A;  2CW9 A;  3RGR A;  2XSH B;  3SXX A;  3MKI A;  2HMN B;  5AYS C;  3U1W A;  1KSI A;  2W6J H;  3I0Y A;  1D6Y A;  8CHO A;  3DGO A;  4K1V A;  1N8R 4;  4L8P A;  4KFD A;  2JDI H;  3WOE B;  3NBR A;  1W5Z A;  5IG0 A;  5AI1 A;  1U8C B;  3F8X A;  3IMA B;  2CFL A;  1K73 4;  3EHC A;  2GU1 A;  3Q1C A;  3GZR A;  2CFG A;  3PXM A;  2PNC A;  4IIA A;  1OPY A;  2XGN A;  1JB2 A;  1A67 A;  1W2Z A;  4JF8 A;  4N6T A;  1ROV A;  2CKF B;  1CEW I;  1O7M B;  3OX9 A;  5EEO A;  2HMO B;  3MYT A;  4XM4 A;  1NB5 I;  3EBY A;  4LZI A;  4HYZ A;  2W03 A;  4L8O A;  2ZL8 A;  2WOH A;  5LC7 A;  2CHC A;  4HM2 B;  3S5C A;  1YJ9 3;  1LXE A;  4HM3 B;  1G96 A;  3BNC A;  3NM7 A;  4BTW A;  4HM5 B;  3CC7 3;  4EBG A;  5KP3 A;  3F9S A;  4AEQ A;  1WMP A;  4HBR A;  1ISK A;  2MF7 A;  5STD A;  3NM2 A;  5AIH A;  3FF2 A;  3OWU A;  2IUK A;  4K61 A;  3NBJ A;  5IF6 A;  1TIJ A;  1E97 A;  3EC9 A;  2WGO A;  2MC8 A;  2W56 B;  5IW9 A;  2RCD A;  5AEU B;  3G4S 3;  1DVC A;  5EVH A;  2GXF A;  1T5Y A;  3G0K A;  3O8Y A;  1IK3 A;  1IVX A;  1WTH A;  1QMA A;  4H61 A;  2QA4 3;  3STD A;  4FMD A;  3MG1 A;  2ML6 A;  5JBS A;  3KII A;  2IA7 A;  5DRE A;  2ZDJ A;  5AIG A;  1S5A A;  2CG1 A;  3DGN A;  2YX9 A;  2OTL 3;  4N6U A;  4RNZ A;  1O7P B;  3FCS B;  1GD4 A;  1VQK 3;  1VQP 3;  1VQ4 3;  2KXG A;  4O02 B;  4R80 A;  2Y74 A;  1DMM A;  4HJL B;  4JRF A;  3DM8 A;  2P05 A;  3WMD A;  3LOY A;  2W9P A;  2W9Q A;  2CWV A;  4FMA A;  3Q2P A;  3NHX A;  1N9E A;  3N54 B;  3X3Z A;  3DUK A;  5JPP A;  5D82 A;  2Z77 A;  2LYX A;  3T8N A;  4N6O B;  3RDE A;  1US1 A;  2HMJ B;  5DRV A;  4FMB A;  1JV2 B;  3DXO A;  3UJM A;  1J2B A;  1IQY A;  1Q86 4;  1FGQ A;  5CXO A;  2Z7A A;  2P09 A;  3LT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...