1QMAA

Nuclear transport factor 2 (ntf2) w7a mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
b'GDKPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title Interaction Betweeen Ntf2 and Xfxfg-Containing Nucleoporins is Required to Mediate Nuclear Import of Ran-Gdp
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport
total genus 35
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1qmaA00
3EC9A 1Z1SA 3HX8A 4HVNA 1OHOA 2XRXB 5KP1A 1ASKA 4Q53A 3HK4A 3EQQB 3B4PA 3JUOA 2OWPA 5BVBA 1GY7A 1SJWA 1O7GB 3MYTA 2INXA 1Q40B 2HMMB 3F8HA 4XM4A 4KVHA 5CLKA 4XBTA 5HGRA 1DMMA 3OV4A 2GXFA 3KE7A 2YFIB 3G16A 1OUNA 2GEXA 6STDA 1O7HB 5JPPA 3EBYA 4WYKB 8CHOA 1Q42A 3GZBA 3KSPA 1UUWB 5BXQA 5CF1A 2QGUA 1E97A 1ULJB 3NV0B 4XDWA 2BMOB 4X2HA 5KP3A 2GEYA 2F98A 1VZZA 5IERA 1GY6A 5JPUA 3HZPA 2Z77A 3EJVA 3LYGA 3H3HA 1W00A 3CPOA 4WWUC 1DMNA 3K0ZA 1K41A 5IG3A 3G0KA 3ROBA 1OHSA 1OCVA 4L7KA 3CNXA 4LGQA 3M8CA 5D83A 1STDA 2F99A 4I4KA 3UNLA 3F9SA 2QIYA 2UX0A 1EG9B 1U5OA 3VSYA 1WQLB 1NWWA 4HM0B 5IF6A 2RGQA 5IEPA 3D9RA 4GB5A 5EVHA 1ULIB 4R1KA 2RFRA 5IG0A 3FF0A 1JB5A 1JN5A 2YFLB 2K54A 1OH0A 2W2CA 3NM2A 5TGNA 3NXJA 3T8UA 2XSOB 3FKAA 7STDA 3MG1A 3FH1A 4J9AA 2BMQB 3GZRA 3T8NA 3JUNA 5AI1A 5AIIA 1JB4A 4XBXA 3BLZA 1JKGB 4IIAA 3OWUA 3CU3A 2HMNB 3I0YA 3DMCA 3LZAA 1JKGA 3NUVA 4HM4B 1OF5A 3E99A 4N3VA 3NHXA 3FZWA 1QMAA 4CDLA 3EN8A 4R9KA 3K7CA 3UJMA 3FLJA 1W02A 3MSOA 2CHCA 5AEWB 2YFJB 1A2KA 5AEUB 2F86B 4LMIA 5AIHA 1OGXA 2Z7AA 3GWRA 1TUHA 5AIFA 3CNMA 1GS3A 3MKIA 5CF2A 1AR0A 3DM8A 3RGRA 5D81A 3MG2A 3MHEA 1OGZA 4OUQA 3WMDA 4L8OA 3B7CA 3FSDA 1GY5A 3RGAA 1O7WB 4FCMA 3EHCA 4HJLB 4J8TA 2R4IA 2IMJA 2HMKB 1EA2A 3OX9A 3DXOA 5IG4A 1E3RA 3DZLA 3GRDA 4K1VA 5AIGA 4HZBB 1ZO2A 3FGYA 3SEDA 1NU3A 3GZYB 3SOAA 3NBRA 1OHPA 1ZX2A 1QJGA 2Z76A 4XB5A 3EBTA 5CXOA 1JN5B 1TP6A 5KP4A 3Q90A 3SOYA 4LEHA 3F7XA 1W6YA 4MJDA 4HKVB 1UUVB 3VGNA 1GYBA 3JUQA 3KKGA 3MG3A 1OF5B 4HM2B 3IPTA 4PEJA 4U13A 1CQSA 4HZ9B 4X2OA 1O7MB 3F7SA 3B4OA 4FCJA 2HMLB 5DREA 1NDOB 2XSHB 1O7PB 5G2GA 4HM8B 4HM6B 3H51A 1Q40A 4ORLA 4HM7B 3F8XA 2BNGA 5IG5A 3OWYA 3B8LA 4RZMA 5D82A 3KZTA 3A76A 3ER7A 1E3VA 3ECFA 4XDVA 2GBXB 5DRVA 3S5CA 3STDA 4K1UA 2RCDA 4WYKA 1W01A 1IDPA 2CKFB 3EN1B 3OXAA 5IEOA 2BMRB 4XBYA 2STDA 1ISKA 2JQ5A 2XR8B 3JUMA 2HMJB 1DMQA 1S5AA 3NV0A 4R9LA 2A15A 3EF8A 3GZXB 3BB9A 1BUQA 2B1XB 3OWSA 4HM5B 3G8ZA 2GBWB 3JUPA 4OVMA 5FW5A 4HM1B 5STDA 1OPYA 2I9WA 2PZVA 1O7NB 4L8PA 3F40A 5IENA 3EX9A 3FF2A 3F14A 1HKXA 4HM3B 1JB2A 1C7HA 5CK6A 4STDA 4WP5A 2HMOB 4H3UA 3DUKA 2B24B
chains in the Genus database with same CATH superfamily
3CME3 1TU5A 3EC9A 3CCQ3 1Z1SA 3HX8A 1SARA 4HVNA 1OHOA 2XRXB 6GSPA 5KP1A 2ZDJA 1PFPA 2CWUA 1QALA 1EKMA 1ASKA 4Q53A 3CPW2 4AKZA 3HK4A 3AGOA 1LNHA 2L4VA 2RBIA 3EQQB 3LT9A 4QWTA 3B4PA 1BVIA 2F4YA 1T2HA 1B3SA 3GSPA 1RKYA 1TRQA 4K90B 2K3DA 3O8YA 1VQL3 3JUOA 2OWPA 3AHSA 5BVBA 1YIJ3 1AV4A 1GY7A 1SJWA 1O7GB 3ALAA 2OQEA 3MYTA 3PS8A 2INXA 1Q40B 2QA43 1YNVX 1BRKA 4BTYA 3JVCA 2W56A 2O3OA 1YJN3 1EQKA 1VQ53 1IVXA 2HMMB 3F8HA 4XM4A 4KVHA 2ZHXB 1FYSA 4XBTA 5CLKA 2QEX3 3CCM3 1I0VA 1Q7Y4 5HGRA 1DMMA 3X42A 3OV4A 1I0XA 2GXFA 3KE7A 2JDIH 5G1KA 1QVF2 1RN7A 1SIIA 1UCKA 1W2ZA 3LH4A 1BRIA 3K63A 2YFIB 1NB3I 3G16A 3S28A 1OUNA 1S723 1JBRA 2GEXA 6STDA 3SX1A 1O7HB 5JPPA 1EEJA 3EBYA 4WYKB 3G4S3 1RDSA 8CHOA 1UI7A 2BU4A 2E2VA 1Q42A 1Q7HA 3GZBA 3Q2PA 1K28A 2XH9A 4MMXB 3WHOA 3CC23 1LOWA 1BANA 4N6LA 4KZ1A 3KSPA 1UUWB 4BTWA 5BXQA 1IVUA 5HOHA 1BNFA 1SPUA 5LC7A 4K61A 5CF1A 2QGUA 1E97A 4MMZB 1I2FA 5LC6A 1I8VA 1ULJB 3NV0B 5G1LA 1TJDA 4FR9A 1BAOA 2KF5A 4XDWA 2BMOB 2CG0A 1G02A 1GMQA 4KFDA 4X2HA 1T2IA 2J8XB 2GEYA 3KIIA 2F98A 5KP3A 1VZZA 4DKIA 2LYXA 1UI8A 4OK0A 5IERA 4LSOA 1GY6A 3U97A 4GL6A 5EEOA 1FUWA 5JPUA 3LTAA 3HZPA 1LXEA 2Z77A 3EJVA 3X41A 1IU7A 1WNHA 1I70A 2OTL3 1VQM3 3LYGA 4AEQA 2KF6A 3BNCA 2P05A 1GMRA 3H3HA 1W00A 1TIJA 1UCJA 2O9UX 4ZM8A 1RGHA 1GD4A 2XGNA 3PXMA 3CPOA 2D1WA 1UW1A 1VQ63 1ROVA 4G1MB 4WWUC 3KCHA 2WOFA 3CC73 1DMNA 1I3FA 1JJ22 3K0ZA 1VQ93 3CCS3 3BIRA 2C11A 1YJW3 1NJI4 1K41A 2CX0A 2ML5A 3WDGB 1RRLA 4N6V0 5IG3A 3IMAB 1DETA 1I2EA 2CFKA 3G0KA 1W2B2 4HYZA 3ROBA 1OHSA 1V57A 1M1XB 2ML6A 1BUJA 1OCVA 4L7KA 3CNXA 3UL5A 4LGQA 1R4CA 4N6NB 2CX1A 3AGNA 3M8CA 5D83A 1QAFA 1STDA 2C10A 2F99A 5AYRB 4I4KA 3DGOA 3SXXA 3UNLA 5RNTA 3F9SA 1ZS7A 2QIYA 2UX0A 1EG9B 3Q1CA 1U5OA 3VSYA 1WQLB 4CCVA 3WA2X 1NWWA 3S29A 2P0XA 4HM0B 5IF6A 1VQO3 1B27A 2RGQA 5IEOA 4BL2A 5IEPA 2GU3A 3D9RA 2FGTA 3RDEA 3CC43 3CCV3 1RRHA 4GB5A 2Z6BA 1BSEA 1YVSA 5EVHA 1ULIB 1BNJA 1LOXA 4R1KA 9RNTA 2KXGA 2OTJ3 3D5IA 3WODG 2RFRA 1RN4A 5IG0A 3FF0A 1JB5A 1JN5A 2YFLB 2K54A 1IQ8A 2CFLA 5GSPA 3CCJ3 1OH0A 3N9HA 2W2CA 1AY7A 3G713 3NM2A 5TGNA 1VQ43 3HOHA 3NXJA 3T8UA 2XSOB 1FA3A 2UUGC 2Y74A 1BIRA 2OQEC 3FKAA 4EW5A 2FXTA 3X3XA 7STDA 3MG1A 3MPHA 2BHMA 3FH1A 4J9AA 1IV9A 3LMLA 4FMBA 1W6GA 2BMQB 1CYUA 3GZRA 3JUNA 5AI1A 5AIIA 3T8NA 1JB4A 3PYJA 8RNTA 1BRHA 4XBXA 3BLZA 3K5TA 1YI23 1JKGB 1BRNL 1A67A 4IIAA 3OWUA 3CU3A 1T3BA 2HMNB 3DMCA 3I0YA 3CCU3 2W56B 3LZAA 1MGRA 1JKGA 3NUVA 1L5GB 4HM4B 2XFTA 5AYSC 1VQP3 1IQXA 1M9GA 4WHAA 1B20A 3QRDA 1OF5A 3E99A 4N3VA 1G96A 1FGQA 3FZWA 1QMAA 3NHXA 3LTBA 1BNSA 4CDLA 1BNRA 1LOYA 3URPA 2M7OA 2W9QA 2MF7A 4KFFA 1ZGXA 2P09A 1SIHA 3EN8A 3NBBA 4BL3A 1HU9A 4R9KA 5A0OB 7GSPA 1MOLA 2CK3H 4O8SA 1LQMB 1BRSA 2W6JH 3K7CA 3KFQC 2CC3A 5FGOA 3U1WA 2XGLA 3HI7A 3UJMA 4HBRA 1V58A 3FLJA 1W02A 1Y4KA 3AHWA 1R4YA 3MSOA 2CHCA 5AEWB 2YFJB 1A2KA 1LOVA 2BIRA 3X40A 3LTDA 5AEUB 2BO9B 2F86B 4LMIA 5AIHA 1NO3A 1OGXA 2AAEA 3K9MC 1FGOA 2Q07A 2KCDA 4KT3B 1B2MA 3SVAA 2Z7AA 2IY2A 1TUHA 3GWRA 5AIFA 1DVDA 4FMAA 1BSDA 3CNMA 3MWZA 1MWUA 1US1A 1GS3A 3MKIA 3X3YA 1U8CB 5CF2A 1AR0A 1GMPA 3DM8A 3RGRA 3ZG5A 1Q9EA 1YJ93 1BNEA 5I97A 2F5WA 4EYCA 1FGTA 4RBNA 5D81A 1RJOA 1M1K4 3MG2A 4EV5A 3WA3A 3MHEA 4N6MA 2CWVA 1YIT3 3KSED 2RSXA 1UDII 4LYLB 2F5MA 1OGZA 3NBJA 2YX9A 4OUQA 3WMDA 2LQVA 4L8OA 1RGLA 1X1XA 3B7CA 1IYYA 3FSDA 1GY5A 3DGLA 3RGAA 1RCLA 1O7WB 2KAAA 4FCMA 2D42A 3EHCA 4HJLB 1RGCA 2XF3A 4J8TA 2IUJA 3V98A 1JV2B 1N5HA 2R4IA 2IMJA 1IT7A 2E2TA 4ILFA 1JZDA 1RGAA 2IA7A 2HMKB 7RNTA 1IV7A 1EA2A 3CD63 4O3VA 3D79A 1JZOA 1UUGB 3LTCA 3OX9A 4EBGA 1OACA 1MGWA 3DXOA 1TFOA 5IG4A 3VF1A 1QVG2 1E3RA 3J7Yd 1BU4A 3DZLA 1EUIC 3GRDA 1YGEA 4IT7A 1GOVA 4K1VA 2V1LA 1JBTA 5AIGA 3CXC2 1KWIA 1UCLA 2OOVA 2H0HA 1I2GA 2CIUA 4HZBB 1ZO2A 3FGYA 1IK3A 4O2HA 4RNYA 1NU3A 3SEDA 1MWSA 2CW9A 2E2UA 3GZYB 4NREA 3NBRA 3SOAA 4EXRA 2CH9A 1OHPA 1SQWA 6RNTA 1DYUA 1ZX2A 1PYLA 1VQK3 1B2SA 1QJGA 1BRGA 2WGOA 2C4BA 4CPKA 2Z76A 1RCKA 5M1AA 1G0TA 3EBTA 4XB5A 5CXOA 1JN5B 1TP6A 5KP4A 3Q90A 1N5PA 4AKYA 3DGNA 5M19A 1RGFA 4JF8A 2ZL8A 5M18A 4J5GA 1ROAA 2FNQA 4JRFA 5JBSA 4EC6A 3BNBA 3SOYA 3A5EA 1BRJA 3D4AA 3L0RA 1GOYA 4LEHA 3FCSB 4N6OB 1X1WA 2P38A 1LRAA 1UCIA 2H0IA 1IVWA 4MEIA 3EB8A 3F7XA 1W6YA 2W0QA 4MJDA 1JBSA 4HKVB 1FW7A 1W5ZA 1UUVB 1DVCA 1RSNA 3VGNA 1F8NA 1KQS2 1GYBA 1VQQA 3AMOA 3JUQA 3NQYA 1TRPA 4HAAA 4KFEA 2K0MA 3KKGA 4FMCA 1LQGC 5ELJA 1GSPA 3MG3A 4N6TA 2IYJA 1N8R4 1IQYA 1MWRA 3TDGA 4GHOA 3T0UA 3LOYA 1FUSA 1OF5B 2PNCA 1GOUA 3N54B 3CCR3 1A90A 1RNTA 1N8QA 3PZWA 4EV2A 1Q814 3CCE3 1YHQ3 1K734 4HM2B 2CFWA 3IPTA 3N8BA 2R41A 4PEJA 4U13A 4R4KA 1CQSA 1DE3A 1LVNA 4HZ9B 4X2OA 2XFSA 1O7MB 3F7SA 1N9EA 3B4OA 3BNDA 1STFI 2KF3A 4FCJA 2HMLB 5DREA 3I553 1KD14 1NDOB 2XSHB 3KN4A 1VQ73 1UGHI 3SYUA 1BNGA 1O7PB 4FCZA 2GU1A 5G2GA 1KC84 4HM8B 1MNLA 2MC8A 2KF4A 1B2UA 3WR2A 4HM6B 3H51A 1KSIA 1AQZA 1Q40A 3HIIA 4ORLA 1RMSA 1TTOA 4HM7B 3F8XA 3RNTA 2BNGA 1CEWI 1RLSA 5IG5A 3NQZA 3OWYA 3B8LA 1A2PA 3SLUA 4RZMA 3LT8A 1FGMA 2OCTA 4IPBA 1X1YA 2WGQA 1UGIA 2ZA4A 3BNEA 5D82A 3KZTA 3A76A 1HZ1A 3PGBA 3ER7A 1E3VA 3ECFA 3S27A 1VQN3 1J2BA 1RHLA 4XDVA 4FMDA 1HYFA 2XEPA 4O02B 1B21A 3UL6A 3G6E3 1NB5I 3CMA3 2GBXB 5DRVA 3S5CA 1BSAA 3STDA 4K1UA 1V74A 5BU4A 1K9M4 3OW22 1N9JA 1FGRA 2RCDA 3Q3FA 1C54A 3PCRA 4WYKA 2SARA 3WOEB 2CWTA 2GSPA 1RGEA 1TFKA 1IT8A 1W4NA 1W01A 1IDPA 3ZFZA 3DH2A 2CKFB 3EN1B 1MWTA 3OXAA 4TX4A 1M904 2CG1A 3HIGA 1YGWA 2BMRB 2L1SA 2W03A 3DY5A 4I5QA 1D6UA 2STDA 4XBYA 3FG3A 2JQ5A 2XR8B 4MMYB 1ISKA 2CFDA 3JUMA 1A2VA 1RGKA 2HMJB 4RNZA 1DMQA 3EE1A 3V92A 1FZUA 1S5AA 1WMNA 3NV0A 1CH0A 2A15A 4R9LA 1Q824 3EF8A 3GZXB 1RTUA 3BB9A 1YVBI 1W7CA 4H61A 2OOVC 4GSPA 1PY3A 2IUKA 2W9PA 2UGIA 1BUQA 2B1XB 2H0GA 2F56A 3PCSA 3OWSA 2AADA 4HM5B 3G8ZA 1BNIA 4LZIA 1BGSA 4BU4A 1I3IA 3DGYA 2GBWB 1NNVA 3JUPA 2KRTA 3GAXA 3ZG0A 1WTHA 3D3LA 3NM7A 4OVMA 5FW5A 2CFGA 1FUTA 2SBLA 4CJNA 4N6UA 3V99A 4HM1B 4NHFA 5STDA 1OPYA 1BOXA 2I9WA 2Y73A 3IJEB 2PZVA 1O7NB 1K8A4 3FG4A 4L8PA 4NPBA 1CYVA 1B2ZA 3NX0A 3CCL3 3F40A 3LXUX 3QK9A 1RN1A 1X1UA 5IENA 1B2XA 5IW9A 1VQ83 2BT3A 2WOHA 3EX9A 4BTXA 1AVKA 2W04A 3FF2A 2RNTA 2WO0A 1HKXA 3F14A 1GD3A 1WMOA 3S67A 1D6ZA 1AVLA 1JNQA 4HOHA 4J5KA 3X3ZA 3DGMA 5EQLA 3D5GA 4HM3B 1Q864 1JB2A 2P0MA 1QAKA 4BIRA 1W6CA 1C7HA 1WMPA 2HOHA 5CK6A 3I563 1RNBA 5BIRA 4STDA 3BU4A 1LNIA 1PU4A 4WP5A 1BSBA 4R80A 1BSCA 2HMOB 1RGGA 3AMOB 1JRQA 4WFOA 3UB1A 5ELUA 3FG1A 4RNTA 1D6YA 3WOFB 4H3UA 1IVVA 3DUKA 2B24B 1T5YA
chains in the Genus database with same CATH topology
3CME3 1TU5A 3EC9A 3CCQ3 1Z1SA 3HX8A 4HVNA 1OHOA 2XRXB 5KP1A 2ZDJA 1PFPA 2CWUA 1QALA 1EKMA 1ASKA 4Q53A 3CPW2 4AKZA 3HK4A 1LNHA 2L4VA 3EQQB 3LT9A 4QWTA 3B4PA 1RKYA 4K90B 3O8YA 1VQL3 3JUOA 2OWPA 5BVBA 1YIJ3 1AV4A 1GY7A 1SJWA 1O7GB 3ALAA 2OQEA 3MYTA 3PS8A 2INXA 1Q40B 2QA43 4BTYA 3JVCA 2W56A 2O3OA 1YJN3 1EQKA 1VQ53 1IVXA 2HMMB 3F8HA 4XM4A 4KVHA 5CLKA 2QEX3 4XBTA 3CCM3 1Q7Y4 5HGRA 1DMMA 3X42A 3OV4A 2GXFA 3KE7A 1QVF2 2JDIH 1RN7A 1SIIA 1W2ZA 3LH4A 3K63A 2YFIB 1NB3I 3G16A 3S28A 1OUNA 1S723 2GEXA 6STDA 3SX1A 1O7HB 5JPPA 3G4S3 3EBYA 4WYKB 8CHOA 1UI7A 2E2VA 1Q42A 3GZBA 3Q2PA 1K28A 2XH9A 4MMXB 3CC23 4N6LA 4KZ1A 3KSPA 1UUWB 4BTWA 5BXQA 1IVUA 1SPUA 5LC7A 4K61A 5CF1A 2QGUA 1E97A 4MMZB 5LC6A 1ULJB 3NV0B 4FR9A 4XDWA 2BMOB 2CG0A 4X2HA 4KFDA 3KIIA 2GEYA 5KP3A 2F98A 1VZZA 2LYXA 1UI8A 4OK0A 5IERA 4LSOA 1GY6A 3U97A 4GL6A 5EEOA 1FUWA 5JPUA 3LTAA 3HZPA 1LXEA 2Z77A 3EJVA 3X41A 1IU7A 1WNHA 2OTL3 1VQM3 3LYGA 4AEQA 3BNCA 2P05A 3H3HA 1W00A 1TIJA 2O9UX 4ZM8A 1GD4A 2XGNA 3PXMA 3CPOA 2D1WA 1UW1A 1VQ63 1ROVA 4G1MB 4WWUC 2WOFA 3CC73 1DMNA 1JJ22 3K0ZA 1VQ93 3CCS3 2C11A 1YJW3 1NJI4 1K41A 2ML5A 3WDGB 1RRLA 4N6V0 5IG3A 3IMAB 2CFKA 3G0KA 1W2B2 4HYZA 3ROBA 1OHSA 1M1XB 2ML6A 1OCVA 4L7KA 3CNXA 3UL5A 4LGQA 1R4CA 4N6NB 3M8CA 5D83A 1QAFA 1STDA 2C10A 2F99A 5AYRB 4I4KA 3DGOA 3SXXA 3UNLA 3F9SA 2QIYA 2UX0A 1EG9B 3Q1CA 1U5OA 3VSYA 1WQLB 4CCVA 3WA2X 1NWWA 3S29A 2P0XA 4HM0B 5IF6A 1VQO3 2RGQA 5IEPA 2GU3A 3D9RA 2FGTA 3RDEA 3CC43 3CCV3 1RRHA 4GB5A 2Z6BA 5EVHA 1ULIB 1LOXA 4R1KA 2KXGA 2OTJ3 3WODG 2RFRA 5IG0A 3FF0A 1JB5A 1JN5A 2YFLB 2K54A 1IQ8A 2CFLA 3CCJ3 1OH0A 3N9HA 2W2CA 3G713 3NM2A 5TGNA 1VQ43 3NXJA 3T8UA 2XSOB 1FA3A 2Y74A 2OQEC 3FKAA 2FXTA 3X3XA 7STDA 3MG1A 3MPHA 2BHMA 3FH1A 4J9AA 1IV9A 3LMLA 4FMBA 1W6GA 2BMQB 1CYUA 3GZRA 3JUNA 5AI1A 5AIIA 3T8NA 1JB4A 3PYJA 1YI23 4XBXA 3BLZA 3K5TA 1JKGB 1A67A 4IIAA 3OWUA 3CU3A 2HMNB 3I0YA 3DMCA 3CCU3 2W56B 3LZAA 1JKGA 3NUVA 1L5GB 4HM4B 2XFTA 5AYSC 1VQP3 1IQXA 1M9GA 4WHAA 3QRDA 1OF5A 3E99A 4N3VA 1G96A 1FGQA 3FZWA 1QMAA 3NHXA 3LTBA 4CDLA 2M7OA 2W9QA 2MF7A 4KFFA 2P09A 1SIHA 3EN8A 3NBBA 1HU9A 4R9KA 5A0OB 1MOLA 2CK3H 4O8SA 2W6JH 3KFQC 3K7CA 2CC3A 5FGOA 3U1WA 2XGLA 3HI7A 3UJMA 4HBRA 3FLJA 1W02A 1Y4KA 3MSOA 2CHCA 5AEWB 2YFJB 1A2KA 3X40A 3LTDA 5AEUB 2BO9B 2F86B 4LMIA 5AIHA 1NO3A 1OGXA 3K9MC 1FGOA 2Q07A 2KCDA 3SVAA 2Z7AA 3GWRA 1TUHA 5AIFA 1DVDA 4FMAA 3CNMA 3MWZA 3X3YA 1US1A 1GS3A 3MKIA 5CF2A 1U8CB 1AR0A 3DM8A 3RGRA 1YJ93 5I97A 4EYCA 1FGTA 4RBNA 5D81A 1RJOA 1M1K4 3MG2A 4EV5A 3WA3A 3MHEA 4N6MA 2CWVA 1YIT3 3KSED 2RSXA 1OGZA 3NBJA 2YX9A 4OUQA 3WMDA 2LQVA 4L8OA 3B7CA 3FSDA 1GY5A 3DGLA 3RGAA 1O7WB 4FCMA 2D42A 3EHCA 4HJLB 2XF3A 4J8TA 2IUJA 3V98A 1JV2B 1N5HA 2R4IA 2IMJA 1IT7A 2E2TA 2IA7A 2HMKB 1IV7A 1EA2A 3CD63 4O3VA 3LTCA 3OX9A 4EBGA 1OACA 3DXOA 1TFOA 5IG4A 3VF1A 1QVG2 1E3RA 3J7Yd 3DZLA 3GRDA 1YGEA 4IT7A 4K1VA 2V1LA 5AIGA 3CXC2 1KWIA 2OOVA 2CIUA 4HZBB 1ZO2A 3FGYA 1IK3A 4O2HA 4RNYA 1NU3A 3SEDA 3GZYB 2CW9A 2E2UA 3SOAA 4NREA 3NBRA 4EXRA 2CH9A 1OHPA 1SQWA 1DYUA 1ZX2A 1VQK3 1QJGA 2WGOA 2Z76A 3EBTA 4XB5A 5CXOA 1JN5B 1TP6A 5KP4A 3Q90A 1N5PA 4AKYA 3DGNA 4JF8A 2ZL8A 1ROAA 2FNQA 4JRFA 5JBSA 4EC6A 3BNBA 3SOYA 3L0RA 4LEHA 4N6OB 3FCSB 2P38A 1IVWA 4MEIA 3EB8A 3F7XA 1W6YA 2W0QA 4MJDA 4HKVB 1UUVB 1W5ZA 1DVCA 3VGNA 1KQS2 1F8NA 1GYBA 3JUQA 3AMOA 3NQYA 4KFEA 2K0MA 3KKGA 4FMCA 5ELJA 3MG3A 4N6TA 1N8R4 1IQYA 3TDGA 3T0UA 3LOYA 1OF5B 2PNCA 3N54B 3CCR3 1A90A 1N8QA 3PZWA 4EV2A 1Q814 3CCE3 1YHQ3 1K734 4HM2B 2CFWA 3IPTA 3N8BA 4PEJA 4U13A 4R4KA 1CQSA 1LVNA 4HZ9B 4X2OA 2XFSA 1O7MB 3F7SA 1N9EA 3B4OA 3BNDA 1STFI 4FCJA 2HMLB 5DREA 3I553 1KD14 1NDOB 2XSHB 3KN4A 1VQ73 1O7PB 4FCZA 2GU1A 5G2GA 1KC84 4HM8B 1MNLA 2MC8A 4HM6B 3H51A 1KSIA 1Q40A 4ORLA 3HIIA 4HM7B 3F8XA 2BNGA 1CEWI 5IG5A 3NQZA 3OWYA 3B8LA 3SLUA 4RZMA 3LT8A 1FGMA 2OCTA 4IPBA 2WGQA 3BNEA 5D82A 3KZTA 3A76A 3PGBA 3ER7A 1E3VA 3ECFA 3S27A 1VQN3 1J2BA 4XDVA 4FMDA 2XEPA 4O02B 3UL6A 3G6E3 1NB5I 3CMA3 2GBXB 5DRVA 3S5CA 3STDA 4K1UA 1V74A 1K9M4 3OW22 1N9JA 1FGRA 2RCDA 3PCRA 4WYKA 3WOEB 2CWTA 1W4NA 1TFKA 1IT8A 1W01A 1IDPA 2CKFB 3EN1B 3OXAA 4TX4A 1M904 2CG1A 3HIGA 2BMRB 2W03A 3DY5A 4XBYA 5IEOA 1D6UA 2STDA 1ISKA 3FG3A 2JQ5A 2XR8B 4MMYB 2CFDA 3JUMA 1A2VA 2HMJB 4RNZA 1DMQA 3EE1A 3V92A 1WMNA 1S5AA 3NV0A 4R9LA 2A15A 1Q824 3EF8A 3GZXB 3BB9A 1YVBI 1W7CA 4H61A 2OOVC 2IUKA 2W9PA 1BUQA 2B1XB 3PCSA 3OWSA 4HM5B 3G8ZA 4LZIA 2GBWB 3JUPA 2KRTA 3GAXA 1WTHA 3D3LA 3NM7A 4OVMA 5FW5A 2CFGA 2SBLA 4N6UA 3V99A 4HM1B 4NHFA 5STDA 1OPYA 2I9WA 2Y73A 3IJEB 2PZVA 1O7NB 1K8A4 3FG4A 4L8PA 1CYVA 3NX0A 3CCL3 3F40A 3LXUX 3QK9A 5IENA 5IW9A 1VQ83 2BT3A 2WOHA 3EX9A 4BTXA 1AVKA 2W04A 3FF2A 2WO0A 3F14A 1HKXA 1GD3A 1WMOA 3S67A 1D6ZA 1AVLA 1JNQA 3X3ZA 3DGMA 5EQLA 4HM3B 1Q864 1JB2A 2P0MA 1QAKA 1W6CA 1C7HA 1WMPA 5CK6A 3I563 4STDA 1PU4A 4WP5A 4R80A 2HMOB 3AMOB 1JRQA 4WFOA 3UB1A 5ELUA 3FG1A 1D6YA 3WOFB 4H3UA 1IVVA 3DUKA 2B24B 1T5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EC9 A;  1Z1S A;  3HX8 A;  4HVN A;  1OHO A;  2XRX B;  5KP1 A;  1ASK A;  4Q53 A;  3HK4 A;  3EQQ B;  3B4P A;  3JUO A;  2OWP A;  5BVB A;  1GY7 A;  1SJW A;  1O7G B;  3MYT A;  2INX A;  1Q40 B;  2HMM B;  3F8H A;  4XM4 A;  4KVH A;  5CLK A;  4XBT A;  5HGR A;  1DMM A;  3OV4 A;  2GXF A;  3KE7 A;  2YFI B;  3G16 A;  1OUN A;  2GEX A;  6STD A;  1O7H B;  5JPP A;  3EBY A;  4WYK B;  8CHO A;  1Q42 A;  3GZB A;  3KSP A;  1UUW B;  5BXQ A;  5CF1 A;  2QGU A;  1E97 A;  1ULJ B;  3NV0 B;  4XDW A;  2BMO B;  4X2H A;  5KP3 A;  2GEY A;  2F98 A;  1VZZ A;  5IER A;  1GY6 A;  5JPU A;  3HZP A;  2Z77 A;  3EJV A;  3LYG A;  3H3H A;  1W00 A;  3CPO A;  4WWU C;  1DMN A;  3K0Z A;  1K41 A;  5IG3 A;  3G0K A;  3ROB A;  1OHS A;  1OCV A;  4L7K A;  3CNX A;  4LGQ A;  3M8C A;  5D83 A;  1STD A;  2F99 A;  4I4K A;  3UNL A;  3F9S A;  2QIY A;  2UX0 A;  1EG9 B;  1U5O A;  3VSY A;  1WQL B;  1NWW A;  4HM0 B;  5IF6 A;  2RGQ A;  5IEP A;  3D9R A;  4GB5 A;  5EVH A;  1ULI B;  4R1K A;  2RFR A;  5IG0 A;  3FF0 A;  1JB5 A;  1JN5 A;  2YFL B;  2K54 A;  1OH0 A;  2W2C A;  3NM2 A;  5TGN A;  3NXJ A;  3T8U A;  2XSO B;  3FKA A;  7STD A;  3MG1 A;  3FH1 A;  4J9A A;  2BMQ B;  3GZR A;  3T8N A;  3JUN A;  5AI1 A;  5AII A;  1JB4 A;  4XBX A;  3BLZ A;  1JKG B;  4IIA A;  3OWU A;  3CU3 A;  2HMN B;  3I0Y A;  3DMC A;  3LZA A;  1JKG A;  3NUV A;  4HM4 B;  1OF5 A;  3E99 A;  4N3V A;  3NHX A;  3FZW A;  1QMA A;  4CDL A;  3EN8 A;  4R9K A;  3K7C A;  3UJM A;  3FLJ A;  1W02 A;  3MSO A;  2CHC A;  5AEW B;  2YFJ B;  1A2K A;  5AEU B;  2F86 B;  4LMI A;  5AIH A;  1OGX A;  2Z7A A;  3GWR A;  1TUH A;  5AIF A;  3CNM A;  1GS3 A;  3MKI A;  5CF2 A;  1AR0 A;  3DM8 A;  3RGR A;  5D81 A;  3MG2 A;  3MHE A;  1OGZ A;  4OUQ A;  3WMD A;  4L8O A;  3B7C A;  3FSD A;  1GY5 A;  3RGA A;  1O7W B;  4FCM A;  3EHC A;  4HJL B;  4J8T A;  2R4I A;  2IMJ A;  2HMK B;  1EA2 A;  3OX9 A;  3DXO A;  5IG4 A;  1E3R A;  3DZL A;  3GRD A;  4K1V A;  5AIG A;  4HZB B;  1ZO2 A;  3FGY A;  3SED A;  1NU3 A;  3GZY B;  3SOA A;  3NBR A;  1OHP A;  1ZX2 A;  1QJG A;  2Z76 A;  4XB5 A;  3EBT A;  5CXO A;  1JN5 B;  1TP6 A;  5KP4 A;  3Q90 A;  3SOY A;  4LEH A;  3F7X A;  1W6Y A;  4MJD A;  4HKV B;  1UUV B;  3VGN A;  1GYB A;  3JUQ A;  3KKG A;  3MG3 A;  1OF5 B;  4HM2 B;  3IPT A;  4PEJ A;  4U13 A;  1CQS A;  4HZ9 B;  4X2O A;  1O7M B;  3F7S A;  3B4O A;  4FCJ A;  2HML B;  5DRE A;  1NDO B;  2XSH B;  1O7P B;  5G2G A;  4HM8 B;  4HM6 B;  3H51 A;  1Q40 A;  4ORL A;  4HM7 B;  3F8X A;  2BNG A;  5IG5 A;  3OWY A;  3B8L A;  4RZM A;  5D82 A;  3KZT A;  3A76 A;  3ER7 A;  1E3V A;  3ECF A;  4XDV A;  2GBX B;  5DRV A;  3S5C A;  3STD A;  4K1U A;  2RCD A;  4WYK A;  1W01 A;  1IDP A;  2CKF B;  3EN1 B;  3OXA A;  5IEO A;  2BMR B;  4XBY A;  2STD A;  1ISK A;  2JQ5 A;  2XR8 B;  3JUM A;  2HMJ B;  1DMQ A;  1S5A A;  3NV0 A;  4R9L A;  2A15 A;  3EF8 A;  3GZX B;  3BB9 A;  1BUQ A;  2B1X B;  3OWS A;  4HM5 B;  3G8Z A;  2GBW B;  3JUP A;  4OVM A;  5FW5 A;  4HM1 B;  5STD A;  1OPY A;  2I9W A;  2PZV A;  1O7N B;  4L8P A;  3F40 A;  5IEN A;  3EX9 A;  3FF2 A;  3F14 A;  1HKX A;  4HM3 B;  1JB2 A;  1C7H A;  5CK6 A;  4STD A;  4WP5 A;  2HMO B;  4H3U A;  3DUK A;  2B24 B; 
#chains in the Genus database with same CATH topology
 3CME 3;  1TU5 A;  3EC9 A;  3CCQ 3;  1Z1S A;  3HX8 A;  1SAR A;  4HVN A;  1OHO A;  2XRX B;  6GSP A;  5KP1 A;  2ZDJ A;  1PFP A;  2CWU A;  1QAL A;  1EKM A;  1ASK A;  4Q53 A;  3CPW 2;  4AKZ A;  3HK4 A;  3AGO A;  1LNH A;  2L4V A;  2RBI A;  3EQQ B;  3LT9 A;  4QWT A;  3B4P A;  1BVI A;  2F4Y A;  1T2H A;  1B3S A;  3GSP A;  1RKY A;  1TRQ A;  4K90 B;  2K3D A;  3O8Y A;  1VQL 3;  3JUO A;  2OWP A;  3AHS A;  5BVB A;  1YIJ 3;  1AV4 A;  1GY7 A;  1SJW A;  1O7G B;  3ALA A;  2OQE A;  3MYT A;  3PS8 A;  2INX A;  1Q40 B;  2QA4 3;  1YNV X;  1BRK A;  4BTY A;  3JVC A;  2W56 A;  2O3O A;  1YJN 3;  1EQK A;  1VQ5 3;  1IVX A;  2HMM B;  3F8H A;  4XM4 A;  4KVH A;  2ZHX B;  1FYS A;  4XBT A;  5CLK A;  2QEX 3;  3CCM 3;  1I0V A;  1Q7Y 4;  5HGR A;  1DMM A;  3X42 A;  3OV4 A;  1I0X A;  2GXF A;  3KE7 A;  2JDI H;  5G1K A;  1QVF 2;  1RN7 A;  1SII A;  1UCK A;  1W2Z A;  3LH4 A;  1BRI A;  3K63 A;  2YFI B;  1NB3 I;  3G16 A;  3S28 A;  1OUN A;  1S72 3;  1JBR A;  2GEX A;  6STD A;  3SX1 A;  1O7H B;  5JPP A;  1EEJ A;  3EBY A;  4WYK B;  3G4S 3;  1RDS A;  8CHO A;  1UI7 A;  2BU4 A;  2E2V A;  1Q42 A;  1Q7H A;  3GZB A;  3Q2P A;  1K28 A;  2XH9 A;  4MMX B;  3WHO A;  3CC2 3;  1LOW A;  1BAN A;  4N6L A;  4KZ1 A;  3KSP A;  1UUW B;  4BTW A;  5BXQ A;  1IVU A;  5HOH A;  1BNF A;  1SPU A;  5LC7 A;  4K61 A;  5CF1 A;  2QGU A;  1E97 A;  4MMZ B;  1I2F A;  5LC6 A;  1I8V A;  1ULJ B;  3NV0 B;  5G1L A;  1TJD A;  4FR9 A;  1BAO A;  2KF5 A;  4XDW A;  2BMO B;  2CG0 A;  1G02 A;  1GMQ A;  4KFD A;  4X2H A;  1T2I A;  2J8X B;  2GEY A;  3KII A;  2F98 A;  5KP3 A;  1VZZ A;  4DKI A;  2LYX A;  1UI8 A;  4OK0 A;  5IER A;  4LSO A;  1GY6 A;  3U97 A;  4GL6 A;  5EEO A;  1FUW A;  5JPU A;  3LTA A;  3HZP A;  1LXE A;  2Z77 A;  3EJV A;  3X41 A;  1IU7 A;  1WNH A;  1I70 A;  2OTL 3;  1VQM 3;  3LYG A;  4AEQ A;  2KF6 A;  3BNC A;  2P05 A;  1GMR A;  3H3H A;  1W00 A;  1TIJ A;  1UCJ A;  2O9U X;  4ZM8 A;  1RGH A;  1GD4 A;  2XGN A;  3PXM A;  3CPO A;  2D1W A;  1UW1 A;  1VQ6 3;  1ROV A;  4G1M B;  4WWU C;  3KCH A;  2WOF A;  3CC7 3;  1DMN A;  1I3F A;  1JJ2 2;  3K0Z A;  1VQ9 3;  3CCS 3;  3BIR A;  2C11 A;  1YJW 3;  1NJI 4;  1K41 A;  2CX0 A;  2ML5 A;  3WDG B;  1RRL A;  4N6V 0;  5IG3 A;  3IMA B;  1DET A;  1I2E A;  2CFK A;  3G0K A;  1W2B 2;  4HYZ A;  3ROB A;  1OHS A;  1V57 A;  1M1X B;  2ML6 A;  1BUJ A;  1OCV A;  4L7K A;  3CNX A;  3UL5 A;  4LGQ A;  1R4C A;  4N6N B;  2CX1 A;  3AGN A;  3M8C A;  5D83 A;  1QAF A;  1STD A;  2C10 A;  2F99 A;  5AYR B;  4I4K A;  3DGO A;  3SXX A;  3UNL A;  5RNT A;  3F9S A;  1ZS7 A;  2QIY A;  2UX0 A;  1EG9 B;  3Q1C A;  1U5O A;  3VSY A;  1WQL B;  4CCV A;  3WA2 X;  1NWW A;  3S29 A;  2P0X A;  4HM0 B;  5IF6 A;  1VQO 3;  1B27 A;  2RGQ A;  5IEO A;  4BL2 A;  5IEP A;  2GU3 A;  3D9R A;  2FGT A;  3RDE A;  3CC4 3;  3CCV 3;  1RRH A;  4GB5 A;  2Z6B A;  1BSE A;  1YVS A;  5EVH A;  1ULI B;  1BNJ A;  1LOX A;  4R1K A;  9RNT A;  2KXG A;  2OTJ 3;  3D5I A;  3WOD G;  2RFR A;  1RN4 A;  5IG0 A;  3FF0 A;  1JB5 A;  1JN5 A;  2YFL B;  2K54 A;  1IQ8 A;  2CFL A;  5GSP A;  3CCJ 3;  1OH0 A;  3N9H A;  2W2C A;  1AY7 A;  3G71 3;  3NM2 A;  5TGN A;  1VQ4 3;  3HOH A;  3NXJ A;  3T8U A;  2XSO B;  1FA3 A;  2UUG C;  2Y74 A;  1BIR A;  2OQE C;  3FKA A;  4EW5 A;  2FXT A;  3X3X A;  7STD A;  3MG1 A;  3MPH A;  2BHM A;  3FH1 A;  4J9A A;  1IV9 A;  3LML A;  4FMB A;  1W6G A;  2BMQ B;  1CYU A;  3GZR A;  3JUN A;  5AI1 A;  5AII A;  3T8N A;  1JB4 A;  3PYJ A;  8RNT A;  1BRH A;  4XBX A;  3BLZ A;  3K5T A;  1YI2 3;  1JKG B;  1BRN L;  1A67 A;  4IIA A;  3OWU A;  3CU3 A;  1T3B A;  2HMN B;  3DMC A;  3I0Y A;  3CCU 3;  2W56 B;  3LZA A;  1MGR A;  1JKG A;  3NUV A;  1L5G B;  4HM4 B;  2XFT A;  5AYS C;  1VQP 3;  1IQX A;  1M9G A;  4WHA A;  1B20 A;  3QRD A;  1OF5 A;  3E99 A;  4N3V A;  1G96 A;  1FGQ A;  3FZW A;  1QMA A;  3NHX A;  3LTB A;  1BNS A;  4CDL A;  1BNR A;  1LOY A;  3URP A;  2M7O A;  2W9Q A;  2MF7 A;  4KFF A;  1ZGX A;  2P09 A;  1SIH A;  3EN8 A;  3NBB A;  4BL3 A;  1HU9 A;  4R9K A;  5A0O B;  7GSP A;  1MOL A;  2CK3 H;  4O8S A;  1LQM B;  1BRS A;  2W6J H;  3K7C A;  3KFQ C;  2CC3 A;  5FGO A;  3U1W A;  2XGL A;  3HI7 A;  3UJM A;  4HBR A;  1V58 A;  3FLJ A;  1W02 A;  1Y4K A;  3AHW A;  1R4Y A;  3MSO A;  2CHC A;  5AEW B;  2YFJ B;  1A2K A;  1LOV A;  2BIR A;  3X40 A;  3LTD A;  5AEU B;  2BO9 B;  2F86 B;  4LMI A;  5AIH A;  1NO3 A;  1OGX A;  2AAE A;  3K9M C;  1FGO A;  2Q07 A;  2KCD A;  4KT3 B;  1B2M A;  3SVA A;  2Z7A A;  2IY2 A;  1TUH A;  3GWR A;  5AIF A;  1DVD A;  4FMA A;  1BSD A;  3CNM A;  3MWZ A;  1MWU A;  1US1 A;  1GS3 A;  3MKI A;  3X3Y A;  1U8C B;  5CF2 A;  1AR0 A;  1GMP A;  3DM8 A;  3RGR A;  3ZG5 A;  1Q9E A;  1YJ9 3;  1BNE A;  5I97 A;  2F5W A;  4EYC A;  1FGT A;  4RBN A;  5D81 A;  1RJO A;  1M1K 4;  3MG2 A;  4EV5 A;  3WA3 A;  3MHE A;  4N6M A;  2CWV A;  1YIT 3;  3KSE D;  2RSX A;  1UDI I;  4LYL B;  2F5M A;  1OGZ A;  3NBJ A;  2YX9 A;  4OUQ A;  3WMD A;  2LQV A;  4L8O A;  1RGL A;  1X1X A;  3B7C A;  1IYY A;  3FSD A;  1GY5 A;  3DGL A;  3RGA A;  1RCL A;  1O7W B;  2KAA A;  4FCM A;  2D42 A;  3EHC A;  4HJL B;  1RGC A;  2XF3 A;  4J8T A;  2IUJ A;  3V98 A;  1JV2 B;  1N5H A;  2R4I A;  2IMJ A;  1IT7 A;  2E2T A;  4ILF A;  1JZD A;  1RGA A;  2IA7 A;  2HMK B;  7RNT A;  1IV7 A;  1EA2 A;  3CD6 3;  4O3V A;  3D79 A;  1JZO A;  1UUG B;  3LTC A;  3OX9 A;  4EBG A;  1OAC A;  1MGW A;  3DXO A;  1TFO A;  5IG4 A;  3VF1 A;  1QVG 2;  1E3R A;  3J7Y d;  1BU4 A;  3DZL A;  1EUI C;  3GRD A;  1YGE A;  4IT7 A;  1GOV A;  4K1V A;  2V1L A;  1JBT A;  5AIG A;  3CXC 2;  1KWI A;  1UCL A;  2OOV A;  2H0H A;  1I2G A;  2CIU A;  4HZB B;  1ZO2 A;  3FGY A;  1IK3 A;  4O2H A;  4RNY A;  1NU3 A;  3SED A;  1MWS A;  2CW9 A;  2E2U A;  3GZY B;  4NRE A;  3NBR A;  3SOA A;  4EXR A;  2CH9 A;  1OHP A;  1SQW A;  6RNT A;  1DYU A;  1ZX2 A;  1PYL A;  1VQK 3;  1B2S A;  1QJG A;  1BRG A;  2WGO A;  2C4B A;  4CPK A;  2Z76 A;  1RCK A;  5M1A A;  1G0T A;  3EBT A;  4XB5 A;  5CXO A;  1JN5 B;  1TP6 A;  5KP4 A;  3Q90 A;  1N5P A;  4AKY A;  3DGN A;  5M19 A;  1RGF A;  4JF8 A;  2ZL8 A;  5M18 A;  4J5G A;  1ROA A;  2FNQ A;  4JRF A;  5JBS A;  4EC6 A;  3BNB A;  3SOY A;  3A5E A;  1BRJ A;  3D4A A;  3L0R A;  1GOY A;  4LEH A;  3FCS B;  4N6O B;  1X1W A;  2P38 A;  1LRA A;  1UCI A;  2H0I A;  1IVW A;  4MEI A;  3EB8 A;  3F7X A;  1W6Y A;  2W0Q A;  4MJD A;  1JBS A;  4HKV B;  1FW7 A;  1W5Z A;  1UUV B;  1DVC A;  1RSN A;  3VGN A;  1F8N A;  1KQS 2;  1GYB A;  1VQQ A;  3AMO A;  3JUQ A;  3NQY A;  1TRP A;  4HAA A;  4KFE A;  2K0M A;  3KKG A;  4FMC A;  1LQG C;  5ELJ A;  1GSP A;  3MG3 A;  4N6T A;  2IYJ A;  1N8R 4;  1IQY A;  1MWR A;  3TDG A;  4GHO A;  3T0U A;  3LOY A;  1FUS A;  1OF5 B;  2PNC A;  1GOU A;  3N54 B;  3CCR 3;  1A90 A;  1RNT A;  1N8Q A;  3PZW A;  4EV2 A;  1Q81 4;  3CCE 3;  1YHQ 3;  1K73 4;  4HM2 B;  2CFW A;  3IPT A;  3N8B A;  2R41 A;  4PEJ A;  4U13 A;  4R4K A;  1CQS A;  1DE3 A;  1LVN A;  4HZ9 B;  4X2O A;  2XFS A;  1O7M B;  3F7S A;  1N9E A;  3B4O A;  3BND A;  1STF I;  2KF3 A;  4FCJ A;  2HML B;  5DRE A;  3I55 3;  1KD1 4;  1NDO B;  2XSH B;  3KN4 A;  1VQ7 3;  1UGH I;  3SYU A;  1BNG A;  1O7P B;  4FCZ A;  2GU1 A;  5G2G A;  1KC8 4;  4HM8 B;  1MNL A;  2MC8 A;  2KF4 A;  1B2U A;  3WR2 A;  4HM6 B;  3H51 A;  1KSI A;  1AQZ A;  1Q40 A;  3HII A;  4ORL A;  1RMS A;  1TTO A;  4HM7 B;  3F8X A;  3RNT A;  2BNG A;  1CEW I;  1RLS A;  5IG5 A;  3NQZ A;  3OWY A;  3B8L A;  1A2P A;  3SLU A;  4RZM A;  3LT8 A;  1FGM A;  2OCT A;  4IPB A;  1X1Y A;  2WGQ A;  1UGI A;  2ZA4 A;  3BNE A;  5D82 A;  3KZT A;  3A76 A;  1HZ1 A;  3PGB A;  3ER7 A;  1E3V A;  3ECF A;  3S27 A;  1VQN 3;  1J2B A;  1RHL A;  4XDV A;  4FMD A;  1HYF A;  2XEP A;  4O02 B;  1B21 A;  3UL6 A;  3G6E 3;  1NB5 I;  3CMA 3;  2GBX B;  5DRV A;  3S5C A;  1BSA A;  3STD A;  4K1U A;  1V74 A;  5BU4 A;  1K9M 4;  3OW2 2;  1N9J A;  1FGR A;  2RCD A;  3Q3F A;  1C54 A;  3PCR A;  4WYK A;  2SAR A;  3WOE B;  2CWT A;  2GSP A;  1RGE A;  1TFK A;  1IT8 A;  1W4N A;  1W01 A;  1IDP A;  3ZFZ A;  3DH2 A;  2CKF B;  3EN1 B;  1MWT A;  3OXA A;  4TX4 A;  1M90 4;  2CG1 A;  3HIG A;  1YGW A;  2BMR B;  2L1S A;  2W03 A;  3DY5 A;  4I5Q A;  1D6U A;  2STD A;  4XBY A;  3FG3 A;  2JQ5 A;  2XR8 B;  4MMY B;  1ISK A;  2CFD A;  3JUM A;  1A2V A;  1RGK A;  2HMJ B;  4RNZ A;  1DMQ A;  3EE1 A;  3V92 A;  1FZU A;  1S5A A;  1WMN A;  3NV0 A;  1CH0 A;  2A15 A;  4R9L A;  1Q82 4;  3EF8 A;  3GZX B;  1RTU A;  3BB9 A;  1YVB I;  1W7C A;  4H61 A;  2OOV C;  4GSP A;  1PY3 A;  2IUK A;  2W9P A;  2UGI A;  1BUQ A;  2B1X B;  2H0G A;  2F56 A;  3PCS A;  3OWS A;  2AAD A;  4HM5 B;  3G8Z A;  1BNI A;  4LZI A;  1BGS A;  4BU4 A;  1I3I A;  3DGY A;  2GBW B;  1NNV A;  3JUP A;  2KRT A;  3GAX A;  3ZG0 A;  1WTH A;  3D3L A;  3NM7 A;  4OVM A;  5FW5 A;  2CFG A;  1FUT A;  2SBL A;  4CJN A;  4N6U A;  3V99 A;  4HM1 B;  4NHF A;  5STD A;  1OPY A;  1BOX A;  2I9W A;  2Y73 A;  3IJE B;  2PZV A;  1O7N B;  1K8A 4;  3FG4 A;  4L8P A;  4NPB A;  1CYV A;  1B2Z A;  3NX0 A;  3CCL 3;  3F40 A;  3LXU X;  3QK9 A;  1RN1 A;  1X1U A;  5IEN A;  1B2X A;  5IW9 A;  1VQ8 3;  2BT3 A;  2WOH A;  3EX9 A;  4BTX A;  1AVK A;  2W04 A;  3FF2 A;  2RNT A;  2WO0 A;  1HKX A;  3F14 A;  1GD3 A;  1WMO A;  3S67 A;  1D6Z A;  1AVL A;  1JNQ A;  4HOH A;  4J5K A;  3X3Z A;  3DGM A;  5EQL A;  3D5G A;  4HM3 B;  1Q86 4;  1JB2 A;  2P0M A;  1QAK A;  4BIR A;  1W6C A;  1C7H A;  1WMP A;  2HOH A;  5CK6 A;  3I56 3;  1RNB A;  5BIR A;  4STD A;  3BU4 A;  1LNI A;  1PU4 A;  4WP5 A;  1BSB A;  4R80 A;  1BSC A;  2HMO B;  1RGG A;  3AMO B;  1JRQ A;  4WFO A;  3UB1 A;  5ELU A;  3FG1 A;  4RNT A;  1D6Y A;  3WOF B;  4H3U A;  1IVV A;  3DUK A;  2B24 B;  1T5Y A; 
#chains in the Genus database with same CATH homology
 3CME 3;  1TU5 A;  3EC9 A;  3CCQ 3;  1Z1S A;  3HX8 A;  4HVN A;  1OHO A;  2XRX B;  5KP1 A;  2ZDJ A;  1PFP A;  2CWU A;  1QAL A;  1EKM A;  1ASK A;  4Q53 A;  3CPW 2;  4AKZ A;  3HK4 A;  1LNH A;  2L4V A;  3EQQ B;  3LT9 A;  4QWT A;  3B4P A;  1RKY A;  4K90 B;  3O8Y A;  1VQL 3;  3JUO A;  2OWP A;  5BVB A;  1YIJ 3;  1AV4 A;  1GY7 A;  1SJW A;  1O7G B;  3ALA A;  2OQE A;  3MYT A;  3PS8 A;  2INX A;  1Q40 B;  2QA4 3;  4BTY A;  3JVC A;  2W56 A;  2O3O A;  1YJN 3;  1EQK A;  1VQ5 3;  1IVX A;  2HMM B;  3F8H A;  4XM4 A;  4KVH A;  5CLK A;  2QEX 3;  4XBT A;  3CCM 3;  1Q7Y 4;  5HGR A;  1DMM A;  3X42 A;  3OV4 A;  2GXF A;  3KE7 A;  1QVF 2;  2JDI H;  1RN7 A;  1SII A;  1W2Z A;  3LH4 A;  3K63 A;  2YFI B;  1NB3 I;  3G16 A;  3S28 A;  1OUN A;  1S72 3;  2GEX A;  6STD A;  3SX1 A;  1O7H B;  5JPP A;  3G4S 3;  3EBY A;  4WYK B;  8CHO A;  1UI7 A;  2E2V A;  1Q42 A;  3GZB A;  3Q2P A;  1K28 A;  2XH9 A;  4MMX B;  3CC2 3;  4N6L A;  4KZ1 A;  3KSP A;  1UUW B;  4BTW A;  5BXQ A;  1IVU A;  1SPU A;  5LC7 A;  4K61 A;  5CF1 A;  2QGU A;  1E97 A;  4MMZ B;  5LC6 A;  1ULJ B;  3NV0 B;  4FR9 A;  4XDW A;  2BMO B;  2CG0 A;  4X2H A;  4KFD A;  3KII A;  2GEY A;  5KP3 A;  2F98 A;  1VZZ A;  2LYX A;  1UI8 A;  4OK0 A;  5IER A;  4LSO A;  1GY6 A;  3U97 A;  4GL6 A;  5EEO A;  1FUW A;  5JPU A;  3LTA A;  3HZP A;  1LXE A;  2Z77 A;  3EJV A;  3X41 A;  1IU7 A;  1WNH A;  2OTL 3;  1VQM 3;  3LYG A;  4AEQ A;  3BNC A;  2P05 A;  3H3H A;  1W00 A;  1TIJ A;  2O9U X;  4ZM8 A;  1GD4 A;  2XGN A;  3PXM A;  3CPO A;  2D1W A;  1UW1 A;  1VQ6 3;  1ROV A;  4G1M B;  4WWU C;  2WOF A;  3CC7 3;  1DMN A;  1JJ2 2;  3K0Z A;  1VQ9 3;  3CCS 3;  2C11 A;  1YJW 3;  1NJI 4;  1K41 A;  2ML5 A;  3WDG B;  1RRL A;  4N6V 0;  5IG3 A;  3IMA B;  2CFK A;  3G0K A;  1W2B 2;  4HYZ A;  3ROB A;  1OHS A;  1M1X B;  2ML6 A;  1OCV A;  4L7K A;  3CNX A;  3UL5 A;  4LGQ A;  1R4C A;  4N6N B;  3M8C A;  5D83 A;  1QAF A;  1STD A;  2C10 A;  2F99 A;  5AYR B;  4I4K A;  3DGO A;  3SXX A;  3UNL A;  3F9S A;  2QIY A;  2UX0 A;  1EG9 B;  3Q1C A;  1U5O A;  3VSY A;  1WQL B;  4CCV A;  3WA2 X;  1NWW A;  3S29 A;  2P0X A;  4HM0 B;  5IF6 A;  1VQO 3;  2RGQ A;  5IEP A;  2GU3 A;  3D9R A;  2FGT A;  3RDE A;  3CC4 3;  3CCV 3;  1RRH A;  4GB5 A;  2Z6B A;  5EVH A;  1ULI B;  1LOX A;  4R1K A;  2KXG A;  2OTJ 3;  3WOD G;  2RFR A;  5IG0 A;  3FF0 A;  1JB5 A;  1JN5 A;  2YFL B;  2K54 A;  1IQ8 A;  2CFL A;  3CCJ 3;  1OH0 A;  3N9H A;  2W2C A;  3G71 3;  3NM2 A;  5TGN A;  1VQ4 3;  3NXJ A;  3T8U A;  2XSO B;  1FA3 A;  2Y74 A;  2OQE C;  3FKA A;  2FXT A;  3X3X A;  7STD A;  3MG1 A;  3MPH A;  2BHM A;  3FH1 A;  4J9A A;  1IV9 A;  3LML A;  4FMB A;  1W6G A;  2BMQ B;  1CYU A;  3GZR A;  3JUN A;  5AI1 A;  5AII A;  3T8N A;  1JB4 A;  3PYJ A;  1YI2 3;  4XBX A;  3BLZ A;  3K5T A;  1JKG B;  1A67 A;  4IIA A;  3OWU A;  3CU3 A;  2HMN B;  3I0Y A;  3DMC A;  3CCU 3;  2W56 B;  3LZA A;  1JKG A;  3NUV A;  1L5G B;  4HM4 B;  2XFT A;  5AYS C;  1VQP 3;  1IQX A;  1M9G A;  4WHA A;  3QRD A;  1OF5 A;  3E99 A;  4N3V A;  1G96 A;  1FGQ A;  3FZW A;  1QMA A;  3NHX A;  3LTB A;  4CDL A;  2M7O A;  2W9Q A;  2MF7 A;  4KFF A;  2P09 A;  1SIH A;  3EN8 A;  3NBB A;  1HU9 A;  4R9K A;  5A0O B;  1MOL A;  2CK3 H;  4O8S A;  2W6J H;  3KFQ C;  3K7C A;  2CC3 A;  5FGO A;  3U1W A;  2XGL A;  3HI7 A;  3UJM A;  4HBR A;  3FLJ A;  1W02 A;  1Y4K A;  3MSO A;  2CHC A;  5AEW B;  2YFJ B;  1A2K A;  3X40 A;  3LTD A;  5AEU B;  2BO9 B;  2F86 B;  4LMI A;  5AIH A;  1NO3 A;  1OGX A;  3K9M C;  1FGO A;  2Q07 A;  2KCD A;  3SVA A;  2Z7A A;  3GWR A;  1TUH A;  5AIF A;  1DVD A;  4FMA A;  3CNM A;  3MWZ A;  3X3Y A;  1US1 A;  1GS3 A;  3MKI A;  5CF2 A;  1U8C B;  1AR0 A;  3DM8 A;  3RGR A;  1YJ9 3;  5I97 A;  4EYC A;  1FGT A;  4RBN A;  5D81 A;  1RJO A;  1M1K 4;  3MG2 A;  4EV5 A;  3WA3 A;  3MHE A;  4N6M A;  2CWV A;  1YIT 3;  3KSE D;  2RSX A;  1OGZ A;  3NBJ A;  2YX9 A;  4OUQ A;  3WMD A;  2LQV A;  4L8O A;  3B7C A;  3FSD A;  1GY5 A;  3DGL A;  3RGA A;  1O7W B;  4FCM A;  2D42 A;  3EHC A;  4HJL B;  2XF3 A;  4J8T A;  2IUJ A;  3V98 A;  1JV2 B;  1N5H A;  2R4I A;  2IMJ A;  1IT7 A;  2E2T A;  2IA7 A;  2HMK B;  1IV7 A;  1EA2 A;  3CD6 3;  4O3V A;  3LTC A;  3OX9 A;  4EBG A;  1OAC A;  3DXO A;  1TFO A;  5IG4 A;  3VF1 A;  1QVG 2;  1E3R A;  3J7Y d;  3DZL A;  3GRD A;  1YGE A;  4IT7 A;  4K1V A;  2V1L A;  5AIG A;  3CXC 2;  1KWI A;  2OOV A;  2CIU A;  4HZB B;  1ZO2 A;  3FGY A;  1IK3 A;  4O2H A;  4RNY A;  1NU3 A;  3SED A;  3GZY B;  2CW9 A;  2E2U A;  3SOA A;  4NRE A;  3NBR A;  4EXR A;  2CH9 A;  1OHP A;  1SQW A;  1DYU A;  1ZX2 A;  1VQK 3;  1QJG A;  2WGO A;  2Z76 A;  3EBT A;  4XB5 A;  5CXO A;  1JN5 B;  1TP6 A;  5KP4 A;  3Q90 A;  1N5P A;  4AKY A;  3DGN A;  4JF8 A;  2ZL8 A;  1ROA A;  2FNQ A;  4JRF A;  5JBS A;  4EC6 A;  3BNB A;  3SOY A;  3L0R A;  4LEH A;  4N6O B;  3FCS B;  2P38 A;  1IVW A;  4MEI A;  3EB8 A;  3F7X A;  1W6Y A;  2W0Q A;  4MJD A;  4HKV B;  1UUV B;  1W5Z A;  1DVC A;  3VGN A;  1KQS 2;  1F8N A;  1GYB A;  3JUQ A;  3AMO A;  3NQY A;  4KFE A;  2K0M A;  3KKG A;  4FMC A;  5ELJ A;  3MG3 A;  4N6T A;  1N8R 4;  1IQY A;  3TDG A;  3T0U A;  3LOY A;  1OF5 B;  2PNC A;  3N54 B;  3CCR 3;  1A90 A;  1N8Q A;  3PZW A;  4EV2 A;  1Q81 4;  3CCE 3;  1YHQ 3;  1K73 4;  4HM2 B;  2CFW A;  3IPT A;  3N8B A;  4PEJ A;  4U13 A;  4R4K A;  1CQS A;  1LVN A;  4HZ9 B;  4X2O A;  2XFS A;  1O7M B;  3F7S A;  1N9E A;  3B4O A;  3BND A;  1STF I;  4FCJ A;  2HML B;  5DRE A;  3I55 3;  1KD1 4;  1NDO B;  2XSH B;  3KN4 A;  1VQ7 3;  1O7P B;  4FCZ A;  2GU1 A;  5G2G A;  1KC8 4;  4HM8 B;  1MNL A;  2MC8 A;  4HM6 B;  3H51 A;  1KSI A;  1Q40 A;  4ORL A;  3HII A;  4HM7 B;  3F8X A;  2BNG A;  1CEW I;  5IG5 A;  3NQZ A;  3OWY A;  3B8L A;  3SLU A;  4RZM A;  3LT8 A;  1FGM A;  2OCT A;  4IPB A;  2WGQ A;  3BNE A;  5D82 A;  3KZT A;  3A76 A;  3PGB A;  3ER7 A;  1E3V A;  3ECF A;  3S27 A;  1VQN 3;  1J2B A;  4XDV A;  4FMD A;  2XEP A;  4O02 B;  3UL6 A;  3G6E 3;  1NB5 I;  3CMA 3;  2GBX B;  5DRV A;  3S5C A;  3STD A;  4K1U A;  1V74 A;  1K9M 4;  3OW2 2;  1N9J A;  1FGR A;  2RCD A;  3PCR A;  4WYK A;  3WOE B;  2CWT A;  1W4N A;  1TFK A;  1IT8 A;  1W01 A;  1IDP A;  2CKF B;  3EN1 B;  3OXA A;  4TX4 A;  1M90 4;  2CG1 A;  3HIG A;  2BMR B;  2W03 A;  3DY5 A;  4XBY A;  5IEO A;  1D6U A;  2STD A;  1ISK A;  3FG3 A;  2JQ5 A;  2XR8 B;  4MMY B;  2CFD A;  3JUM A;  1A2V A;  2HMJ B;  4RNZ A;  1DMQ A;  3EE1 A;  3V92 A;  1WMN A;  1S5A A;  3NV0 A;  4R9L A;  2A15 A;  1Q82 4;  3EF8 A;  3GZX B;  3BB9 A;  1YVB I;  1W7C A;  4H61 A;  2OOV C;  2IUK A;  2W9P A;  1BUQ A;  2B1X B;  3PCS A;  3OWS A;  4HM5 B;  3G8Z A;  4LZI A;  2GBW B;  3JUP A;  2KRT A;  3GAX A;  1WTH A;  3D3L A;  3NM7 A;  4OVM A;  5FW5 A;  2CFG A;  2SBL A;  4N6U A;  3V99 A;  4HM1 B;  4NHF A;  5STD A;  1OPY A;  2I9W A;  2Y73 A;  3IJE B;  2PZV A;  1O7N B;  1K8A 4;  3FG4 A;  4L8P A;  1CYV A;  3NX0 A;  3CCL 3;  3F40 A;  3LXU X;  3QK9 A;  5IEN A;  5IW9 A;  1VQ8 3;  2BT3 A;  2WOH A;  3EX9 A;  4BTX A;  1AVK A;  2W04 A;  3FF2 A;  2WO0 A;  3F14 A;  1HKX A;  1GD3 A;  1WMO A;  3S67 A;  1D6Z A;  1AVL A;  1JNQ A;  3X3Z A;  3DGM A;  5EQL A;  4HM3 B;  1Q86 4;  1JB2 A;  2P0M A;  1QAK A;  1W6C A;  1C7H A;  1WMP A;  5CK6 A;  3I56 3;  4STD A;  1PU4 A;  4WP5 A;  4R80 A;  2HMO B;  3AMO B;  1JRQ A;  4WFO A;  3UB1 A;  5ELU A;  3FG1 A;  1D6Y A;  3WOF B;  4H3U A;  1IVV A;  3DUK A;  2B24 B;  1T5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...