4IIAA

Low resolution crystal structure of the ntf2-like domain of human g3bp1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
SHMVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ras GTPase-activating protein-binding protein 1
publication title Crystal Structures of the Human G3BP1 NTF2-Like Domain Visualize FxFG Nup Repeat Specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 131
sequence length 131
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4iiaA00
1OUNA 4FCJA 2GBWB 3SEDA 4HM1B 1OHSA 5DRVA 4HM7B 2HMJB 1TUHA 3ECFA 4HM8B 4FCMA 5AEUB 3OXAA 3CPOA 5DREA 2B1XB 1O7PB 5D81A 1UUWB 4ORLA 4HM5B 4OVMA 1HKXA 1QMAA 4HM0B 2GEYA 1NWWA 8CHOA 4HZBB 3UJMA 3OV4A 1U5OA 2QIYA 1VZZA 2STDA 2HMLB 5AIFA 2I9WA 2W2CA 4OUQA 3JUNA 4R1KA 1GS3A 3SOAA 2JQ5A 3MKIA 5IENA 3BB9A 1Q40B 3UNLA 2RGQA 4CDLA 1W00A 5BXQA 5FW5A 1Z1SA 5JPUA 3H3HA 3NBRA 4HM2B 4X2OA 1OF5B 3F14A 3HK4A 5CF2A 3F7XA 1GY7A 2HMKB 3FZWA 1DMNA 1W02A 3OX9A 2K54A 5IEOA 5CLKA 4LEHA 2B24B 2UX0A 2XSHB 5CK6A 3ROBA 1EA2A 1JB5A 3NHXA 2GEXA 2A15A 1ZX2A 4H3UA 2Z76A 3NV0B 2HMMB 2RFRA 3KZTA 2YFJB 3NXJA 5IERA 3DXOA 5AI1A 3OWSA 1JKGB 2Z7AA 5IG3A 2HMNB 3CNMA 3S5CA 1OPYA 3FLJA 4LMIA 2XSOB 4IIAA 2BMQB 2XRXB 3T8UA 1Q40A 4XDVA 3DMCA 6STDA 3IPTA 3K0ZA 1JB4A 3MSOA 1OCVA 1E3RA 5JPPA 2YFLB 3FKAA 1OF5A 1O7GB 4HJLB 1OGZA 3JUMA 2XR8B 4R9KA 3JUQA 1W6YA 5KP1A 3RGAA 5AIIA 3EBTA 1Q42A 5TGNA 3EQQB 1A2KA 4K1UA 2F98A 3GWRA 4HM6B 2GBXB 1GYBA 3EHCA 3HX8A 4XDWA 3WMDA 5KP4A 3NV0A 3MG2A 2BNGA 4XBTA 1SJWA 3F7SA 3FGYA 1ASKA 4K1VA 3ER7A 4U13A 3M8CA 5STDA 3KSPA 7STDA 1BUQA 1K41A 1O7MB 1JKGA 3I0YA 1AR0A 3EN8A 1STDA 1DMQA 5KP3A 4WYKB 4N3VA 5EVHA 2IMJA 1JB2A 3OWUA 3F40A 4PEJA 3T8NA 4L8OA 1E3VA 4Q53A 1OHOA 5IG5A 4LGQA 3NUVA 3MG3A 3B8LA 3FSDA 4XB5A 5AEWB 2Z77A 3STDA 5CF1A 1GY6A 2OWPA 3Q90A 2CHCA 3EF8A 3F8XA 4I4KA 5CXOA 3G8ZA 4RZMA 4J9AA 3FH1A 3EX9A 3LYGA 3GZRA 4WWUC 2HMOB 5IG0A 4L7KA 3OWYA 1OGXA 1ULJB 2QGUA 3EC9A 3G16A 4R9LA 5IEPA 2YFIB 3CNXA 4HM4B 4GB5A 3KE7A 1C7HA 5IF6A 3D9RA 4J8TA 1DMMA 3DM8A 5HGRA 4HVNA 4KVHA 1OH0A 1EG9B 1CQSA 4X2HA 3BLZA 3F9SA 2PZVA 3GZBA 4WYKA 4STDA 1GY5A 1OHPA 3EN1B 3VSYA 1O7NB 1TP6A 4L8PA 4HM3B 3HZPA 1JN5B 1UUVB 5BVBA 3DZLA 1NU3A 5D83A 3JUPA 5AIGA 3B4PA 3JUOA 3GZYB 2INXA 3VGNA 5IG4A 2CKFB 2R4IA 3KKGA 3SOYA 1S5AA 2GXFA 3F8HA 3G0KA 1NDOB 3E99A 1ULIB 3NM2A 3GZXB 1WQLB 3CU3A 4MJDA 5AIHA 1IDPA 2BMOB 3MG1A 1QJGA 2BMRB 3EJVA 5D82A 1ZO2A 4XM4A 3LZAA 3DUKA 3FF2A 1ISKA 3B7CA 1W01A 3B4OA 3MHEA 3EBYA 1O7HB 5G2GA 4XBYA 3MYTA 3RGRA 2F99A 3H51A 4XBXA 2RCDA 1E97A 2F86B 4HZ9B 3K7CA 3A76A 3FF0A 1JN5A 4HKVB 4WP5A 1O7WB 3GRDA
chains in the Genus database with same CATH superfamily
1GOVA 3PYJA 1OUNA 2D42A 2KF5A 4FCJA 3DGYA 2GBWB 3BNBA 1RRLA 3SEDA 4HM1B 3FG1A 1VQO3 3WDGB 1Q824 1OHSA 1YVBI 4WHAA 1BSBA 1BSEA 1N5PA 1EQKA 3AHSA 2CK3H 4EV5A 3D3LA 5DRVA 1HU9A 3KIIA 4MMYB 4HM7B 2LYXA 5LC7A 1K8A4 2HMJB 4MMZB 1TUHA 3ECFA 4HM8B 4FCMA 3CPW2 5AEUB 3X41A 4EW5A 1JBTA 1Q7HA 3GSPA 2F4YA 3AHWA 1YJN3 3HOHA 3OXAA 1LNIA 3CPOA 2FXTA 4ZM8A 5DREA 1UCIA 2B1XB 3WOEB 1O7PB 2BIRA 5D81A 1UUWB 4ORLA 2RBIA 1GD4A 1UGIA 1B20A 3X3ZA 4HM5B 1W2ZA 4OVMA 2E2UA 1X1UA 5ELUA 1HKXA 3HI7A 3HIIA 1QMAA 4HM0B 2WGQA 2GEYA 4K90B 3T0UA 1U8CB 1PY3A 1W6CA 2KF4A 4NPBA 2C4BA 2W03A 1A2VA 1NWWA 8CHOA 5JBSA 3NM7A 1RGKA 1Q814 1LQMB 1NB5I 4HZBB 4N6NB 3U1WA 1RGEA 4FR9A 2F5MA 4HYZA 3I553 3UJMA 4EYCA 4IPBA 3TDGA 4CPKA 3OV4A 3D5IA 1U5OA 7GSPA 4KT3B 1C54A 2P09A 1QALA 2QIYA 1I3FA 1UGHI 1ROVA 1X1YA 1UCKA 3D79A 3LTCA 1VZZA 3HIGA 2STDA 2HMLB 2I9WA 2W2CA 4OUQA 5AIFA 3FG3A 3AMOB 1NJI4 1F8NA 3JUNA 3V98A 4MEIA 1GS3A 4R1KA 3SOAA 3KFQC 2JQ5A 1RGLA 3MKIA 2IY2A 3SLUA 3CCJ3 5IENA 1YNVX 1N9JA 2GSPA 1TTOA 3BB9A 3PGBA 2J8XB 1Q40B 3UNLA 2QEX3 1IQXA 4N6V0 1BRSA 4RNTA 2P38A 2RGQA 5G1LA 4CDLA 4BL2A 1VQN3 1RGAA 1RKYA 4GL6A 1FW7A 1W00A 1SIIA 3AGOA 1RN4A 2ML5A 4EXRA 5BXQA 5FW5A 3NBBA 1Z1SA 1LOVA 2WOHA 5JPUA 1TRQA 1RLSA 3H3HA 3G713 1LXEA 3NBRA 2WO0A 1VQ73 1KD14 1N8QA 1ROAA 4HM2B 3DH2A 1B2UA 4X2OA 3D5GA 1L5GB 2AADA 1OF5B 1T2IA 1V74A 3CCQ3 1KQS2 3F14A 2L1SA 1JZOA 3HK4A 2JDIH 3SX1A 5CF2A 3F7XA 1GY7A 1J2BA 2HMKB 3FZWA 1DMNA 3WA3A 4CCVA 4EBGA 2CW9A 1W02A 2IUJA 1ZGXA 1HZ1A 1VQM3 3LTDA 1N9EA 3OX9A 1JRQA 2K54A 3CCM3 3A5EA 4EV2A 5IEOA 2AAEA 5CLKA 3UL5A 1IT7A 4LEHA 1VQ83 4WFOA 2B24B 1YI23 1YJW3 2UX0A 4RBNA 1UI8A 2IYJA 1IU7A 2XSHB 1JV2B 1EA2A 3QRDA 5CK6A 1RN7A 3ROBA 5M19A 1YIJ3 2XFSA 1Q864 1JB5A 2PNCA 3NHXA 2CG1A 2GEXA 2XF3A 2A15A 1ZX2A 2XGLA 4H3UA 2Z76A 4IT7A 1K734 3U97A 3NV0B 4KZ1A 2HMMB 2RFRA 3BNDA 3URPA 2HOHA 1IK3A 1AVKA 3KCHA 3KZTA 3CD63 2YFJB 1QVG2 3NXJA 1RCLA 2W04A 1US1A 4H61A 3DXOA 5IERA 1BSCA 3LTBA 1EEJA 5AI1A 1NNVA 2KCDA 1IVVA 2K3DA 2ZL8A 1IV7A 2CWTA 1TIJA 3OWSA 2W9PA 1LVNA 1JKGB 1FUSA 1MGWA 1TJDA 2CIUA 3S29A 1TFKA 2Z7AA 5IG3A 2HMNB 3AMOA 3CNMA 5I97A 3S5CA 3PCRA 2CG0A 1OPYA 1RGFA 2K0MA 3FLJA 4O8SA 1BNGA 4LMIA 2XSOB 4IIAA 1VQL3 1DYUA 1GMPA 2BMQB 1AQZA 1DETA 1MWTA 2XRXB 3T8UA 1BGSA 4N6MA 1Q40A 3DGMA 4XDVA 3I563 5G1KA 3DMCA 2OCTA 2Z6BA 3L0RA 5ELJA 2W6JH 3IPTA 1SARA 6STDA 1BRHA 3K0ZA 3ZFZA 1FUTA 1Y4KA 3NQYA 3X3XA 3QK9A 1DVDA 2BHMA 1JB4A 2O9UX 1KSIA 2F56A 3ALAA 2UGIA 3MSOA 4HBRA 2P0MA 1OCVA 5AYSC 1E3RA 3S28A 1B2MA 2V1LA 1D6ZA 2XH9A 1BNIA 5EQLA 5JPPA 1LOYA 2ML6A 2YFLB 3CCU3 1KWIA 4FMCA 2CFDA 3FKAA 4KFDA 1OF5A 1BRKA 1O7GB 3NX0A 4HJLB 1OGZA 3JUMA 5HOHA 2XR8B 1B21A 4CJNA 5M1AA 5BU4A 4R9KA 3JUQA 1BNEA 4HOHA 4EC6A 1BRNL 5EEOA 1W6YA 5KP1A 3RGAA 5AIIA 3EBTA 1EUIC 1Q42A 3WR2A 1IQ8A 1I0XA 3PXMA 5M18A 1LOWA 2E2TA 5TGNA 1RN1A 3OW22 1T5YA 3EQQB 6GSPA 1A2KA 4K1UA 1UCLA 2F98A 1BSAA 3GWRA 1M1XB 1VQ53 2OTL3 4HM6B 1HYFA 1GSPA 2GBXB 1GYBA 1RHLA 4K61A 3EHCA 1R4YA 1B27A 4O3VA 3HX8A 4XDWA 3WMDA 5KP4A 3KSED 2CFGA 1S723 3NV0A 1MWRA 3MG2A 3SXXA 1IT8A 4NHFA 1R4CA 2BNGA 4O2HA 1SJWA 3LOYA 1MWUA 4XBTA 4BTYA 1CH0A 3LTAA 1D6UA 2IA7A 3F7SA 3FGYA 1BOXA 2Y74A 2CX0A 1ASKA 3Q2PA 2YX9A 5IW9A 4K1VA 3G4S3 3LXUX 3ER7A 2P05A 4U13A 1IV9A 1LOXA 4BTWA 3UL6A 1G02A 3M8CA 3PZWA 5STDA 3KSPA 1AY7A 2CWVA 1I2EA 1FZUA 7STDA 1BUQA 1K41A 1O7MB 3MWZA 1JKGA 1IVWA 1MWSA 1RRHA 1STFI 3CCS3 1VQ63 2OQEC 3I0YA 5A0OB 4N6TA 1AR0A 2Y73A 3EN8A 2H0HA 1JNQA 3X40A 3NQZA 4BU4A 1VQ93 1STDA 2LQVA 3D4AA 3V99A 2XFTA 1DMQA 4G1MB 5KP3A 1RCKA 4N3VA 4WYKB 2R41A 5EVHA 4AEQA 2IMJA 1JB2A 3OWUA 4N6OB 3F40A 2CWUA 2CX1A 4PEJA 3T8NA 4L8OA 1GD3A 3BNCA 8RNTA 1E3VA 2RSXA 3RDEA 1CEWI 3SYUA 4AKYA 4LYLB 1W2B2 4ILFA 2CH9A 4Q53A 1OHOA 1LNHA 3X42A 3N9HA 5IG5A 2C11A 4LGQA 3PCSA 3DGNA 4FMBA 3CC73 3NUVA 1K9M4 3MG3A 2MF7A 3B8LA 2ZHXB 4AKZA 1YGEA 2BU4A 2GU1A 1SIHA 2GU3A 3FSDA 4XB5A 5AEWB 1A90A 1JBSA 2W56B 2Z77A 3STDA 1YJ93 5CF1A 1MGRA 1GY6A 2OOVC 2OWPA 3Q90A 2E2VA 4QWTA 2CHCA 2FGTA 1VQP3 3EF8A 1FGRA 3F8XA 3CME3 1BSDA 4I4KA 4JF8A 7RNTA 1VQ43 5CXOA 2SARA 1BU4A 3G8ZA 4RZMA 1GMRA 4J9AA 4N6LA 1JJ22 1BUJA 3FH1A 2C10A 1CYVA 4KFFA 2W0QA 3EX9A 3LYGA 1YVSA 3GZRA 4WWUC 3K5TA 2HMOB 4TX4A 1RGHA 3EB8A 5AYRB 3CMA3 2MC8A 1RTUA 3O8YA 3SVAA 3CCE3 5IG0A 1M1K4 4L7KA 2BT3A 3CCR3 4DKIA 3OWYA 1DVCA 1TU5A 1OGXA 5FGOA 1FA3A 1ULJB 2QGUA 3RNTA 2WOFA 3EC9A 3G16A 3IJEB 4R9LA 3K63A 5IEPA 2YFIB 2QA43 4GHOA 3CNXA 1QAKA 9RNTA 3WHOA 1OACA 4HM4B 1TFOA 1M904 1RNTA 4GB5A 3KE7A 1BRIA 1MNLA 1X1XA 1C7HA 2XEPA 1BRGA 5IF6A 1SQWA 2RNTA 5GSPA 3D9RA 4J8TA 1DMMA 1Q9EA 3KN4A 1BNFA 3DM8A 5HGRA 1V58A 4HVNA 1VQK3 3Q1CA 4RNZA 1OH0A 4KVHA 3X3YA 1EG9B 1CQSA 4X2HA 3EE1A 1PFPA 2H0GA 3BLZA 3F9SA 1T2HA 3WODG 2PZVA 1W7CA 1X1WA 4JRFA 4KFEA 1I8VA 1PYLA 1FYSA 3GZBA 3JVCA 1FGTA 1B2SA 4WYKA 1BAOA 1B2XA 2FNQA 4STDA 3CC23 1NB3I 3V92A 3ZG0A 1GY5A 3DGOA 3CCL3 3N8BA 1OHPA 2SBLA 3EN1B 4J5KA 2P0XA 1GMQA 1PU4A 1BIRA 1IVUA 6RNTA 1RNBA 3VSYA 1O7NB 1TP6A 2D1WA 1IVXA 1JZDA 4L8PA 1M9GA 4HM3B 3HZPA 1EKMA 1JN5B 3WA2X 1TRPA 1UUVB 3LMLA 5BVBA 1FUWA 4BIRA 1MOLA 3DZLA 1NU3A 1BNJA 5D83A 1UUGB 2KF6A 4RNYA 1YHQ3 4BL3A 2W56A 3Q3FA 4OK0A 1I2FA 1N5HA 3JUPA 1RGGA 5AIGA 3LH4A 1I0VA 3B4PA 1A2PA 1WMNA 3BU4A 1WTHA 3JUOA 4LSOA 3CCV3 1D6YA 1YIT3 1DE3A 3GZYB 2INXA 2ZA4A 3N54B 3VGNA 1W4NA 3WOFB 1BNRA 5IG4A 2CKFB 2WGOA 2KRTA 2ZDJA 1A67A 2CFKA 2W9QA 1Q7Y4 1WMPA 2R4IA 2KF3A 4FMAA 2CFWA 2H0IA 3CC43 3KKGA 1SPUA 3SOYA 1S5AA 4N6UA 1V57A 2GXFA 3F8HA 1I70A 3PS8A 3G0KA 3J7Yd 3GAXA 1B3SA 1NDOB 1RMSA 1W6GA 3E99A 4R80A 1ULIB 3NM2A 3GZXB 1RSNA 1WQLB 3CU3A 4FCZA 1I2GA 3BNEA 2F5WA 4MJDA 1BVIA 5AIHA 1IDPA 1KC84 2BMOB 3MG1A 3FG4A 4LZIA 1WMOA 1YGWA 1QJGA 2BMRB 1FGOA 3EJVA 5D82A 2KAAA 1ZO2A 4I5QA 4J5GA 2XGNA 1LRAA 3FCSB 1QVF2 1W5ZA 4XM4A 3LZAA 3DUKA 2OQEA 1BRJA 3FF2A 1BANA 1QAFA 4MMXB 1ISKA 1K28A 1T3BA 3B7CA 5LC6A 1W01A 3S27A 3ZG5A 1CYUA 3B4OA 4O02B 3MHEA 3EBYA 1WNHA 1O7HB 2O3OA 3LT9A 1AVLA 4NREA 3NBJA 3DY5A 5G2GA 4BTXA 1ZS7A 1N8R4 3BIRA 5RNTA 2L4VA 1FGMA 1RJOA 3K9MC 1GOUA 3VF1A 5BIRA 1IYYA 4XBYA 2OTJ3 1LQGC 4GSPA 1G0TA 2IUKA 3MYTA 2UUGC 3UB1A 3RGRA 3CXC2 1UI7A 4FMDA 1JBRA 3LT8A 1RGCA 2F99A 1AV4A 3AGNA 3H51A 4XBXA 2RCDA 1E97A 2F86B 4HZ9B 3DGLA 3K7CA 1B2ZA 1RDSA 1FGQA 1GOYA 1UW1A 2Q07A 3A76A 3S67A 1UDII 1G96A 3FF0A 3MPHA 1NO3A 1JN5A 4HKVB 4WP5A 2M7OA 1O7WB 4HAAA 2BO9B 2KXGA 1BNSA 1I3IA 1VQQA 3IMAB 4R4KA 2OOVA 1UCJA 3GRDA 2CC3A 1IQYA 3G6E3 2CFLA
chains in the Genus database with same CATH topology
3PYJA 1OUNA 2D42A 4FCJA 2GBWB 3BNBA 1RRLA 3SEDA 4HM1B 3FG1A 1VQO3 3WDGB 1Q824 1OHSA 1YVBI 4WHAA 1N5PA 1EQKA 2CK3H 4EV5A 3D3LA 5DRVA 1HU9A 3KIIA 4MMYB 4HM7B 2LYXA 5LC7A 1K8A4 2HMJB 4MMZB 1TUHA 3ECFA 4HM8B 4FCMA 3CPW2 5AEUB 3X41A 1YJN3 3OXAA 3CPOA 2FXTA 4ZM8A 5DREA 2B1XB 3WOEB 1O7PB 5D81A 1UUWB 4ORLA 1GD4A 3X3ZA 4HM5B 1W2ZA 4OVMA 2E2UA 5ELUA 1HKXA 3HI7A 3HIIA 1QMAA 4HM0B 2WGQA 2GEYA 4K90B 3T0UA 1U8CB 1W6CA 2W03A 1A2VA 1NWWA 8CHOA 5JBSA 3NM7A 1Q814 1NB5I 4HZBB 4N6NB 3U1WA 4FR9A 4HYZA 3I553 3UJMA 4EYCA 4IPBA 3TDGA 3OV4A 1U5OA 2P09A 1QALA 2QIYA 1ROVA 3LTCA 1VZZA 3HIGA 2STDA 2HMLB 2I9WA 2W2CA 4OUQA 5AIFA 3FG3A 3AMOB 1NJI4 1F8NA 3JUNA 3V98A 4MEIA 1GS3A 4R1KA 3SOAA 3KFQC 2JQ5A 3MKIA 3SLUA 3CCJ3 5IENA 1N9JA 3BB9A 3PGBA 1Q40B 3UNLA 2QEX3 1IQXA 4N6V0 2P38A 2RGQA 4CDLA 1VQN3 1RKYA 4GL6A 1W00A 1SIIA 2ML5A 4EXRA 5BXQA 5FW5A 3NBBA 1Z1SA 2WOHA 5JPUA 3H3HA 3G713 1LXEA 3NBRA 2WO0A 1VQ73 1KD14 1N8QA 1ROAA 4HM2B 4X2OA 1L5GB 1KQS2 1OF5B 1V74A 3CCQ3 3F14A 3SX1A 3HK4A 2JDIH 5CF2A 3F7XA 1GY7A 1J2BA 2HMKB 3FZWA 1DMNA 3WA3A 4CCVA 4EBGA 2CW9A 1W02A 2IUJA 1VQM3 3LTDA 1N9EA 3OX9A 1JRQA 2K54A 3CCM3 4EV2A 5IEOA 5CLKA 3UL5A 1IT7A 4LEHA 1VQ83 4WFOA 2B24B 1YI23 1YJW3 2UX0A 4RBNA 1UI8A 1IU7A 2XSHB 1JV2B 1EA2A 3QRDA 5CK6A 1RN7A 3ROBA 1YIJ3 2XFSA 1Q864 1JB5A 2PNCA 3NHXA 2CG1A 2GEXA 2XF3A 2A15A 1ZX2A 2XGLA 4H3UA 2Z76A 4IT7A 1K734 3U97A 3NV0B 4KZ1A 2HMMB 2RFRA 3BNDA 1IK3A 1AVKA 3KZTA 3CD63 2YFJB 1QVG2 3NXJA 2W04A 1US1A 4H61A 3DXOA 5IERA 3LTBA 5AI1A 2KCDA 1IVVA 2ZL8A 1IV7A 2CWTA 1TIJA 3OWSA 2W9PA 1LVNA 1JKGB 2CIUA 3S29A 1TFKA 2Z7AA 5IG3A 2HMNB 3AMOA 3CNMA 5I97A 3S5CA 3PCRA 2CG0A 1OPYA 3FLJA 2K0MA 4O8SA 4LMIA 2XSOB 4IIAA 1VQL3 1DYUA 2BMQB 2XRXB 3T8UA 4N6MA 1Q40A 3DGMA 4XDVA 3I563 3CC73 3DMCA 2OCTA 2Z6BA 3L0RA 5ELJA 2W6JH 3IPTA 6STDA 3K0ZA 1Y4KA 3X3XA 3NQYA 3QK9A 1DVDA 2BHMA 1JB4A 2O9UX 1KSIA 3ALAA 3MSOA 4HBRA 2P0MA 1OCVA 5AYSC 1E3RA 3S28A 2V1LA 1D6ZA 2XH9A 5EQLA 5JPPA 2ML6A 2YFLB 3CCU3 1KWIA 4FMCA 2CFDA 3FKAA 4KFDA 1OF5A 1O7GB 3NX0A 4HJLB 1OGZA 3JUMA 2XR8B 4R9KA 3JUQA 4EC6A 5EEOA 1W6YA 5KP1A 3RGAA 5AIIA 3EBTA 1Q42A 1IQ8A 3PXMA 2E2TA 3OW22 5TGNA 1T5YA 3EQQB 1A2KA 4K1UA 2F98A 3GWRA 1M1XB 1VQ53 2OTL3 4HM6B 2GBXB 1GYBA 4K61A 3EHCA 4O3VA 3HX8A 4XDWA 3WMDA 5KP4A 3KSED 2CFGA 1S723 3NV0A 3MG2A 3SXXA 1IT8A 4NHFA 1R4CA 2BNGA 4O2HA 1SJWA 3LOYA 4XBTA 4BTYA 3LTAA 1D6UA 2IA7A 3F7SA 3FGYA 2Y74A 1ASKA 3Q2PA 2YX9A 5IW9A 4K1VA 3G4S3 3LXUX 3ER7A 2P05A 4U13A 1IV9A 1LOXA 4BTWA 3UL6A 3PZWA 3M8CA 5STDA 3KSPA 2CWVA 7STDA 1BUQA 1K41A 1O7MB 3MWZA 1JKGA 1IVWA 1RRHA 1STFI 3CCS3 1VQ63 2OQEC 3I0YA 5A0OB 4N6TA 1AR0A 2Y73A 3EN8A 3X40A 1JNQA 3NQZA 1VQ93 1STDA 2LQVA 3V99A 2XFTA 1DMQA 4G1MB 5KP3A 4WYKB 4N3VA 5EVHA 4AEQA 2IMJA 1JB2A 3OWUA 4N6OB 3F40A 2CWUA 4PEJA 3T8NA 4L8OA 1GD3A 3BNCA 1E3VA 2RSXA 3RDEA 1CEWI 4AKYA 1W2B2 2CH9A 4Q53A 1OHOA 1LNHA 3X42A 3N9HA 5IG5A 2C11A 4LGQA 3PCSA 3DGNA 4FMBA 3NUVA 1K9M4 3MG3A 2MF7A 3B8LA 4AKZA 1YGEA 2GU1A 1SIHA 2GU3A 3FSDA 4XB5A 5AEWB 1A90A 2W56B 2Z77A 3STDA 1YJ93 5CF1A 1GY6A 2OOVC 2OWPA 3Q90A 2E2VA 4QWTA 2CHCA 2FGTA 1VQP3 3EF8A 1FGRA 3F8XA 3CME3 4I4KA 4JF8A 1VQ43 5CXOA 3G8ZA 4RZMA 4J9AA 1JJ22 4N6LA 3FH1A 2C10A 1CYVA 4KFFA 2W0QA 3EX9A 3LYGA 3GZRA 4WWUC 3K5TA 2HMOB 4TX4A 3EB8A 5AYRB 3CMA3 2MC8A 3O8YA 3SVAA 3CCE3 5IG0A 1M1K4 4L7KA 2BT3A 3CCR3 3OWYA 1DVCA 1TU5A 1OGXA 5FGOA 1FA3A 1ULJB 2QGUA 2WOFA 3EC9A 3G16A 3IJEB 4R9LA 3K63A 5IEPA 2YFIB 2QA43 3CNXA 1QAKA 1OACA 4HM4B 1TFOA 1M904 4GB5A 3KE7A 1MNLA 1C7HA 5IF6A 2XEPA 1SQWA 3D9RA 4J8TA 1DMMA 3KN4A 3DM8A 5HGRA 4HVNA 1VQK3 3Q1CA 4RNZA 1OH0A 4KVHA 3X3YA 1EG9B 1CQSA 4X2HA 3EE1A 1PFPA 3BLZA 3F9SA 3WODG 2PZVA 1W7CA 4JRFA 4KFEA 3JVCA 3GZBA 1FGTA 4WYKA 2FNQA 4STDA 3CC23 1NB3I 3V92A 1GY5A 3DGOA 3CCL3 3N8BA 1OHPA 2SBLA 3EN1B 2P0XA 1PU4A 1IVUA 3VSYA 1O7NB 1TP6A 2D1WA 1IVXA 4L8PA 1M9GA 4HM3B 3HZPA 1EKMA 1JN5B 3WA2X 1UUVB 3LMLA 5BVBA 1FUWA 1MOLA 3DZLA 1NU3A 5D83A 4RNYA 1YHQ3 2W56A 4OK0A 1N5HA 3JUPA 5AIGA 3LH4A 3B4PA 1WMNA 3CCV3 1WTHA 3JUOA 4LSOA 1D6YA 1YIT3 3GZYB 2INXA 3N54B 3VGNA 1W4NA 3WOFB 5IG4A 2ZDJA 2CKFB 2KRTA 2WGOA 1A67A 2CFKA 2W9QA 1Q7Y4 1WMPA 2R4IA 4FMAA 2CFWA 3CC43 3KKGA 1SPUA 3SOYA 1S5AA 4N6UA 2GXFA 3F8HA 3PS8A 3G0KA 3J7Yd 3GAXA 1NDOB 1W6GA 3E99A 4R80A 1ULIB 3NM2A 3GZXB 1WQLB 3CU3A 4FCZA 3BNEA 4MJDA 5AIHA 1IDPA 1KC84 2BMOB 3MG1A 3FG4A 4LZIA 1WMOA 1QJGA 2BMRB 1FGOA 3EJVA 5D82A 1ZO2A 2XGNA 3FCSB 1QVF2 1W5ZA 4XM4A 3LZAA 3DUKA 2OQEA 3FF2A 1QAFA 4MMXB 1ISKA 1K28A 3B7CA 5LC6A 1W01A 3S27A 1CYUA 3B4OA 4O02B 3MHEA 3EBYA 1WNHA 1O7HB 2O3OA 3LT9A 1AVLA 4NREA 3NBJA 3DY5A 5G2GA 4BTXA 1N8R4 2L4VA 1FGMA 1RJOA 3K9MC 3VF1A 4XBYA 2OTJ3 2IUKA 3MYTA 3UB1A 3CXC2 3RGRA 1UI7A 4FMDA 3LT8A 2F99A 1AV4A 3H51A 4XBXA 2RCDA 1E97A 2F86B 4HZ9B 3DGLA 3K7CA 1UW1A 1FGQA 3A76A 2Q07A 3S67A 1G96A 3FF0A 3MPHA 1NO3A 1JN5A 4HKVB 4WP5A 2M7OA 1O7WB 2BO9B 2KXGA 3IMAB 4R4KA 2OOVA 3GRDA 2CC3A 1IQYA 3G6E3 2CFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUN A;  4FCJ A;  2GBW B;  3SED A;  4HM1 B;  1OHS A;  5DRV A;  4HM7 B;  2HMJ B;  1TUH A;  3ECF A;  4HM8 B;  4FCM A;  5AEU B;  3OXA A;  3CPO A;  5DRE A;  2B1X B;  1O7P B;  5D81 A;  1UUW B;  4ORL A;  4HM5 B;  4OVM A;  1HKX A;  1QMA A;  4HM0 B;  2GEY A;  1NWW A;  8CHO A;  4HZB B;  3UJM A;  3OV4 A;  1U5O A;  2QIY A;  1VZZ A;  2STD A;  2HML B;  5AIF A;  2I9W A;  2W2C A;  4OUQ A;  3JUN A;  4R1K A;  1GS3 A;  3SOA A;  2JQ5 A;  3MKI A;  5IEN A;  3BB9 A;  1Q40 B;  3UNL A;  2RGQ A;  4CDL A;  1W00 A;  5BXQ A;  5FW5 A;  1Z1S A;  5JPU A;  3H3H A;  3NBR A;  4HM2 B;  4X2O A;  1OF5 B;  3F14 A;  3HK4 A;  5CF2 A;  3F7X A;  1GY7 A;  2HMK B;  3FZW A;  1DMN A;  1W02 A;  3OX9 A;  2K54 A;  5IEO A;  5CLK A;  4LEH A;  2B24 B;  2UX0 A;  2XSH B;  5CK6 A;  3ROB A;  1EA2 A;  1JB5 A;  3NHX A;  2GEX A;  2A15 A;  1ZX2 A;  4H3U A;  2Z76 A;  3NV0 B;  2HMM B;  2RFR A;  3KZT A;  2YFJ B;  3NXJ A;  5IER A;  3DXO A;  5AI1 A;  3OWS A;  1JKG B;  2Z7A A;  5IG3 A;  2HMN B;  3CNM A;  3S5C A;  1OPY A;  3FLJ A;  4LMI A;  2XSO B;  4IIA A;  2BMQ B;  2XRX B;  3T8U A;  1Q40 A;  4XDV A;  3DMC A;  6STD A;  3IPT A;  3K0Z A;  1JB4 A;  3MSO A;  1OCV A;  1E3R A;  5JPP A;  2YFL B;  3FKA A;  1OF5 A;  1O7G B;  4HJL B;  1OGZ A;  3JUM A;  2XR8 B;  4R9K A;  3JUQ A;  1W6Y A;  5KP1 A;  3RGA A;  5AII A;  3EBT A;  1Q42 A;  5TGN A;  3EQQ B;  1A2K A;  4K1U A;  2F98 A;  3GWR A;  4HM6 B;  2GBX B;  1GYB A;  3EHC A;  3HX8 A;  4XDW A;  3WMD A;  5KP4 A;  3NV0 A;  3MG2 A;  2BNG A;  4XBT A;  1SJW A;  3F7S A;  3FGY A;  1ASK A;  4K1V A;  3ER7 A;  4U13 A;  3M8C A;  5STD A;  3KSP A;  7STD A;  1BUQ A;  1K41 A;  1O7M B;  1JKG A;  3I0Y A;  1AR0 A;  3EN8 A;  1STD A;  1DMQ A;  5KP3 A;  4WYK B;  4N3V A;  5EVH A;  2IMJ A;  1JB2 A;  3OWU A;  3F40 A;  4PEJ A;  3T8N A;  4L8O A;  1E3V A;  4Q53 A;  1OHO A;  5IG5 A;  4LGQ A;  3NUV A;  3MG3 A;  3B8L A;  3FSD A;  4XB5 A;  5AEW B;  2Z77 A;  3STD A;  5CF1 A;  1GY6 A;  2OWP A;  3Q90 A;  2CHC A;  3EF8 A;  3F8X A;  4I4K A;  5CXO A;  3G8Z A;  4RZM A;  4J9A A;  3FH1 A;  3EX9 A;  3LYG A;  3GZR A;  4WWU C;  2HMO B;  5IG0 A;  4L7K A;  3OWY A;  1OGX A;  1ULJ B;  2QGU A;  3EC9 A;  3G16 A;  4R9L A;  5IEP A;  2YFI B;  3CNX A;  4HM4 B;  4GB5 A;  3KE7 A;  1C7H A;  5IF6 A;  3D9R A;  4J8T A;  1DMM A;  3DM8 A;  5HGR A;  4HVN A;  4KVH A;  1OH0 A;  1EG9 B;  1CQS A;  4X2H A;  3BLZ A;  3F9S A;  2PZV A;  3GZB A;  4WYK A;  4STD A;  1GY5 A;  1OHP A;  3EN1 B;  3VSY A;  1O7N B;  1TP6 A;  4L8P A;  4HM3 B;  3HZP A;  1JN5 B;  1UUV B;  5BVB A;  3DZL A;  1NU3 A;  5D83 A;  3JUP A;  5AIG A;  3B4P A;  3JUO A;  3GZY B;  2INX A;  3VGN A;  5IG4 A;  2CKF B;  2R4I A;  3KKG A;  3SOY A;  1S5A A;  2GXF A;  3F8H A;  3G0K A;  1NDO B;  3E99 A;  1ULI B;  3NM2 A;  3GZX B;  1WQL B;  3CU3 A;  4MJD A;  5AIH A;  1IDP A;  2BMO B;  3MG1 A;  1QJG A;  2BMR B;  3EJV A;  5D82 A;  1ZO2 A;  4XM4 A;  3LZA A;  3DUK A;  3FF2 A;  1ISK A;  3B7C A;  1W01 A;  3B4O A;  3MHE A;  3EBY A;  1O7H B;  5G2G A;  4XBY A;  3MYT A;  3RGR A;  2F99 A;  3H51 A;  4XBX A;  2RCD A;  1E97 A;  2F86 B;  4HZ9 B;  3K7C A;  3A76 A;  3FF0 A;  1JN5 A;  4HKV B;  4WP5 A;  1O7W B;  3GRD A; 
#chains in the Genus database with same CATH topology
 1GOV A;  3PYJ A;  1OUN A;  2D42 A;  2KF5 A;  4FCJ A;  3DGY A;  2GBW B;  3BNB A;  1RRL A;  3SED A;  4HM1 B;  3FG1 A;  1VQO 3;  3WDG B;  1Q82 4;  1OHS A;  1YVB I;  4WHA A;  1BSB A;  1BSE A;  1N5P A;  1EQK A;  3AHS A;  2CK3 H;  4EV5 A;  3D3L A;  5DRV A;  1HU9 A;  3KII A;  4MMY B;  4HM7 B;  2LYX A;  5LC7 A;  1K8A 4;  2HMJ B;  4MMZ B;  1TUH A;  3ECF A;  4HM8 B;  4FCM A;  3CPW 2;  5AEU B;  3X41 A;  4EW5 A;  1JBT A;  1Q7H A;  3GSP A;  2F4Y A;  3AHW A;  1YJN 3;  3HOH A;  3OXA A;  1LNI A;  3CPO A;  2FXT A;  4ZM8 A;  5DRE A;  1UCI A;  2B1X B;  3WOE B;  1O7P B;  2BIR A;  5D81 A;  1UUW B;  4ORL A;  2RBI A;  1GD4 A;  1UGI A;  1B20 A;  3X3Z A;  4HM5 B;  1W2Z A;  4OVM A;  2E2U A;  1X1U A;  5ELU A;  1HKX A;  3HI7 A;  3HII A;  1QMA A;  4HM0 B;  2WGQ A;  2GEY A;  4K90 B;  3T0U A;  1U8C B;  1PY3 A;  1W6C A;  2KF4 A;  4NPB A;  2C4B A;  2W03 A;  1A2V A;  1NWW A;  8CHO A;  5JBS A;  3NM7 A;  1RGK A;  1Q81 4;  1LQM B;  1NB5 I;  4HZB B;  4N6N B;  3U1W A;  1RGE A;  4FR9 A;  2F5M A;  4HYZ A;  3I55 3;  3UJM A;  4EYC A;  4IPB A;  3TDG A;  4CPK A;  3OV4 A;  3D5I A;  1U5O A;  7GSP A;  4KT3 B;  1C54 A;  2P09 A;  1QAL A;  2QIY A;  1I3F A;  1UGH I;  1ROV A;  1X1Y A;  1UCK A;  3D79 A;  3LTC A;  1VZZ A;  3HIG A;  2STD A;  2HML B;  2I9W A;  2W2C A;  4OUQ A;  5AIF A;  3FG3 A;  3AMO B;  1NJI 4;  1F8N A;  3JUN A;  3V98 A;  4MEI A;  1GS3 A;  4R1K A;  3SOA A;  3KFQ C;  2JQ5 A;  1RGL A;  3MKI A;  2IY2 A;  3SLU A;  3CCJ 3;  5IEN A;  1YNV X;  1N9J A;  2GSP A;  1TTO A;  3BB9 A;  3PGB A;  2J8X B;  1Q40 B;  3UNL A;  2QEX 3;  1IQX A;  4N6V 0;  1BRS A;  4RNT A;  2P38 A;  2RGQ A;  5G1L A;  4CDL A;  4BL2 A;  1VQN 3;  1RGA A;  1RKY A;  4GL6 A;  1FW7 A;  1W00 A;  1SII A;  3AGO A;  1RN4 A;  2ML5 A;  4EXR A;  5BXQ A;  5FW5 A;  3NBB A;  1Z1S A;  1LOV A;  2WOH A;  5JPU A;  1TRQ A;  1RLS A;  3H3H A;  3G71 3;  1LXE A;  3NBR A;  2WO0 A;  1VQ7 3;  1KD1 4;  1N8Q A;  1ROA A;  4HM2 B;  3DH2 A;  1B2U A;  4X2O A;  3D5G A;  1L5G B;  2AAD A;  1OF5 B;  1T2I A;  1V74 A;  3CCQ 3;  1KQS 2;  3F14 A;  2L1S A;  1JZO A;  3HK4 A;  2JDI H;  3SX1 A;  5CF2 A;  3F7X A;  1GY7 A;  1J2B A;  2HMK B;  3FZW A;  1DMN A;  3WA3 A;  4CCV A;  4EBG A;  2CW9 A;  1W02 A;  2IUJ A;  1ZGX A;  1HZ1 A;  1VQM 3;  3LTD A;  1N9E A;  3OX9 A;  1JRQ A;  2K54 A;  3CCM 3;  3A5E A;  4EV2 A;  5IEO A;  2AAE A;  5CLK A;  3UL5 A;  1IT7 A;  4LEH A;  1VQ8 3;  4WFO A;  2B24 B;  1YI2 3;  1YJW 3;  2UX0 A;  4RBN A;  1UI8 A;  2IYJ A;  1IU7 A;  2XSH B;  1JV2 B;  1EA2 A;  3QRD A;  5CK6 A;  1RN7 A;  3ROB A;  5M19 A;  1YIJ 3;  2XFS A;  1Q86 4;  1JB5 A;  2PNC A;  3NHX A;  2CG1 A;  2GEX A;  2XF3 A;  2A15 A;  1ZX2 A;  2XGL A;  4H3U A;  2Z76 A;  4IT7 A;  1K73 4;  3U97 A;  3NV0 B;  4KZ1 A;  2HMM B;  2RFR A;  3BND A;  3URP A;  2HOH A;  1IK3 A;  1AVK A;  3KCH A;  3KZT A;  3CD6 3;  2YFJ B;  1QVG 2;  3NXJ A;  1RCL A;  2W04 A;  1US1 A;  4H61 A;  3DXO A;  5IER A;  1BSC A;  3LTB A;  1EEJ A;  5AI1 A;  1NNV A;  2KCD A;  1IVV A;  2K3D A;  2ZL8 A;  1IV7 A;  2CWT A;  1TIJ A;  3OWS A;  2W9P A;  1LVN A;  1JKG B;  1FUS A;  1MGW A;  1TJD A;  2CIU A;  3S29 A;  1TFK A;  2Z7A A;  5IG3 A;  2HMN B;  3AMO A;  3CNM A;  5I97 A;  3S5C A;  3PCR A;  2CG0 A;  1OPY A;  1RGF A;  2K0M A;  3FLJ A;  4O8S A;  1BNG A;  4LMI A;  2XSO B;  4IIA A;  1VQL 3;  1DYU A;  1GMP A;  2BMQ B;  1AQZ A;  1DET A;  1MWT A;  2XRX B;  3T8U A;  1BGS A;  4N6M A;  1Q40 A;  3DGM A;  4XDV A;  3I56 3;  5G1K A;  3DMC A;  2OCT A;  2Z6B A;  3L0R A;  5ELJ A;  2W6J H;  3IPT A;  1SAR A;  6STD A;  1BRH A;  3K0Z A;  3ZFZ A;  1FUT A;  1Y4K A;  3NQY A;  3X3X A;  3QK9 A;  1DVD A;  2BHM A;  1JB4 A;  2O9U X;  1KSI A;  2F56 A;  3ALA A;  2UGI A;  3MSO A;  4HBR A;  2P0M A;  1OCV A;  5AYS C;  1E3R A;  3S28 A;  1B2M A;  2V1L A;  1D6Z A;  2XH9 A;  1BNI A;  5EQL A;  5JPP A;  1LOY A;  2ML6 A;  2YFL B;  3CCU 3;  1KWI A;  4FMC A;  2CFD A;  3FKA A;  4KFD A;  1OF5 A;  1BRK A;  1O7G B;  3NX0 A;  4HJL B;  1OGZ A;  3JUM A;  5HOH A;  2XR8 B;  1B21 A;  4CJN A;  5M1A A;  5BU4 A;  4R9K A;  3JUQ A;  1BNE A;  4HOH A;  4EC6 A;  1BRN L;  5EEO A;  1W6Y A;  5KP1 A;  3RGA A;  5AII A;  3EBT A;  1EUI C;  1Q42 A;  3WR2 A;  1IQ8 A;  1I0X A;  3PXM A;  5M18 A;  1LOW A;  2E2T A;  5TGN A;  1RN1 A;  3OW2 2;  1T5Y A;  3EQQ B;  6GSP A;  1A2K A;  4K1U A;  1UCL A;  2F98 A;  1BSA A;  3GWR A;  1M1X B;  1VQ5 3;  2OTL 3;  4HM6 B;  1HYF A;  1GSP A;  2GBX B;  1GYB A;  1RHL A;  4K61 A;  3EHC A;  1R4Y A;  1B27 A;  4O3V A;  3HX8 A;  4XDW A;  3WMD A;  5KP4 A;  3KSE D;  2CFG A;  1S72 3;  3NV0 A;  1MWR A;  3MG2 A;  3SXX A;  1IT8 A;  4NHF A;  1R4C A;  2BNG A;  4O2H A;  1SJW A;  3LOY A;  1MWU A;  4XBT A;  4BTY A;  1CH0 A;  3LTA A;  1D6U A;  2IA7 A;  3F7S A;  3FGY A;  1BOX A;  2Y74 A;  2CX0 A;  1ASK A;  3Q2P A;  2YX9 A;  5IW9 A;  4K1V A;  3G4S 3;  3LXU X;  3ER7 A;  2P05 A;  4U13 A;  1IV9 A;  1LOX A;  4BTW A;  3UL6 A;  1G02 A;  3M8C A;  3PZW A;  5STD A;  3KSP A;  1AY7 A;  2CWV A;  1I2E A;  1FZU A;  7STD A;  1BUQ A;  1K41 A;  1O7M B;  3MWZ A;  1JKG A;  1IVW A;  1MWS A;  1RRH A;  1STF I;  3CCS 3;  1VQ6 3;  2OQE C;  3I0Y A;  5A0O B;  4N6T A;  1AR0 A;  2Y73 A;  3EN8 A;  2H0H A;  1JNQ A;  3X40 A;  3NQZ A;  4BU4 A;  1VQ9 3;  1STD A;  2LQV A;  3D4A A;  3V99 A;  2XFT A;  1DMQ A;  4G1M B;  5KP3 A;  1RCK A;  4N3V A;  4WYK B;  2R41 A;  5EVH A;  4AEQ A;  2IMJ A;  1JB2 A;  3OWU A;  4N6O B;  3F40 A;  2CWU A;  2CX1 A;  4PEJ A;  3T8N A;  4L8O A;  1GD3 A;  3BNC A;  8RNT A;  1E3V A;  2RSX A;  3RDE A;  1CEW I;  3SYU A;  4AKY A;  4LYL B;  1W2B 2;  4ILF A;  2CH9 A;  4Q53 A;  1OHO A;  1LNH A;  3X42 A;  3N9H A;  5IG5 A;  2C11 A;  4LGQ A;  3PCS A;  3DGN A;  4FMB A;  3CC7 3;  3NUV A;  1K9M 4;  3MG3 A;  2MF7 A;  3B8L A;  2ZHX B;  4AKZ A;  1YGE A;  2BU4 A;  2GU1 A;  1SIH A;  2GU3 A;  3FSD A;  4XB5 A;  5AEW B;  1A90 A;  1JBS A;  2W56 B;  2Z77 A;  3STD A;  1YJ9 3;  5CF1 A;  1MGR A;  1GY6 A;  2OOV C;  2OWP A;  3Q90 A;  2E2V A;  4QWT A;  2CHC A;  2FGT A;  1VQP 3;  3EF8 A;  1FGR A;  3F8X A;  3CME 3;  1BSD A;  4I4K A;  4JF8 A;  7RNT A;  1VQ4 3;  5CXO A;  2SAR A;  1BU4 A;  3G8Z A;  4RZM A;  1GMR A;  4J9A A;  4N6L A;  1JJ2 2;  1BUJ A;  3FH1 A;  2C10 A;  1CYV A;  4KFF A;  2W0Q A;  3EX9 A;  3LYG A;  1YVS A;  3GZR A;  4WWU C;  3K5T A;  2HMO B;  4TX4 A;  1RGH A;  3EB8 A;  5AYR B;  3CMA 3;  2MC8 A;  1RTU A;  3O8Y A;  3SVA A;  3CCE 3;  5IG0 A;  1M1K 4;  4L7K A;  2BT3 A;  3CCR 3;  4DKI A;  3OWY A;  1DVC A;  1TU5 A;  1OGX A;  5FGO A;  1FA3 A;  1ULJ B;  2QGU A;  3RNT A;  2WOF A;  3EC9 A;  3G16 A;  3IJE B;  4R9L A;  3K63 A;  5IEP A;  2YFI B;  2QA4 3;  4GHO A;  3CNX A;  1QAK A;  9RNT A;  3WHO A;  1OAC A;  4HM4 B;  1TFO A;  1M90 4;  1RNT A;  4GB5 A;  3KE7 A;  1BRI A;  1MNL A;  1X1X A;  1C7H A;  2XEP A;  1BRG A;  5IF6 A;  1SQW A;  2RNT A;  5GSP A;  3D9R A;  4J8T A;  1DMM A;  1Q9E A;  3KN4 A;  1BNF A;  3DM8 A;  5HGR A;  1V58 A;  4HVN A;  1VQK 3;  3Q1C A;  4RNZ A;  1OH0 A;  4KVH A;  3X3Y A;  1EG9 B;  1CQS A;  4X2H A;  3EE1 A;  1PFP A;  2H0G A;  3BLZ A;  3F9S A;  1T2H A;  3WOD G;  2PZV A;  1W7C A;  1X1W A;  4JRF A;  4KFE A;  1I8V A;  1PYL A;  1FYS A;  3GZB A;  3JVC A;  1FGT A;  1B2S A;  4WYK A;  1BAO A;  1B2X A;  2FNQ A;  4STD A;  3CC2 3;  1NB3 I;  3V92 A;  3ZG0 A;  1GY5 A;  3DGO A;  3CCL 3;  3N8B A;  1OHP A;  2SBL A;  3EN1 B;  4J5K A;  2P0X A;  1GMQ A;  1PU4 A;  1BIR A;  1IVU A;  6RNT A;  1RNB A;  3VSY A;  1O7N B;  1TP6 A;  2D1W A;  1IVX A;  1JZD A;  4L8P A;  1M9G A;  4HM3 B;  3HZP A;  1EKM A;  1JN5 B;  3WA2 X;  1TRP A;  1UUV B;  3LML A;  5BVB A;  1FUW A;  4BIR A;  1MOL A;  3DZL A;  1NU3 A;  1BNJ A;  5D83 A;  1UUG B;  2KF6 A;  4RNY A;  1YHQ 3;  4BL3 A;  2W56 A;  3Q3F A;  4OK0 A;  1I2F A;  1N5H A;  3JUP A;  1RGG A;  5AIG A;  3LH4 A;  1I0V A;  3B4P A;  1A2P A;  1WMN A;  3BU4 A;  1WTH A;  3JUO A;  4LSO A;  3CCV 3;  1D6Y A;  1YIT 3;  1DE3 A;  3GZY B;  2INX A;  2ZA4 A;  3N54 B;  3VGN A;  1W4N A;  3WOF B;  1BNR A;  5IG4 A;  2CKF B;  2WGO A;  2KRT A;  2ZDJ A;  1A67 A;  2CFK A;  2W9Q A;  1Q7Y 4;  1WMP A;  2R4I A;  2KF3 A;  4FMA A;  2CFW A;  2H0I A;  3CC4 3;  3KKG A;  1SPU A;  3SOY A;  1S5A A;  4N6U A;  1V57 A;  2GXF A;  3F8H A;  1I70 A;  3PS8 A;  3G0K A;  3J7Y d;  3GAX A;  1B3S A;  1NDO B;  1RMS A;  1W6G A;  3E99 A;  4R80 A;  1ULI B;  3NM2 A;  3GZX B;  1RSN A;  1WQL B;  3CU3 A;  4FCZ A;  1I2G A;  3BNE A;  2F5W A;  4MJD A;  1BVI A;  5AIH A;  1IDP A;  1KC8 4;  2BMO B;  3MG1 A;  3FG4 A;  4LZI A;  1WMO A;  1YGW A;  1QJG A;  2BMR B;  1FGO A;  3EJV A;  5D82 A;  2KAA A;  1ZO2 A;  4I5Q A;  4J5G A;  2XGN A;  1LRA A;  3FCS B;  1QVF 2;  1W5Z A;  4XM4 A;  3LZA A;  3DUK A;  2OQE A;  1BRJ A;  3FF2 A;  1BAN A;  1QAF A;  4MMX B;  1ISK A;  1K28 A;  1T3B A;  3B7C A;  5LC6 A;  1W01 A;  3S27 A;  3ZG5 A;  1CYU A;  3B4O A;  4O02 B;  3MHE A;  3EBY A;  1WNH A;  1O7H B;  2O3O A;  3LT9 A;  1AVL A;  4NRE A;  3NBJ A;  3DY5 A;  5G2G A;  4BTX A;  1ZS7 A;  1N8R 4;  3BIR A;  5RNT A;  2L4V A;  1FGM A;  1RJO A;  3K9M C;  1GOU A;  3VF1 A;  5BIR A;  1IYY A;  4XBY A;  2OTJ 3;  1LQG C;  4GSP A;  1G0T A;  2IUK A;  3MYT A;  2UUG C;  3UB1 A;  3RGR A;  3CXC 2;  1UI7 A;  4FMD A;  1JBR A;  3LT8 A;  1RGC A;  2F99 A;  1AV4 A;  3AGN A;  3H51 A;  4XBX A;  2RCD A;  1E97 A;  2F86 B;  4HZ9 B;  3DGL A;  3K7C A;  1B2Z A;  1RDS A;  1FGQ A;  1GOY A;  1UW1 A;  2Q07 A;  3A76 A;  3S67 A;  1UDI I;  1G96 A;  3FF0 A;  3MPH A;  1NO3 A;  1JN5 A;  4HKV B;  4WP5 A;  2M7O A;  1O7W B;  4HAA A;  2BO9 B;  2KXG A;  1BNS A;  1I3I A;  1VQQ A;  3IMA B;  4R4K A;  2OOV A;  1UCJ A;  3GRD A;  2CC3 A;  1IQY A;  3G6E 3;  2CFL A; 
#chains in the Genus database with same CATH homology
 3PYJ A;  1OUN A;  2D42 A;  4FCJ A;  2GBW B;  3BNB A;  1RRL A;  3SED A;  4HM1 B;  3FG1 A;  1VQO 3;  3WDG B;  1Q82 4;  1OHS A;  1YVB I;  4WHA A;  1N5P A;  1EQK A;  2CK3 H;  4EV5 A;  3D3L A;  5DRV A;  1HU9 A;  3KII A;  4MMY B;  4HM7 B;  2LYX A;  5LC7 A;  1K8A 4;  2HMJ B;  4MMZ B;  1TUH A;  3ECF A;  4HM8 B;  4FCM A;  3CPW 2;  5AEU B;  3X41 A;  1YJN 3;  3OXA A;  3CPO A;  2FXT A;  4ZM8 A;  5DRE A;  2B1X B;  3WOE B;  1O7P B;  5D81 A;  1UUW B;  4ORL A;  1GD4 A;  3X3Z A;  4HM5 B;  1W2Z A;  4OVM A;  2E2U A;  5ELU A;  1HKX A;  3HI7 A;  3HII A;  1QMA A;  4HM0 B;  2WGQ A;  2GEY A;  4K90 B;  3T0U A;  1U8C B;  1W6C A;  2W03 A;  1A2V A;  1NWW A;  8CHO A;  5JBS A;  3NM7 A;  1Q81 4;  1NB5 I;  4HZB B;  4N6N B;  3U1W A;  4FR9 A;  4HYZ A;  3I55 3;  3UJM A;  4EYC A;  4IPB A;  3TDG A;  3OV4 A;  1U5O A;  2P09 A;  1QAL A;  2QIY A;  1ROV A;  3LTC A;  1VZZ A;  3HIG A;  2STD A;  2HML B;  2I9W A;  2W2C A;  4OUQ A;  5AIF A;  3FG3 A;  3AMO B;  1NJI 4;  1F8N A;  3JUN A;  3V98 A;  4MEI A;  1GS3 A;  4R1K A;  3SOA A;  3KFQ C;  2JQ5 A;  3MKI A;  3SLU A;  3CCJ 3;  5IEN A;  1N9J A;  3BB9 A;  3PGB A;  1Q40 B;  3UNL A;  2QEX 3;  1IQX A;  4N6V 0;  2P38 A;  2RGQ A;  4CDL A;  1VQN 3;  1RKY A;  4GL6 A;  1W00 A;  1SII A;  2ML5 A;  4EXR A;  5BXQ A;  5FW5 A;  3NBB A;  1Z1S A;  2WOH A;  5JPU A;  3H3H A;  3G71 3;  1LXE A;  3NBR A;  2WO0 A;  1VQ7 3;  1KD1 4;  1N8Q A;  1ROA A;  4HM2 B;  4X2O A;  1L5G B;  1KQS 2;  1OF5 B;  1V74 A;  3CCQ 3;  3F14 A;  3SX1 A;  3HK4 A;  2JDI H;  5CF2 A;  3F7X A;  1GY7 A;  1J2B A;  2HMK B;  3FZW A;  1DMN A;  3WA3 A;  4CCV A;  4EBG A;  2CW9 A;  1W02 A;  2IUJ A;  1VQM 3;  3LTD A;  1N9E A;  3OX9 A;  1JRQ A;  2K54 A;  3CCM 3;  4EV2 A;  5IEO A;  5CLK A;  3UL5 A;  1IT7 A;  4LEH A;  1VQ8 3;  4WFO A;  2B24 B;  1YI2 3;  1YJW 3;  2UX0 A;  4RBN A;  1UI8 A;  1IU7 A;  2XSH B;  1JV2 B;  1EA2 A;  3QRD A;  5CK6 A;  1RN7 A;  3ROB A;  1YIJ 3;  2XFS A;  1Q86 4;  1JB5 A;  2PNC A;  3NHX A;  2CG1 A;  2GEX A;  2XF3 A;  2A15 A;  1ZX2 A;  2XGL A;  4H3U A;  2Z76 A;  4IT7 A;  1K73 4;  3U97 A;  3NV0 B;  4KZ1 A;  2HMM B;  2RFR A;  3BND A;  1IK3 A;  1AVK A;  3KZT A;  3CD6 3;  2YFJ B;  1QVG 2;  3NXJ A;  2W04 A;  1US1 A;  4H61 A;  3DXO A;  5IER A;  3LTB A;  5AI1 A;  2KCD A;  1IVV A;  2ZL8 A;  1IV7 A;  2CWT A;  1TIJ A;  3OWS A;  2W9P A;  1LVN A;  1JKG B;  2CIU A;  3S29 A;  1TFK A;  2Z7A A;  5IG3 A;  2HMN B;  3AMO A;  3CNM A;  5I97 A;  3S5C A;  3PCR A;  2CG0 A;  1OPY A;  3FLJ A;  2K0M A;  4O8S A;  4LMI A;  2XSO B;  4IIA A;  1VQL 3;  1DYU A;  2BMQ B;  2XRX B;  3T8U A;  4N6M A;  1Q40 A;  3DGM A;  4XDV A;  3I56 3;  3CC7 3;  3DMC A;  2OCT A;  2Z6B A;  3L0R A;  5ELJ A;  2W6J H;  3IPT A;  6STD A;  3K0Z A;  1Y4K A;  3X3X A;  3NQY A;  3QK9 A;  1DVD A;  2BHM A;  1JB4 A;  2O9U X;  1KSI A;  3ALA A;  3MSO A;  4HBR A;  2P0M A;  1OCV A;  5AYS C;  1E3R A;  3S28 A;  2V1L A;  1D6Z A;  2XH9 A;  5EQL A;  5JPP A;  2ML6 A;  2YFL B;  3CCU 3;  1KWI A;  4FMC A;  2CFD A;  3FKA A;  4KFD A;  1OF5 A;  1O7G B;  3NX0 A;  4HJL B;  1OGZ A;  3JUM A;  2XR8 B;  4R9K A;  3JUQ A;  4EC6 A;  5EEO A;  1W6Y A;  5KP1 A;  3RGA A;  5AII A;  3EBT A;  1Q42 A;  1IQ8 A;  3PXM A;  2E2T A;  3OW2 2;  5TGN A;  1T5Y A;  3EQQ B;  1A2K A;  4K1U A;  2F98 A;  3GWR A;  1M1X B;  1VQ5 3;  2OTL 3;  4HM6 B;  2GBX B;  1GYB A;  4K61 A;  3EHC A;  4O3V A;  3HX8 A;  4XDW A;  3WMD A;  5KP4 A;  3KSE D;  2CFG A;  1S72 3;  3NV0 A;  3MG2 A;  3SXX A;  1IT8 A;  4NHF A;  1R4C A;  2BNG A;  4O2H A;  1SJW A;  3LOY A;  4XBT A;  4BTY A;  3LTA A;  1D6U A;  2IA7 A;  3F7S A;  3FGY A;  2Y74 A;  1ASK A;  3Q2P A;  2YX9 A;  5IW9 A;  4K1V A;  3G4S 3;  3LXU X;  3ER7 A;  2P05 A;  4U13 A;  1IV9 A;  1LOX A;  4BTW A;  3UL6 A;  3PZW A;  3M8C A;  5STD A;  3KSP A;  2CWV A;  7STD A;  1BUQ A;  1K41 A;  1O7M B;  3MWZ A;  1JKG A;  1IVW A;  1RRH A;  1STF I;  3CCS 3;  1VQ6 3;  2OQE C;  3I0Y A;  5A0O B;  4N6T A;  1AR0 A;  2Y73 A;  3EN8 A;  3X40 A;  1JNQ A;  3NQZ A;  1VQ9 3;  1STD A;  2LQV A;  3V99 A;  2XFT A;  1DMQ A;  4G1M B;  5KP3 A;  4WYK B;  4N3V A;  5EVH A;  4AEQ A;  2IMJ A;  1JB2 A;  3OWU A;  4N6O B;  3F40 A;  2CWU A;  4PEJ A;  3T8N A;  4L8O A;  1GD3 A;  3BNC A;  1E3V A;  2RSX A;  3RDE A;  1CEW I;  4AKY A;  1W2B 2;  2CH9 A;  4Q53 A;  1OHO A;  1LNH A;  3X42 A;  3N9H A;  5IG5 A;  2C11 A;  4LGQ A;  3PCS A;  3DGN A;  4FMB A;  3NUV A;  1K9M 4;  3MG3 A;  2MF7 A;  3B8L A;  4AKZ A;  1YGE A;  2GU1 A;  1SIH A;  2GU3 A;  3FSD A;  4XB5 A;  5AEW B;  1A90 A;  2W56 B;  2Z77 A;  3STD A;  1YJ9 3;  5CF1 A;  1GY6 A;  2OOV C;  2OWP A;  3Q90 A;  2E2V A;  4QWT A;  2CHC A;  2FGT A;  1VQP 3;  3EF8 A;  1FGR A;  3F8X A;  3CME 3;  4I4K A;  4JF8 A;  1VQ4 3;  5CXO A;  3G8Z A;  4RZM A;  4J9A A;  1JJ2 2;  4N6L A;  3FH1 A;  2C10 A;  1CYV A;  4KFF A;  2W0Q A;  3EX9 A;  3LYG A;  3GZR A;  4WWU C;  3K5T A;  2HMO B;  4TX4 A;  3EB8 A;  5AYR B;  3CMA 3;  2MC8 A;  3O8Y A;  3SVA A;  3CCE 3;  5IG0 A;  1M1K 4;  4L7K A;  2BT3 A;  3CCR 3;  3OWY A;  1DVC A;  1TU5 A;  1OGX A;  5FGO A;  1FA3 A;  1ULJ B;  2QGU A;  2WOF A;  3EC9 A;  3G16 A;  3IJE B;  4R9L A;  3K63 A;  5IEP A;  2YFI B;  2QA4 3;  3CNX A;  1QAK A;  1OAC A;  4HM4 B;  1TFO A;  1M90 4;  4GB5 A;  3KE7 A;  1MNL A;  1C7H A;  5IF6 A;  2XEP A;  1SQW A;  3D9R A;  4J8T A;  1DMM A;  3KN4 A;  3DM8 A;  5HGR A;  4HVN A;  1VQK 3;  3Q1C A;  4RNZ A;  1OH0 A;  4KVH A;  3X3Y A;  1EG9 B;  1CQS A;  4X2H A;  3EE1 A;  1PFP A;  3BLZ A;  3F9S A;  3WOD G;  2PZV A;  1W7C A;  4JRF A;  4KFE A;  3JVC A;  3GZB A;  1FGT A;  4WYK A;  2FNQ A;  4STD A;  3CC2 3;  1NB3 I;  3V92 A;  1GY5 A;  3DGO A;  3CCL 3;  3N8B A;  1OHP A;  2SBL A;  3EN1 B;  2P0X A;  1PU4 A;  1IVU A;  3VSY A;  1O7N B;  1TP6 A;  2D1W A;  1IVX A;  4L8P A;  1M9G A;  4HM3 B;  3HZP A;  1EKM A;  1JN5 B;  3WA2 X;  1UUV B;  3LML A;  5BVB A;  1FUW A;  1MOL A;  3DZL A;  1NU3 A;  5D83 A;  4RNY A;  1YHQ 3;  2W56 A;  4OK0 A;  1N5H A;  3JUP A;  5AIG A;  3LH4 A;  3B4P A;  1WMN A;  3CCV 3;  1WTH A;  3JUO A;  4LSO A;  1D6Y A;  1YIT 3;  3GZY B;  2INX A;  3N54 B;  3VGN A;  1W4N A;  3WOF B;  5IG4 A;  2ZDJ A;  2CKF B;  2KRT A;  2WGO A;  1A67 A;  2CFK A;  2W9Q A;  1Q7Y 4;  1WMP A;  2R4I A;  4FMA A;  2CFW A;  3CC4 3;  3KKG A;  1SPU A;  3SOY A;  1S5A A;  4N6U A;  2GXF A;  3F8H A;  3PS8 A;  3G0K A;  3J7Y d;  3GAX A;  1NDO B;  1W6G A;  3E99 A;  4R80 A;  1ULI B;  3NM2 A;  3GZX B;  1WQL B;  3CU3 A;  4FCZ A;  3BNE A;  4MJD A;  5AIH A;  1IDP A;  1KC8 4;  2BMO B;  3MG1 A;  3FG4 A;  4LZI A;  1WMO A;  1QJG A;  2BMR B;  1FGO A;  3EJV A;  5D82 A;  1ZO2 A;  2XGN A;  3FCS B;  1QVF 2;  1W5Z A;  4XM4 A;  3LZA A;  3DUK A;  2OQE A;  3FF2 A;  1QAF A;  4MMX B;  1ISK A;  1K28 A;  3B7C A;  5LC6 A;  1W01 A;  3S27 A;  1CYU A;  3B4O A;  4O02 B;  3MHE A;  3EBY A;  1WNH A;  1O7H B;  2O3O A;  3LT9 A;  1AVL A;  4NRE A;  3NBJ A;  3DY5 A;  5G2G A;  4BTX A;  1N8R 4;  2L4V A;  1FGM A;  1RJO A;  3K9M C;  3VF1 A;  4XBY A;  2OTJ 3;  2IUK A;  3MYT A;  3UB1 A;  3CXC 2;  3RGR A;  1UI7 A;  4FMD A;  3LT8 A;  2F99 A;  1AV4 A;  3H51 A;  4XBX A;  2RCD A;  1E97 A;  2F86 B;  4HZ9 B;  3DGL A;  3K7C A;  1UW1 A;  1FGQ A;  3A76 A;  2Q07 A;  3S67 A;  1G96 A;  3FF0 A;  3MPH A;  1NO3 A;  1JN5 A;  4HKV B;  4WP5 A;  2M7O A;  1O7W B;  2BO9 B;  2KXG A;  3IMA B;  4R4K A;  2OOV A;  3GRD A;  2CC3 A;  1IQY A;  3G6E 3;  2CFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...