4IIAA

Low resolution crystal structure of the ntf2-like domain of human g3bp1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
b'SHMVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein-binding protein 1
publication title Crystal Structures of the Human G3BP1 NTF2-Like Domain Visualize FxFG Nup Repeat Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 28
structure length 131
sequence length 131
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4iiaA00
2QIYA 4STDA 1JKGA 2PZVA 3KSPA 3ER7A 3OX9A 3B4OA 4LGQA 4HM1B 3BLZA 3G16A 5KP1A 3M8CA 3STDA 3CNXA 1OCVA 3HK4A 1IDPA 2CHCA 1OGZA 3NHXA 3SEDA 2HMOB 3F7XA 4J9AA 1NU3A 4CDLA 3KKGA 5STDA 4HM6B 5CF1A 3ECFA 3EN8A 3F14A 3VGNA 2XRXB 2BMOB 4HM7B 4WYKA 4H3UA 3GZYB 4I4KA 1OF5B 2RGQA 2INXA 3S5CA 3DM8A 2BMRB 3JUQA 3LZAA 4L8PA 4Q53A 4HZBB 1O7WB 3DMCA 4R9LA 5CXOA 2YFIB 4XBXA 4HM0B 5IG4A 3GRDA 1O7MB 3SOAA 1ULJB 1E97A 4X2HA 3CU3A 1S5AA 3UJMA 1JN5B 2UX0A 3EBYA 3GZBA 3F9SA 2GEYA 1W6YA 1NDOB 3K7CA 1ULIB 3NXJA 5AEWB 1VZZA 3CPOA 3F7SA 1OHOA 4GB5A 1QJGA 1UUWB 1W01A 3H51A 4RZMA 1OF5A 2GEXA 1GYBA 2HMLB 3D9RA 3NM2A 2Z7AA 1OHSA 1GS3A 5IG3A 4K1UA 3NBRA 4XBTA 3A76A 3FGYA 3EN1B 1ASKA 8CHOA 1W00A 3EHCA 5CF2A 5JPPA 2W2CA 3JUMA 5IERA 3BB9A 1JN5A 1GY5A 3NUVA 2F86B 3JUOA 1GY6A 2A15A 2GBWB 4HZ9B 1NWWA 4HM8B 3E99A 1O7HB 3MKIA 3SOYA 1SJWA 4L7KA 4WWUC 3FF0A 2HMKB 1E3VA 3MHEA 3RGRA 3KZTA 3T8NA 3HX8A 3F40A 1ZX2A 2RCDA 3DXOA 3CNMA 1Q42A 1OHPA 1ISKA 1O7GB 3B8LA 3JUNA 1JB5A 2OWPA 5AIIA 3FH1A 5IG5A 1OGXA 3MG2A 1TP6A 4OVMA 1GY7A 5IEPA 1DMNA 1O7PB 3FKAA 1OPYA 4HM3B 3MG3A 5DRVA 3Q90A 1ZO2A 4U13A 3F8XA 2XR8B 1JB4A 1OH0A 4PEJA 2BNGA 5AEUB 4HM5B 4HM4B 1K41A 1BUQA 2B24B 1EG9B 5CK6A 4LMIA 1U5OA 3B4PA 4N3VA 2I9WA 6STDA 3OV4A 5KP4A 3WMDA 1WQLB 5FW5A 3G8ZA 2JQ5A 3I0YA 3VSYA 4WP5A 3GZRA 3EBTA 2BMQB 1C7HA 1QMAA 2HMMB 3K0ZA 3ROBA 3OXAA 1A2KA 5AIFA 4XBYA 2YFLB 2YFJB 4LEHA 4XM4A 1Q40A 4XDVA 5KP3A 3MG1A 1HKXA 2IMJA 5AIGA 5CLKA 5HGRA 3GWRA 3LYGA 3NV0A 3JUPA 3EJVA 5DREA 3IPTA 3OWYA 3T8UA 3GZXB 3EF8A 1DMQA 4IIAA 3RGAA 3MYTA 2Z77A 1JB2A 3UNLA 3DZLA 2K54A 5D82A 1EA2A 4J8TA 4KVHA 1UUVB 3F8HA 1STDA 4ORLA 1CQSA 4K1VA 4FCMA 2XSHB 2QGUA 5G2GA 4X2OA 4R9KA 2RFRA 4HKVB 3FLJA 4XDWA 4HJLB 1AR0A 5BXQA 7STDA 4MJDA 2XSOB 2F98A 1Q40B 2HMNB 1JKGB 5BVBA 2HMJB 3FZWA 5JPUA 5TGNA 3EC9A 5D83A 3NV0B 3DUKA 2GBXB 3EQQB 3FF2A 5IG0A 1E3RA 1W02A 2R4IA 5AI1A 3G0KA 3OWSA 1O7NB 4L8OA 5EVHA 3B7CA 3FSDA 1Z1SA 3HZPA 2STDA 2F99A 5IF6A 3KE7A 4R1KA 4HVNA 5D81A 5IEOA 2CKFB 3OWUA 5IENA 4FCJA 5AIHA 2Z76A 1DMMA 2GXFA 4XB5A 2B1XB 1OUNA 4OUQA 3H3HA 3EX9A 1TUHA 4WYKB 3MSOA 4HM2B
chains in the Genus database with same CATH superfamily
2CC3A 2F5WA 3WHOA 1DVCA 3AMOB 2QIYA 4BU4A 3LXUX 2SBLA 1BSDA 4STDA 2FGTA 1LVNA 1JBRA 5AYRB 1JKGA 2PZVA 1SARA 2FXTA 3L0RA 3KSPA 3ER7A 2W03A 3D5GA 3OX9A 3B4OA 4LGQA 4HM1B 3BLZA 1LRAA 1TRPA 3G16A 4IT7A 3PYJA 2W9QA 4R4KA 1YHQ3 2H0GA 4N6MA 1EKMA 3ZFZA 5KP1A 1FW7A 3M8CA 2C10A 2OTL3 3U1WA 3STDA 3CNXA 1OCVA 3HK4A 3SLUA 3DGMA 2LQVA 1G96A 1YIJ3 1QVF2 1IDPA 2CHCA 1OGZA 1IVUA 1IV7A 3NHXA 1FUTA 2OQEA 1QAKA 1RSNA 2JDIH 1VQP3 2ML5A 3SEDA 2HMOB 3BU4A 3F7XA 8RNTA 3HI7A 4J9AA 1GSPA 1NU3A 4GL6A 2ZHXB 2Y74A 2OOVC 2WGQA 1N5PA 1UGHI 4CDLA 3KKGA 5STDA 1YI23 4HM6B 1LNHA 4AEQA 4LSOA 3DGYA 1CH0A 5CF1A 4DKIA 1FGRA 1JZDA 1RCLA 1VQ83 3QRDA 3FCSB 1VQ63 1D6ZA 1YIT3 3ECFA 1BNFA 3EN8A 3F14A 1NB5I 3UL5A 3CMA3 1M904 2C4BA 4N6V0 2CFGA 2KRTA 3PXMA 5LC6A 3CXC2 1Q864 3VGNA 3G4S3 1MWSA 3X40A 1QAFA 1I8VA 2XRXB 5BU4A 4N6OB 2BMOB 1BNSA 5AYSC 3SXXA 1FGMA 4HM7B 2OTJ3 1SPUA 4WYKA 1V58A 1MWTA 1ROVA 3LOYA 3CD63 4EBGA 3X3ZA 4H3UA 3QK9A 2Z6BA 3GZYB 4FMDA 4I4KA 3NBJA 3KCHA 1OF5B 2RGQA 4EW5A 2INXA 1CEWI 3AMOA 2GSPA 5EQLA 3S5CA 1LOYA 1RRHA 5M1AA 1BNEA 1BNRA 1WTHA 3DM8A 1AQZA 3CCU3 5A0OB 2BMRB 2ZL8A 3KFQC 1VQ73 3JUQA 3N54B 2RNTA 3PCSA 4N6NB 4EYCA 1BRGA 3LZAA 1I2EA 2GU3A 3LH4A 1G02A 4L8PA 1DE3A 4Q53A 1KD14 4HZBB 1O7WB 3DMCA 4R9LA 1VQ53 5CXOA 2YFIB 4NPBA 4XBXA 1JZOA 1I0XA 3AHSA 4HM0B 3BNEA 5IG4A 3GRDA 1Q7Y4 1O7MB 3SOAA 1ULJB 4CPKA 2XH9A 1CYVA 1KSIA 5G1KA 1E97A 1Q7HA 4I5QA 3NQZA 1RHLA 1YVBI 1UW1A 2FNQA 4X2HA 3CU3A 4EV2A 1F8NA 1RJOA 3FG3A 1S5AA 3VF1A 3X3YA 3UJMA 4R80A 1LXEA 3K63A 1X1UA 1JN5B 1AY7A 2UX0A 1PYLA 4IPBA 1M1XB 1B2SA 3NBBA 1K8A4 3EBYA 3GZBA 1RGHA 3F9SA 2GEYA 1GMQA 3V99A 1W6YA 1RCKA 3RNTA 1BRKA 1NDOB 1AVLA 1ROAA 1WMNA 2C11A 3GAXA 4H61A 2OCTA 3K7CA 3BNBA 1JV2B 1ULIB 3NXJA 1KC84 5AEWB 1VZZA 2RBIA 2KAAA 3DGOA 3LTAA 1RGLA 4CJNA 1IQXA 2IUKA 3AGNA 2CX1A 3LT9A 5LC7A 2D1WA 4CCVA 2QEX3 3CPOA 1TFKA 1BRSA 3F7SA 3I563 1M9GA 2Y73A 3J7Yd 1OHOA 1UCLA 4GB5A 1VQQA 1QJGA 4MEIA 3TDGA 3EE1A 3CCR3 2CG0A 3OW22 3HIIA 1UUWB 3CC43 4EXRA 1MWUA 1W01A 2CG1A 3X41A 1W6CA 3CCQ3 1W5ZA 2CIUA 3H51A 2KF3A 3KN4A 4ZM8A 4RZMA 1N8QA 1JBTA 1VQL3 5M18A 1NB3I 1OF5A 1W6GA 2GEXA 4JF8A 5FGOA 1RGFA 3A5EA 1DYUA 1GYBA 2HMLB 3KSED 1K9M4 2F56A 3D9RA 3NM2A 2Z7AA 1OHSA 2WO0A 1GS3A 3Q3FA 4KFEA 3ZG5A 5IG3A 4K1UA 1RN7A 2W6JH 1GOUA 3NBRA 3Q1CA 4XBTA 1Q824 1BNIA 3A76A 3FGYA 3EN1B 4KT3B 3CC23 5GSPA 3G713 3Q2PA 1ASKA 1PFPA 8CHOA 1MGRA 4KFFA 1AV4A 1FGTA 1YJW3 1IQYA 1W00A 3EHCA 2MC8A 5CF2A 1BU4A 5JPPA 1NJI4 1A2PA 2W2CA 4OK0A 2LYXA 1WMPA 1C54A 1IVXA 3UB1A 4QWTA 3G6E3 3JUMA 5IERA 3BB9A 1JN5A 3WDGB 1GY5A 2H0IA 3NUVA 2F86B 2QA43 3CCE3 1RN4A 1GY6A 3JUOA 2WOHA 2Q07A 1B27A 2A15A 1GD3A 2GBWB 4HZ9B 3CPW2 1NWWA 3SVAA 4HM8B 2W04A 1TIJA 2W9PA 3E99A 1BOXA 3T0UA 1IU7A 1JNQA 1IT8A 1O7HB 1X1WA 2XGNA 1LQGC 1SJWA 3MKIA 4L7KA 4WWUC 3D79A 1RRLA 3BNDA 3FF0A 3PCRA 4N6TA 2KCDA 2HMKB 4BL2A 4LZIA 2CFDA 3AGOA 2P09A 1VQO3 1E3VA 3MHEA 3ALAA 1UGIA 2AAEA 1RN1A 1WNHA 3KZTA 3RGRA 1IV9A 3N8BA 1BRNL 3T8NA 3HX8A 3F40A 1ZX2A 2RCDA 3DXOA 3CNMA 1BSBA 1Q42A 4J5KA 1BRHA 1OHPA 3D4AA 1ISKA 2CW9A 3HIGA 3O8YA 1O7GB 3B8LA 3JUNA 3CCM3 1UCKA 2M7OA 3DY5A 3ZG0A 2CWUA 1JB5A 4BTWA 5RNTA 2BT3A 4G1MB 2CWTA 2OWPA 1W2B2 3WOFB 5AIIA 4GHOA 1RDSA 4RNTA 1IK3A 3CME3 3CCJ3 1K28A 1FZUA 1I2GA 3FH1A 3S27A 5IG5A 1OGXA 1TU5A 3MG2A 1TP6A 1MOLA 1GY7A 1R4YA 1DMNA 4OVMA 5EEOA 5IEPA 1PU4A 3BNCA 1SIHA 1S723 2R41A 1O7PB 1BVIA 2KXGA 2D42A 3U97A 1BSAA 3FKAA 1OPYA 3LMLA 4HM3B 2RSXA 1BANA 2W56B 2XFTA 2K3DA 5HOHA 3WODG 1V74A 3MG3A 4MMXB 5DRVA 3Q90A 3DH2A 3PS8A 4RBNA 1ZO2A 1YJ93 1KWIA 2BHMA 4U13A 3F8XA 3SOYA 1IYYA 1Y4KA 1Q814 1B2ZA 1MNLA 1X1YA 2XR8B 1JB4A 1OH0A 2OQEC 2BNGA 4PEJA 4BTYA 1KQS2 1US1A 1SQWA 1V57A 2L4VA 4HM5B 1K41A 1I70A 2MF7A 4HM4B 4NHFA 5AEUB 1BUQA 2B24B 1EG9B 2H0HA 5CK6A 1STFI 2V1LA 1ZS7A 1U5OA 4LMIA 1M1K4 3B4PA 4N3VA 1GD4A 1B21A 1WMOA 2I9WA 2CFWA 6STDA 4K90B 3OV4A 4N6UA 3WA2X 1I2FA 1NO3A 1B20A 1N9JA 4HBRA 5KP4A 1RLSA 4HYZA 3WMDA 9RNTA 2BU4A 1WQLB 4MMZB 5FW5A 1I3FA 3G8ZA 1VQN3 1IVWA 2JQ5A 2P0XA 3I0YA 1A2VA 2ZA4A 1FGQA 2PNCA 3VSYA 1U8CB 4WP5A 2J8XB 2SARA 2XEPA 3GZRA 3EBTA 3N9HA 2BMQB 3D3LA 1C7HA 1QMAA 4GSPA 1GOYA 4KZ1A 2UUGC 4BL3A 1TJDA 1RTUA 3K5TA 4FMAA 4LYLB 4WFOA 2O3OA 2W0QA 2HMMB 3K0ZA 3ROBA 3S28A 3OXAA 1A2KA 3NX0A 1K734 5AIFA 4XBYA 1I3IA 2YFLB 1B2UA 2YFJB 4LEHA 4XM4A 2E2TA 1Q40A 1W4NA 1YNVX 4XDVA 5KP3A 3MG1A 1VQM3 1TRQA 1HKXA 1PY3A 2IMJA 3IJEB 5AIGA 3SYUA 5JBSA 1YGWA 3LT8A 1EUIC 4TX4A 5CLKA 1N8R4 1OACA 5HGRA 3GWRA 1RGCA 1UDII 3LYGA 3NV0A 1RMSA 1RKYA 3JUPA 5M19A 2W56A 1T5YA 2CWVA 1JBSA 4AKYA 1I0VA 1UI7A 3EJVA 3LTDA 3IPTA 3OWYA 4KFDA 5DREA 3T8UA 3GZXB 1VQ43 2F5MA 1RNTA 3EF8A 1GOVA 1DMQA 3JVCA 2O9UX 3MPHA 4IIAA 3RGAA 3FG4A 7RNTA 5I97A 3MYTA 2Z77A 1JB2A 3UNLA 3DZLA 1ZGXA 2K54A 4O02B 3SX1A 1BSEA 5D82A 4WHAA 3S67A 1EA2A 4J8TA 4KVHA 3X3XA 1UUVB 3F8HA 1STDA 4ORLA 1TTOA 5ELUA 1FYSA 2IYJA 1BSCA 1UI8A 1CQSA 2CK3H 3MWZA 2BO9B 4K1VA 1VQ93 3KIIA 1JJ22 2KF5A 4FCMA 2XSHB 2QGUA 2ZDJA 1T3BA 5G2GA 4X2OA 1UCIA 1FGOA 4R9KA 1EQKA 4K61A 1CYUA 1TFOA 2RFRA 1MWRA 1N9EA 4HOHA 4HKVB 1FA3A 3GSPA 3NM7A 1YJN3 3WOEB 3FLJA 6GSPA 3BIRA 1IT7A 4O8SA 3CCS3 1VQK3 4N6LA 1G0TA 2CH9A 3D5IA 4FMBA 1UUGB 5G1LA 4BTXA 2ML6A 4HJLB 4XDWA 1AR0A 1B2MA 5BXQA 1HU9A 7STDA 4MJDA 2XSOB 3WA3A 2GU1A 3PZWA 2F98A 4O3VA 1HYFA 4FCZA 1SIIA 2KF6A 3LTCA 1Q40B 3DGNA 2HMNB 2CFLA 1JKGB 1B2XA 2E2VA 2P0MA 5BVBA 2HMJB 1AVKA 2IA7A 3CCL3 2HOHA 3FZWA 4NREA 5JPUA 1YVSA 2WOFA 5TGNA 1JRQA 3EC9A 2AADA 2XF3A 1BRJA 5D83A 3NV0B 2CFKA 3DUKA 2GBXB 2E2UA 3EQQB 1FUWA 3FF2A 5IG0A 2XFSA 3DGLA 3EB8A 3X42A 1LNIA 1QVG2 1E3RA 3RDEA 3V98A 1W02A 4RNZA 1LOWA 2R4IA 3WR2A 1R4CA 3CC73 2OOVA 4EV5A 5AI1A 1X1XA 3G0KA 1LOVA 1QALA 1BIRA 3OWSA 3IMAB 5BIRA 3S29A 1O7NB 1T2IA 2YX9A 4L8OA 1BGSA 7GSPA 2CX0A 3NQYA 5EVHA 1T2HA 1W2ZA 3B7CA 3CCV3 3I553 1BUJA 1BNJA 3FSDA 1EEJA 3LTBA 5ELJA 1BNGA 1W7CA 1Z1SA 4J5GA 4AKZA 2IUJA 3HZPA 2STDA 5IW9A 1RGGA 2F99A 1GMRA 1GMPA 4MMYB 1D6YA 5IF6A 3HOHA 4JRFA 2WGOA 3KE7A 4R1KA 4EC6A 2P05A 1A67A 4HVNA 1HZ1A 4ILFA 5D81A 1Q9EA 5IEOA 1MGWA 4HAAA 2KF4A 1J2BA 2CKFB 1DETA 2P38A 1L5GB 1LQMB 6RNTA 4BIRA 1YGEA 3OWUA 1RNBA 1DVDA 5IENA 4FCJA 1BAOA 1B3SA 1UCJA 5AIHA 1NNVA 2Z76A 1DMMA 2GXFA 1IQ8A 2L1SA 1RGEA 1IVVA 4XB5A 2B1XB 1OUNA 1D6UA 1FUSA 4OUQA 1RGAA 3H3HA 3PGBA 2XGLA 3EX9A 4O2HA 1A90A 1TUHA 1RGKA 3K9MC 4FMCA 3MSOA 4WYKB 2BIRA 2UGIA 1LOXA 2K0MA 4FR9A 3AHWA 3URPA 3V92A 1BRIA 4RNYA 3UL6A 4HM2B 2F4YA 2IY2A 1N5HA 3FG1A
chains in the Genus database with same CATH topology
2CC3A 1DVCA 3AMOB 2QIYA 3LXUX 2SBLA 4STDA 2FGTA 1LVNA 5AYRB 1JKGA 2PZVA 2FXTA 3L0RA 3KSPA 3ER7A 2W03A 3OX9A 3B4OA 4LGQA 4HM1B 3BLZA 3G16A 4IT7A 3PYJA 2W9QA 4R4KA 1YHQ3 4N6MA 1EKMA 5KP1A 3M8CA 2C10A 2OTL3 3U1WA 3STDA 3CNXA 1OCVA 3HK4A 3SLUA 3DGMA 2LQVA 1G96A 1YIJ3 1QVF2 1IDPA 2CHCA 1OGZA 1IVUA 1IV7A 3NHXA 1VQP3 2OQEA 1QAKA 2JDIH 2ML5A 3SEDA 2HMOB 3F7XA 3HI7A 4J9AA 1NU3A 4GL6A 3CCJ3 2Y74A 2OOVC 2WGQA 1N5PA 4CDLA 3KKGA 5STDA 1YI23 4HM6B 1LNHA 4AEQA 4LSOA 5CF1A 1FGRA 1VQ83 3QRDA 3FCSB 1VQ63 1D6ZA 1YIT3 3ECFA 3EN8A 3F14A 1NB5I 3UL5A 3CMA3 1M904 4N6V0 2CFGA 2KRTA 3PXMA 5LC6A 3CXC2 1Q864 3VGNA 3G4S3 3X40A 1QAFA 2XRXB 4N6OB 2BMOB 3SXXA 1FGMA 4HM7B 2OTJ3 1SPUA 4WYKA 1ROVA 3LOYA 3CD63 4EBGA 3X3ZA 4H3UA 3QK9A 2Z6BA 3GZYB 4FMDA 4I4KA 3NBJA 1OF5B 2RGQA 2INXA 1CEWI 3AMOA 5EQLA 3S5CA 1RRHA 1WTHA 3DM8A 3CCU3 5A0OB 2BMRB 2ZL8A 3KFQC 1VQ73 3JUQA 3N54B 4EYCA 3PCSA 4N6NB 3LZAA 2GU3A 3LH4A 4L8PA 4Q53A 1KD14 4HZBB 1O7WB 3DMCA 4R9LA 1VQ53 5CXOA 2YFIB 4XBXA 4HM0B 3BNEA 5IG4A 3GRDA 1Q7Y4 1O7MB 3SOAA 1ULJB 2XH9A 1CYVA 1KSIA 1E97A 3NQZA 2FNQA 1YVBI 1UW1A 4X2HA 3CU3A 4EV2A 1F8NA 1RJOA 3FG3A 1S5AA 3VF1A 3X3YA 3UJMA 4R80A 1LXEA 3K63A 1JN5B 2UX0A 4IPBA 1M1XB 3NBBA 1K8A4 3EBYA 3GZBA 3F9SA 2GEYA 3V99A 1W6YA 3GAXA 1NDOB 1AVLA 1ROAA 1WMNA 2C11A 4H61A 2OCTA 3K7CA 3BNBA 1JV2B 1ULIB 3NXJA 1KC84 5AEWB 1VZZA 3DGOA 3LTAA 1IQXA 2IUKA 3LT9A 5LC7A 4CCVA 2D1WA 2QEX3 3CPOA 1TFKA 3F7SA 3I563 1M9GA 2Y73A 3J7Yd 1OHOA 4MEIA 4GB5A 3TDGA 1QJGA 3EE1A 3CCR3 2CG0A 3OW22 3HIIA 1UUWB 3CC43 4EXRA 1W01A 2CG1A 3X41A 1W6CA 3CCQ3 1W5ZA 2CIUA 3H51A 3KN4A 4ZM8A 1VQL3 4RZMA 1N8QA 1NB3I 1OF5A 1W6GA 2GEXA 4JF8A 5FGOA 1DYUA 1GYBA 2HMLB 3KSED 1K9M4 3D9RA 3NM2A 2Z7AA 1OHSA 2WO0A 1GS3A 4KFEA 5IG3A 4K1UA 1RN7A 2W6JH 3NBRA 3Q1CA 4XBTA 1Q824 3A76A 3FGYA 3EN1B 3CC23 3G713 3Q2PA 1ASKA 1PFPA 8CHOA 4KFFA 1AV4A 1FGTA 1YJW3 1IQYA 1W00A 3EHCA 2MC8A 5CF2A 5JPPA 1NJI4 2W2CA 4OK0A 2LYXA 1WMPA 1IVXA 3UB1A 4QWTA 3G6E3 3JUMA 5IERA 3BB9A 1JN5A 3WDGB 1GY5A 3NUVA 2QA43 2F86B 3CCE3 3JUOA 1GY6A 2WOHA 2Q07A 2A15A 1GD3A 2GBWB 4HZ9B 3CPW2 1NWWA 3SVAA 4HM8B 2W04A 1TIJA 2W9PA 3E99A 3T0UA 1IU7A 1JNQA 1IT8A 1O7HB 3MKIA 2XGNA 5AYSC 1SJWA 4L7KA 4WWUC 3SOYA 1RRLA 3BNDA 3FF0A 3PCRA 4N6TA 2KCDA 2HMKB 4LZIA 2CFDA 2P09A 1VQO3 1E3VA 3MHEA 3ALAA 1WNHA 3RGRA 3KZTA 1IV9A 3N8BA 3T8NA 3HX8A 3F40A 1ZX2A 2RCDA 3DXOA 3CNMA 1Q42A 1OHPA 1ISKA 2CW9A 3HIGA 3O8YA 1O7GB 3B8LA 3JUNA 3CCM3 2M7OA 3DY5A 2CWUA 1JB5A 4BTWA 2BT3A 4G1MB 2CWTA 2OWPA 1W2B2 3WOFB 5AIIA 1IK3A 3CME3 1K28A 3FH1A 3S27A 5IG5A 1OGXA 1TU5A 3MG2A 1TP6A 1MOLA 1GY7A 4OVMA 1DMNA 5EEOA 5IEPA 1PU4A 3BNCA 1SIHA 1S723 1O7PB 2KXGA 2D42A 3U97A 3FKAA 1OPYA 3LMLA 4HM3B 2RSXA 2W56B 2XFTA 3WODG 1V74A 3MG3A 4MMXB 5DRVA 3Q90A 3PS8A 4RBNA 1ZO2A 1YJ93 1KWIA 2BHMA 4U13A 3F8XA 1Y4KA 1Q814 2XR8B 1MNLA 1JB4A 1OH0A 2OQEC 2BNGA 4PEJA 4BTYA 1KQS2 1US1A 1SQWA 4HM5B 2L4VA 4HM4B 1K41A 2MF7A 4NHFA 1L5GB 5AEUB 1BUQA 2B24B 1EG9B 5CK6A 1STFI 2V1LA 4LMIA 1U5OA 1M1K4 3B4PA 4N3VA 1GD4A 1WMOA 2I9WA 2CFWA 6STDA 4K90B 3OV4A 4N6UA 3WA2X 1NO3A 1N9JA 4HBRA 5KP4A 4HYZA 3WMDA 1WQLB 4MMZB 5FW5A 3G8ZA 1VQN3 1IVWA 2JQ5A 2P0XA 3I0YA 1A2VA 1FGQA 2PNCA 3VSYA 1U8CB 4WP5A 2XEPA 3GZRA 3EBTA 3N9HA 2BMQB 3D3LA 1C7HA 1QMAA 4KZ1A 3K5TA 4FMAA 4WFOA 2O3OA 2W0QA 2HMMB 3K0ZA 3ROBA 3S28A 3OXAA 1A2KA 3NX0A 1K734 5AIFA 4XBYA 2YFLB 2YFJB 4LEHA 4XM4A 2E2TA 1Q40A 1W4NA 4XDVA 5KP3A 3MG1A 1VQM3 1HKXA 2IMJA 3IJEB 5AIGA 5JBSA 3LT8A 1N8R4 4TX4A 5CLKA 1OACA 5HGRA 3GWRA 3LYGA 3NV0A 1RKYA 3JUPA 2W56A 1T5YA 2CWVA 4AKYA 3EJVA 1UI7A 3LTDA 4KFDA 3IPTA 3OWYA 5DREA 3T8UA 1VQ43 3GZXB 3EF8A 1DMQA 3JVCA 2O9UX 3MPHA 4IIAA 3RGAA 3FG4A 5I97A 3MYTA 2Z77A 1JB2A 3UNLA 3DZLA 2K54A 4O02B 3SX1A 5D82A 4WHAA 3S67A 1EA2A 4J8TA 4KVHA 3X3XA 1UUVB 3F8HA 1STDA 4ORLA 5ELUA 3MWZA 1UI8A 1CQSA 2CK3H 4K1VA 2BO9B 1VQ93 3KIIA 1JJ22 4FCMA 2XSHB 2QGUA 2ZDJA 5G2GA 4X2OA 1FGOA 4R9KA 1EQKA 4K61A 1CYUA 1TFOA 2RFRA 1N9EA 4HKVB 1FA3A 3NM7A 1YJN3 3WOEB 3FLJA 1IT7A 4O8SA 3CCS3 1VQK3 4N6LA 2CH9A 4BTXA 4FMBA 2ML6A 4HJLB 4XDWA 1AR0A 5BXQA 1HU9A 7STDA 4MJDA 2XSOB 3WA3A 2GU1A 3PZWA 2F98A 4O3VA 4FCZA 1SIIA 3LTCA 1Q40B 3DGNA 2HMNB 2CFLA 1JKGB 2E2VA 2P0MA 5BVBA 2HMJB 1AVKA 2IA7A 3CCL3 3FZWA 4NREA 5JPUA 2WOFA 5TGNA 1JRQA 3EC9A 2XF3A 5D83A 3NV0B 2CFKA 3DUKA 2GBXB 2E2UA 3EQQB 1FUWA 3FF2A 5IG0A 2XFSA 3DGLA 3EB8A 3X42A 1QVG2 1E3RA 3RDEA 3V98A 1W02A 4RNZA 2R4IA 1R4CA 3CC73 2OOVA 4EV5A 5AI1A 3G0KA 3OWSA 1QALA 3IMAB 3S29A 1O7NB 4L8OA 2YX9A 3NQYA 5EVHA 3CCV3 1W2ZA 3B7CA 3I553 3FSDA 3LTBA 5ELJA 1W7CA 1Z1SA 4AKZA 2IUJA 3HZPA 2STDA 5IW9A 2F99A 5IF6A 4MMYB 1D6YA 4JRFA 2WGOA 3KE7A 4R1KA 4EC6A 2P05A 1A67A 4HVNA 5D81A 5IEOA 1J2BA 2CKFB 2P38A 1YGEA 3OWUA 1DVDA 5IENA 4FCJA 5AIHA 2Z76A 1DMMA 2GXFA 1IQ8A 1IVVA 4XB5A 2B1XB 1OUNA 1D6UA 4OUQA 3H3HA 3PGBA 2XGLA 3EX9A 4O2HA 1A90A 1TUHA 3K9MC 4FMCA 3MSOA 4WYKB 3V92A 1LOXA 2K0MA 4FR9A 4RNYA 3UL6A 4HM2B 1N5HA 3FG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIY A;  4STD A;  1JKG A;  2PZV A;  3KSP A;  3ER7 A;  3OX9 A;  3B4O A;  4LGQ A;  4HM1 B;  3BLZ A;  3G16 A;  5KP1 A;  3M8C A;  3STD A;  3CNX A;  1OCV A;  3HK4 A;  1IDP A;  2CHC A;  1OGZ A;  3NHX A;  3SED A;  2HMO B;  3F7X A;  4J9A A;  1NU3 A;  4CDL A;  3KKG A;  5STD A;  4HM6 B;  5CF1 A;  3ECF A;  3EN8 A;  3F14 A;  3VGN A;  2XRX B;  2BMO B;  4HM7 B;  4WYK A;  4H3U A;  3GZY B;  4I4K A;  1OF5 B;  2RGQ A;  2INX A;  3S5C A;  3DM8 A;  2BMR B;  3JUQ A;  3LZA A;  4L8P A;  4Q53 A;  4HZB B;  1O7W B;  3DMC A;  4R9L A;  5CXO A;  2YFI B;  4XBX A;  4HM0 B;  5IG4 A;  3GRD A;  1O7M B;  3SOA A;  1ULJ B;  1E97 A;  4X2H A;  3CU3 A;  1S5A A;  3UJM A;  1JN5 B;  2UX0 A;  3EBY A;  3GZB A;  3F9S A;  2GEY A;  1W6Y A;  1NDO B;  3K7C A;  1ULI B;  3NXJ A;  5AEW B;  1VZZ A;  3CPO A;  3F7S A;  1OHO A;  4GB5 A;  1QJG A;  1UUW B;  1W01 A;  3H51 A;  4RZM A;  1OF5 A;  2GEX A;  1GYB A;  2HML B;  3D9R A;  3NM2 A;  2Z7A A;  1OHS A;  1GS3 A;  5IG3 A;  4K1U A;  3NBR A;  4XBT A;  3A76 A;  3FGY A;  3EN1 B;  1ASK A;  8CHO A;  1W00 A;  3EHC A;  5CF2 A;  5JPP A;  2W2C A;  3JUM A;  5IER A;  3BB9 A;  1JN5 A;  1GY5 A;  3NUV A;  2F86 B;  3JUO A;  1GY6 A;  2A15 A;  2GBW B;  4HZ9 B;  1NWW A;  4HM8 B;  3E99 A;  1O7H B;  3MKI A;  3SOY A;  1SJW A;  4L7K A;  4WWU C;  3FF0 A;  2HMK B;  1E3V A;  3MHE A;  3RGR A;  3KZT A;  3T8N A;  3HX8 A;  3F40 A;  1ZX2 A;  2RCD A;  3DXO A;  3CNM A;  1Q42 A;  1OHP A;  1ISK A;  1O7G B;  3B8L A;  3JUN A;  1JB5 A;  2OWP A;  5AII A;  3FH1 A;  5IG5 A;  1OGX A;  3MG2 A;  1TP6 A;  4OVM A;  1GY7 A;  5IEP A;  1DMN A;  1O7P B;  3FKA A;  1OPY A;  4HM3 B;  3MG3 A;  5DRV A;  3Q90 A;  1ZO2 A;  4U13 A;  3F8X A;  2XR8 B;  1JB4 A;  1OH0 A;  4PEJ A;  2BNG A;  5AEU B;  4HM5 B;  4HM4 B;  1K41 A;  1BUQ A;  2B24 B;  1EG9 B;  5CK6 A;  4LMI A;  1U5O A;  3B4P A;  4N3V A;  2I9W A;  6STD A;  3OV4 A;  5KP4 A;  3WMD A;  1WQL B;  5FW5 A;  3G8Z A;  2JQ5 A;  3I0Y A;  3VSY A;  4WP5 A;  3GZR A;  3EBT A;  2BMQ B;  1C7H A;  1QMA A;  2HMM B;  3K0Z A;  3ROB A;  3OXA A;  1A2K A;  5AIF A;  4XBY A;  2YFL B;  2YFJ B;  4LEH A;  4XM4 A;  1Q40 A;  4XDV A;  5KP3 A;  3MG1 A;  1HKX A;  2IMJ A;  5AIG A;  5CLK A;  5HGR A;  3GWR A;  3LYG A;  3NV0 A;  3JUP A;  3EJV A;  5DRE A;  3IPT A;  3OWY A;  3T8U A;  3GZX B;  3EF8 A;  1DMQ A;  4IIA A;  3RGA A;  3MYT A;  2Z77 A;  1JB2 A;  3UNL A;  3DZL A;  2K54 A;  5D82 A;  1EA2 A;  4J8T A;  4KVH A;  1UUV B;  3F8H A;  1STD A;  4ORL A;  1CQS A;  4K1V A;  4FCM A;  2XSH B;  2QGU A;  5G2G A;  4X2O A;  4R9K A;  2RFR A;  4HKV B;  3FLJ A;  4XDW A;  4HJL B;  1AR0 A;  5BXQ A;  7STD A;  4MJD A;  2XSO B;  2F98 A;  1Q40 B;  2HMN B;  1JKG B;  5BVB A;  2HMJ B;  3FZW A;  5JPU A;  5TGN A;  3EC9 A;  5D83 A;  3NV0 B;  3DUK A;  2GBX B;  3EQQ B;  3FF2 A;  5IG0 A;  1E3R A;  1W02 A;  2R4I A;  5AI1 A;  3G0K A;  3OWS A;  1O7N B;  4L8O A;  5EVH A;  3B7C A;  3FSD A;  1Z1S A;  3HZP A;  2STD A;  2F99 A;  5IF6 A;  3KE7 A;  4R1K A;  4HVN A;  5D81 A;  5IEO A;  2CKF B;  3OWU A;  5IEN A;  4FCJ A;  5AIH A;  2Z76 A;  1DMM A;  2GXF A;  4XB5 A;  2B1X B;  1OUN A;  4OUQ A;  3H3H A;  3EX9 A;  1TUH A;  4WYK B;  3MSO A;  4HM2 B; 
#chains in the Genus database with same CATH topology
 2CC3 A;  2F5W A;  3WHO A;  1DVC A;  3AMO B;  2QIY A;  4BU4 A;  3LXU X;  2SBL A;  1BSD A;  4STD A;  2FGT A;  1LVN A;  1JBR A;  5AYR B;  1JKG A;  2PZV A;  1SAR A;  2FXT A;  3L0R A;  3KSP A;  3ER7 A;  2W03 A;  3D5G A;  3OX9 A;  3B4O A;  4LGQ A;  4HM1 B;  3BLZ A;  1LRA A;  1TRP A;  3G16 A;  4IT7 A;  3PYJ A;  2W9Q A;  4R4K A;  1YHQ 3;  2H0G A;  4N6M A;  1EKM A;  3ZFZ A;  5KP1 A;  1FW7 A;  3M8C A;  2C10 A;  2OTL 3;  3U1W A;  3STD A;  3CNX A;  1OCV A;  3HK4 A;  3SLU A;  3DGM A;  2LQV A;  1G96 A;  1YIJ 3;  1QVF 2;  1IDP A;  2CHC A;  1OGZ A;  1IVU A;  1IV7 A;  3NHX A;  1FUT A;  2OQE A;  1QAK A;  1RSN A;  2JDI H;  1VQP 3;  2ML5 A;  3SED A;  2HMO B;  3BU4 A;  3F7X A;  8RNT A;  3HI7 A;  4J9A A;  1GSP A;  1NU3 A;  4GL6 A;  2ZHX B;  2Y74 A;  2OOV C;  2WGQ A;  1N5P A;  1UGH I;  4CDL A;  3KKG A;  5STD A;  1YI2 3;  4HM6 B;  1LNH A;  4AEQ A;  4LSO A;  3DGY A;  1CH0 A;  5CF1 A;  4DKI A;  1FGR A;  1JZD A;  1RCL A;  1VQ8 3;  3QRD A;  3FCS B;  1VQ6 3;  1D6Z A;  1YIT 3;  3ECF A;  1BNF A;  3EN8 A;  3F14 A;  1NB5 I;  3UL5 A;  3CMA 3;  1M90 4;  2C4B A;  4N6V 0;  2CFG A;  2KRT A;  3PXM A;  5LC6 A;  3CXC 2;  1Q86 4;  3VGN A;  3G4S 3;  1MWS A;  3X40 A;  1QAF A;  1I8V A;  2XRX B;  5BU4 A;  4N6O B;  2BMO B;  1BNS A;  5AYS C;  3SXX A;  1FGM A;  4HM7 B;  2OTJ 3;  1SPU A;  4WYK A;  1V58 A;  1MWT A;  1ROV A;  3LOY A;  3CD6 3;  4EBG A;  3X3Z A;  4H3U A;  3QK9 A;  2Z6B A;  3GZY B;  4FMD A;  4I4K A;  3NBJ A;  3KCH A;  1OF5 B;  2RGQ A;  4EW5 A;  2INX A;  1CEW I;  3AMO A;  2GSP A;  5EQL A;  3S5C A;  1LOY A;  1RRH A;  5M1A A;  1BNE A;  1BNR A;  1WTH A;  3DM8 A;  1AQZ A;  3CCU 3;  5A0O B;  2BMR B;  2ZL8 A;  3KFQ C;  1VQ7 3;  3JUQ A;  3N54 B;  2RNT A;  3PCS A;  4N6N B;  4EYC A;  1BRG A;  3LZA A;  1I2E A;  2GU3 A;  3LH4 A;  1G02 A;  4L8P A;  1DE3 A;  4Q53 A;  1KD1 4;  4HZB B;  1O7W B;  3DMC A;  4R9L A;  1VQ5 3;  5CXO A;  2YFI B;  4NPB A;  4XBX A;  1JZO A;  1I0X A;  3AHS A;  4HM0 B;  3BNE A;  5IG4 A;  3GRD A;  1Q7Y 4;  1O7M B;  3SOA A;  1ULJ B;  4CPK A;  2XH9 A;  1CYV A;  1KSI A;  5G1K A;  1E97 A;  1Q7H A;  4I5Q A;  3NQZ A;  1RHL A;  1YVB I;  1UW1 A;  2FNQ A;  4X2H A;  3CU3 A;  4EV2 A;  1F8N A;  1RJO A;  3FG3 A;  1S5A A;  3VF1 A;  3X3Y A;  3UJM A;  4R80 A;  1LXE A;  3K63 A;  1X1U A;  1JN5 B;  1AY7 A;  2UX0 A;  1PYL A;  4IPB A;  1M1X B;  1B2S A;  3NBB A;  1K8A 4;  3EBY A;  3GZB A;  1RGH A;  3F9S A;  2GEY A;  1GMQ A;  3V99 A;  1W6Y A;  1RCK A;  3RNT A;  1BRK A;  1NDO B;  1AVL A;  1ROA A;  1WMN A;  2C11 A;  3GAX A;  4H61 A;  2OCT A;  3K7C A;  3BNB A;  1JV2 B;  1ULI B;  3NXJ A;  1KC8 4;  5AEW B;  1VZZ A;  2RBI A;  2KAA A;  3DGO A;  3LTA A;  1RGL A;  4CJN A;  1IQX A;  2IUK A;  3AGN A;  2CX1 A;  3LT9 A;  5LC7 A;  2D1W A;  4CCV A;  2QEX 3;  3CPO A;  1TFK A;  1BRS A;  3F7S A;  3I56 3;  1M9G A;  2Y73 A;  3J7Y d;  1OHO A;  1UCL A;  4GB5 A;  1VQQ A;  1QJG A;  4MEI A;  3TDG A;  3EE1 A;  3CCR 3;  2CG0 A;  3OW2 2;  3HII A;  1UUW B;  3CC4 3;  4EXR A;  1MWU A;  1W01 A;  2CG1 A;  3X41 A;  1W6C A;  3CCQ 3;  1W5Z A;  2CIU A;  3H51 A;  2KF3 A;  3KN4 A;  4ZM8 A;  4RZM A;  1N8Q A;  1JBT A;  1VQL 3;  5M18 A;  1NB3 I;  1OF5 A;  1W6G A;  2GEX A;  4JF8 A;  5FGO A;  1RGF A;  3A5E A;  1DYU A;  1GYB A;  2HML B;  3KSE D;  1K9M 4;  2F56 A;  3D9R A;  3NM2 A;  2Z7A A;  1OHS A;  2WO0 A;  1GS3 A;  3Q3F A;  4KFE A;  3ZG5 A;  5IG3 A;  4K1U A;  1RN7 A;  2W6J H;  1GOU A;  3NBR A;  3Q1C A;  4XBT A;  1Q82 4;  1BNI A;  3A76 A;  3FGY A;  3EN1 B;  4KT3 B;  3CC2 3;  5GSP A;  3G71 3;  3Q2P A;  1ASK A;  1PFP A;  8CHO A;  1MGR A;  4KFF A;  1AV4 A;  1FGT A;  1YJW 3;  1IQY A;  1W00 A;  3EHC A;  2MC8 A;  5CF2 A;  1BU4 A;  5JPP A;  1NJI 4;  1A2P A;  2W2C A;  4OK0 A;  2LYX A;  1WMP A;  1C54 A;  1IVX A;  3UB1 A;  4QWT A;  3G6E 3;  3JUM A;  5IER A;  3BB9 A;  1JN5 A;  3WDG B;  1GY5 A;  2H0I A;  3NUV A;  2F86 B;  2QA4 3;  3CCE 3;  1RN4 A;  1GY6 A;  3JUO A;  2WOH A;  2Q07 A;  1B27 A;  2A15 A;  1GD3 A;  2GBW B;  4HZ9 B;  3CPW 2;  1NWW A;  3SVA A;  4HM8 B;  2W04 A;  1TIJ A;  2W9P A;  3E99 A;  1BOX A;  3T0U A;  1IU7 A;  1JNQ A;  1IT8 A;  1O7H B;  1X1W A;  2XGN A;  1LQG C;  1SJW A;  3MKI A;  4L7K A;  4WWU C;  3D79 A;  1RRL A;  3BND A;  3FF0 A;  3PCR A;  4N6T A;  2KCD A;  2HMK B;  4BL2 A;  4LZI A;  2CFD A;  3AGO A;  2P09 A;  1VQO 3;  1E3V A;  3MHE A;  3ALA A;  1UGI A;  2AAE A;  1RN1 A;  1WNH A;  3KZT A;  3RGR A;  1IV9 A;  3N8B A;  1BRN L;  3T8N A;  3HX8 A;  3F40 A;  1ZX2 A;  2RCD A;  3DXO A;  3CNM A;  1BSB A;  1Q42 A;  4J5K A;  1BRH A;  1OHP A;  3D4A A;  1ISK A;  2CW9 A;  3HIG A;  3O8Y A;  1O7G B;  3B8L A;  3JUN A;  3CCM 3;  1UCK A;  2M7O A;  3DY5 A;  3ZG0 A;  2CWU A;  1JB5 A;  4BTW A;  5RNT A;  2BT3 A;  4G1M B;  2CWT A;  2OWP A;  1W2B 2;  3WOF B;  5AII A;  4GHO A;  1RDS A;  4RNT A;  1IK3 A;  3CME 3;  3CCJ 3;  1K28 A;  1FZU A;  1I2G A;  3FH1 A;  3S27 A;  5IG5 A;  1OGX A;  1TU5 A;  3MG2 A;  1TP6 A;  1MOL A;  1GY7 A;  1R4Y A;  1DMN A;  4OVM A;  5EEO A;  5IEP A;  1PU4 A;  3BNC A;  1SIH A;  1S72 3;  2R41 A;  1O7P B;  1BVI A;  2KXG A;  2D42 A;  3U97 A;  1BSA A;  3FKA A;  1OPY A;  3LML A;  4HM3 B;  2RSX A;  1BAN A;  2W56 B;  2XFT A;  2K3D A;  5HOH A;  3WOD G;  1V74 A;  3MG3 A;  4MMX B;  5DRV A;  3Q90 A;  3DH2 A;  3PS8 A;  4RBN A;  1ZO2 A;  1YJ9 3;  1KWI A;  2BHM A;  4U13 A;  3F8X A;  3SOY A;  1IYY A;  1Y4K A;  1Q81 4;  1B2Z A;  1MNL A;  1X1Y A;  2XR8 B;  1JB4 A;  1OH0 A;  2OQE C;  2BNG A;  4PEJ A;  4BTY A;  1KQS 2;  1US1 A;  1SQW A;  1V57 A;  2L4V A;  4HM5 B;  1K41 A;  1I70 A;  2MF7 A;  4HM4 B;  4NHF A;  5AEU B;  1BUQ A;  2B24 B;  1EG9 B;  2H0H A;  5CK6 A;  1STF I;  2V1L A;  1ZS7 A;  1U5O A;  4LMI A;  1M1K 4;  3B4P A;  4N3V A;  1GD4 A;  1B21 A;  1WMO A;  2I9W A;  2CFW A;  6STD A;  4K90 B;  3OV4 A;  4N6U A;  3WA2 X;  1I2F A;  1NO3 A;  1B20 A;  1N9J A;  4HBR A;  5KP4 A;  1RLS A;  4HYZ A;  3WMD A;  9RNT A;  2BU4 A;  1WQL B;  4MMZ B;  5FW5 A;  1I3F A;  3G8Z A;  1VQN 3;  1IVW A;  2JQ5 A;  2P0X A;  3I0Y A;  1A2V A;  2ZA4 A;  1FGQ A;  2PNC A;  3VSY A;  1U8C B;  4WP5 A;  2J8X B;  2SAR A;  2XEP A;  3GZR A;  3EBT A;  3N9H A;  2BMQ B;  3D3L A;  1C7H A;  1QMA A;  4GSP A;  1GOY A;  4KZ1 A;  2UUG C;  4BL3 A;  1TJD A;  1RTU A;  3K5T A;  4FMA A;  4LYL B;  4WFO A;  2O3O A;  2W0Q A;  2HMM B;  3K0Z A;  3ROB A;  3S28 A;  3OXA A;  1A2K A;  3NX0 A;  1K73 4;  5AIF A;  4XBY A;  1I3I A;  2YFL B;  1B2U A;  2YFJ B;  4LEH A;  4XM4 A;  2E2T A;  1Q40 A;  1W4N A;  1YNV X;  4XDV A;  5KP3 A;  3MG1 A;  1VQM 3;  1TRQ A;  1HKX A;  1PY3 A;  2IMJ A;  3IJE B;  5AIG A;  3SYU A;  5JBS A;  1YGW A;  3LT8 A;  1EUI C;  4TX4 A;  5CLK A;  1N8R 4;  1OAC A;  5HGR A;  3GWR A;  1RGC A;  1UDI I;  3LYG A;  3NV0 A;  1RMS A;  1RKY A;  3JUP A;  5M19 A;  2W56 A;  1T5Y A;  2CWV A;  1JBS A;  4AKY A;  1I0V A;  1UI7 A;  3EJV A;  3LTD A;  3IPT A;  3OWY A;  4KFD A;  5DRE A;  3T8U A;  3GZX B;  1VQ4 3;  2F5M A;  1RNT A;  3EF8 A;  1GOV A;  1DMQ A;  3JVC A;  2O9U X;  3MPH A;  4IIA A;  3RGA A;  3FG4 A;  7RNT A;  5I97 A;  3MYT A;  2Z77 A;  1JB2 A;  3UNL A;  3DZL A;  1ZGX A;  2K54 A;  4O02 B;  3SX1 A;  1BSE A;  5D82 A;  4WHA A;  3S67 A;  1EA2 A;  4J8T A;  4KVH A;  3X3X A;  1UUV B;  3F8H A;  1STD A;  4ORL A;  1TTO A;  5ELU A;  1FYS A;  2IYJ A;  1BSC A;  1UI8 A;  1CQS A;  2CK3 H;  3MWZ A;  2BO9 B;  4K1V A;  1VQ9 3;  3KII A;  1JJ2 2;  2KF5 A;  4FCM A;  2XSH B;  2QGU A;  2ZDJ A;  1T3B A;  5G2G A;  4X2O A;  1UCI A;  1FGO A;  4R9K A;  1EQK A;  4K61 A;  1CYU A;  1TFO A;  2RFR A;  1MWR A;  1N9E A;  4HOH A;  4HKV B;  1FA3 A;  3GSP A;  3NM7 A;  1YJN 3;  3WOE B;  3FLJ A;  6GSP A;  3BIR A;  1IT7 A;  4O8S A;  3CCS 3;  1VQK 3;  4N6L A;  1G0T A;  2CH9 A;  3D5I A;  4FMB A;  1UUG B;  5G1L A;  4BTX A;  2ML6 A;  4HJL B;  4XDW A;  1AR0 A;  1B2M A;  5BXQ A;  1HU9 A;  7STD A;  4MJD A;  2XSO B;  3WA3 A;  2GU1 A;  3PZW A;  2F98 A;  4O3V A;  1HYF A;  4FCZ A;  1SII A;  2KF6 A;  3LTC A;  1Q40 B;  3DGN A;  2HMN B;  2CFL A;  1JKG B;  1B2X A;  2E2V A;  2P0M A;  5BVB A;  2HMJ B;  1AVK A;  2IA7 A;  3CCL 3;  2HOH A;  3FZW A;  4NRE A;  5JPU A;  1YVS A;  2WOF A;  5TGN A;  1JRQ A;  3EC9 A;  2AAD A;  2XF3 A;  1BRJ A;  5D83 A;  3NV0 B;  2CFK A;  3DUK A;  2GBX B;  2E2U A;  3EQQ B;  1FUW A;  3FF2 A;  5IG0 A;  2XFS A;  3DGL A;  3EB8 A;  3X42 A;  1LNI A;  1QVG 2;  1E3R A;  3RDE A;  3V98 A;  1W02 A;  4RNZ A;  1LOW A;  2R4I A;  3WR2 A;  1R4C A;  3CC7 3;  2OOV A;  4EV5 A;  5AI1 A;  1X1X A;  3G0K A;  1LOV A;  1QAL A;  1BIR A;  3OWS A;  3IMA B;  5BIR A;  3S29 A;  1O7N B;  1T2I A;  2YX9 A;  4L8O A;  1BGS A;  7GSP A;  2CX0 A;  3NQY A;  5EVH A;  1T2H A;  1W2Z A;  3B7C A;  3CCV 3;  3I55 3;  1BUJ A;  1BNJ A;  3FSD A;  1EEJ A;  3LTB A;  5ELJ A;  1BNG A;  1W7C A;  1Z1S A;  4J5G A;  4AKZ A;  2IUJ A;  3HZP A;  2STD A;  5IW9 A;  1RGG A;  2F99 A;  1GMR A;  1GMP A;  4MMY B;  1D6Y A;  5IF6 A;  3HOH A;  4JRF A;  2WGO A;  3KE7 A;  4R1K A;  4EC6 A;  2P05 A;  1A67 A;  4HVN A;  1HZ1 A;  4ILF A;  5D81 A;  1Q9E A;  5IEO A;  1MGW A;  4HAA A;  2KF4 A;  1J2B A;  2CKF B;  1DET A;  2P38 A;  1L5G B;  1LQM B;  6RNT A;  4BIR A;  1YGE A;  3OWU A;  1RNB A;  1DVD A;  5IEN A;  4FCJ A;  1BAO A;  1B3S A;  1UCJ A;  5AIH A;  1NNV A;  2Z76 A;  1DMM A;  2GXF A;  1IQ8 A;  2L1S A;  1RGE A;  1IVV A;  4XB5 A;  2B1X B;  1OUN A;  1D6U A;  1FUS A;  4OUQ A;  1RGA A;  3H3H A;  3PGB A;  2XGL A;  3EX9 A;  4O2H A;  1A90 A;  1TUH A;  1RGK A;  3K9M C;  4FMC A;  3MSO A;  4WYK B;  2BIR A;  2UGI A;  1LOX A;  2K0M A;  4FR9 A;  3AHW A;  3URP A;  3V92 A;  1BRI A;  4RNY A;  3UL6 A;  4HM2 B;  2F4Y A;  2IY2 A;  1N5H A;  3FG1 A; 
#chains in the Genus database with same CATH homology
 2CC3 A;  1DVC A;  3AMO B;  2QIY A;  3LXU X;  2SBL A;  4STD A;  2FGT A;  1LVN A;  5AYR B;  1JKG A;  2PZV A;  2FXT A;  3L0R A;  3KSP A;  3ER7 A;  2W03 A;  3OX9 A;  3B4O A;  4LGQ A;  4HM1 B;  3BLZ A;  3G16 A;  4IT7 A;  3PYJ A;  2W9Q A;  4R4K A;  1YHQ 3;  4N6M A;  1EKM A;  5KP1 A;  3M8C A;  2C10 A;  2OTL 3;  3U1W A;  3STD A;  3CNX A;  1OCV A;  3HK4 A;  3SLU A;  3DGM A;  2LQV A;  1G96 A;  1YIJ 3;  1QVF 2;  1IDP A;  2CHC A;  1OGZ A;  1IVU A;  1IV7 A;  3NHX A;  1VQP 3;  2OQE A;  1QAK A;  2JDI H;  2ML5 A;  3SED A;  2HMO B;  3F7X A;  3HI7 A;  4J9A A;  1NU3 A;  4GL6 A;  3CCJ 3;  2Y74 A;  2OOV C;  2WGQ A;  1N5P A;  4CDL A;  3KKG A;  5STD A;  1YI2 3;  4HM6 B;  1LNH A;  4AEQ A;  4LSO A;  5CF1 A;  1FGR A;  1VQ8 3;  3QRD A;  3FCS B;  1VQ6 3;  1D6Z A;  1YIT 3;  3ECF A;  3EN8 A;  3F14 A;  1NB5 I;  3UL5 A;  3CMA 3;  1M90 4;  4N6V 0;  2CFG A;  2KRT A;  3PXM A;  5LC6 A;  3CXC 2;  1Q86 4;  3VGN A;  3G4S 3;  3X40 A;  1QAF A;  2XRX B;  4N6O B;  2BMO B;  3SXX A;  1FGM A;  4HM7 B;  2OTJ 3;  1SPU A;  4WYK A;  1ROV A;  3LOY A;  3CD6 3;  4EBG A;  3X3Z A;  4H3U A;  3QK9 A;  2Z6B A;  3GZY B;  4FMD A;  4I4K A;  3NBJ A;  1OF5 B;  2RGQ A;  2INX A;  1CEW I;  3AMO A;  5EQL A;  3S5C A;  1RRH A;  1WTH A;  3DM8 A;  3CCU 3;  5A0O B;  2BMR B;  2ZL8 A;  3KFQ C;  1VQ7 3;  3JUQ A;  3N54 B;  4EYC A;  3PCS A;  4N6N B;  3LZA A;  2GU3 A;  3LH4 A;  4L8P A;  4Q53 A;  1KD1 4;  4HZB B;  1O7W B;  3DMC A;  4R9L A;  1VQ5 3;  5CXO A;  2YFI B;  4XBX A;  4HM0 B;  3BNE A;  5IG4 A;  3GRD A;  1Q7Y 4;  1O7M B;  3SOA A;  1ULJ B;  2XH9 A;  1CYV A;  1KSI A;  1E97 A;  3NQZ A;  2FNQ A;  1YVB I;  1UW1 A;  4X2H A;  3CU3 A;  4EV2 A;  1F8N A;  1RJO A;  3FG3 A;  1S5A A;  3VF1 A;  3X3Y A;  3UJM A;  4R80 A;  1LXE A;  3K63 A;  1JN5 B;  2UX0 A;  4IPB A;  1M1X B;  3NBB A;  1K8A 4;  3EBY A;  3GZB A;  3F9S A;  2GEY A;  3V99 A;  1W6Y A;  3GAX A;  1NDO B;  1AVL A;  1ROA A;  1WMN A;  2C11 A;  4H61 A;  2OCT A;  3K7C A;  3BNB A;  1JV2 B;  1ULI B;  3NXJ A;  1KC8 4;  5AEW B;  1VZZ A;  3DGO A;  3LTA A;  1IQX A;  2IUK A;  3LT9 A;  5LC7 A;  4CCV A;  2D1W A;  2QEX 3;  3CPO A;  1TFK A;  3F7S A;  3I56 3;  1M9G A;  2Y73 A;  3J7Y d;  1OHO A;  4MEI A;  4GB5 A;  3TDG A;  1QJG A;  3EE1 A;  3CCR 3;  2CG0 A;  3OW2 2;  3HII A;  1UUW B;  3CC4 3;  4EXR A;  1W01 A;  2CG1 A;  3X41 A;  1W6C A;  3CCQ 3;  1W5Z A;  2CIU A;  3H51 A;  3KN4 A;  4ZM8 A;  1VQL 3;  4RZM A;  1N8Q A;  1NB3 I;  1OF5 A;  1W6G A;  2GEX A;  4JF8 A;  5FGO A;  1DYU A;  1GYB A;  2HML B;  3KSE D;  1K9M 4;  3D9R A;  3NM2 A;  2Z7A A;  1OHS A;  2WO0 A;  1GS3 A;  4KFE A;  5IG3 A;  4K1U A;  1RN7 A;  2W6J H;  3NBR A;  3Q1C A;  4XBT A;  1Q82 4;  3A76 A;  3FGY A;  3EN1 B;  3CC2 3;  3G71 3;  3Q2P A;  1ASK A;  1PFP A;  8CHO A;  4KFF A;  1AV4 A;  1FGT A;  1YJW 3;  1IQY A;  1W00 A;  3EHC A;  2MC8 A;  5CF2 A;  5JPP A;  1NJI 4;  2W2C A;  4OK0 A;  2LYX A;  1WMP A;  1IVX A;  3UB1 A;  4QWT A;  3G6E 3;  3JUM A;  5IER A;  3BB9 A;  1JN5 A;  3WDG B;  1GY5 A;  3NUV A;  2QA4 3;  2F86 B;  3CCE 3;  3JUO A;  1GY6 A;  2WOH A;  2Q07 A;  2A15 A;  1GD3 A;  2GBW B;  4HZ9 B;  3CPW 2;  1NWW A;  3SVA A;  4HM8 B;  2W04 A;  1TIJ A;  2W9P A;  3E99 A;  3T0U A;  1IU7 A;  1JNQ A;  1IT8 A;  1O7H B;  3MKI A;  2XGN A;  5AYS C;  1SJW A;  4L7K A;  4WWU C;  3SOY A;  1RRL A;  3BND A;  3FF0 A;  3PCR A;  4N6T A;  2KCD A;  2HMK B;  4LZI A;  2CFD A;  2P09 A;  1VQO 3;  1E3V A;  3MHE A;  3ALA A;  1WNH A;  3RGR A;  3KZT A;  1IV9 A;  3N8B A;  3T8N A;  3HX8 A;  3F40 A;  1ZX2 A;  2RCD A;  3DXO A;  3CNM A;  1Q42 A;  1OHP A;  1ISK A;  2CW9 A;  3HIG A;  3O8Y A;  1O7G B;  3B8L A;  3JUN A;  3CCM 3;  2M7O A;  3DY5 A;  2CWU A;  1JB5 A;  4BTW A;  2BT3 A;  4G1M B;  2CWT A;  2OWP A;  1W2B 2;  3WOF B;  5AII A;  1IK3 A;  3CME 3;  1K28 A;  3FH1 A;  3S27 A;  5IG5 A;  1OGX A;  1TU5 A;  3MG2 A;  1TP6 A;  1MOL A;  1GY7 A;  4OVM A;  1DMN A;  5EEO A;  5IEP A;  1PU4 A;  3BNC A;  1SIH A;  1S72 3;  1O7P B;  2KXG A;  2D42 A;  3U97 A;  3FKA A;  1OPY A;  3LML A;  4HM3 B;  2RSX A;  2W56 B;  2XFT A;  3WOD G;  1V74 A;  3MG3 A;  4MMX B;  5DRV A;  3Q90 A;  3PS8 A;  4RBN A;  1ZO2 A;  1YJ9 3;  1KWI A;  2BHM A;  4U13 A;  3F8X A;  1Y4K A;  1Q81 4;  2XR8 B;  1MNL A;  1JB4 A;  1OH0 A;  2OQE C;  2BNG A;  4PEJ A;  4BTY A;  1KQS 2;  1US1 A;  1SQW A;  4HM5 B;  2L4V A;  4HM4 B;  1K41 A;  2MF7 A;  4NHF A;  1L5G B;  5AEU B;  1BUQ A;  2B24 B;  1EG9 B;  5CK6 A;  1STF I;  2V1L A;  4LMI A;  1U5O A;  1M1K 4;  3B4P A;  4N3V A;  1GD4 A;  1WMO A;  2I9W A;  2CFW A;  6STD A;  4K90 B;  3OV4 A;  4N6U A;  3WA2 X;  1NO3 A;  1N9J A;  4HBR A;  5KP4 A;  4HYZ A;  3WMD A;  1WQL B;  4MMZ B;  5FW5 A;  3G8Z A;  1VQN 3;  1IVW A;  2JQ5 A;  2P0X A;  3I0Y A;  1A2V A;  1FGQ A;  2PNC A;  3VSY A;  1U8C B;  4WP5 A;  2XEP A;  3GZR A;  3EBT A;  3N9H A;  2BMQ B;  3D3L A;  1C7H A;  1QMA A;  4KZ1 A;  3K5T A;  4FMA A;  4WFO A;  2O3O A;  2W0Q A;  2HMM B;  3K0Z A;  3ROB A;  3S28 A;  3OXA A;  1A2K A;  3NX0 A;  1K73 4;  5AIF A;  4XBY A;  2YFL B;  2YFJ B;  4LEH A;  4XM4 A;  2E2T A;  1Q40 A;  1W4N A;  4XDV A;  5KP3 A;  3MG1 A;  1VQM 3;  1HKX A;  2IMJ A;  3IJE B;  5AIG A;  5JBS A;  3LT8 A;  1N8R 4;  4TX4 A;  5CLK A;  1OAC A;  5HGR A;  3GWR A;  3LYG A;  3NV0 A;  1RKY A;  3JUP A;  2W56 A;  1T5Y A;  2CWV A;  4AKY A;  3EJV A;  1UI7 A;  3LTD A;  4KFD A;  3IPT A;  3OWY A;  5DRE A;  3T8U A;  1VQ4 3;  3GZX B;  3EF8 A;  1DMQ A;  3JVC A;  2O9U X;  3MPH A;  4IIA A;  3RGA A;  3FG4 A;  5I97 A;  3MYT A;  2Z77 A;  1JB2 A;  3UNL A;  3DZL A;  2K54 A;  4O02 B;  3SX1 A;  5D82 A;  4WHA A;  3S67 A;  1EA2 A;  4J8T A;  4KVH A;  3X3X A;  1UUV B;  3F8H A;  1STD A;  4ORL A;  5ELU A;  3MWZ A;  1UI8 A;  1CQS A;  2CK3 H;  4K1V A;  2BO9 B;  1VQ9 3;  3KII A;  1JJ2 2;  4FCM A;  2XSH B;  2QGU A;  2ZDJ A;  5G2G A;  4X2O A;  1FGO A;  4R9K A;  1EQK A;  4K61 A;  1CYU A;  1TFO A;  2RFR A;  1N9E A;  4HKV B;  1FA3 A;  3NM7 A;  1YJN 3;  3WOE B;  3FLJ A;  1IT7 A;  4O8S A;  3CCS 3;  1VQK 3;  4N6L A;  2CH9 A;  4BTX A;  4FMB A;  2ML6 A;  4HJL B;  4XDW A;  1AR0 A;  5BXQ A;  1HU9 A;  7STD A;  4MJD A;  2XSO B;  3WA3 A;  2GU1 A;  3PZW A;  2F98 A;  4O3V A;  4FCZ A;  1SII A;  3LTC A;  1Q40 B;  3DGN A;  2HMN B;  2CFL A;  1JKG B;  2E2V A;  2P0M A;  5BVB A;  2HMJ B;  1AVK A;  2IA7 A;  3CCL 3;  3FZW A;  4NRE A;  5JPU A;  2WOF A;  5TGN A;  1JRQ A;  3EC9 A;  2XF3 A;  5D83 A;  3NV0 B;  2CFK A;  3DUK A;  2GBX B;  2E2U A;  3EQQ B;  1FUW A;  3FF2 A;  5IG0 A;  2XFS A;  3DGL A;  3EB8 A;  3X42 A;  1QVG 2;  1E3R A;  3RDE A;  3V98 A;  1W02 A;  4RNZ A;  2R4I A;  1R4C A;  3CC7 3;  2OOV A;  4EV5 A;  5AI1 A;  3G0K A;  3OWS A;  1QAL A;  3IMA B;  3S29 A;  1O7N B;  4L8O A;  2YX9 A;  3NQY A;  5EVH A;  3CCV 3;  1W2Z A;  3B7C A;  3I55 3;  3FSD A;  3LTB A;  5ELJ A;  1W7C A;  1Z1S A;  4AKZ A;  2IUJ A;  3HZP A;  2STD A;  5IW9 A;  2F99 A;  5IF6 A;  4MMY B;  1D6Y A;  4JRF A;  2WGO A;  3KE7 A;  4R1K A;  4EC6 A;  2P05 A;  1A67 A;  4HVN A;  5D81 A;  5IEO A;  1J2B A;  2CKF B;  2P38 A;  1YGE A;  3OWU A;  1DVD A;  5IEN A;  4FCJ A;  5AIH A;  2Z76 A;  1DMM A;  2GXF A;  1IQ8 A;  1IVV A;  4XB5 A;  2B1X B;  1OUN A;  1D6U A;  4OUQ A;  3H3H A;  3PGB A;  2XGL A;  3EX9 A;  4O2H A;  1A90 A;  1TUH A;  3K9M C;  4FMC A;  3MSO A;  4WYK B;  3V92 A;  1LOX A;  2K0M A;  4FR9 A;  4RNY A;  3UL6 A;  4HM2 B;  1N5H A;  3FG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...