2GU3A

Ypmb protein from bacillus subtilis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
b'KEEGHEAAAAEAKKETDLAHVDQVETFVGKEKYYVVKGTDKKGTALYVWVPADKKAKILSKEAKEGISEDKAAKIIKDEGLVSKQKEVHLAREGNVLLWEVTYLDKEGQYSLSYVDFTTGKILKNITP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YpmB protein
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis subsp. subtilis str. 168
publication title X-ray crystal structure of YpmB protein from Bacillus subtilis.
rcsb
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF17881 DUF5590 Domain of unknown function (DUF5590)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A01
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A02
2OOVC 2WOHA 3HI7A 1DYUA 3HIIA 3AMOB 3SX1A 1SIIA 1IVVA 3KIIA 3NQZA 3T0UA 1UI7A 2CFKA 1US1A 1AV4A 3WA2X 1W5ZA 1RKYA 2CG0A 1TU5A 1AVLA 2D1WA 1IQYA 1IVXA 2WO0A 3X42A 3AMOA 1W7CA 2BT3A 2WGQA 3KN4A 1W4NA 4EV5A 1D6YA 3HIGA 2CG1A 1IU7A 3X3YA 3WA3A 4KFFA 3ALAA 3SXXA 1D6ZA 2E2UA 3K5TA 4BTYA 2GU3A 3X3XA 4EXRA 1EKMA 5IW9A 2C11A 1W6CA 3PGBA 4KFDA 3X3ZA 1SPUA 3X41A 1JRQA 2K0MA 1N9EA 2C10A 1KSIA 3LOYA 4BTXA 1W2ZA 2CWTA 2YX9A 1PU4A 3N9HA 1SIHA 2CFGA 1QALA 1QAKA 1UI8A 1WMOA 3NBBA 2CWVA 4BTWA 1D6UA 4EV2A 1WMNA 1IVUA 2ZL8A 3MPHA 1RJOA 2CFLA 2CWUA 1QAFA 1W6GA 2WOFA 2CFWA 3X40A 1WMPA 1IQXA 2Y74A 2E2VA 4KFEA 1OACA 2Y73A 1AVKA 2CFDA 2W0QA 1A2VA 1IVWA 2IA7A 2OQEC 2E2TA 2OQEA 1LVNA 3NQYA 3NBJA 2OOVA 2PNCA
chains in the Genus database with same CATH superfamily
3EQQB 3WOEB 3LT9A 1M1XB 1U5OA 3RNTA 3DGYA 1RRLA 1BRNL 1GOYA 1FGMA 4WHAA 5BVBA 3RDEA 4KVHA 4Q53A 1BNGA 1RGGA 3KFQC 5AEUB 1GYBA 1OHSA 2LYXA 1G02A 4BL2A 1RN4A 1RN7A 1UW1A 1EA2A 1QMAA 2CFKA 3NQZA 2HOHA 3SVAA 1JZOA 3T0UA 4XBTA 4FMBA 4N6OB 7STDA 4HM2B 5G1KA 1OH0A 4AKYA 2ZHXB 1E97A 4WFOA 4LYLB 3NUVA 4J9AA 1EUIC 1Q7HA 2J8XB 1VQ53 1RGAA 5ELJA 3X42A 2XH9A 1FA3A 3UJMA 5FW5A 3DZLA 1S723 2WGQA 1RHLA 3KN4A 9RNTA 1N9JA 4NPBA 1UGIA 5JBSA 2CX0A 1BNEA 1HYFA 1CYVA 1YNVX 3SEDA 3LH4A 1O7HB 2RFRA 1GD3A 5IEPA 4XM4A 1N5PA 3SXXA 1JKGB 5LC7A 3SOYA 2KF5A 2CKFB 2E2UA 1FYSA 3K5TA 1JBTA 2R41A 2H0IA 4I5QA 1E3VA 2O9UX 1MWSA 2K54A 1EEJA 1C7HA 3F7XA 1EKMA 1YI23 3GRDA 1JJ22 1DMNA 3B4OA 1LOVA 1IT7A 2IMJA 4N6NB 3S67A 2CH9A 5KP3A 2C11A 4GSPA 3D79A 1STFI 4KFDA 3PZWA 4X2HA 3STDA 1NNVA 3JUPA 3RGAA 1B21A 3FLJA 1STDA 3G713 4K1UA 8CHOA 3CCJ3 3URPA 1FZUA 1JRQA 1N9EA 3IPTA 2C10A 3LTBA 6RNTA 1TFKA 3LOYA 5STDA 3WHOA 3OV4A 1PU4A 3GZBA 2F56A 1QALA 1FGQA 4HM0B 4HBRA 1MGRA 3KSPA 1B20A 1ROAA 3Q3FA 1U8CB 2CWVA 4HM4B 4MJDA 5IG3A 3FH1A 2XEPA 2H0GA 4MMXB 1TP6A 2F99A 2F86B 2CHCA 2MF7A 2OTJ3 2F4YA 2SARA 2P0MA 1UUGB 3MPHA 3LTAA 1O7WB 2BNGA 1RJOA 1OHPA 2ZDJA 5AEWB 4RNZA 1VQM3 1JKGA 2BIRA 1BOXA 1OGXA 2AADA 2BU4A 2H0HA 4R80A 5FGOA 3EBTA 3MG3A 6STDA 3K63A 4OK0A 3K0ZA 1T3BA 1JBRA 2KAAA 1W6GA 3NV0A 3WR2A 1VQL3 1RGEA 3M8CA 1IV9A 3CU3A 6GSPA 1A90A 1JB5A 1ULJB 1UUWB 1IK3A 1DMQA 2B24B 4BU4A 3RGRA 4KFEA 3FKAA 1ROVA 1WNHA 2Y73A 1FW7A 4XB5A 1Q7Y4 1AVKA 2C4BA 1IVWA 3QRDA 4HVNA 3GSPA 2E2TA 1UCJA 3KCHA 1LNIA 2HMLB 4HOHA 1RLSA 5G2GA 2OQEA 3EN8A 3UL6A 1GY7A 4K61A 5IG5A 1Q864 3VSYA 1A2PA 4R1KA 4IT7A 4O8SA 3ROBA 1UUVB 3NBJA 1VQN3 4GL6A 1BRJA 2UGIA 5CXOA 3CCL3 3BB9A 1JN5B 3HI7A 3TDGA 5IEOA 1O7GB 3ZG0A 3KKGA 3V99A 3JUMA 2FNQA 3BNEA 3NX0A 2W56A 3HIIA 2KXGA 4K90B 3WODG 4HM7B 1B27A 1LOXA 1RGFA 3KIIA 3UNLA 5EEOA 1I2GA 3CCU3 2GSPA 1CEWI 5DRVA 4R4KA 1VQ43 1FGTA 2GXFA 1NDOB 3EX9A 1W5ZA 1BSAA 1B2XA 2CX1A 1RKYA 1RRHA 5JPPA 1JNQA 3GAXA 1TU5A 2IUKA 2Z6BA 1OCVA 4XDWA 5G1LA 1Q9EA 1IYYA 3MKIA 1BRSA 1W7CA 1RDSA 3NM2A 1JN5A 2W9PA 2P38A 2SBLA 3G6E3 1YGEA 3DH2A 4RNYA 2V1LA 3GZXB 1B2SA 1DVCA 1ZX2A 2IY2A 1UCKA 1O7NB 2YFJB 2I9WA 3D9RA 3OWSA 4OUQA 3H51A 1FGOA 1X1UA 3HIGA 4N6TA 1AY7A 1NB3I 3E99A 1B2UA 1KWIA 3U97A 1EQKA 1LNHA 1R4YA 3PS8A 3EF8A 1D6ZA 5LC6A 3AHSA 3NHXA 1VQQA 3JUNA 2YFIB 4ORLA 3OW22 4GHOA 2GU3A 3S27A 3X3XA 3IJEB 5IW9A 3J7Yd 1OPYA 3CC73 1S5AA 1HZ1A 1RCKA 2F98A 1UCIA 3B7CA 2LQVA 4N6UA 3CCE3 4HKVB 4MMYB 3HK4A 2KF3A 1M1K4 1SPUA 3T8NA 4HM8B 1BUJA 1UDII 3X41A 2CIUA 4X2OA 3HX8A 1TTOA 1KSIA 1W2ZA 1MGWA 1JZDA 3A76A 2YFLB 1W2B2 2UUGC 2K3DA 4K1VA 1V74A 3EC9A 4EC6A 2BO9B 2W56B 3EB8A 1RNBA 5M19A 3K7CA 4BTWA 1BSDA 4CCVA 4RZMA 3PCRA 3FCSB 5TGNA 5AYRB 1TFOA 4O2HA 4EYCA 1RGHA 1OF5A 2IYJA 1MNLA 3B8LA 3DXOA 3F14A 2QA43 2STDA 2XGLA 1GY5A 4WP5A 4BIRA 3ER7A 4IIAA 1HU9A 3I553 1KC84 4QWTA 1BRHA 1LOYA 1T2HA 4EBGA 5HOHA 3DMCA 3F8XA 1GY6A 1K41A 3HOHA 3LXUX 1ASKA 1BANA 3MWZA 4L8PA 3D4AA 3LZAA 5AIHA 1WMPA 4GB5A 4LEHA 5CF1A 1IQXA 5D83A 3GZRA 1VQP3 1OHOA 4KT3B 5IG0A 1LQGC 4WWUC 3V98A 1C54A 2RBIA 2AAEA 3BLZA 3OX9A 4N6LA 1V57A 2IA7A 3NV0B 1IV7A 1Q40B 1LVNA 3MG1A 2RNTA 1Q42A 4LMIA 1QJGA 3CMA3 4HAAA 1GMPA 4J5GA 3QK9A 5HGRA 4U13A 1LRAA 2BMRB 5BU4A 3CC23 3F7SA 3G8ZA 3OWYA 3D5GA 5BXQA 2WOHA 4G1MB 4CJNA 1GD4A 1SJWA 1HKXA 3BNDA 3EJVA 4CDLA 3I563 3LYGA 1YHQ3 5IG4A 4JRFA 1DYUA 3A5EA 3HZPA 1O7PB 3G16A 5AIFA 1N8R4 1I0VA 3AMOB 5CF2A 2O3OA 3D3LA 3OXAA 5M1AA 1I3IA 3CCV3 2XGNA 3GWRA 1SIIA 1IVVA 2HMMB 4NHFA 7GSPA 5ELUA 1AV4A 1BRKA 3MHEA 3Q90A 2OWPA 2W2CA 1MWTA 5DREA 4FCJA 2D1WA 1IQYA 1IVXA 2WO0A 3NBRA 5D81A 3CCM3 2BT3A 3F40A 3NXJA 2F5WA 5GSPA 1RCLA 1M904 4JF8A 2ML5A 1NU3A 1W4NA 5BIRA 1BIRA 1N5HA 1RSNA 4EV5A 1D6YA 2Q07A 3B4PA 3BU4A 1BNRA 1E3RA 3LTCA 1AQZA 1BRGA 2D42A 2GU1A 3VF1A 1RGCA 4WYKA 1YJ93 4XBXA 2BHMA 2Z77A 3L0RA 4H3UA 2FGTA 1NO3A 1BU4A 1GOUA 3CNXA 4STDA 1QVF2 2RGQA 1MOLA 1GS3A 1RTUA 4FCZA 4ZM8A 3G4S3 4N6MA 1WQLB 3PGBA 2HMJB 1PFPA 8RNTA 1OUNA 2UX0A 5EVHA 4DKIA 5I97A 4L8OA 2K0MA 1GSPA 1G0TA 1GMRA 2OCTA 3Q2PA 2MC8A 3FF2A 3N9HA 1PY3A 5KP1A 1SIHA 2CFGA 3NM7A 4PEJA 4R9KA 5AI1A 3PXMA 4N6V0 2OTL3 3CPW2 1WMOA 1BAOA 4CPKA 5CK6A 1W02A 1D6UA 2XFSA 1L5GB 4KZ1A 4IPBA 3JUQA 1T5YA 1TRQA 1EG9B 1I3FA 2QEX3 1IVUA 2M7OA 3PYJA 1TIJA 2A15A 3WMDA 1R4CA 1YJW3 4LGQA 3MG2A 1YVBI 3CNMA 3S5CA 3FSDA 3KZTA 4FMAA 1BSEA 2CWUA 2P0XA 4WYKB 5A0OB 2Z7AA 1CQSA 1FUSA 1QAFA 4L7KA 4HZ9B 5M18A 2CFWA 3FF0A 3X40A 1VQO3 3U1WA 1KQS2 2HMNB 1IQ8A 2P09A 2Y74A 3FG3A 4FMDA 2HMOB 3Q1CA 4AKZA 2KF6A 2PZVA 3DUKA 5IENA 3LTDA 1Y4KA 1FGRA 1X1XA 4RNTA 1TUHA 1A2VA 1Q40A 2OQEC 4H61A 1BGSA 3EBYA 1VQ83 1GOVA 2CK3H 4FR9A 5EQLA 1ZS7A 5IERA 1I2FA 1UGHI 3NQYA 2XSHB 2FXTA 1BNFA 1AR0A 3PCSA 7RNTA 2CW9A 1JBSA 1ISKA 2IUJA 1I8VA 2OOVC 3S28A 1IT8A 2QGUA 3ZFZA 1A2KA 1VQ93 3AGOA 4I4KA 2XRXB 1RN1A 1YJN3 1K28A 1FUTA 1VZZA 1RGKA 2BMQB 3SX1A 3N54B 4O3VA 2QIYA 5AYSC 1K8A4 1ZO2A 3WOFB 1MWRA 3LT8A 2Z76A 1UI7A 1LOWA 1US1A 1B2ZA 1NB5I 2RCDA 3WA2X 1DE3A 1I2EA 1TJDA 3LMLA 3OWUA 3CME3 1SQWA 1OGZA 2CG0A 3CC43 1AVLA 1V58A 1I70A 3G0KA 4FMCA 4LSOA 3SOAA 3V92A 1NJI4 1DVDA 3AMOA 1JB2A 3D5IA 1IDPA 3CPOA 3MYTA 1CYUA 3SYUA 1M9GA 1SARA 1BRIA 5JPUA 3AGNA 1K734 1MWUA 5D82A 1JV2B 3UL5A 4AEQA 1PYLA 5CLKA 1TRPA 2CG1A 1IU7A 3X3YA 3WA3A 4KFFA 1RNTA 2ML6A 4N3VA 1YIT3 1B2MA 1BSCA 3ECFA 4XDVA 1FUWA 1YVSA 2L1SA 1BVIA 2JDIH 2WGOA 3ALAA 3FZWA 1GMQA 3VGNA 5IF6A 4HYZA 1Z1SA 1QVG2 2B1XB 3JUOA 1I0XA 3EE1A 4BTYA 3JVCA 3AHWA 2XSOB 1N8QA 1LQMB 1O7MB 1CH0A 2KF4A 4MEIA 3CD63 3EN1B 4TX4A 4EXRA 1YGWA 3KE7A 2KRTA 1JB4A 2XF3A 1RMSA 3EHCA 1ZGXA 2RSXA 3K9MC 1WTHA 1W6CA 2CC3A 4BL3A 3X3ZA 3IMAB 1KD14 2GBWB 1ULIB 2P05A 5RNTA 1T2IA 4R9LA 1BSBA 4BTXA 2CWTA 2YX9A 2KCDA 3I0YA 1OF5B 3O8YA 4HM6B 1QAKA 4HM1B 1UI8A 3NBBA 2GEXA 3KSED 1X1YA 4XBYA 1YIJ3 1LXEA 2ZA4A 1VQ63 3BNCA 3DM8A 1RGLA 1VQK3 1BNJA 4EV2A 1WMNA 4FCMA 1Q814 2W04A 2ZL8A 3H3HA 4J8TA 4HM5B 4OVMA 3CCR3 1K9M4 1G96A 1VQ73 2CFLA 2R4IA 3DY5A 3N8BA 3UB1A 3ZG5A 1DMMA 3GZYB 1Q824 3F8HA 4EW5A 3BIRA 2W6JH 2XR8B 3DGMA 2W03A 3SLUA 3CXC2 3BNBA 1X1WA 2JQ5A 2W9QA 2WOFA 3FG4A 4NREA 1A67A 4J5KA 3CCQ3 2INXA 1NWWA 3DGNA 1BNSA 4O02B 5AIGA 2GBXB 4LZIA 2E2VA 1BNIA 3WDGB 1UCLA 2XFTA 4HM3B 2F5MA 1OACA 3T8UA 3FG1A 5KP4A 4HJLB 2CFDA 2W0QA 1W6YA 3F9SA 1W00A 2HMKB 1B3SA 4RBNA 3S29A 1BUQA 4HZBB 1J2BA 1DETA 3DGLA 3MSOA 4MMZB 5AIIA 1W01A 4ILFA 3FGYA 3DGOA 3CCS3 2L4VA 2GEYA 1F8NA 2OOVA 2BMOB 2PNCA
chains in the Genus database with same CATH topology
3EQQB 3WOEB 3LT9A 1M1XB 1U5OA 1RRLA 1FGMA 4WHAA 5BVBA 3RDEA 4KVHA 4Q53A 3KFQC 5AEUB 1GYBA 1OHSA 2LYXA 3NQZA 1RN7A 1UW1A 1EA2A 1QMAA 2CFKA 3T0UA 3SVAA 4XBTA 4FMBA 4N6OB 7STDA 4HM2B 1OH0A 4AKYA 1E97A 4WFOA 3NUVA 4J9AA 1VQ53 5ELJA 3X42A 2XH9A 1FA3A 3UJMA 5FW5A 3DZLA 1S723 2WGQA 3KN4A 1N9JA 5JBSA 1CYVA 3SEDA 3LH4A 1O7HB 2RFRA 1GD3A 5IEPA 4XM4A 1N5PA 3SXXA 1JKGB 5LC7A 3SOYA 2CKFB 2E2UA 3K5TA 1E3VA 2O9UX 2K54A 1C7HA 3F7XA 1EKMA 1YI23 3GRDA 1JJ22 1DMNA 3B4OA 1IT7A 2IMJA 4N6NB 3S67A 2CH9A 5KP3A 2C11A 1STFI 4KFDA 3PZWA 4X2HA 3STDA 3JUPA 3RGAA 3G713 3FLJA 1STDA 4K1UA 8CHOA 3CCJ3 1JRQA 3IPTA 1N9EA 3LTBA 2C10A 1TFKA 3LOYA 5STDA 3OV4A 1PU4A 3GZBA 1QALA 1FGQA 4HM0B 4HBRA 3KSPA 1ROAA 1U8CB 2CWVA 4HM4B 4MJDA 5IG3A 3FH1A 2XEPA 4MMXB 1TP6A 2F99A 2F86B 2CHCA 2MF7A 2OTJ3 3MPHA 2P0MA 3LTAA 1O7WB 2BNGA 1RJOA 1OHPA 2ZDJA 5AEWB 4RNZA 1VQM3 1JKGA 4R80A 1OGXA 5FGOA 3EBTA 3MG3A 6STDA 3K63A 4OK0A 3K0ZA 1W6GA 3NV0A 1VQL3 3M8CA 1IV9A 3CU3A 1A90A 1JB5A 1ULJB 1UUWB 1IK3A 1DMQA 2B24B 3RGRA 4KFEA 3FKAA 1ROVA 1WNHA 2Y73A 4XB5A 1Q7Y4 1AVKA 1IVWA 3QRDA 4HVNA 2E2TA 2HMLB 5G2GA 2OQEA 3UL6A 3EN8A 5IG5A 1GY7A 4K61A 1Q864 3VSYA 4R1KA 4IT7A 4O8SA 3ROBA 1UUVB 3NBJA 1VQN3 4GL6A 5CXOA 3CCL3 3BB9A 1JN5B 3HI7A 3TDGA 5IEOA 1O7GB 3KKGA 3V99A 3JUMA 2FNQA 3BNEA 3NX0A 2W56A 3HIIA 2KXGA 4K90B 3WODG 4HM7B 1LOXA 3KIIA 3UNLA 5EEOA 3CCU3 1CEWI 5DRVA 4R4KA 1VQ43 1FGTA 2GXFA 1NDOB 3EX9A 1W5ZA 1RKYA 1RRHA 5JPPA 1JNQA 3GAXA 1TU5A 2IUKA 2Z6BA 1OCVA 4XDWA 3MKIA 1W7CA 3NM2A 1JN5A 2W9PA 2P38A 2SBLA 3G6E3 1YGEA 4RNYA 2V1LA 3GZXB 1DVCA 1ZX2A 2YFJB 3OWSA 1O7NB 4OUQA 2I9WA 3D9RA 3H51A 1FGOA 3HIGA 4N6TA 1NB3I 3E99A 3U97A 1KWIA 1EQKA 1LNHA 3PS8A 3EF8A 1D6ZA 5LC6A 3NHXA 3JUNA 2YFIB 4ORLA 3OW22 2GU3A 3S27A 3X3XA 3IJEB 5IW9A 3J7Yd 1OPYA 3CC73 1S5AA 2F98A 3B7CA 2LQVA 4N6UA 3CCE3 4HKVB 4MMYB 3HK4A 1M1K4 1SPUA 3T8NA 4HM8B 3X41A 2CIUA 4X2OA 3HX8A 1KSIA 1W2ZA 3A76A 2YFLB 1W2B2 4K1VA 1V74A 3EC9A 4EC6A 2BO9B 2W56B 3EB8A 3K7CA 4BTWA 4CCVA 4RZMA 3PCRA 3FCSB 5TGNA 5AYRB 1TFOA 4O2HA 4EYCA 1OF5A 1MNLA 3B8LA 3DXOA 3F14A 2QA43 2STDA 2XGLA 1GY5A 4WP5A 3ER7A 4IIAA 1HU9A 3I553 1KC84 4QWTA 4EBGA 3DMCA 3F8XA 1GY6A 1K41A 3LXUX 1ASKA 3MWZA 4L8PA 3LZAA 5AIHA 1WMPA 4GB5A 4LEHA 5CF1A 1IQXA 5D83A 3GZRA 1VQP3 1OHOA 5IG0A 4WWUC 3V98A 3BLZA 3OX9A 4N6LA 2IA7A 3NV0B 1IV7A 1Q40B 1LVNA 3MG1A 4LMIA 1Q42A 1QJGA 3CMA3 3QK9A 5HGRA 4U13A 2BMRB 3CC23 3F7SA 3G8ZA 3OWYA 5BXQA 2WOHA 4G1MB 1GD4A 1SJWA 1HKXA 3BNDA 3EJVA 4CDLA 3I563 3LYGA 1YHQ3 5IG4A 4JRFA 1DYUA 3HZPA 1N8R4 1O7PB 3G16A 5AIFA 3AMOB 5CF2A 2O3OA 3D3LA 3OXAA 3CCV3 2XGNA 3GWRA 1SIIA 1IVVA 2HMMB 4NHFA 5ELUA 1AV4A 3MHEA 3Q90A 2OWPA 2W2CA 5DREA 4FCJA 2D1WA 1IQYA 1IVXA 2WO0A 3NBRA 5D81A 3CCM3 2BT3A 3F40A 3NXJA 1M904 4JF8A 2ML5A 1NU3A 1W4NA 1N5HA 4EV5A 1D6YA 2Q07A 3B4PA 1E3RA 3LTCA 2D42A 2GU1A 3VF1A 4WYKA 1YJ93 4XBXA 2BHMA 2Z77A 3L0RA 4H3UA 2FGTA 1NO3A 4STDA 3CNXA 1QVF2 2RGQA 1MOLA 1GS3A 4FCZA 4ZM8A 3G4S3 4N6MA 1WQLB 3PGBA 2HMJB 1PFPA 1OUNA 2UX0A 5EVHA 5I97A 4L8OA 2K0MA 2OCTA 3Q2PA 2MC8A 3FF2A 3N9HA 5KP1A 1SIHA 2CFGA 3NM7A 4PEJA 4R9KA 5AI1A 3PXMA 4N6V0 2OTL3 3CPW2 1WMOA 5CK6A 1W02A 1D6UA 2XFSA 1L5GB 4KZ1A 4IPBA 3JUQA 1T5YA 1EG9B 2QEX3 1IVUA 2M7OA 3PYJA 1TIJA 2A15A 3WMDA 1R4CA 1YJW3 4LGQA 3MG2A 1YVBI 3CNMA 3S5CA 3FSDA 3KZTA 4FMAA 2CWUA 2P0XA 4WYKB 5A0OB 2Z7AA 1CQSA 1QAFA 4L7KA 4HZ9B 2CFWA 3FF0A 3X40A 1VQO3 3U1WA 1KQS2 2HMNB 1IQ8A 2P09A 2Y74A 3FG3A 4FMDA 2HMOB 3Q1CA 4AKZA 2PZVA 5IENA 3DUKA 3LTDA 1Y4KA 1FGRA 1TUHA 1A2VA 1Q40A 2OQEC 4H61A 3EBYA 1VQ83 5EQLA 2CK3H 4FR9A 5IERA 3NQYA 2XSHB 2FXTA 1AR0A 3PCSA 2CW9A 1ISKA 2IUJA 2OOVC 3S28A 1IT8A 2QGUA 1VQ93 1A2KA 4I4KA 2XRXB 1YJN3 1K28A 1VZZA 2BMQB 3SX1A 3N54B 4O3VA 2QIYA 5AYSC 1K8A4 1ZO2A 3WOFB 3LT8A 2Z76A 1UI7A 1US1A 1NB5I 2RCDA 3WA2X 3LMLA 3OWUA 3CME3 1SQWA 1OGZA 2CG0A 3CC43 1AVLA 4FMCA 4LSOA 3G0KA 3SOAA 3V92A 1NJI4 1DVDA 3AMOA 1JB2A 1IDPA 3CPOA 3MYTA 1CYUA 1M9GA 5JPUA 1K734 5D82A 1JV2B 3UL5A 4AEQA 5CLKA 2CG1A 1IU7A 3X3YA 3WA3A 4KFFA 1YIT3 2ML6A 4N3VA 1FUWA 3ECFA 4XDVA 3ALAA 2JDIH 2WGOA 3FZWA 3VGNA 5IF6A 4HYZA 1Z1SA 1QVG2 2B1XB 3JUOA 3EE1A 4BTYA 3JVCA 2XSOB 1N8QA 1O7MB 3CD63 4MEIA 3EN1B 4TX4A 4EXRA 3KE7A 2KRTA 1JB4A 2XF3A 3EHCA 2RSXA 3K9MC 1WTHA 1W6CA 2CC3A 3X3ZA 3IMAB 1KD14 2GBWB 1ULIB 2P05A 4R9LA 4BTXA 2CWTA 2YX9A 2KCDA 3I0YA 1OF5B 3O8YA 4HM6B 1QAKA 4HM1B 1UI8A 3NBBA 2GEXA 3KSED 4XBYA 1YIJ3 1LXEA 1VQ63 3BNCA 3DM8A 1VQK3 4EV2A 1WMNA 4FCMA 1Q814 2W04A 2ZL8A 3H3HA 4J8TA 4HM5B 4OVMA 3CCR3 1K9M4 1G96A 1VQ73 2CFLA 2R4IA 3DY5A 3N8BA 3UB1A 1DMMA 3GZYB 1Q824 3F8HA 2W6JH 2XR8B 3DGMA 2W03A 3SLUA 3CXC2 3BNBA 2JQ5A 2W9QA 3FG4A 2WOFA 4NREA 1A67A 3CCQ3 2INXA 1NWWA 3DGNA 4O02B 5AIGA 2GBXB 4LZIA 2E2VA 3WDGB 2XFTA 4HM3B 3T8UA 1OACA 3FG1A 5KP4A 4HJLB 2CFDA 2W0QA 1W6YA 3F9SA 1W00A 2HMKB 4RBNA 3S29A 1BUQA 4HZBB 1J2BA 3DGLA 3MSOA 4MMZB 5AIIA 1W01A 3FGYA 3DGOA 3CCS3 2L4VA 2GEYA 1F8NA 2OOVA 2BMOB 2PNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOV C;  2WOH A;  3HI7 A;  1DYU A;  3HII A;  3AMO B;  3SX1 A;  1SII A;  1IVV A;  3KII A;  3NQZ A;  3T0U A;  1UI7 A;  2CFK A;  1US1 A;  1AV4 A;  3WA2 X;  1W5Z A;  1RKY A;  2CG0 A;  1TU5 A;  1AVL A;  2D1W A;  1IQY A;  1IVX A;  2WO0 A;  3X42 A;  3AMO A;  1W7C A;  2BT3 A;  2WGQ A;  3KN4 A;  1W4N A;  4EV5 A;  1D6Y A;  3HIG A;  2CG1 A;  1IU7 A;  3X3Y A;  3WA3 A;  4KFF A;  3ALA A;  3SXX A;  1D6Z A;  2E2U A;  3K5T A;  4BTY A;  2GU3 A;  3X3X A;  4EXR A;  1EKM A;  5IW9 A;  2C11 A;  1W6C A;  3PGB A;  4KFD A;  3X3Z A;  1SPU A;  3X41 A;  1JRQ A;  2K0M A;  1N9E A;  2C10 A;  1KSI A;  3LOY A;  4BTX A;  1W2Z A;  2CWT A;  2YX9 A;  1PU4 A;  3N9H A;  1SIH A;  2CFG A;  1QAL A;  1QAK A;  1UI8 A;  1WMO A;  3NBB A;  2CWV A;  4BTW A;  1D6U A;  4EV2 A;  1WMN A;  1IVU A;  2ZL8 A;  3MPH A;  1RJO A;  2CFL A;  2CWU A;  1QAF A;  1W6G A;  2WOF A;  2CFW A;  3X40 A;  1WMP A;  1IQX A;  2Y74 A;  2E2V A;  4KFE A;  1OAC A;  2Y73 A;  1AVK A;  2CFD A;  2W0Q A;  1A2V A;  1IVW A;  2IA7 A;  2OQE C;  2E2T A;  2OQE A;  1LVN A;  3NQY A;  3NBJ A;  2OOV A;  2PNC A; 
#chains in the Genus database with same CATH topology
 3EQQ B;  3WOE B;  3LT9 A;  1M1X B;  1U5O A;  3RNT A;  3DGY A;  1RRL A;  1BRN L;  1GOY A;  1FGM A;  4WHA A;  5BVB A;  3RDE A;  4KVH A;  4Q53 A;  1BNG A;  1RGG A;  3KFQ C;  5AEU B;  1GYB A;  1OHS A;  2LYX A;  1G02 A;  4BL2 A;  1RN4 A;  1RN7 A;  1UW1 A;  1EA2 A;  1QMA A;  2CFK A;  3NQZ A;  2HOH A;  3SVA A;  1JZO A;  3T0U A;  4XBT A;  4FMB A;  4N6O B;  7STD A;  4HM2 B;  5G1K A;  1OH0 A;  4AKY A;  2ZHX B;  1E97 A;  4WFO A;  4LYL B;  3NUV A;  4J9A A;  1EUI C;  1Q7H A;  2J8X B;  1VQ5 3;  1RGA A;  5ELJ A;  3X42 A;  2XH9 A;  1FA3 A;  3UJM A;  5FW5 A;  3DZL A;  1S72 3;  2WGQ A;  1RHL A;  3KN4 A;  9RNT A;  1N9J A;  4NPB A;  1UGI A;  5JBS A;  2CX0 A;  1BNE A;  1HYF A;  1CYV A;  1YNV X;  3SED A;  3LH4 A;  1O7H B;  2RFR A;  1GD3 A;  5IEP A;  4XM4 A;  1N5P A;  3SXX A;  1JKG B;  5LC7 A;  3SOY A;  2KF5 A;  2CKF B;  2E2U A;  1FYS A;  3K5T A;  1JBT A;  2R41 A;  2H0I A;  4I5Q A;  1E3V A;  2O9U X;  1MWS A;  2K54 A;  1EEJ A;  1C7H A;  3F7X A;  1EKM A;  1YI2 3;  3GRD A;  1JJ2 2;  1DMN A;  3B4O A;  1LOV A;  1IT7 A;  2IMJ A;  4N6N B;  3S67 A;  2CH9 A;  5KP3 A;  2C11 A;  4GSP A;  3D79 A;  1STF I;  4KFD A;  3PZW A;  4X2H A;  3STD A;  1NNV A;  3JUP A;  3RGA A;  1B21 A;  3FLJ A;  1STD A;  3G71 3;  4K1U A;  8CHO A;  3CCJ 3;  3URP A;  1FZU A;  1JRQ A;  1N9E A;  3IPT A;  2C10 A;  3LTB A;  6RNT A;  1TFK A;  3LOY A;  5STD A;  3WHO A;  3OV4 A;  1PU4 A;  3GZB A;  2F56 A;  1QAL A;  1FGQ A;  4HM0 B;  4HBR A;  1MGR A;  3KSP A;  1B20 A;  1ROA A;  3Q3F A;  1U8C B;  2CWV A;  4HM4 B;  4MJD A;  5IG3 A;  3FH1 A;  2XEP A;  2H0G A;  4MMX B;  1TP6 A;  2F99 A;  2F86 B;  2CHC A;  2MF7 A;  2OTJ 3;  2F4Y A;  2SAR A;  2P0M A;  1UUG B;  3MPH A;  3LTA A;  1O7W B;  2BNG A;  1RJO A;  1OHP A;  2ZDJ A;  5AEW B;  4RNZ A;  1VQM 3;  1JKG A;  2BIR A;  1BOX A;  1OGX A;  2AAD A;  2BU4 A;  2H0H A;  4R80 A;  5FGO A;  3EBT A;  3MG3 A;  6STD A;  3K63 A;  4OK0 A;  3K0Z A;  1T3B A;  1JBR A;  2KAA A;  1W6G A;  3NV0 A;  3WR2 A;  1VQL 3;  1RGE A;  3M8C A;  1IV9 A;  3CU3 A;  6GSP A;  1A90 A;  1JB5 A;  1ULJ B;  1UUW B;  1IK3 A;  1DMQ A;  2B24 B;  4BU4 A;  3RGR A;  4KFE A;  3FKA A;  1ROV A;  1WNH A;  2Y73 A;  1FW7 A;  4XB5 A;  1Q7Y 4;  1AVK A;  2C4B A;  1IVW A;  3QRD A;  4HVN A;  3GSP A;  2E2T A;  1UCJ A;  3KCH A;  1LNI A;  2HML B;  4HOH A;  1RLS A;  5G2G A;  2OQE A;  3EN8 A;  3UL6 A;  1GY7 A;  4K61 A;  5IG5 A;  1Q86 4;  3VSY A;  1A2P A;  4R1K A;  4IT7 A;  4O8S A;  3ROB A;  1UUV B;  3NBJ A;  1VQN 3;  4GL6 A;  1BRJ A;  2UGI A;  5CXO A;  3CCL 3;  3BB9 A;  1JN5 B;  3HI7 A;  3TDG A;  5IEO A;  1O7G B;  3ZG0 A;  3KKG A;  3V99 A;  3JUM A;  2FNQ A;  3BNE A;  3NX0 A;  2W56 A;  3HII A;  2KXG A;  4K90 B;  3WOD G;  4HM7 B;  1B27 A;  1LOX A;  1RGF A;  3KII A;  3UNL A;  5EEO A;  1I2G A;  3CCU 3;  2GSP A;  1CEW I;  5DRV A;  4R4K A;  1VQ4 3;  1FGT A;  2GXF A;  1NDO B;  3EX9 A;  1W5Z A;  1BSA A;  1B2X A;  2CX1 A;  1RKY A;  1RRH A;  5JPP A;  1JNQ A;  3GAX A;  1TU5 A;  2IUK A;  2Z6B A;  1OCV A;  4XDW A;  5G1L A;  1Q9E A;  1IYY A;  3MKI A;  1BRS A;  1W7C A;  1RDS A;  3NM2 A;  1JN5 A;  2W9P A;  2P38 A;  2SBL A;  3G6E 3;  1YGE A;  3DH2 A;  4RNY A;  2V1L A;  3GZX B;  1B2S A;  1DVC A;  1ZX2 A;  2IY2 A;  1UCK A;  1O7N B;  2YFJ B;  2I9W A;  3D9R A;  3OWS A;  4OUQ A;  3H51 A;  1FGO A;  1X1U A;  3HIG A;  4N6T A;  1AY7 A;  1NB3 I;  3E99 A;  1B2U A;  1KWI A;  3U97 A;  1EQK A;  1LNH A;  1R4Y A;  3PS8 A;  3EF8 A;  1D6Z A;  5LC6 A;  3AHS A;  3NHX A;  1VQQ A;  3JUN A;  2YFI B;  4ORL A;  3OW2 2;  4GHO A;  2GU3 A;  3S27 A;  3X3X A;  3IJE B;  5IW9 A;  3J7Y d;  1OPY A;  3CC7 3;  1S5A A;  1HZ1 A;  1RCK A;  2F98 A;  1UCI A;  3B7C A;  2LQV A;  4N6U A;  3CCE 3;  4HKV B;  4MMY B;  3HK4 A;  2KF3 A;  1M1K 4;  1SPU A;  3T8N A;  4HM8 B;  1BUJ A;  1UDI I;  3X41 A;  2CIU A;  4X2O A;  3HX8 A;  1TTO A;  1KSI A;  1W2Z A;  1MGW A;  1JZD A;  3A76 A;  2YFL B;  1W2B 2;  2UUG C;  2K3D A;  4K1V A;  1V74 A;  3EC9 A;  4EC6 A;  2BO9 B;  2W56 B;  3EB8 A;  1RNB A;  5M19 A;  3K7C A;  4BTW A;  1BSD A;  4CCV A;  4RZM A;  3PCR A;  3FCS B;  5TGN A;  5AYR B;  1TFO A;  4O2H A;  4EYC A;  1RGH A;  1OF5 A;  2IYJ A;  1MNL A;  3B8L A;  3DXO A;  3F14 A;  2QA4 3;  2STD A;  2XGL A;  1GY5 A;  4WP5 A;  4BIR A;  3ER7 A;  4IIA A;  1HU9 A;  3I55 3;  1KC8 4;  4QWT A;  1BRH A;  1LOY A;  1T2H A;  4EBG A;  5HOH A;  3DMC A;  3F8X A;  1GY6 A;  1K41 A;  3HOH A;  3LXU X;  1ASK A;  1BAN A;  3MWZ A;  4L8P A;  3D4A A;  3LZA A;  5AIH A;  1WMP A;  4GB5 A;  4LEH A;  5CF1 A;  1IQX A;  5D83 A;  3GZR A;  1VQP 3;  1OHO A;  4KT3 B;  5IG0 A;  1LQG C;  4WWU C;  3V98 A;  1C54 A;  2RBI A;  2AAE A;  3BLZ A;  3OX9 A;  4N6L A;  1V57 A;  2IA7 A;  3NV0 B;  1IV7 A;  1Q40 B;  1LVN A;  3MG1 A;  2RNT A;  1Q42 A;  4LMI A;  1QJG A;  3CMA 3;  4HAA A;  1GMP A;  4J5G A;  3QK9 A;  5HGR A;  4U13 A;  1LRA A;  2BMR B;  5BU4 A;  3CC2 3;  3F7S A;  3G8Z A;  3OWY A;  3D5G A;  5BXQ A;  2WOH A;  4G1M B;  4CJN A;  1GD4 A;  1SJW A;  1HKX A;  3BND A;  3EJV A;  4CDL A;  3I56 3;  3LYG A;  1YHQ 3;  5IG4 A;  4JRF A;  1DYU A;  3A5E A;  3HZP A;  1O7P B;  3G16 A;  5AIF A;  1N8R 4;  1I0V A;  3AMO B;  5CF2 A;  2O3O A;  3D3L A;  3OXA A;  5M1A A;  1I3I A;  3CCV 3;  2XGN A;  3GWR A;  1SII A;  1IVV A;  2HMM B;  4NHF A;  7GSP A;  5ELU A;  1AV4 A;  1BRK A;  3MHE A;  3Q90 A;  2OWP A;  2W2C A;  1MWT A;  5DRE A;  4FCJ A;  2D1W A;  1IQY A;  1IVX A;  2WO0 A;  3NBR A;  5D81 A;  3CCM 3;  2BT3 A;  3F40 A;  3NXJ A;  2F5W A;  5GSP A;  1RCL A;  1M90 4;  4JF8 A;  2ML5 A;  1NU3 A;  1W4N A;  5BIR A;  1BIR A;  1N5H A;  1RSN A;  4EV5 A;  1D6Y A;  2Q07 A;  3B4P A;  3BU4 A;  1BNR A;  1E3R A;  3LTC A;  1AQZ A;  1BRG A;  2D42 A;  2GU1 A;  3VF1 A;  1RGC A;  4WYK A;  1YJ9 3;  4XBX A;  2BHM A;  2Z77 A;  3L0R A;  4H3U A;  2FGT A;  1NO3 A;  1BU4 A;  1GOU A;  3CNX A;  4STD A;  1QVF 2;  2RGQ A;  1MOL A;  1GS3 A;  1RTU A;  4FCZ A;  4ZM8 A;  3G4S 3;  4N6M A;  1WQL B;  3PGB A;  2HMJ B;  1PFP A;  8RNT A;  1OUN A;  2UX0 A;  5EVH A;  4DKI A;  5I97 A;  4L8O A;  2K0M A;  1GSP A;  1G0T A;  1GMR A;  2OCT A;  3Q2P A;  2MC8 A;  3FF2 A;  3N9H A;  1PY3 A;  5KP1 A;  1SIH A;  2CFG A;  3NM7 A;  4PEJ A;  4R9K A;  5AI1 A;  3PXM A;  4N6V 0;  2OTL 3;  3CPW 2;  1WMO A;  1BAO A;  4CPK A;  5CK6 A;  1W02 A;  1D6U A;  2XFS A;  1L5G B;  4KZ1 A;  4IPB A;  3JUQ A;  1T5Y A;  1TRQ A;  1EG9 B;  1I3F A;  2QEX 3;  1IVU A;  2M7O A;  3PYJ A;  1TIJ A;  2A15 A;  3WMD A;  1R4C A;  1YJW 3;  4LGQ A;  3MG2 A;  1YVB I;  3CNM A;  3S5C A;  3FSD A;  3KZT A;  4FMA A;  1BSE A;  2CWU A;  2P0X A;  4WYK B;  5A0O B;  2Z7A A;  1CQS A;  1FUS A;  1QAF A;  4L7K A;  4HZ9 B;  5M18 A;  2CFW A;  3FF0 A;  3X40 A;  1VQO 3;  3U1W A;  1KQS 2;  2HMN B;  1IQ8 A;  2P09 A;  2Y74 A;  3FG3 A;  4FMD A;  2HMO B;  3Q1C A;  4AKZ A;  2KF6 A;  2PZV A;  3DUK A;  5IEN A;  3LTD A;  1Y4K A;  1FGR A;  1X1X A;  4RNT A;  1TUH A;  1A2V A;  1Q40 A;  2OQE C;  4H61 A;  1BGS A;  3EBY A;  1VQ8 3;  1GOV A;  2CK3 H;  4FR9 A;  5EQL A;  1ZS7 A;  5IER A;  1I2F A;  1UGH I;  3NQY A;  2XSH B;  2FXT A;  1BNF A;  1AR0 A;  3PCS A;  7RNT A;  2CW9 A;  1JBS A;  1ISK A;  2IUJ A;  1I8V A;  2OOV C;  3S28 A;  1IT8 A;  2QGU A;  3ZFZ A;  1A2K A;  1VQ9 3;  3AGO A;  4I4K A;  2XRX B;  1RN1 A;  1YJN 3;  1K28 A;  1FUT A;  1VZZ A;  1RGK A;  2BMQ B;  3SX1 A;  3N54 B;  4O3V A;  2QIY A;  5AYS C;  1K8A 4;  1ZO2 A;  3WOF B;  1MWR A;  3LT8 A;  2Z76 A;  1UI7 A;  1LOW A;  1US1 A;  1B2Z A;  1NB5 I;  2RCD A;  3WA2 X;  1DE3 A;  1I2E A;  1TJD A;  3LML A;  3OWU A;  3CME 3;  1SQW A;  1OGZ A;  2CG0 A;  3CC4 3;  1AVL A;  1V58 A;  1I70 A;  3G0K A;  4FMC A;  4LSO A;  3SOA A;  3V92 A;  1NJI 4;  1DVD A;  3AMO A;  1JB2 A;  3D5I A;  1IDP A;  3CPO A;  3MYT A;  1CYU A;  3SYU A;  1M9G A;  1SAR A;  1BRI A;  5JPU A;  3AGN A;  1K73 4;  1MWU A;  5D82 A;  1JV2 B;  3UL5 A;  4AEQ A;  1PYL A;  5CLK A;  1TRP A;  2CG1 A;  1IU7 A;  3X3Y A;  3WA3 A;  4KFF A;  1RNT A;  2ML6 A;  4N3V A;  1YIT 3;  1B2M A;  1BSC A;  3ECF A;  4XDV A;  1FUW A;  1YVS A;  2L1S A;  1BVI A;  2JDI H;  2WGO A;  3ALA A;  3FZW A;  1GMQ A;  3VGN A;  5IF6 A;  4HYZ A;  1Z1S A;  1QVG 2;  2B1X B;  3JUO A;  1I0X A;  3EE1 A;  4BTY A;  3JVC A;  3AHW A;  2XSO B;  1N8Q A;  1LQM B;  1O7M B;  1CH0 A;  2KF4 A;  4MEI A;  3CD6 3;  3EN1 B;  4TX4 A;  4EXR A;  1YGW A;  3KE7 A;  2KRT A;  1JB4 A;  2XF3 A;  1RMS A;  3EHC A;  1ZGX A;  2RSX A;  3K9M C;  1WTH A;  1W6C A;  2CC3 A;  4BL3 A;  3X3Z A;  3IMA B;  1KD1 4;  2GBW B;  1ULI B;  2P05 A;  5RNT A;  1T2I A;  4R9L A;  1BSB A;  4BTX A;  2CWT A;  2YX9 A;  2KCD A;  3I0Y A;  1OF5 B;  3O8Y A;  4HM6 B;  1QAK A;  4HM1 B;  1UI8 A;  3NBB A;  2GEX A;  3KSE D;  1X1Y A;  4XBY A;  1YIJ 3;  1LXE A;  2ZA4 A;  1VQ6 3;  3BNC A;  3DM8 A;  1RGL A;  1VQK 3;  1BNJ A;  4EV2 A;  1WMN A;  4FCM A;  1Q81 4;  2W04 A;  2ZL8 A;  3H3H A;  4J8T A;  4HM5 B;  4OVM A;  3CCR 3;  1K9M 4;  1G96 A;  1VQ7 3;  2CFL A;  2R4I A;  3DY5 A;  3N8B A;  3UB1 A;  3ZG5 A;  1DMM A;  3GZY B;  1Q82 4;  3F8H A;  4EW5 A;  3BIR A;  2W6J H;  2XR8 B;  3DGM A;  2W03 A;  3SLU A;  3CXC 2;  3BNB A;  1X1W A;  2JQ5 A;  2W9Q A;  2WOF A;  3FG4 A;  4NRE A;  1A67 A;  4J5K A;  3CCQ 3;  2INX A;  1NWW A;  3DGN A;  1BNS A;  4O02 B;  5AIG A;  2GBX B;  4LZI A;  2E2V A;  1BNI A;  3WDG B;  1UCL A;  2XFT A;  4HM3 B;  2F5M A;  1OAC A;  3T8U A;  3FG1 A;  5KP4 A;  4HJL B;  2CFD A;  2W0Q A;  1W6Y A;  3F9S A;  1W00 A;  2HMK B;  1B3S A;  4RBN A;  3S29 A;  1BUQ A;  4HZB B;  1J2B A;  1DET A;  3DGL A;  3MSO A;  4MMZ B;  5AII A;  1W01 A;  4ILF A;  3FGY A;  3DGO A;  3CCS 3;  2L4V A;  2GEY A;  1F8N A;  2OOV A;  2BMO B;  2PNC A; 
#chains in the Genus database with same CATH homology
 3EQQ B;  3WOE B;  3LT9 A;  1M1X B;  1U5O A;  1RRL A;  1FGM A;  4WHA A;  5BVB A;  3RDE A;  4KVH A;  4Q53 A;  3KFQ C;  5AEU B;  1GYB A;  1OHS A;  2LYX A;  3NQZ A;  1RN7 A;  1UW1 A;  1EA2 A;  1QMA A;  2CFK A;  3T0U A;  3SVA A;  4XBT A;  4FMB A;  4N6O B;  7STD A;  4HM2 B;  1OH0 A;  4AKY A;  1E97 A;  4WFO A;  3NUV A;  4J9A A;  1VQ5 3;  5ELJ A;  3X42 A;  2XH9 A;  1FA3 A;  3UJM A;  5FW5 A;  3DZL A;  1S72 3;  2WGQ A;  3KN4 A;  1N9J A;  5JBS A;  1CYV A;  3SED A;  3LH4 A;  1O7H B;  2RFR A;  1GD3 A;  5IEP A;  4XM4 A;  1N5P A;  3SXX A;  1JKG B;  5LC7 A;  3SOY A;  2CKF B;  2E2U A;  3K5T A;  1E3V A;  2O9U X;  2K54 A;  1C7H A;  3F7X A;  1EKM A;  1YI2 3;  3GRD A;  1JJ2 2;  1DMN A;  3B4O A;  1IT7 A;  2IMJ A;  4N6N B;  3S67 A;  2CH9 A;  5KP3 A;  2C11 A;  1STF I;  4KFD A;  3PZW A;  4X2H A;  3STD A;  3JUP A;  3RGA A;  3G71 3;  3FLJ A;  1STD A;  4K1U A;  8CHO A;  3CCJ 3;  1JRQ A;  3IPT A;  1N9E A;  3LTB A;  2C10 A;  1TFK A;  3LOY A;  5STD A;  3OV4 A;  1PU4 A;  3GZB A;  1QAL A;  1FGQ A;  4HM0 B;  4HBR A;  3KSP A;  1ROA A;  1U8C B;  2CWV A;  4HM4 B;  4MJD A;  5IG3 A;  3FH1 A;  2XEP A;  4MMX B;  1TP6 A;  2F99 A;  2F86 B;  2CHC A;  2MF7 A;  2OTJ 3;  3MPH A;  2P0M A;  3LTA A;  1O7W B;  2BNG A;  1RJO A;  1OHP A;  2ZDJ A;  5AEW B;  4RNZ A;  1VQM 3;  1JKG A;  4R80 A;  1OGX A;  5FGO A;  3EBT A;  3MG3 A;  6STD A;  3K63 A;  4OK0 A;  3K0Z A;  1W6G A;  3NV0 A;  1VQL 3;  3M8C A;  1IV9 A;  3CU3 A;  1A90 A;  1JB5 A;  1ULJ B;  1UUW B;  1IK3 A;  1DMQ A;  2B24 B;  3RGR A;  4KFE A;  3FKA A;  1ROV A;  1WNH A;  2Y73 A;  4XB5 A;  1Q7Y 4;  1AVK A;  1IVW A;  3QRD A;  4HVN A;  2E2T A;  2HML B;  5G2G A;  2OQE A;  3UL6 A;  3EN8 A;  5IG5 A;  1GY7 A;  4K61 A;  1Q86 4;  3VSY A;  4R1K A;  4IT7 A;  4O8S A;  3ROB A;  1UUV B;  3NBJ A;  1VQN 3;  4GL6 A;  5CXO A;  3CCL 3;  3BB9 A;  1JN5 B;  3HI7 A;  3TDG A;  5IEO A;  1O7G B;  3KKG A;  3V99 A;  3JUM A;  2FNQ A;  3BNE A;  3NX0 A;  2W56 A;  3HII A;  2KXG A;  4K90 B;  3WOD G;  4HM7 B;  1LOX A;  3KII A;  3UNL A;  5EEO A;  3CCU 3;  1CEW I;  5DRV A;  4R4K A;  1VQ4 3;  1FGT A;  2GXF A;  1NDO B;  3EX9 A;  1W5Z A;  1RKY A;  1RRH A;  5JPP A;  1JNQ A;  3GAX A;  1TU5 A;  2IUK A;  2Z6B A;  1OCV A;  4XDW A;  3MKI A;  1W7C A;  3NM2 A;  1JN5 A;  2W9P A;  2P38 A;  2SBL A;  3G6E 3;  1YGE A;  4RNY A;  2V1L A;  3GZX B;  1DVC A;  1ZX2 A;  2YFJ B;  3OWS A;  1O7N B;  4OUQ A;  2I9W A;  3D9R A;  3H51 A;  1FGO A;  3HIG A;  4N6T A;  1NB3 I;  3E99 A;  3U97 A;  1KWI A;  1EQK A;  1LNH A;  3PS8 A;  3EF8 A;  1D6Z A;  5LC6 A;  3NHX A;  3JUN A;  2YFI B;  4ORL A;  3OW2 2;  2GU3 A;  3S27 A;  3X3X A;  3IJE B;  5IW9 A;  3J7Y d;  1OPY A;  3CC7 3;  1S5A A;  2F98 A;  3B7C A;  2LQV A;  4N6U A;  3CCE 3;  4HKV B;  4MMY B;  3HK4 A;  1M1K 4;  1SPU A;  3T8N A;  4HM8 B;  3X41 A;  2CIU A;  4X2O A;  3HX8 A;  1KSI A;  1W2Z A;  3A76 A;  2YFL B;  1W2B 2;  4K1V A;  1V74 A;  3EC9 A;  4EC6 A;  2BO9 B;  2W56 B;  3EB8 A;  3K7C A;  4BTW A;  4CCV A;  4RZM A;  3PCR A;  3FCS B;  5TGN A;  5AYR B;  1TFO A;  4O2H A;  4EYC A;  1OF5 A;  1MNL A;  3B8L A;  3DXO A;  3F14 A;  2QA4 3;  2STD A;  2XGL A;  1GY5 A;  4WP5 A;  3ER7 A;  4IIA A;  1HU9 A;  3I55 3;  1KC8 4;  4QWT A;  4EBG A;  3DMC A;  3F8X A;  1GY6 A;  1K41 A;  3LXU X;  1ASK A;  3MWZ A;  4L8P A;  3LZA A;  5AIH A;  1WMP A;  4GB5 A;  4LEH A;  5CF1 A;  1IQX A;  5D83 A;  3GZR A;  1VQP 3;  1OHO A;  5IG0 A;  4WWU C;  3V98 A;  3BLZ A;  3OX9 A;  4N6L A;  2IA7 A;  3NV0 B;  1IV7 A;  1Q40 B;  1LVN A;  3MG1 A;  4LMI A;  1Q42 A;  1QJG A;  3CMA 3;  3QK9 A;  5HGR A;  4U13 A;  2BMR B;  3CC2 3;  3F7S A;  3G8Z A;  3OWY A;  5BXQ A;  2WOH A;  4G1M B;  1GD4 A;  1SJW A;  1HKX A;  3BND A;  3EJV A;  4CDL A;  3I56 3;  3LYG A;  1YHQ 3;  5IG4 A;  4JRF A;  1DYU A;  3HZP A;  1N8R 4;  1O7P B;  3G16 A;  5AIF A;  3AMO B;  5CF2 A;  2O3O A;  3D3L A;  3OXA A;  3CCV 3;  2XGN A;  3GWR A;  1SII A;  1IVV A;  2HMM B;  4NHF A;  5ELU A;  1AV4 A;  3MHE A;  3Q90 A;  2OWP A;  2W2C A;  5DRE A;  4FCJ A;  2D1W A;  1IQY A;  1IVX A;  2WO0 A;  3NBR A;  5D81 A;  3CCM 3;  2BT3 A;  3F40 A;  3NXJ A;  1M90 4;  4JF8 A;  2ML5 A;  1NU3 A;  1W4N A;  1N5H A;  4EV5 A;  1D6Y A;  2Q07 A;  3B4P A;  1E3R A;  3LTC A;  2D42 A;  2GU1 A;  3VF1 A;  4WYK A;  1YJ9 3;  4XBX A;  2BHM A;  2Z77 A;  3L0R A;  4H3U A;  2FGT A;  1NO3 A;  4STD A;  3CNX A;  1QVF 2;  2RGQ A;  1MOL A;  1GS3 A;  4FCZ A;  4ZM8 A;  3G4S 3;  4N6M A;  1WQL B;  3PGB A;  2HMJ B;  1PFP A;  1OUN A;  2UX0 A;  5EVH A;  5I97 A;  4L8O A;  2K0M A;  2OCT A;  3Q2P A;  2MC8 A;  3FF2 A;  3N9H A;  5KP1 A;  1SIH A;  2CFG A;  3NM7 A;  4PEJ A;  4R9K A;  5AI1 A;  3PXM A;  4N6V 0;  2OTL 3;  3CPW 2;  1WMO A;  5CK6 A;  1W02 A;  1D6U A;  2XFS A;  1L5G B;  4KZ1 A;  4IPB A;  3JUQ A;  1T5Y A;  1EG9 B;  2QEX 3;  1IVU A;  2M7O A;  3PYJ A;  1TIJ A;  2A15 A;  3WMD A;  1R4C A;  1YJW 3;  4LGQ A;  3MG2 A;  1YVB I;  3CNM A;  3S5C A;  3FSD A;  3KZT A;  4FMA A;  2CWU A;  2P0X A;  4WYK B;  5A0O B;  2Z7A A;  1CQS A;  1QAF A;  4L7K A;  4HZ9 B;  2CFW A;  3FF0 A;  3X40 A;  1VQO 3;  3U1W A;  1KQS 2;  2HMN B;  1IQ8 A;  2P09 A;  2Y74 A;  3FG3 A;  4FMD A;  2HMO B;  3Q1C A;  4AKZ A;  2PZV A;  5IEN A;  3DUK A;  3LTD A;  1Y4K A;  1FGR A;  1TUH A;  1A2V A;  1Q40 A;  2OQE C;  4H61 A;  3EBY A;  1VQ8 3;  5EQL A;  2CK3 H;  4FR9 A;  5IER A;  3NQY A;  2XSH B;  2FXT A;  1AR0 A;  3PCS A;  2CW9 A;  1ISK A;  2IUJ A;  2OOV C;  3S28 A;  1IT8 A;  2QGU A;  1VQ9 3;  1A2K A;  4I4K A;  2XRX B;  1YJN 3;  1K28 A;  1VZZ A;  2BMQ B;  3SX1 A;  3N54 B;  4O3V A;  2QIY A;  5AYS C;  1K8A 4;  1ZO2 A;  3WOF B;  3LT8 A;  2Z76 A;  1UI7 A;  1US1 A;  1NB5 I;  2RCD A;  3WA2 X;  3LML A;  3OWU A;  3CME 3;  1SQW A;  1OGZ A;  2CG0 A;  3CC4 3;  1AVL A;  4FMC A;  4LSO A;  3G0K A;  3SOA A;  3V92 A;  1NJI 4;  1DVD A;  3AMO A;  1JB2 A;  1IDP A;  3CPO A;  3MYT A;  1CYU A;  1M9G A;  5JPU A;  1K73 4;  5D82 A;  1JV2 B;  3UL5 A;  4AEQ A;  5CLK A;  2CG1 A;  1IU7 A;  3X3Y A;  3WA3 A;  4KFF A;  1YIT 3;  2ML6 A;  4N3V A;  1FUW A;  3ECF A;  4XDV A;  3ALA A;  2JDI H;  2WGO A;  3FZW A;  3VGN A;  5IF6 A;  4HYZ A;  1Z1S A;  1QVG 2;  2B1X B;  3JUO A;  3EE1 A;  4BTY A;  3JVC A;  2XSO B;  1N8Q A;  1O7M B;  3CD6 3;  4MEI A;  3EN1 B;  4TX4 A;  4EXR A;  3KE7 A;  2KRT A;  1JB4 A;  2XF3 A;  3EHC A;  2RSX A;  3K9M C;  1WTH A;  1W6C A;  2CC3 A;  3X3Z A;  3IMA B;  1KD1 4;  2GBW B;  1ULI B;  2P05 A;  4R9L A;  4BTX A;  2CWT A;  2YX9 A;  2KCD A;  3I0Y A;  1OF5 B;  3O8Y A;  4HM6 B;  1QAK A;  4HM1 B;  1UI8 A;  3NBB A;  2GEX A;  3KSE D;  4XBY A;  1YIJ 3;  1LXE A;  1VQ6 3;  3BNC A;  3DM8 A;  1VQK 3;  4EV2 A;  1WMN A;  4FCM A;  1Q81 4;  2W04 A;  2ZL8 A;  3H3H A;  4J8T A;  4HM5 B;  4OVM A;  3CCR 3;  1K9M 4;  1G96 A;  1VQ7 3;  2CFL A;  2R4I A;  3DY5 A;  3N8B A;  3UB1 A;  1DMM A;  3GZY B;  1Q82 4;  3F8H A;  2W6J H;  2XR8 B;  3DGM A;  2W03 A;  3SLU A;  3CXC 2;  3BNB A;  2JQ5 A;  2W9Q A;  3FG4 A;  2WOF A;  4NRE A;  1A67 A;  3CCQ 3;  2INX A;  1NWW A;  3DGN A;  4O02 B;  5AIG A;  2GBX B;  4LZI A;  2E2V A;  3WDG B;  2XFT A;  4HM3 B;  3T8U A;  1OAC A;  3FG1 A;  5KP4 A;  4HJL B;  2CFD A;  2W0Q A;  1W6Y A;  3F9S A;  1W00 A;  2HMK B;  4RBN A;  3S29 A;  1BUQ A;  4HZB B;  1J2B A;  3DGL A;  3MSO A;  4MMZ B;  5AII A;  1W01 A;  3FGY A;  3DGO A;  3CCS 3;  2L4V A;  2GEY A;  1F8N A;  2OOV A;  2BMO B;  2PNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...