2GU3A

Ypmb protein from bacillus subtilis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
b'KEEGHEAAAAEAKKETDLAHVDQVETFVGKEKYYVVKGTDKKGTALYVWVPADKKAKILSKEAKEGISEDKAAKIIKDEGLVSKQKEVHLAREGNVLLWEVTYLDKEGQYSLSYVDFTTGKILKNITP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YpmB protein
publication title X-ray crystal structure of YpmB protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF17881 DUF5590 Domain of unknown function (DUF5590)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A01
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A02
2E2UA 2CWTA 1IVXA 2CG1A 3KIIA 3PGBA 1QALA 3X3YA 1W2ZA 2D1WA 2IA7A 3NQZA 5IW9A 1RJOA 2CFLA 2Y74A 1SPUA 1TU5A 2Y73A 1RKYA 1D6YA 1SIHA 2WGQA 3N9HA 1DYUA 2CFKA 1IQYA 1SIIA 2CFDA 4EV2A 2E2VA 2OQEC 2C10A 2WO0A 3SX1A 1WMPA 1QAFA 1UI8A 2PNCA 2CWVA 4KFFA 4EV5A 3AMOA 3AMOB 3HIGA 2ZL8A 2GU3A 2WOHA 1US1A 3NQYA 4BTYA 1IVWA 3NBBA 3LOYA 2BT3A 2K0MA 3X3ZA 1W5ZA 3X42A 2W0QA 4EXRA 4KFDA 3KN4A 3SXXA 1EKMA 3MPHA 2YX9A 1UI7A 3HIIA 1IVUA 4KFEA 1JRQA 2CG0A 1WMOA 3X40A 1W7CA 3X41A 3T0UA 1IVVA 2OOVC 1N9EA 2OQEA 3ALAA 1KSIA 1D6ZA 2C11A 3WA3A 1A2VA 1D6UA 3K5TA 1W4NA 1AV4A 2WOFA 1AVLA 1OACA 2CFGA 1IQXA 3X3XA 2OOVA 4BTWA 1QAKA 2E2TA 4BTXA 3NBJA 1PU4A 1AVKA 3WA2X 1W6CA 1LVNA 3HI7A 1IU7A 1W6GA 1WMNA 2CFWA 2CWUA
chains in the Genus database with same CATH superfamily
3PXMA 1MGRA 3FF2A 6STDA 2CWTA 1I8VA 1IVXA 2F4YA 1MWRA 2BNGA 5AI1A 3SYUA 1FZUA 1EG9B 5M1AA 1GOUA 1IQ8A 1ZO2A 2XRXB 3X3YA 2CK3H 2QEX3 1Z1SA 4RNZA 1JN5A 1LRAA 3DUKA 1VQL3 3NQZA 3CCV3 1QMAA 1VQQA 4CJNA 3K7CA 1JBTA 5AEUB 3IJEB 3OW22 1UCKA 1SPUA 3WOFB 1TUHA 1X1WA 1WNHA 4HYZA 1B2ZA 4XDWA 1OF5B 1D6YA 1YVSA 3EE1A 1A67A 4L7KA 3LTDA 4GSPA 2GSPA 2RCDA 4N6LA 1LQMB 1UGHI 2GXFA 2CKFB 3NM7A 3CU3A 2SARA 5CF2A 3G4S3 3FG3A 3JVCA 1IQYA 2WGOA 4EV2A 3DGLA 4KVHA 4WHAA 2RGQA 1I2FA 3DXOA 4XBXA 3DY5A 2F98A 1ULJB 2LYXA 3PCSA 1BNJA 1GS3A 1Q40A 4H61A 1FA3A 2BMQB 1JZDA 1BRJA 1ROVA 4L8OA 1OPYA 3UNLA 1LNHA 5BIRA 5GSPA 2W9QA 1QVG2 1N5HA 2O3OA 5STDA 2XGLA 5FW5A 2B1XB 2R41A 3BNCA 1OGXA 3PZWA 5G2GA 3VF1A 1T5YA 2BIRA 2XR8B 4L8PA 9RNTA 1T3BA 3MKIA 1BUJA 1VQ53 2C4BA 1IVWA 1RN7A 4I5QA 2K54A 3O8YA 2QA43 2KXGA 5AYSC 1QJGA 2BT3A 3ER7A 2K0MA 3BB9A 4N6OB 1OCVA 2P05A 1ASKA 1O7WB 4CCVA 3GSPA 3KN4A 1UCIA 3SOAA 1BRNL 5M19A 3G713 1RRHA 3T8NA 3EC9A 1DMQA 1BIRA 3B4PA 1VQM3 4FMBA 2P0MA 3B4OA 3CCR3 1BGSA 1WMOA 1I0XA 1O7NB 2QIYA 3X41A 3LH4A 1IVVA 5BU4A 2BMRB 5AIGA 1ISKA 1TIJA 4BL3A 1Y4KA 1B2XA 1KSIA 1D6ZA 2C11A 1FUWA 3MG2A 1NNVA 3CCM3 1YVBI 1ROAA 3LYGA 1GY5A 3FGYA 2HMOB 1E3RA 4AEQA 1AV4A 4RZMA 3G0KA 3RGAA 2OTJ3 1AVLA 2JDIH 3KE7A 1FW7A 2KAAA 3X3XA 2W56B 3Q1CA 1QAKA 5LC7A 1TRPA 2XSOB 4BTXA 1Q864 2F99A 1U8CB 1RGEA 1BSEA 2Q07A 3V98A 1VQ93 3CC73 4CDLA 3U1WA 3WA2X 1G0TA 1LVNA 1NDOB 3RDEA 3CC43 1VQ63 4R9KA 1KWIA 2RNTA 4RNYA 3H51A 2BO9B 4N3VA 2CWUA 1TU5A 2BHMA 4N6V0 1FGTA 4O3VA 3ZFZA 1BNEA 1QVF2 1AQZA 5ELJA 1DMMA 2CG1A 1IV9A 1Q9EA 1JJ22 3KIIA 7RNTA 4EYCA 1BSCA 4OK0A 5CLKA 2K3DA 1GMRA 3FF0A 3U97A 1OHOA 1QALA 3FLJA 1W2ZA 3LT9A 5G1KA 4ZM8A 1UUGB 3STDA 1DE3A 5IW9A 2ML5A 4N6MA 2F56A 3CCQ3 3LTBA 3CCU3 3BNDA 5KP4A 2MC8A 1GMQA 3M8CA 1OF5A 3D5IA 5HGRA 4FCJA 1PY3A 3CD63 3S5CA 3BNEA 1BSAA 1IT8A 1HZ1A 1PYLA 2V1LA 3E99A 1CEWI 4HM7B 4N6NB 1M1XB 1DYUA 1G96A 1B20A 2B24B 2CFDA 2OQEC 2IUJA 3RNTA 1EQKA 1SARA 3EBYA 3SX1A 1DVCA 3L0RA 2KF4A 3GAXA 1WMPA 2OWPA 3RGRA 2A15A 1RNTA 5TGNA 1N9JA 4BL2A 3I0YA 1FGMA 1VQO3 3BIRA 4FCMA 4R4KA 4FMCA 1BNRA 3LZAA 4KFFA 4BIRA 5IERA 1BSBA 3N54B 4HM4B 5JPUA 1HU9A 1Q42A 3AMOB 3UJMA 2ZL8A 1ZGXA 1HKXA 1OH0A 5DRVA 1RSNA 2W03A 3KKGA 3LTCA 4HM8B 3NBRA 1GD3A 2GBWB 3NM2A 1U5OA 5AYRB 2AAEA 3GRDA 2HMKB 5EQLA 4BU4A 1EA2A 2W0QA 2IUKA 4EXRA 4R1KA 3NXJA 1WTHA 2L1SA 4KFDA 1M1K4 1BAOA 2MF7A 3DGYA 1C54A 3ECFA 4K90B 1TRQA 3PS8A 1EKMA 1I3IA 3MPHA 1K734 2XSHB 4EBGA 4GL6A 2INXA 1BU4A 3HIIA 4HM3B 3K9MC 1TFKA 3GZBA 1JRQA 4HM2B 1AY7A 4RNTA 3QRDA 4EW5A 2IYJA 3FZWA 2Z77A 1LOYA 4ORLA 5I97A 1STFI 1RCKA 2STDA 2JQ5A 5FGOA 1K8A4 3JUNA 3F14A 2ZHXB 1D6UA 3K5TA 1W4NA 3EX9A 1GY7A 3SEDA 2CC3A 1O7PB 4FCZA 2F5MA 2ZA4A 4HM1B 3FCSB 1A2KA 1RTUA 2XEPA 3IMAB 2CW9A 5D83A 2ML6A 4BTWA 3MWZA 4K61A 2W56A 1K41A 1WQLB 1CH0A 1LOVA 2UUGC 3LT8A 4J5GA 4R80A 3SLUA 5CF1A 4ILFA 1RGAA 2H0HA 3WODG 3NBJA 1LNIA 1YJ93 3B8LA 1NB5I 3F7SA 4XB5A 1PU4A 4I4KA 2HOHA 3CCL3 3CNXA 1SJWA 2GEXA 1L5GB 2W6JH 3JUOA 4FMAA 4U13A 4WWUC 1YHQ3 1VQ73 1OUNA 1IU7A 1MWUA 1MWSA 1TJDA 3SOYA 3B7CA 1WMNA 2CFWA 3D5GA 3D3LA 1RGGA 3WHOA 2QGUA 3F7XA 2YFIB 2E2UA 1I0VA 4GHOA 5DREA 5EEOA 2FGTA 5AIFA 4GB5A 2KRTA 1UCJA 2XGNA 3MSOA 3PGBA 2P0XA 3TDGA 4OVMA 1UW1A 6GSPA 2XFTA 3F40A 4HM6B 1TP6A 2IA7A 4KZ1A 1S723 5HOHA 3Q90A 5BVBA 1MOLA 2R4IA 5G1LA 3CCS3 1RNBA 1BSDA 1DETA 3AGOA 1BRKA 1RGCA 1I2GA 4PEJA 2Y73A 1RN1A 2CH9A 1B21A 1BNFA 1E97A 1FYSA 3Q3FA 4NREA 5ELUA 1SIHA 1S5AA 1SQWA 2WGQA 2Z76A 3N8BA 3NUVA 1LOXA 1LOWA 2CX1A 2Z6BA 1BANA 3Q2PA 5IF6A 3CMA3 4IPBA 5AIIA 1JKGB 2UGIA 3N9HA 1MGWA 2KCDA 3DGMA 2CFKA 1V58A 4HVNA 1OHPA 4AKYA 2E2VA 2HMNB 4G1MB 2C10A 2WO0A 4N6TA 3ROBA 3DGOA 3BU4A 4HM0B 1PFPA 1AR0A 1YIJ3 1K9M4 2PNCA 3DM8A 5LC6A 1GSPA 1RGKA 4K1UA 8RNTA 1JBRA 1N5PA 1CQSA 2XF3A 3BLZA 4LZIA 2CWVA 3HZPA 1IK3A 1YJN3 2F86B 2HMMB 4OUQA 3AMOA 1A2PA 3S28A 3NV0B 4LYLB 2GU3A 3FKAA 1RLSA 3EN8A 3NQYA 1B3SA 5BXQA 4HZ9B 4BTYA 1IYYA 1BOXA 1RGLA 2FNQA 1W2B2 1UUVB 3D4AA 5IG0A 3UB1A 1W5ZA 3X42A 1BUQA 3QK9A 4IT7A 1RMSA 3EHCA 1RGHA 4CPKA 3GZRA 5JPPA 2YX9A 3KCHA 1IVUA 1YJW3 4KFEA 3WMDA 1UUWB 1UDII 1GD4A 1JZOA 3AHWA 3D79A 4WFOA 1E3VA 1NB3I 1X1XA 1W6YA 3EN1B 3S67A 1N9EA 2OQEA 1RCLA 3FG1A 3OWYA 3NHXA 1R4CA 3DMCA 3WA3A 1ZS7A 1NO3A 3D9RA 1RN4A 5D81A 1R4YA 1T2IA 4IIAA 5KP1A 3LTAA 2WOFA 1JB5A 3MYTA 3EJVA 2CFGA 1GY6A 2PZVA 5IEOA 3DH2A 1RRLA 3OXAA 1EUIC 3HX8A 1VZZA 3I553 1B2UA 4XBTA 3PYJA 2IY2A 3FG4A 3PCRA 5IG4A 2YFJB 2GEYA 3LXUX 2H0IA 1N8R4 3KSED 1CYVA 3CNMA 5IEPA 1X1UA 1EEJA 1W01A 4O8SA 4WYKB 1JBSA 3NX0A 3DGNA 1JNQA 3F8XA 4HZBB 3FSDA 5EVHA 1DMNA 3HOHA 1ZX2A 3K63A 3IPTA 5AEWB 1Q7Y4 1GOYA 3A76A 3HI7A 1W6GA 1B2SA 1HYFA 5D82A 3EB8A 4MMZB 1O7GB 5AIHA 3CXC2 1A90A 3AHSA 4O02B 3S29A 2GBXB 2W2CA 4LGQA 1VQ43 1FGRA 3A5EA 2HMLB 1FGOA 1O7HB 2H0GA 2W04A 4XM4A 1N8QA 1X1YA 2CHCA 1RKYA 1OHSA 4HKVB 3URPA 4H3UA 1LQGC 1TTOA 1GOVA 1MWTA 2BMOB 2D1WA 3WR2A 3AGNA 2D42A 3MG3A 4DKIA 1VQ83 1UGIA 1ULIB 1JN5B 5M18A 1Q824 5KP3A 3LMLA 1YGEA 3S27A 1M904 4EC6A 2Z7AA 4KT3B 1F8NA 1RJOA 2CFLA 2Y74A 3UL6A 3EQQB 3JUPA 1FUTA 4HJLB 4JRFA 1BNIA 4J5KA 2ZDJA 7STDA 1JV2B 5CK6A 2KF5A 1B27A 2CX0A 5IG3A 2M7OA 4Q53A 4HBRA 1JKGA 2HMJB 2KF3A 1NU3A 3J7Yd 3HK4A 3I563 3CC23 1SIIA 4X2HA 4XBYA 4QWTA 4MMYB 1V74A 2O9UX 3VSYA 4XDVA 2F5WA 5IG5A 2CIUA 3SVAA 3GWRA 3JUQA 1YNVX 3GZXB 1QAFA 1TFOA 1UI8A 1V57A 2XFSA 2RFRA 1Q40B 1YGWA 3V92A 3CME3 1RHLA 1VQP3 4NPBA 1I3FA 3UL5A 1STDA 3F9SA 1MNLA 4EV5A 4LEHA 3ZG5A 3G6E3 1VQK3 3HIGA 3F8HA 2XH9A 3NV0A 1NWWA 4STDA 8CHOA 2FXTA 2RBIA 4FMDA 1IV7A 2WOHA 3JUMA 4AKZA 1US1A 2P09A 3EF8A 6RNTA 4MMXB 3GZYB 4R9LA 1CYUA 3G16A 1KC84 3VGNA 4HAAA 2KF6A 3LOYA 3NBBA 1G02A 1K28A 3T8UA 3X3ZA 3MHEA 1J2BA 1I70A 2OCTA 3KSPA 3KZTA 4LSOA 1LXEA 4J8TA 4RBNA 1Q7HA 3SXXA 1BVIA 1UCLA 4HM5B 2P38A 1I2EA 3DZLA 1RDSA 3EBTA 1OGZA 1UI7A 4FR9A 2GU1A 3CPW2 1YI23 5CXOA 4LMIA 2CG0A 3OWSA 1BRIA 1IT7A 3G8ZA 3FH1A 1W7CA 3X40A 1M9GA 3T0UA 2OOVC 2BU4A 3ZG0A 1JB2A 1RGFA 5RNTA 3CCJ3 1B2MA 2UX0A 2OTL3 3ALAA 4TX4A 1BNSA 5A0OB 1A2VA 1KD14 3CCE3 2I9WA 1FUSA 2IMJA 3OX9A 4JF8A 1KQS2 3KFQC 3MG1A 5IENA 4N6UA 1GMPA 1IQXA 1BNGA 3OV4A 2OOVA 2LQVA 1O7MB 2W9PA 1W00A 5JBSA 1IDPA 4MJDA 1BRSA 1NJI4 4MEIA 3WDGB 1DVDA 2E2TA 1BRGA 2AADA 4WYKA 1Q814 1T2HA 2SBLA 1BRHA 2RSXA 3WOEB 4J9AA 4X2OA 4O2HA 1AVKA 1FGQA 4WP5A 4NHFA 2J8XB 3OWUA 1W6CA 2L4VA 3CPOA 3V99A 1C7HA 3K0ZA 1JB4A 1YIT3 7GSPA 1GYBA 1VQN3 3H3HA 3BNBA 1OACA 2YFLB 4HOHA 1W02A 4K1VA
chains in the Genus database with same CATH topology
3PXMA 3FF2A 6STDA 2CWTA 1IVXA 5AI1A 2BNGA 1EG9B 1IQ8A 1ZO2A 2XRXB 3X3YA 2CK3H 2QEX3 1Z1SA 4RNZA 1JN5A 1VQL3 3DUKA 3NQZA 3CCV3 1QMAA 3K7CA 5AEUB 3IJEB 3OW22 1SPUA 3WOFB 1TUHA 4HYZA 1WNHA 4XDWA 1OF5B 1D6YA 3EE1A 1A67A 4L7KA 3LTDA 4N6LA 2RCDA 2GXFA 3G4S3 2CKFB 3NM7A 3CU3A 5CF2A 3FG3A 3JVCA 2WGOA 1IQYA 4EV2A 3DGLA 4KVHA 4WHAA 2RGQA 3DXOA 4XBXA 3DY5A 2F98A 1ULJB 2LYXA 3PCSA 1GS3A 1Q40A 4H61A 1FA3A 2BMQB 1ROVA 4L8OA 1OPYA 3UNLA 1LNHA 2W9QA 1QVG2 1N5HA 2O3OA 5STDA 2XGLA 5FW5A 2B1XB 5G2GA 3BNCA 1OGXA 3PZWA 3VF1A 1T5YA 2XR8B 4L8PA 3MKIA 1VQ53 1IVWA 1RN7A 2K54A 3O8YA 2QA43 2KXGA 5AYSC 1QJGA 2BT3A 3ER7A 2K0MA 3BB9A 4N6OB 1OCVA 2P05A 1ASKA 1O7WB 4CCVA 3KN4A 3SOAA 3G713 1RRHA 3T8NA 3EC9A 1DMQA 3B4PA 4FMBA 2P0MA 3B4OA 3CCR3 1WMOA 1O7NB 2QIYA 3X41A 3LH4A 1IVVA 1ISKA 2BMRB 5AIGA 1TIJA 1Y4KA 1KSIA 1D6ZA 2C11A 1FUWA 3MG2A 3CCM3 1YVBI 1ROAA 3LYGA 1GY5A 3FGYA 2HMOB 1E3RA 4AEQA 1AV4A 4RZMA 3G0KA 3RGAA 2OTJ3 1AVLA 2JDIH 3KE7A 3X3XA 2W56B 3Q1CA 1QAKA 5LC7A 2XSOB 4BTXA 1Q864 2F99A 1U8CB 2Q07A 3V98A 1VQ93 3CC73 4CDLA 3U1WA 3WA2X 1LVNA 1NDOB 3RDEA 3CC43 1VQ63 4R9KA 1KWIA 4RNYA 3H51A 2BO9B 4N3VA 2CWUA 1TU5A 2BHMA 4N6V0 1FGTA 4O3VA 1QVF2 5ELJA 1DMMA 2CG1A 1IV9A 1JJ22 3KIIA 4EYCA 4OK0A 5CLKA 3FF0A 3U97A 1OHOA 1QALA 3FLJA 1W2ZA 3LT9A 4ZM8A 3STDA 5IW9A 2ML5A 4N6MA 3CCQ3 3LTBA 3CCU3 3BNDA 5KP4A 2MC8A 3M8CA 1OF5A 4FCJA 3CD63 3S5CA 3BNEA 4N6NB 1IT8A 2V1LA 3E99A 1CEWI 4HM7B 1M1XB 1DYUA 1G96A 2B24B 2CFDA 2OQEC 2IUJA 1EQKA 3EBYA 3SX1A 1DVCA 3L0RA 3GAXA 1WMPA 2OWPA 3RGRA 2A15A 5TGNA 1N9JA 3I0YA 1FGMA 1VQO3 4FCMA 4R4KA 4FMCA 3LZAA 4KFFA 5IERA 5JPUA 4HM4B 3N54B 1HU9A 1Q42A 3AMOB 3UJMA 2ZL8A 1HKXA 1OH0A 5DRVA 2W03A 3LTCA 3KKGA 4HM8B 3NBRA 1GD3A 2GBWB 3NM2A 1U5OA 5AYRB 3GRDA 5EQLA 2HMKB 1EA2A 2W0QA 2IUKA 4EXRA 4R1KA 3NXJA 1WTHA 4KFDA 2MF7A 3ECFA 4K90B 3PS8A 1EKMA 3MPHA 1K734 2XSHB 4EBGA 4GL6A 2INXA 4HM3B 3HIIA 3K9MC 1TFKA 3GZBA 1JRQA 4HM2B 3QRDA 3FZWA 2Z77A 4ORLA 5I97A 1STFI 2STDA 2JQ5A 5FGOA 1K8A4 3JUNA 3F14A 1D6UA 3K5TA 1W4NA 3EX9A 1GY7A 3SEDA 2CC3A 1O7PB 4FCZA 4HM1B 3FCSB 1A2KA 3IMAB 2XEPA 2CW9A 5D83A 2ML6A 4BTWA 3MWZA 4K61A 2W56A 1K41A 1WQLB 4R80A 3LT8A 3SLUA 5CF1A 3WODG 3NBJA 1YJ93 3B8LA 1NB5I 3F7SA 4XB5A 1PU4A 4I4KA 3CCL3 3CNXA 1SJWA 2GEXA 1L5GB 2W6JH 3JUOA 4FMAA 4U13A 4WWUC 1YHQ3 1VQ73 1OUNA 1IU7A 3SOYA 3B7CA 1WMNA 2CFWA 3D3LA 2QGUA 3F7XA 2YFIB 2E2UA 5DREA 5EEOA 2FGTA 5AIFA 4GB5A 2KRTA 2XGNA 3MSOA 3PGBA 2P0XA 3TDGA 4OVMA 1UW1A 2XFTA 3F40A 4HM6B 1TP6A 2IA7A 4KZ1A 1S723 3Q90A 5BVBA 1MOLA 2R4IA 3CCS3 4PEJA 2Y73A 2CH9A 5ELUA 1E97A 1RKYA 1M1K4 4NREA 1SIHA 1S5AA 1SQWA 2WGQA 2Z76A 3N8BA 3NUVA 1LOXA 2Z6BA 3Q2PA 3CMA3 5IF6A 4IPBA 5AIIA 1JKGB 3N9HA 2KCDA 3DGMA 2CFKA 4HVNA 4AKYA 1OHPA 2E2VA 2HMNB 4G1MB 2C10A 2WO0A 4N6TA 3ROBA 3DGOA 4HM0B 1PFPA 1AR0A 1YIJ3 1K9M4 2PNCA 3DM8A 5LC6A 4K1UA 1N5PA 1CQSA 2XF3A 3BLZA 4LZIA 2CWVA 3HZPA 1IK3A 1YJN3 2F86B 2HMMB 4OUQA 3AMOA 3S28A 3NV0B 2GU3A 3FKAA 3EN8A 3NQYA 5BXQA 4HZ9B 4BTYA 2FNQA 1W2B2 1UUVB 5IG0A 3UB1A 1W5ZA 3X42A 1BUQA 3QK9A 4IT7A 3EHCA 3GZRA 5JPPA 2YX9A 1IVUA 1YJW3 4KFEA 3WMDA 1UUWB 1GD4A 4WFOA 1E3VA 1NB3I 1W6YA 3EN1B 3S67A 1N9EA 2OQEA 3FG1A 3OWYA 3NHXA 1R4CA 3DMCA 3WA3A 1NO3A 3D9RA 5D81A 5KP1A 4IIAA 3LTAA 2WOFA 1JB5A 3MYTA 3EJVA 2CFGA 1GY6A 2PZVA 5IEOA 1RRLA 3OXAA 3HX8A 1VZZA 3I553 4XBTA 3PYJA 3PCRA 3FG4A 5IG4A 2YFJB 2GEYA 3LXUX 1N8R4 3KSED 1CYVA 3CNMA 5IEPA 4WYKB 1W01A 4O8SA 3NX0A 3DGNA 1JNQA 3F8XA 4HZBB 3FSDA 5EVHA 1DMNA 1ZX2A 3K63A 3IPTA 5AEWB 1Q7Y4 3A76A 1VQM3 3HI7A 1W6GA 5D82A 3EB8A 4MMZB 1O7GB 5AIHA 3CXC2 1A90A 4O02B 3S29A 2GBXB 2W2CA 4LGQA 1VQ43 1FGRA 2HMLB 1FGOA 1O7HB 4XM4A 2W04A 1N8QA 2CHCA 1OHSA 4HKVB 4H3UA 2BMOB 2D1WA 2D42A 3MG3A 1VQ83 1ULIB 1JN5B 1Q824 5KP3A 3LMLA 1YGEA 3S27A 1M904 4EC6A 2Z7AA 1F8NA 1RJOA 2CFLA 2Y74A 3UL6A 3EQQB 3JUPA 4HJLB 4JRFA 2ZDJA 7STDA 1JV2B 5CK6A 5IG3A 2M7OA 4Q53A 4HBRA 1JKGA 2HMJB 1NU3A 3J7Yd 3HK4A 3I563 3CC23 1SIIA 4X2HA 4XBYA 4QWTA 4MMYB 1V74A 2O9UX 3VSYA 4XDVA 5IG5A 2CIUA 3SVAA 3GWRA 3JUQA 3GZXB 1QAFA 1TFOA 1UI8A 2XFSA 2RFRA 1Q40B 3V92A 3CME3 1VQP3 3UL5A 1STDA 3F9SA 1MNLA 4EV5A 4LEHA 3G6E3 1VQK3 3HIGA 3F8HA 2XH9A 3NV0A 1NWWA 4STDA 8CHOA 2FXTA 4FMDA 1IV7A 2WOHA 3JUMA 4AKZA 1US1A 2P09A 3EF8A 4MMXB 3GZYB 4R9LA 1CYUA 3G16A 1KC84 3VGNA 3NBBA 3LOYA 1K28A 3T8UA 3X3ZA 3MHEA 1J2BA 3KSPA 2OCTA 3KZTA 4LSOA 1LXEA 4J8TA 4RBNA 3SXXA 4HM5B 2P38A 3DZLA 3EBTA 4FR9A 1OGZA 1UI7A 2GU1A 3CPW2 1YI23 5CXOA 4LMIA 2CG0A 3OWSA 3G8ZA 1IT7A 3X40A 3FH1A 1W7CA 1M9GA 3T0UA 2OOVC 1JB2A 2OTL3 3CCJ3 2UX0A 3ALAA 4TX4A 5A0OB 1A2VA 1KD14 3CCE3 2I9WA 2IMJA 3OX9A 4JF8A 1KQS2 3KFQC 3MG1A 5IENA 4N6UA 3OV4A 1IQXA 2OOVA 2LQVA 1O7MB 2W9PA 1W00A 5JBSA 1IDPA 4MJDA 1NJI4 4MEIA 3WDGB 1DVDA 2E2TA 4WYKA 1Q814 2SBLA 2RSXA 3WOEB 4J9AA 4X2OA 4O2HA 1AVKA 1FGQA 4WP5A 4NHFA 3OWUA 1W6CA 2L4VA 3CPOA 3V99A 1C7HA 3K0ZA 1JB4A 1YIT3 1GYBA 1VQN3 3H3HA 3BNBA 1OACA 2YFLB 5HGRA 1W02A 4K1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2U A;  2CWT A;  1IVX A;  2CG1 A;  3KII A;  3PGB A;  1QAL A;  3X3Y A;  1W2Z A;  2D1W A;  2IA7 A;  3NQZ A;  5IW9 A;  1RJO A;  2CFL A;  2Y74 A;  1SPU A;  1TU5 A;  2Y73 A;  1RKY A;  1D6Y A;  1SIH A;  2WGQ A;  3N9H A;  1DYU A;  2CFK A;  1IQY A;  1SII A;  2CFD A;  4EV2 A;  2E2V A;  2OQE C;  2C10 A;  2WO0 A;  3SX1 A;  1WMP A;  1QAF A;  1UI8 A;  2PNC A;  2CWV A;  4KFF A;  4EV5 A;  3AMO A;  3AMO B;  3HIG A;  2ZL8 A;  2GU3 A;  2WOH A;  1US1 A;  3NQY A;  4BTY A;  1IVW A;  3NBB A;  3LOY A;  2BT3 A;  2K0M A;  3X3Z A;  1W5Z A;  3X42 A;  2W0Q A;  4EXR A;  4KFD A;  3KN4 A;  3SXX A;  1EKM A;  3MPH A;  2YX9 A;  1UI7 A;  3HII A;  1IVU A;  4KFE A;  1JRQ A;  2CG0 A;  1WMO A;  3X40 A;  1W7C A;  3X41 A;  3T0U A;  1IVV A;  2OOV C;  1N9E A;  2OQE A;  3ALA A;  1KSI A;  1D6Z A;  2C11 A;  3WA3 A;  1A2V A;  1D6U A;  3K5T A;  1W4N A;  1AV4 A;  2WOF A;  1AVL A;  1OAC A;  2CFG A;  1IQX A;  3X3X A;  2OOV A;  4BTW A;  1QAK A;  2E2T A;  4BTX A;  3NBJ A;  1PU4 A;  1AVK A;  3WA2 X;  1W6C A;  1LVN A;  3HI7 A;  1IU7 A;  1W6G A;  1WMN A;  2CFW A;  2CWU A; 
#chains in the Genus database with same CATH topology
 3PXM A;  1MGR A;  3FF2 A;  6STD A;  2CWT A;  1I8V A;  1IVX A;  2F4Y A;  1MWR A;  2BNG A;  5AI1 A;  3SYU A;  1FZU A;  1EG9 B;  5M1A A;  1GOU A;  1IQ8 A;  1ZO2 A;  2XRX B;  3X3Y A;  2CK3 H;  2QEX 3;  1Z1S A;  4RNZ A;  1JN5 A;  1LRA A;  3DUK A;  1VQL 3;  3NQZ A;  3CCV 3;  1QMA A;  1VQQ A;  4CJN A;  3K7C A;  1JBT A;  5AEU B;  3IJE B;  3OW2 2;  1UCK A;  1SPU A;  3WOF B;  1TUH A;  1X1W A;  1WNH A;  4HYZ A;  1B2Z A;  4XDW A;  1OF5 B;  1D6Y A;  1YVS A;  3EE1 A;  1A67 A;  4L7K A;  3LTD A;  4GSP A;  2GSP A;  2RCD A;  4N6L A;  1LQM B;  1UGH I;  2GXF A;  2CKF B;  3NM7 A;  3CU3 A;  2SAR A;  5CF2 A;  3G4S 3;  3FG3 A;  3JVC A;  1IQY A;  2WGO A;  4EV2 A;  3DGL A;  4KVH A;  4WHA A;  2RGQ A;  1I2F A;  3DXO A;  4XBX A;  3DY5 A;  2F98 A;  1ULJ B;  2LYX A;  3PCS A;  1BNJ A;  1GS3 A;  1Q40 A;  4H61 A;  1FA3 A;  2BMQ B;  1JZD A;  1BRJ A;  1ROV A;  4L8O A;  1OPY A;  3UNL A;  1LNH A;  5BIR A;  5GSP A;  2W9Q A;  1QVG 2;  1N5H A;  2O3O A;  5STD A;  2XGL A;  5FW5 A;  2B1X B;  2R41 A;  3BNC A;  1OGX A;  3PZW A;  5G2G A;  3VF1 A;  1T5Y A;  2BIR A;  2XR8 B;  4L8P A;  9RNT A;  1T3B A;  3MKI A;  1BUJ A;  1VQ5 3;  2C4B A;  1IVW A;  1RN7 A;  4I5Q A;  2K54 A;  3O8Y A;  2QA4 3;  2KXG A;  5AYS C;  1QJG A;  2BT3 A;  3ER7 A;  2K0M A;  3BB9 A;  4N6O B;  1OCV A;  2P05 A;  1ASK A;  1O7W B;  4CCV A;  3GSP A;  3KN4 A;  1UCI A;  3SOA A;  1BRN L;  5M19 A;  3G71 3;  1RRH A;  3T8N A;  3EC9 A;  1DMQ A;  1BIR A;  3B4P A;  1VQM 3;  4FMB A;  2P0M A;  3B4O A;  3CCR 3;  1BGS A;  1WMO A;  1I0X A;  1O7N B;  2QIY A;  3X41 A;  3LH4 A;  1IVV A;  5BU4 A;  2BMR B;  5AIG A;  1ISK A;  1TIJ A;  4BL3 A;  1Y4K A;  1B2X A;  1KSI A;  1D6Z A;  2C11 A;  1FUW A;  3MG2 A;  1NNV A;  3CCM 3;  1YVB I;  1ROA A;  3LYG A;  1GY5 A;  3FGY A;  2HMO B;  1E3R A;  4AEQ A;  1AV4 A;  4RZM A;  3G0K A;  3RGA A;  2OTJ 3;  1AVL A;  2JDI H;  3KE7 A;  1FW7 A;  2KAA A;  3X3X A;  2W56 B;  3Q1C A;  1QAK A;  5LC7 A;  1TRP A;  2XSO B;  4BTX A;  1Q86 4;  2F99 A;  1U8C B;  1RGE A;  1BSE A;  2Q07 A;  3V98 A;  1VQ9 3;  3CC7 3;  4CDL A;  3U1W A;  3WA2 X;  1G0T A;  1LVN A;  1NDO B;  3RDE A;  3CC4 3;  1VQ6 3;  4R9K A;  1KWI A;  2RNT A;  4RNY A;  3H51 A;  2BO9 B;  4N3V A;  2CWU A;  1TU5 A;  2BHM A;  4N6V 0;  1FGT A;  4O3V A;  3ZFZ A;  1BNE A;  1QVF 2;  1AQZ A;  5ELJ A;  1DMM A;  2CG1 A;  1IV9 A;  1Q9E A;  1JJ2 2;  3KII A;  7RNT A;  4EYC A;  1BSC A;  4OK0 A;  5CLK A;  2K3D A;  1GMR A;  3FF0 A;  3U97 A;  1OHO A;  1QAL A;  3FLJ A;  1W2Z A;  3LT9 A;  5G1K A;  4ZM8 A;  1UUG B;  3STD A;  1DE3 A;  5IW9 A;  2ML5 A;  4N6M A;  2F56 A;  3CCQ 3;  3LTB A;  3CCU 3;  3BND A;  5KP4 A;  2MC8 A;  1GMQ A;  3M8C A;  1OF5 A;  3D5I A;  5HGR A;  4FCJ A;  1PY3 A;  3CD6 3;  3S5C A;  3BNE A;  1BSA A;  1IT8 A;  1HZ1 A;  1PYL A;  2V1L A;  3E99 A;  1CEW I;  4HM7 B;  4N6N B;  1M1X B;  1DYU A;  1G96 A;  1B20 A;  2B24 B;  2CFD A;  2OQE C;  2IUJ A;  3RNT A;  1EQK A;  1SAR A;  3EBY A;  3SX1 A;  1DVC A;  3L0R A;  2KF4 A;  3GAX A;  1WMP A;  2OWP A;  3RGR A;  2A15 A;  1RNT A;  5TGN A;  1N9J A;  4BL2 A;  3I0Y A;  1FGM A;  1VQO 3;  3BIR A;  4FCM A;  4R4K A;  4FMC A;  1BNR A;  3LZA A;  4KFF A;  4BIR A;  5IER A;  1BSB A;  3N54 B;  4HM4 B;  5JPU A;  1HU9 A;  1Q42 A;  3AMO B;  3UJM A;  2ZL8 A;  1ZGX A;  1HKX A;  1OH0 A;  5DRV A;  1RSN A;  2W03 A;  3KKG A;  3LTC A;  4HM8 B;  3NBR A;  1GD3 A;  2GBW B;  3NM2 A;  1U5O A;  5AYR B;  2AAE A;  3GRD A;  2HMK B;  5EQL A;  4BU4 A;  1EA2 A;  2W0Q A;  2IUK A;  4EXR A;  4R1K A;  3NXJ A;  1WTH A;  2L1S A;  4KFD A;  1M1K 4;  1BAO A;  2MF7 A;  3DGY A;  1C54 A;  3ECF A;  4K90 B;  1TRQ A;  3PS8 A;  1EKM A;  1I3I A;  3MPH A;  1K73 4;  2XSH B;  4EBG A;  4GL6 A;  2INX A;  1BU4 A;  3HII A;  4HM3 B;  3K9M C;  1TFK A;  3GZB A;  1JRQ A;  4HM2 B;  1AY7 A;  4RNT A;  3QRD A;  4EW5 A;  2IYJ A;  3FZW A;  2Z77 A;  1LOY A;  4ORL A;  5I97 A;  1STF I;  1RCK A;  2STD A;  2JQ5 A;  5FGO A;  1K8A 4;  3JUN A;  3F14 A;  2ZHX B;  1D6U A;  3K5T A;  1W4N A;  3EX9 A;  1GY7 A;  3SED A;  2CC3 A;  1O7P B;  4FCZ A;  2F5M A;  2ZA4 A;  4HM1 B;  3FCS B;  1A2K A;  1RTU A;  2XEP A;  3IMA B;  2CW9 A;  5D83 A;  2ML6 A;  4BTW A;  3MWZ A;  4K61 A;  2W56 A;  1K41 A;  1WQL B;  1CH0 A;  1LOV A;  2UUG C;  3LT8 A;  4J5G A;  4R80 A;  3SLU A;  5CF1 A;  4ILF A;  1RGA A;  2H0H A;  3WOD G;  3NBJ A;  1LNI A;  1YJ9 3;  3B8L A;  1NB5 I;  3F7S A;  4XB5 A;  1PU4 A;  4I4K A;  2HOH A;  3CCL 3;  3CNX A;  1SJW A;  2GEX A;  1L5G B;  2W6J H;  3JUO A;  4FMA A;  4U13 A;  4WWU C;  1YHQ 3;  1VQ7 3;  1OUN A;  1IU7 A;  1MWU A;  1MWS A;  1TJD A;  3SOY A;  3B7C A;  1WMN A;  2CFW A;  3D5G A;  3D3L A;  1RGG A;  3WHO A;  2QGU A;  3F7X A;  2YFI B;  2E2U A;  1I0V A;  4GHO A;  5DRE A;  5EEO A;  2FGT A;  5AIF A;  4GB5 A;  2KRT A;  1UCJ A;  2XGN A;  3MSO A;  3PGB A;  2P0X A;  3TDG A;  4OVM A;  1UW1 A;  6GSP A;  2XFT A;  3F40 A;  4HM6 B;  1TP6 A;  2IA7 A;  4KZ1 A;  1S72 3;  5HOH A;  3Q90 A;  5BVB A;  1MOL A;  2R4I A;  5G1L A;  3CCS 3;  1RNB A;  1BSD A;  1DET A;  3AGO A;  1BRK A;  1RGC A;  1I2G A;  4PEJ A;  2Y73 A;  1RN1 A;  2CH9 A;  1B21 A;  1BNF A;  1E97 A;  1FYS A;  3Q3F A;  4NRE A;  5ELU A;  1SIH A;  1S5A A;  1SQW A;  2WGQ A;  2Z76 A;  3N8B A;  3NUV A;  1LOX A;  1LOW A;  2CX1 A;  2Z6B A;  1BAN A;  3Q2P A;  5IF6 A;  3CMA 3;  4IPB A;  5AII A;  1JKG B;  2UGI A;  3N9H A;  1MGW A;  2KCD A;  3DGM A;  2CFK A;  1V58 A;  4HVN A;  1OHP A;  4AKY A;  2E2V A;  2HMN B;  4G1M B;  2C10 A;  2WO0 A;  4N6T A;  3ROB A;  3DGO A;  3BU4 A;  4HM0 B;  1PFP A;  1AR0 A;  1YIJ 3;  1K9M 4;  2PNC A;  3DM8 A;  5LC6 A;  1GSP A;  1RGK A;  4K1U A;  8RNT A;  1JBR A;  1N5P A;  1CQS A;  2XF3 A;  3BLZ A;  4LZI A;  2CWV A;  3HZP A;  1IK3 A;  1YJN 3;  2F86 B;  2HMM B;  4OUQ A;  3AMO A;  1A2P A;  3S28 A;  3NV0 B;  4LYL B;  2GU3 A;  3FKA A;  1RLS A;  3EN8 A;  3NQY A;  1B3S A;  5BXQ A;  4HZ9 B;  4BTY A;  1IYY A;  1BOX A;  1RGL A;  2FNQ A;  1W2B 2;  1UUV B;  3D4A A;  5IG0 A;  3UB1 A;  1W5Z A;  3X42 A;  1BUQ A;  3QK9 A;  4IT7 A;  1RMS A;  3EHC A;  1RGH A;  4CPK A;  3GZR A;  5JPP A;  2YX9 A;  3KCH A;  1IVU A;  1YJW 3;  4KFE A;  3WMD A;  1UUW B;  1UDI I;  1GD4 A;  1JZO A;  3AHW A;  3D79 A;  4WFO A;  1E3V A;  1NB3 I;  1X1X A;  1W6Y A;  3EN1 B;  3S67 A;  1N9E A;  2OQE A;  1RCL A;  3FG1 A;  3OWY A;  3NHX A;  1R4C A;  3DMC A;  3WA3 A;  1ZS7 A;  1NO3 A;  3D9R A;  1RN4 A;  5D81 A;  1R4Y A;  1T2I A;  4IIA A;  5KP1 A;  3LTA A;  2WOF A;  1JB5 A;  3MYT A;  3EJV A;  2CFG A;  1GY6 A;  2PZV A;  5IEO A;  3DH2 A;  1RRL A;  3OXA A;  1EUI C;  3HX8 A;  1VZZ A;  3I55 3;  1B2U A;  4XBT A;  3PYJ A;  2IY2 A;  3FG4 A;  3PCR A;  5IG4 A;  2YFJ B;  2GEY A;  3LXU X;  2H0I A;  1N8R 4;  3KSE D;  1CYV A;  3CNM A;  5IEP A;  1X1U A;  1EEJ A;  1W01 A;  4O8S A;  4WYK B;  1JBS A;  3NX0 A;  3DGN A;  1JNQ A;  3F8X A;  4HZB B;  3FSD A;  5EVH A;  1DMN A;  3HOH A;  1ZX2 A;  3K63 A;  3IPT A;  5AEW B;  1Q7Y 4;  1GOY A;  3A76 A;  3HI7 A;  1W6G A;  1B2S A;  1HYF A;  5D82 A;  3EB8 A;  4MMZ B;  1O7G B;  5AIH A;  3CXC 2;  1A90 A;  3AHS A;  4O02 B;  3S29 A;  2GBX B;  2W2C A;  4LGQ A;  1VQ4 3;  1FGR A;  3A5E A;  2HML B;  1FGO A;  1O7H B;  2H0G A;  2W04 A;  4XM4 A;  1N8Q A;  1X1Y A;  2CHC A;  1RKY A;  1OHS A;  4HKV B;  3URP A;  4H3U A;  1LQG C;  1TTO A;  1GOV A;  1MWT A;  2BMO B;  2D1W A;  3WR2 A;  3AGN A;  2D42 A;  3MG3 A;  4DKI A;  1VQ8 3;  1UGI A;  1ULI B;  1JN5 B;  5M18 A;  1Q82 4;  5KP3 A;  3LML A;  1YGE A;  3S27 A;  1M90 4;  4EC6 A;  2Z7A A;  4KT3 B;  1F8N A;  1RJO A;  2CFL A;  2Y74 A;  3UL6 A;  3EQQ B;  3JUP A;  1FUT A;  4HJL B;  4JRF A;  1BNI A;  4J5K A;  2ZDJ A;  7STD A;  1JV2 B;  5CK6 A;  2KF5 A;  1B27 A;  2CX0 A;  5IG3 A;  2M7O A;  4Q53 A;  4HBR A;  1JKG A;  2HMJ B;  2KF3 A;  1NU3 A;  3J7Y d;  3HK4 A;  3I56 3;  3CC2 3;  1SII A;  4X2H A;  4XBY A;  4QWT A;  4MMY B;  1V74 A;  2O9U X;  3VSY A;  4XDV A;  2F5W A;  5IG5 A;  2CIU A;  3SVA A;  3GWR A;  3JUQ A;  1YNV X;  3GZX B;  1QAF A;  1TFO A;  1UI8 A;  1V57 A;  2XFS A;  2RFR A;  1Q40 B;  1YGW A;  3V92 A;  3CME 3;  1RHL A;  1VQP 3;  4NPB A;  1I3F A;  3UL5 A;  1STD A;  3F9S A;  1MNL A;  4EV5 A;  4LEH A;  3ZG5 A;  3G6E 3;  1VQK 3;  3HIG A;  3F8H A;  2XH9 A;  3NV0 A;  1NWW A;  4STD A;  8CHO A;  2FXT A;  2RBI A;  4FMD A;  1IV7 A;  2WOH A;  3JUM A;  4AKZ A;  1US1 A;  2P09 A;  3EF8 A;  6RNT A;  4MMX B;  3GZY B;  4R9L A;  1CYU A;  3G16 A;  1KC8 4;  3VGN A;  4HAA A;  2KF6 A;  3LOY A;  3NBB A;  1G02 A;  1K28 A;  3T8U A;  3X3Z A;  3MHE A;  1J2B A;  1I70 A;  2OCT A;  3KSP A;  3KZT A;  4LSO A;  1LXE A;  4J8T A;  4RBN A;  1Q7H A;  3SXX A;  1BVI A;  1UCL A;  4HM5 B;  2P38 A;  1I2E A;  3DZL A;  1RDS A;  3EBT A;  1OGZ A;  1UI7 A;  4FR9 A;  2GU1 A;  3CPW 2;  1YI2 3;  5CXO A;  4LMI A;  2CG0 A;  3OWS A;  1BRI A;  1IT7 A;  3G8Z A;  3FH1 A;  1W7C A;  3X40 A;  1M9G A;  3T0U A;  2OOV C;  2BU4 A;  3ZG0 A;  1JB2 A;  1RGF A;  5RNT A;  3CCJ 3;  1B2M A;  2UX0 A;  2OTL 3;  3ALA A;  4TX4 A;  1BNS A;  5A0O B;  1A2V A;  1KD1 4;  3CCE 3;  2I9W A;  1FUS A;  2IMJ A;  3OX9 A;  4JF8 A;  1KQS 2;  3KFQ C;  3MG1 A;  5IEN A;  4N6U A;  1GMP A;  1IQX A;  1BNG A;  3OV4 A;  2OOV A;  2LQV A;  1O7M B;  2W9P A;  1W00 A;  5JBS A;  1IDP A;  4MJD A;  1BRS A;  1NJI 4;  4MEI A;  3WDG B;  1DVD A;  2E2T A;  1BRG A;  2AAD A;  4WYK A;  1Q81 4;  1T2H A;  2SBL A;  1BRH A;  2RSX A;  3WOE B;  4J9A A;  4X2O A;  4O2H A;  1AVK A;  1FGQ A;  4WP5 A;  4NHF A;  2J8X B;  3OWU A;  1W6C A;  2L4V A;  3CPO A;  3V99 A;  1C7H A;  3K0Z A;  1JB4 A;  1YIT 3;  7GSP A;  1GYB A;  1VQN 3;  3H3H A;  3BNB A;  1OAC A;  2YFL B;  4HOH A;  1W02 A;  4K1V A; 
#chains in the Genus database with same CATH homology
 3PXM A;  3FF2 A;  6STD A;  2CWT A;  1IVX A;  5AI1 A;  2BNG A;  1EG9 B;  1IQ8 A;  1ZO2 A;  2XRX B;  3X3Y A;  2CK3 H;  2QEX 3;  1Z1S A;  4RNZ A;  1JN5 A;  1VQL 3;  3DUK A;  3NQZ A;  3CCV 3;  1QMA A;  3K7C A;  5AEU B;  3IJE B;  3OW2 2;  1SPU A;  3WOF B;  1TUH A;  4HYZ A;  1WNH A;  4XDW A;  1OF5 B;  1D6Y A;  3EE1 A;  1A67 A;  4L7K A;  3LTD A;  4N6L A;  2RCD A;  2GXF A;  3G4S 3;  2CKF B;  3NM7 A;  3CU3 A;  5CF2 A;  3FG3 A;  3JVC A;  2WGO A;  1IQY A;  4EV2 A;  3DGL A;  4KVH A;  4WHA A;  2RGQ A;  3DXO A;  4XBX A;  3DY5 A;  2F98 A;  1ULJ B;  2LYX A;  3PCS A;  1GS3 A;  1Q40 A;  4H61 A;  1FA3 A;  2BMQ B;  1ROV A;  4L8O A;  1OPY A;  3UNL A;  1LNH A;  2W9Q A;  1QVG 2;  1N5H A;  2O3O A;  5STD A;  2XGL A;  5FW5 A;  2B1X B;  5G2G A;  3BNC A;  1OGX A;  3PZW A;  3VF1 A;  1T5Y A;  2XR8 B;  4L8P A;  3MKI A;  1VQ5 3;  1IVW A;  1RN7 A;  2K54 A;  3O8Y A;  2QA4 3;  2KXG A;  5AYS C;  1QJG A;  2BT3 A;  3ER7 A;  2K0M A;  3BB9 A;  4N6O B;  1OCV A;  2P05 A;  1ASK A;  1O7W B;  4CCV A;  3KN4 A;  3SOA A;  3G71 3;  1RRH A;  3T8N A;  3EC9 A;  1DMQ A;  3B4P A;  4FMB A;  2P0M A;  3B4O A;  3CCR 3;  1WMO A;  1O7N B;  2QIY A;  3X41 A;  3LH4 A;  1IVV A;  1ISK A;  2BMR B;  5AIG A;  1TIJ A;  1Y4K A;  1KSI A;  1D6Z A;  2C11 A;  1FUW A;  3MG2 A;  3CCM 3;  1YVB I;  1ROA A;  3LYG A;  1GY5 A;  3FGY A;  2HMO B;  1E3R A;  4AEQ A;  1AV4 A;  4RZM A;  3G0K A;  3RGA A;  2OTJ 3;  1AVL A;  2JDI H;  3KE7 A;  3X3X A;  2W56 B;  3Q1C A;  1QAK A;  5LC7 A;  2XSO B;  4BTX A;  1Q86 4;  2F99 A;  1U8C B;  2Q07 A;  3V98 A;  1VQ9 3;  3CC7 3;  4CDL A;  3U1W A;  3WA2 X;  1LVN A;  1NDO B;  3RDE A;  3CC4 3;  1VQ6 3;  4R9K A;  1KWI A;  4RNY A;  3H51 A;  2BO9 B;  4N3V A;  2CWU A;  1TU5 A;  2BHM A;  4N6V 0;  1FGT A;  4O3V A;  1QVF 2;  5ELJ A;  1DMM A;  2CG1 A;  1IV9 A;  1JJ2 2;  3KII A;  4EYC A;  4OK0 A;  5CLK A;  3FF0 A;  3U97 A;  1OHO A;  1QAL A;  3FLJ A;  1W2Z A;  3LT9 A;  4ZM8 A;  3STD A;  5IW9 A;  2ML5 A;  4N6M A;  3CCQ 3;  3LTB A;  3CCU 3;  3BND A;  5KP4 A;  2MC8 A;  3M8C A;  1OF5 A;  4FCJ A;  3CD6 3;  3S5C A;  3BNE A;  4N6N B;  1IT8 A;  2V1L A;  3E99 A;  1CEW I;  4HM7 B;  1M1X B;  1DYU A;  1G96 A;  2B24 B;  2CFD A;  2OQE C;  2IUJ A;  1EQK A;  3EBY A;  3SX1 A;  1DVC A;  3L0R A;  3GAX A;  1WMP A;  2OWP A;  3RGR A;  2A15 A;  5TGN A;  1N9J A;  3I0Y A;  1FGM A;  1VQO 3;  4FCM A;  4R4K A;  4FMC A;  3LZA A;  4KFF A;  5IER A;  5JPU A;  4HM4 B;  3N54 B;  1HU9 A;  1Q42 A;  3AMO B;  3UJM A;  2ZL8 A;  1HKX A;  1OH0 A;  5DRV A;  2W03 A;  3LTC A;  3KKG A;  4HM8 B;  3NBR A;  1GD3 A;  2GBW B;  3NM2 A;  1U5O A;  5AYR B;  3GRD A;  5EQL A;  2HMK B;  1EA2 A;  2W0Q A;  2IUK A;  4EXR A;  4R1K A;  3NXJ A;  1WTH A;  4KFD A;  2MF7 A;  3ECF A;  4K90 B;  3PS8 A;  1EKM A;  3MPH A;  1K73 4;  2XSH B;  4EBG A;  4GL6 A;  2INX A;  4HM3 B;  3HII A;  3K9M C;  1TFK A;  3GZB A;  1JRQ A;  4HM2 B;  3QRD A;  3FZW A;  2Z77 A;  4ORL A;  5I97 A;  1STF I;  2STD A;  2JQ5 A;  5FGO A;  1K8A 4;  3JUN A;  3F14 A;  1D6U A;  3K5T A;  1W4N A;  3EX9 A;  1GY7 A;  3SED A;  2CC3 A;  1O7P B;  4FCZ A;  4HM1 B;  3FCS B;  1A2K A;  3IMA B;  2XEP A;  2CW9 A;  5D83 A;  2ML6 A;  4BTW A;  3MWZ A;  4K61 A;  2W56 A;  1K41 A;  1WQL B;  4R80 A;  3LT8 A;  3SLU A;  5CF1 A;  3WOD G;  3NBJ A;  1YJ9 3;  3B8L A;  1NB5 I;  3F7S A;  4XB5 A;  1PU4 A;  4I4K A;  3CCL 3;  3CNX A;  1SJW A;  2GEX A;  1L5G B;  2W6J H;  3JUO A;  4FMA A;  4U13 A;  4WWU C;  1YHQ 3;  1VQ7 3;  1OUN A;  1IU7 A;  3SOY A;  3B7C A;  1WMN A;  2CFW A;  3D3L A;  2QGU A;  3F7X A;  2YFI B;  2E2U A;  5DRE A;  5EEO A;  2FGT A;  5AIF A;  4GB5 A;  2KRT A;  2XGN A;  3MSO A;  3PGB A;  2P0X A;  3TDG A;  4OVM A;  1UW1 A;  2XFT A;  3F40 A;  4HM6 B;  1TP6 A;  2IA7 A;  4KZ1 A;  1S72 3;  3Q90 A;  5BVB A;  1MOL A;  2R4I A;  3CCS 3;  4PEJ A;  2Y73 A;  2CH9 A;  5ELU A;  1E97 A;  1RKY A;  1M1K 4;  4NRE A;  1SIH A;  1S5A A;  1SQW A;  2WGQ A;  2Z76 A;  3N8B A;  3NUV A;  1LOX A;  2Z6B A;  3Q2P A;  3CMA 3;  5IF6 A;  4IPB A;  5AII A;  1JKG B;  3N9H A;  2KCD A;  3DGM A;  2CFK A;  4HVN A;  4AKY A;  1OHP A;  2E2V A;  2HMN B;  4G1M B;  2C10 A;  2WO0 A;  4N6T A;  3ROB A;  3DGO A;  4HM0 B;  1PFP A;  1AR0 A;  1YIJ 3;  1K9M 4;  2PNC A;  3DM8 A;  5LC6 A;  4K1U A;  1N5P A;  1CQS A;  2XF3 A;  3BLZ A;  4LZI A;  2CWV A;  3HZP A;  1IK3 A;  1YJN 3;  2F86 B;  2HMM B;  4OUQ A;  3AMO A;  3S28 A;  3NV0 B;  2GU3 A;  3FKA A;  3EN8 A;  3NQY A;  5BXQ A;  4HZ9 B;  4BTY A;  2FNQ A;  1W2B 2;  1UUV B;  5IG0 A;  3UB1 A;  1W5Z A;  3X42 A;  1BUQ A;  3QK9 A;  4IT7 A;  3EHC A;  3GZR A;  5JPP A;  2YX9 A;  1IVU A;  1YJW 3;  4KFE A;  3WMD A;  1UUW B;  1GD4 A;  4WFO A;  1E3V A;  1NB3 I;  1W6Y A;  3EN1 B;  3S67 A;  1N9E A;  2OQE A;  3FG1 A;  3OWY A;  3NHX A;  1R4C A;  3DMC A;  3WA3 A;  1NO3 A;  3D9R A;  5D81 A;  5KP1 A;  4IIA A;  3LTA A;  2WOF A;  1JB5 A;  3MYT A;  3EJV A;  2CFG A;  1GY6 A;  2PZV A;  5IEO A;  1RRL A;  3OXA A;  3HX8 A;  1VZZ A;  3I55 3;  4XBT A;  3PYJ A;  3PCR A;  3FG4 A;  5IG4 A;  2YFJ B;  2GEY A;  3LXU X;  1N8R 4;  3KSE D;  1CYV A;  3CNM A;  5IEP A;  4WYK B;  1W01 A;  4O8S A;  3NX0 A;  3DGN A;  1JNQ A;  3F8X A;  4HZB B;  3FSD A;  5EVH A;  1DMN A;  1ZX2 A;  3K63 A;  3IPT A;  5AEW B;  1Q7Y 4;  3A76 A;  1VQM 3;  3HI7 A;  1W6G A;  5D82 A;  3EB8 A;  4MMZ B;  1O7G B;  5AIH A;  3CXC 2;  1A90 A;  4O02 B;  3S29 A;  2GBX B;  2W2C A;  4LGQ A;  1VQ4 3;  1FGR A;  2HML B;  1FGO A;  1O7H B;  4XM4 A;  2W04 A;  1N8Q A;  2CHC A;  1OHS A;  4HKV B;  4H3U A;  2BMO B;  2D1W A;  2D42 A;  3MG3 A;  1VQ8 3;  1ULI B;  1JN5 B;  1Q82 4;  5KP3 A;  3LML A;  1YGE A;  3S27 A;  1M90 4;  4EC6 A;  2Z7A A;  1F8N A;  1RJO A;  2CFL A;  2Y74 A;  3UL6 A;  3EQQ B;  3JUP A;  4HJL B;  4JRF A;  2ZDJ A;  7STD A;  1JV2 B;  5CK6 A;  5IG3 A;  2M7O A;  4Q53 A;  4HBR A;  1JKG A;  2HMJ B;  1NU3 A;  3J7Y d;  3HK4 A;  3I56 3;  3CC2 3;  1SII A;  4X2H A;  4XBY A;  4QWT A;  4MMY B;  1V74 A;  2O9U X;  3VSY A;  4XDV A;  5IG5 A;  2CIU A;  3SVA A;  3GWR A;  3JUQ A;  3GZX B;  1QAF A;  1TFO A;  1UI8 A;  2XFS A;  2RFR A;  1Q40 B;  3V92 A;  3CME 3;  1VQP 3;  3UL5 A;  1STD A;  3F9S A;  1MNL A;  4EV5 A;  4LEH A;  3G6E 3;  1VQK 3;  3HIG A;  3F8H A;  2XH9 A;  3NV0 A;  1NWW A;  4STD A;  8CHO A;  2FXT A;  4FMD A;  1IV7 A;  2WOH A;  3JUM A;  4AKZ A;  1US1 A;  2P09 A;  3EF8 A;  4MMX B;  3GZY B;  4R9L A;  1CYU A;  3G16 A;  1KC8 4;  3VGN A;  3NBB A;  3LOY A;  1K28 A;  3T8U A;  3X3Z A;  3MHE A;  1J2B A;  3KSP A;  2OCT A;  3KZT A;  4LSO A;  1LXE A;  4J8T A;  4RBN A;  3SXX A;  4HM5 B;  2P38 A;  3DZL A;  3EBT A;  4FR9 A;  1OGZ A;  1UI7 A;  2GU1 A;  3CPW 2;  1YI2 3;  5CXO A;  4LMI A;  2CG0 A;  3OWS A;  3G8Z A;  1IT7 A;  3X40 A;  3FH1 A;  1W7C A;  1M9G A;  3T0U A;  2OOV C;  1JB2 A;  2OTL 3;  3CCJ 3;  2UX0 A;  3ALA A;  4TX4 A;  5A0O B;  1A2V A;  1KD1 4;  3CCE 3;  2I9W A;  2IMJ A;  3OX9 A;  4JF8 A;  1KQS 2;  3KFQ C;  3MG1 A;  5IEN A;  4N6U A;  3OV4 A;  1IQX A;  2OOV A;  2LQV A;  1O7M B;  2W9P A;  1W00 A;  5JBS A;  1IDP A;  4MJD A;  1NJI 4;  4MEI A;  3WDG B;  1DVD A;  2E2T A;  4WYK A;  1Q81 4;  2SBL A;  2RSX A;  3WOE B;  4J9A A;  4X2O A;  4O2H A;  1AVK A;  1FGQ A;  4WP5 A;  4NHF A;  3OWU A;  1W6C A;  2L4V A;  3CPO A;  3V99 A;  1C7H A;  3K0Z A;  1JB4 A;  1YIT 3;  1GYB A;  1VQN 3;  3H3H A;  3BNB A;  1OAC A;  2YFL B;  5HGR A;  1W02 A;  4K1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...