2GU3A

Ypmb protein from bacillus subtilis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
KEEGHEAAAAEAKKETDLAHVDQVETFVGKEKYYVVKGTDKKGTALYVWVPADKKAKILSKEAKEGISEDKAAKIIKDEGLVSKQKEVHLAREGNVLLWEVTYLDKEGQYSLSYVDFTTGKILKNITP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of YpmB protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
molecule keywords YpmB protein
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF17881 DUF5590 Domain of unknown function (DUF5590)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A01
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A02
2Y73A 1W6GA 2C10A 1IQXA 1US1A 2Y74A 3X40A 3SXXA 1IVUA 3PGBA 3X42A 1AVKA 3T0UA 3AMOB 4BTYA 1UI7A 3NBJA 4EV2A 1RKYA 3X41A 2C11A 2D1WA 5IW9A 3LOYA 1A2VA 1RJOA 2OQEC 1WMNA 1WMOA 2W0QA 2WGQA 1TU5A 2CFKA 3HIIA 1W2ZA 2CFDA 2WOHA 2CWUA 1PU4A 4BTWA 2K0MA 2WOFA 1AVLA 1D6YA 3X3YA 1AV4A 1OACA 2GU3A 2OQEA 2OOVC 2E2TA 1IQYA 2CFGA 3NQYA 2PNCA 3K5TA 3NQZA 1DYUA 1D6ZA 1IVVA 3SX1A 4EXRA 2CG0A 3HIGA 2CWVA 2YX9A 2ZL8A 1WMPA 2BT3A 1W6CA 3ALAA 1UI8A 2CG1A 1QAKA 3N9HA 1W7CA 2E2VA 2OOVA 1W5ZA 3KN4A 1EKMA 1QAFA 3AMOA 4KFDA 1IVXA 4KFEA 3WA2X 1N9EA 3KIIA 4KFFA 1IU7A 1W4NA 1JRQA 2WO0A 1SPUA 4BTXA 1D6UA 3NBBA 1KSIA 3MPHA 2CWTA 1QALA 2IA7A 3X3ZA 1SIHA 2CFLA 2E2UA 4EV5A 3X3XA 2CFWA 1IVWA 1SIIA 3WA3A 3HI7A 1LVNA
chains in the Genus database with same CATH superfamily
2BO9B 3MWZA 1FGRA 3CCE3 2Y74A 1ZO2A 1G96A 1IVUA 2P38A 3SOYA 3ZFZA 1BANA 1TJDA 1X1YA 8CHOA 1FGMA 3T0UA 1UCLA 3D4AA 5D83A 5G1LA 4BIRA 2J8XB 4HM4B 1GY5A 1N5HA 2W6JH 4N6UA 1JB4A 3OWUA 1R4CA 1A2PA 1W02A 5LC7A 4EV2A 1GY7A 1ZGXA 2C11A 1LRAA 1BSAA 2D1WA 1CH0A 3LOYA 1RJOA 4GHOA 3GAXA 2F4YA 4L8PA 3D9RA 3MG2A 4EC6A 5IEPA 2W0QA 4FR9A 1AR0A 1BNRA 3KE7A 4N6V0 3WDGB 3U1WA 1W01A 2CFDA 3PZWA 3OWSA 1RRLA 1RDSA 1DE3A 2XRXB 1CQSA 4XDWA 3CCQ3 2AADA 1J2BA 4BTWA 4MMYB 2K0MA 3CNMA 1BIRA 3X3YA 1JBSA 3FG3A 3EB8A 4NHFA 2L1SA 3EF8A 3F40A 3CXC2 1UGHI 5M19A 3DZLA 4RNTA 3VF1A 3KSPA 2MC8A 3GWRA 5KP1A 4HM0B 1DVDA 3K5TA 1ISKA 1AQZA 2HMNB 5BIRA 1E3RA 1TTOA 4HZ9B 1EG9B 4CJNA 2OTJ3 3Q3FA 4XB5A 3GZYB 3BU4A 4HOHA 4O8SA 5G1KA 1FW7A 4N6TA 4KT3B 1BSEA 4EXRA 3SX1A 2CG0A 1UCIA 3FF0A 3SEDA 2YX9A 3ECFA 1WMPA 1JKGA 1ROVA 4HM7B 1E97A 4KZ1A 1VQL3 1UI8A 4R4KA 3QK9A 4MMZB 3N9HA 1DETA 1W7CA 3WHOA 2RFRA 1YHQ3 3CCS3 1STDA 2SBLA 3OW22 1O7WB 1VQM3 3CC43 1QAFA 4HM1B 2M7OA 3AMOA 3LH4A 5IG0A 1VQQA 4KFDA 1RGKA 1IT7A 3PYJA 3WMDA 1A67A 1RCLA 3NV0A 4LZIA 2IUJA 3RNTA 1I2FA 1I3FA 2KXGA 1EA2A 3FZWA 4GB5A 2ZHXB 1K9M4 4K1VA 1GY6A 3NM7A 1EQKA 4BTXA 1JZOA 3LXUX 3CU3A 3DGLA 5AIIA 1I2GA 1D6UA 4FMAA 4XBTA 1N8QA 1RN4A 1RGLA 1BNJA 1OHPA 1LOVA 3SLUA 1JJ22 2GSPA 1V57A 2XEPA 5IEOA 2IA7A 3I0YA 3IMAB 4FMBA 5AEWB 1MWUA 2K54A 1NB5I 1Q814 2D42A 4K61A 3X3XA 4LYLB 4IPBA 1JN5A 5BVBA 1ZS7A 5EVHA 4LMIA 1IYYA 1ASKA 3DGNA 3KKGA 3CC73 2HMLB 6RNTA 3DY5A 1PY3A 1YJW3 1JB2A 2O3OA 3FSDA 5DREA 1I0XA 3T8NA 2C10A 4N6OB 4EYCA 1JB5A 2FXTA 1RMSA 3SYUA 4K90B 1US1A 7STDA 3X40A 1RSNA 4R9KA 2PZVA 1ULIB 2QIYA 1Q40B 4CDLA 3GZRA 1JBTA 2P09A 2SARA 3AGNA 3G0KA 4HM3B 2UUGC 4N6NB 5M1AA 1FGOA 1VQ63 1TIJA 4N3VA 5AI1A 3S67A 1IT8A 1T5YA 1T3BA 2ZDJA 3BNEA 2YFJB 4LGQA 3AMOB 4BTYA 1WQLB 1YGWA 1UI7A 4BL3A 3NBJA 1LXEA 3NM2A 1RGAA 2F56A 3WR2A 3RGRA 3X41A 1I2EA 1MGWA 6GSPA 4G1MB 2RGQA 2OQEC 4N6LA 1VQN3 2QA43 1ZX2A 4O2HA 4X2OA 3CME3 2WGQA 1TU5A 3HIIA 5D82A 1W2ZA 3UJMA 3F9SA 3J7Yd 2ZA4A 2WOHA 1I3IA 1BNEA 4WP5A 3FCSB 3LTDA 8RNTA 2KAAA 4XDVA 3WODG 4HZBB 3CPW2 4RNYA 1VQ43 2P0MA 3ROBA 1DMMA 3K9MC 1AVLA 3CCM3 1VQ53 3CCV3 1OACA 4ILFA 2GU3A 5M18A 2OQEA 4HM5B 2BHMA 1LOYA 2O9UX 3N8BA 4AEQA 1IDPA 5AIFA 3BIRA 1Q7Y4 1BNGA 3SVAA 1BSDA 1EUIC 2CFGA 2CW9A 1NJI4 1O7PB 1VZZA 3O8YA 4KVHA 1GMQA 1B20A 4HM2B 2CK3H 1LOWA 2UGIA 3Q2PA 4IIAA 1A2KA 3D3LA 1RGGA 1RRHA 3QRDA 4FMCA 1D6ZA 1M1XB 5KP3A 1LOXA 1YJ93 1RN7A 1F8NA 1OGZA 1TFKA 2QGUA 1FYSA 2GEXA 2ML6A 4IT7A 4LSOA 5FW5A 2XR8B 1YGEA 2W04A 2RNTA 5JPPA 2HMJB 1RGHA 3ZG0A 3AGOA 4WHAA 1BRKA 1W6YA 1Q864 2YFLB 7RNTA 3LZAA 5HGRA 1GMRA 5CK6A 1B27A 1W5ZA 3KN4A 2OOVA 1BRSA 1EKMA 3MYTA 3MG1A 1K28A 4X2HA 3CCU3 4O02B 2W56B 3A5EA 3CCR3 4KFEA 1VQ93 1MWTA 1IV9A 4WYKA 4BU4A 4J5KA 4KFFA 1HKXA 3B7CA 1BGSA 1O7NB 1QMAA 4FCJA 4R1KA 1IU7A 1LNIA 3HOHA 3JUPA 4XBYA 3DUKA 1W4NA 2KRTA 2W03A 3S29A 2KF6A 1SPUA 3Q90A 1EEJA 4MMXB 4QWTA 7GSPA 3CCJ3 2GU1A 1JZDA 4FMDA 1UW1A 1RN1A 3CNXA 4HM8B 3HZPA 1K8A4 1FZUA 1TUHA 2A15A 3MPHA 1NWWA 2Z6BA 3KFQC 5CF1A 1SIHA 4FCMA 4WYKB 1NNVA 1E3VA 1BSBA 1N5PA 1BSCA 2E2UA 2CKFB 2HMKB 4MEIA 4U13A 1OHOA 2W9QA 2XGLA 1BRHA 4O3VA 1GS3A 1W00A 2H0GA 3UB1A 1GSPA 1Z1SA 2OTL3 2ML5A 4I4KA 3PS8A 2KF3A 1OHSA 3VSYA 3WOFB 4MJDA 1FA3A 1B2ZA 2KF4A 3OXAA 2Y73A 1W6GA 1RGFA 3I553 1PFPA 1UCJA 2CX1A 3NUVA 1BUJA 3T8UA 2HMOB 1C54A 3DGYA 3DMCA 1BRIA 1UGIA 2CX0A 2UX0A 5CXOA 1GOYA 3MG3A 1N8R4 3DGMA 2BNGA 5EEOA 1TRPA 2BMQB 1MGRA 4LEHA 3NX0A 1VQK3 3FLJA 3NV0B 1SQWA 4H61A 1BU4A 2FGTA 2C4BA 3RDEA 4K1UA 1B2MA 3LMLA 3K63A 3F8XA 3PCRA 4L8OA 1WMNA 3FF2A 1M1K4 3EN8A 1FGQA 2WGOA 3EQQB 3EX9A 2IY2A 3VGNA 3GZXB 1B2UA 1X1XA 3DGOA 1HYFA 3B8LA 2CWUA 1DMNA 5BXQA 1Q7HA 1UUWB 1ULJB 1JN5B 3E99A 1T2HA 4JF8A 1PU4A 1BRNL 2CC3A 1IV7A 2WOFA 2IUKA 3G8ZA 1Q9EA 3LYGA 2FNQA 1QVF2 1RNBA 1TFOA 1Q824 1MWRA 3S5CA 2RSXA 3KSED 3DXOA 3HK4A 1BRGA 2JQ5A 4Q53A 4EW5A 5KP4A 5TGNA 2I9WA 2XSOB 1R4YA 1RLSA 2Z7AA 3NQZA 1I0VA 1HU9A 4TX4A 3DH2A 3GRDA 5AIHA 3UNLA 1G02A 1BNFA 1OGXA 2GEYA 1M9GA 3FKAA 3UL5A 1G0TA 1C7HA 1UUGB 3LTCA 1IVVA 1RCKA 5AIGA 1BNSA 1O7HB 2CWVA 2ZL8A 3HIGA 3JUNA 3NHXA 1JBRA 1OCVA 4AKYA 2BT3A 1RGCA 2CH9A 3EC9A 3EE1A 1K41A 1O7MB 1YI23 2R4IA 3ALAA 3G16A 3MHEA 3G713 1TRQA 3FG1A 1SJWA 2CG1A 1QAKA 1GYBA 2E2VA 5JPUA 3I563 5AEUB 1GOUA 2W2CA 3A76A 3LT8A 1VQ83 1V58A 3WA2X 1VQO3 1N9EA 3KIIA 4JRFA 4OK0A 2XFTA 1DVCA 3H51A 1OF5A 5IG3A 4I5QA 1U5OA 4J9AA 2AAEA 1BVIA 3EN1B 1QJGA 2R41A 2WO0A 4NREA 3V99A 1YIJ3 1CYUA 4XBXA 1KC84 4HYZA 1MNLA 3DM8A 3GSPA 2P05A 3SOAA 1WNHA 2GXFA 3AHSA 4DKIA 3CD63 4H3UA 2GBWB 3D79A 2L4VA 2Z77A 3URPA 3V98A 3CMA3 1BRJA 5JBSA 5IF6A 2B1XB 3L0RA 1KSIA 2CWTA 2RCDA 1OPYA 3X3ZA 2JDIH 3M8CA 2H0HA 1OH0A 4EV5A 1MOLA 3KCHA 1X1WA 2CFWA 2IYJA 3K7CA 2V1LA 3ZG5A 1B3SA 1CEWI 1FUTA 3BNBA 2OCTA 1UDII 3WA3A 2LYXA 1N9JA 1VQP3 5AYRB 1BUQA 5CLKA 1RHLA 3RGAA 3NBRA 2BIRA 4RZMA 4WFOA 4L7KA 3U97A 4CCVA 1I8VA 1NDOB 2F98A 4HJLB 6STDA 1IQXA 2IMJA 3AHWA 3MKIA 2XF3A 1NO3A 3S27A 1NU3A 2HMMB 1AY7A 3B4OA 3SXXA 5HOHA 3PGBA 2KF5A 4PEJA 3EHCA 2F5MA 5BU4A 3X42A 1AVKA 3JVCA 2Q07A 5FGOA 3NXJA 3STDA 5D81A 2BMRB 1UUVB 1RKYA 3Q1CA 5RNTA 5IW9A 1M904 1CYVA 2GBXB 3JUOA 1A2VA 2YFIB 1FGTA 1BNIA 3IPTA 3LTAA 4RBNA 3IJEB 1WMOA 5G2GA 3G6E3 1YVSA 2CHCA 3BNDA 2F99A 3LT9A 4HAAA 2CFKA 3G4S3 1HZ1A 1NB3I 1KWIA 2XH9A 3OX9A 2BMOB 5A0OB 2XGNA 1IK3A 4N6MA 3OV4A 3EJVA 4GSPA 1UCKA 3K0ZA 1JNQA 4XM4A 1A90A 1D6YA 3UL6A 1OUNA 1AV4A 1Y4KA 2W56A 5CF2A 1T2IA 9RNTA 2OOVC 1GD3A 2MF7A 2E2TA 3JUMA 3CC23 2LQVA 1IQYA 3BNCA 1YJN3 3NQYA 3KZTA 4NPBA 2PNCA 3JUQA 3BLZA 3F7XA 3FG4A 2P0XA 4HBRA 1TP6A 1JKGB 1DYUA 5AYSC 3TDGA 2Z76A 2QEX3 1FUSA 3CPOA 3FH1A 1U8CB 4R80A 1W2B2 1RNTA 5IG4A 1KD14 3PXMA 3FGYA 4CPKA 1B2XA 4HVNA 1YNVX 1ROAA 3H3HA 1LQMB 4HKVB 4OUQA 4FCZA 3MSOA 2STDA 1W6CA 5STDA 3D5GA 4HM6B 2BU4A 1X1UA 3BB9A 3WOEB 4ZM8A 3V92A 3EBTA 1I70A 2H0IA 1BAOA 1FUWA 2XFSA 3GZBA 4WWUC 3F8HA 1DMQA 3F7SA 4J5GA 3HX8A 1GD4A 1RGEA 1BOXA 2RBIA 1L5GB 4R9LA 1IVXA 3N54B 1STFI 4J8TA 2XSHB 2W9PA 1YIT3 1WTHA 1VQ73 4OVMA 3ER7A 4GL6A 1B21A 1S5AA 1K734 1O7GB 3S28A 5IG5A 1IQ8A 3B4PA 1JRQA 2B24B 1YVBI 2F86B 4STDA 1RTUA 1SARA 2F5WA 5GSPA 5I97A 5IERA 3PCSA 1QVG2 1Q42A 1OF5B 1LNHA 3EBYA 4RNZA 1LQGC 1MWSA 3NBBA 1GOVA 2INXA 3CCL3 1B2SA 1QALA 3D5IA 1PYLA 2CFLA 2HOHA 2K3DA 2CIUA 1S723 5IENA 3F14A 5DRVA 1IVWA 4BL2A 4EBGA 1GMPA 1SIIA 3LTBA 2KCDA 5ELUA 2OWPA 4AKZA 1Q40A 3HI7A 5EQLA 3OWYA 5ELJA 5LC6A 1V74A 1KQS2 4ORLA 1JV2B 1LVNA
chains in the Genus database with same CATH topology
2BO9B 3MWZA 1FGRA 3CCE3 2Y74A 1ZO2A 1G96A 1IVUA 2P38A 3SOYA 8CHOA 1FGMA 3T0UA 5D83A 4HM4B 1GY5A 1N5HA 2W6JH 4N6UA 1JB4A 3OWUA 1R4CA 1W02A 5LC7A 4EV2A 1GY7A 2C11A 2D1WA 3LOYA 1RJOA 3GAXA 4L8PA 3D9RA 3MG2A 4EC6A 5IEPA 2W0QA 4FR9A 1AR0A 3KE7A 4N6V0 3WDGB 3U1WA 1W01A 2CFDA 3PZWA 3OWSA 1RRLA 2XRXB 1CQSA 4XDWA 3CCQ3 1J2BA 4BTWA 4MMYB 2K0MA 3CNMA 3X3YA 3FG3A 3EB8A 4NHFA 3F40A 3EF8A 3CXC2 3DZLA 3VF1A 3KSPA 2MC8A 3GWRA 5KP1A 4HM0B 1DVDA 3K5TA 1ISKA 2HMNB 1E3RA 4HZ9B 1EG9B 2OTJ3 1LVNA 4XB5A 3GZYB 4O8SA 4N6TA 4EXRA 3SX1A 2CG0A 3SEDA 3FF0A 2YX9A 3ECFA 1WMPA 1JKGA 1ROVA 4HM7B 1E97A 4KZ1A 1VQL3 1UI8A 4R4KA 3QK9A 4MMZB 3N9HA 1W7CA 2RFRA 1YHQ3 3CCS3 1STDA 2SBLA 3OW22 1O7WB 1VQM3 3CC43 1QAFA 4HM1B 2M7OA 3AMOA 3LH4A 5IG0A 4KFDA 1IT7A 3PYJA 3WMDA 1A67A 3NV0A 4LZIA 2IUJA 2KXGA 1EA2A 3FZWA 4GB5A 1K9M4 4K1VA 1GY6A 3NM7A 1EQKA 4BTXA 3LXUX 3CU3A 3DGLA 5AIIA 1D6UA 4FMAA 4XBTA 1N8QA 1OHPA 3SLUA 1JJ22 2XEPA 5IEOA 2IA7A 3I0YA 3IMAB 4FMBA 5AEWB 2K54A 1NB5I 1Q814 2D42A 4K61A 3X3XA 4IPBA 1JN5A 5BVBA 5EVHA 4LMIA 1ASKA 3DGNA 3KKGA 3CC73 2HMLB 3DY5A 1YJW3 2O3OA 1JB2A 3FSDA 5DREA 3T8NA 4EYCA 2C10A 4N6OB 1JB5A 2FXTA 4K90B 1US1A 7STDA 3X40A 4R9KA 2PZVA 1ULIB 2QIYA 1Q40B 4CDLA 3GZRA 2P09A 4N6NB 4HM3B 3G0KA 1VQ63 1FGOA 1TIJA 4N3VA 5AI1A 3S67A 1IT8A 1T5YA 2ZDJA 3BNEA 2YFJB 4LGQA 3AMOB 4BTYA 1WQLB 1UI7A 3NBJA 1LXEA 3NM2A 3RGRA 3X41A 4G1MB 2RGQA 2OQEC 4N6LA 1VQN3 2QA43 1ZX2A 4O2HA 4X2OA 3CME3 2WGQA 1TU5A 3HIIA 5D82A 1W2ZA 3UJMA 3F9SA 3J7Yd 2WOHA 4WP5A 3FCSB 3LTDA 4XDVA 3WODG 4HZBB 3CPW2 4RNYA 1VQ43 2P0MA 3ROBA 1DMMA 3K9MC 1AVLA 3CCM3 1VQ53 3CCV3 1OACA 2GU3A 2OQEA 4HM5B 2BHMA 3N8BA 2O9UX 4AEQA 1Q7Y4 1IDPA 5AIFA 3SVAA 2CW9A 2CFGA 1NJI4 1O7PB 1VZZA 3O8YA 4KVHA 4HM2B 2CK3H 3Q2PA 4IIAA 1A2KA 3D3LA 1RRHA 3QRDA 4FMCA 1D6ZA 1M1XB 5KP3A 1LOXA 1YJ93 1RN7A 1F8NA 1OGZA 1TFKA 2QGUA 2GEXA 4IT7A 2ML6A 4LSOA 5FW5A 2XR8B 1YGEA 2W04A 5JPPA 2HMJB 4WHAA 1W6YA 1Q864 2YFLB 3LZAA 5HGRA 5CK6A 1W5ZA 3KN4A 2OOVA 3CCU3 1EKMA 3MYTA 4X2HA 3MG1A 1K28A 4O02B 2W56B 3CCR3 4KFEA 1VQ93 1IV9A 4WYKA 4KFFA 1HKXA 3B7CA 1O7NB 1QMAA 4FCJA 4R1KA 1IU7A 3JUPA 4XBYA 3DUKA 1W4NA 2KRTA 2W03A 3S29A 1SPUA 3Q90A 4MMXB 4QWTA 3CCJ3 2GU1A 4FMDA 1UW1A 3CNXA 4HM8B 3HZPA 1K8A4 1TUHA 2A15A 3MPHA 1NWWA 2Z6BA 3KFQC 5CF1A 1SIHA 4FCMA 4WYKB 4MEIA 1E3VA 1N5PA 2E2UA 2CKFB 2HMKB 4U13A 1OHOA 2W9QA 2XGLA 4O3VA 1GS3A 1W00A 3UB1A 1Z1SA 2OTL3 2ML5A 4I4KA 3PS8A 1OHSA 3VSYA 3WOFB 4MJDA 1FA3A 3OXAA 2Y73A 1W6GA 3I553 1PFPA 3NUVA 3T8UA 2HMOB 3DMCA 2UX0A 5CXOA 3MG3A 1N8R4 3DGMA 2BNGA 5EEOA 2BMQB 4LEHA 3NX0A 1VQK3 3FLJA 3NV0B 1SQWA 4H61A 2FGTA 3RDEA 4K1UA 3LMLA 3K63A 3F8XA 3PCRA 4L8OA 1WMNA 3FF2A 1M1K4 3EN8A 1FGQA 2WGOA 3EQQB 3EX9A 3VGNA 3GZXB 3DGOA 3B8LA 2CWUA 1DMNA 5BXQA 1UUWB 3E99A 1ULJB 1JN5B 4JF8A 1PU4A 2CC3A 1IV7A 2WOFA 2IUKA 3G8ZA 3LYGA 2FNQA 1QVF2 1TFOA 1Q824 3S5CA 2RSXA 3KSED 3DXOA 3HK4A 2JQ5A 4Q53A 5KP4A 5TGNA 2I9WA 2XSOB 2Z7AA 3NQZA 1HU9A 3UNLA 4TX4A 3GRDA 5AIHA 1OGXA 2GEYA 1M9GA 3FKAA 3UL5A 1C7HA 3LTCA 1IVVA 5AIGA 3HIGA 1O7HB 2CWVA 2ZL8A 3JUNA 3NHXA 1OCVA 4AKYA 2BT3A 3EC9A 3EE1A 2CH9A 1K41A 1O7MB 1YI23 2R4IA 3ALAA 3G16A 3MHEA 3G713 3FG1A 1SJWA 2CG1A 1QAKA 1GYBA 2E2VA 5JPUA 3I563 5AEUB 2W2CA 3A76A 3LT8A 1VQ83 3WA2X 1VQO3 1N9EA 3KIIA 4JRFA 4OK0A 2XFTA 1DVCA 3H51A 1OF5A 5IG3A 1U5OA 4J9AA 3EN1B 1QJGA 2WO0A 4NREA 3V99A 1YIJ3 1CYUA 4XBXA 1KC84 4HYZA 1MNLA 3DM8A 2P05A 3SOAA 1WNHA 2GXFA 3CD63 4H3UA 2GBWB 2L4VA 2Z77A 3V98A 3CMA3 5JBSA 5IF6A 2B1XB 3L0RA 1KSIA 2CWTA 2RCDA 1OPYA 3X3ZA 2JDIH 3M8CA 1OH0A 4EV5A 1MOLA 2CFWA 3K7CA 2V1LA 1CEWI 3BNBA 2OCTA 3WA3A 2LYXA 1N9JA 1VQP3 5AYRB 1BUQA 5CLKA 3RGAA 3NBRA 4RZMA 4WFOA 4L7KA 3U97A 4CCVA 2F98A 1NDOB 4HJLB 6STDA 1IQXA 2IMJA 3MKIA 2XF3A 1NO3A 3S27A 1NU3A 2HMMB 3B4OA 3SXXA 3PGBA 4PEJA 3EHCA 3X42A 1AVKA 3JVCA 5FGOA 3NXJA 3STDA 5D81A 2BMRB 1UUVB 1RKYA 3Q1CA 1M904 5IW9A 1CYVA 2GBXB 3JUOA 1A2VA 2YFIB 1FGTA 3IPTA 3LTAA 5G2GA 4RBNA 3IJEB 1WMOA 3G6E3 2CHCA 3BNDA 3LT9A 2F99A 2CFKA 3G4S3 2XH9A 1NB3I 1KWIA 3OX9A 2BMOB 5A0OB 2XGNA 1IK3A 4N6MA 3OV4A 3EJVA 3K0ZA 1JNQA 4XM4A 1A90A 1D6YA 3UL6A 1OUNA 1AV4A 1Y4KA 2W56A 5CF2A 2OOVC 1GD3A 2MF7A 2E2TA 3JUMA 3CC23 2LQVA 1IQYA 3BNCA 1YJN3 3NQYA 3KZTA 2PNCA 3JUQA 3BLZA 3F7XA 3FG4A 2P0XA 4HBRA 1TP6A 1JKGB 1DYUA 5AYSC 3TDGA 2Z76A 2QEX3 3CPOA 3FH1A 1U8CB 4R80A 1W2B2 5IG4A 1KD14 3PXMA 3FGYA 4HVNA 1ROAA 3H3HA 4HKVB 4OUQA 4FCZA 3MSOA 2STDA 1W6CA 5STDA 4HM6B 4ZM8A 3BB9A 3WOEB 3V92A 3EBTA 1FUWA 2XFSA 3GZBA 4WWUC 3F8HA 1DMQA 3F7SA 3HX8A 1GD4A 1L5GB 4R9LA 1IVXA 3N54B 1STFI 4J8TA 2XSHB 2W9PA 1YIT3 1WTHA 1VQ73 4OVMA 3ER7A 4GL6A 1S5AA 1K734 1O7GB 3S28A 5IG5A 1IQ8A 3B4PA 1JRQA 2B24B 1YVBI 2F86B 4STDA 5I97A 5IERA 1QVG2 3PCSA 1Q42A 1OF5B 1LNHA 3EBYA 4RNZA 3NBBA 2INXA 3CCL3 1QALA 2CFLA 2CIUA 1S723 5IENA 3F14A 5DRVA 1IVWA 4EBGA 1SIIA 3LTBA 2KCDA 5ELUA 2OWPA 4AKZA 1Q40A 3HI7A 5EQLA 3OWYA 5ELJA 5LC6A 1V74A 1KQS2 4ORLA 1JV2B 2Q07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y73 A;  1W6G A;  2C10 A;  1IQX A;  1US1 A;  2Y74 A;  3X40 A;  3SXX A;  1IVU A;  3PGB A;  3X42 A;  1AVK A;  3T0U A;  3AMO B;  4BTY A;  1UI7 A;  3NBJ A;  4EV2 A;  1RKY A;  3X41 A;  2C11 A;  2D1W A;  5IW9 A;  3LOY A;  1A2V A;  1RJO A;  2OQE C;  1WMN A;  1WMO A;  2W0Q A;  2WGQ A;  1TU5 A;  2CFK A;  3HII A;  1W2Z A;  2CFD A;  2WOH A;  2CWU A;  1PU4 A;  4BTW A;  2K0M A;  2WOF A;  1AVL A;  1D6Y A;  3X3Y A;  1AV4 A;  1OAC A;  2GU3 A;  2OQE A;  2OOV C;  2E2T A;  1IQY A;  2CFG A;  3NQY A;  2PNC A;  3K5T A;  3NQZ A;  1DYU A;  1D6Z A;  1IVV A;  3SX1 A;  4EXR A;  2CG0 A;  3HIG A;  2CWV A;  2YX9 A;  2ZL8 A;  1WMP A;  2BT3 A;  1W6C A;  3ALA A;  1UI8 A;  2CG1 A;  1QAK A;  3N9H A;  1W7C A;  2E2V A;  2OOV A;  1W5Z A;  3KN4 A;  1EKM A;  1QAF A;  3AMO A;  4KFD A;  1IVX A;  4KFE A;  3WA2 X;  1N9E A;  3KII A;  4KFF A;  1IU7 A;  1W4N A;  1JRQ A;  2WO0 A;  1SPU A;  4BTX A;  1D6U A;  3NBB A;  1KSI A;  3MPH A;  2CWT A;  1QAL A;  2IA7 A;  3X3Z A;  1SIH A;  2CFL A;  2E2U A;  4EV5 A;  3X3X A;  2CFW A;  1IVW A;  1SII A;  3WA3 A;  3HI7 A;  1LVN A; 
#chains in the Genus database with same CATH topology
 2BO9 B;  3MWZ A;  1FGR A;  3CCE 3;  2Y74 A;  1ZO2 A;  1G96 A;  1IVU A;  2P38 A;  3SOY A;  3ZFZ A;  1BAN A;  1TJD A;  1X1Y A;  8CHO A;  1FGM A;  3T0U A;  1UCL A;  3D4A A;  5D83 A;  5G1L A;  4BIR A;  2J8X B;  4HM4 B;  1GY5 A;  1N5H A;  2W6J H;  4N6U A;  1JB4 A;  3OWU A;  1R4C A;  1A2P A;  1W02 A;  5LC7 A;  4EV2 A;  1GY7 A;  1ZGX A;  2C11 A;  1LRA A;  1BSA A;  2D1W A;  1CH0 A;  3LOY A;  1RJO A;  4GHO A;  3GAX A;  2F4Y A;  4L8P A;  3D9R A;  3MG2 A;  4EC6 A;  5IEP A;  2W0Q A;  4FR9 A;  1AR0 A;  1BNR A;  3KE7 A;  4N6V 0;  3WDG B;  3U1W A;  1W01 A;  2CFD A;  3PZW A;  3OWS A;  1RRL A;  1RDS A;  1DE3 A;  2XRX B;  1CQS A;  4XDW A;  3CCQ 3;  2AAD A;  1J2B A;  4BTW A;  4MMY B;  2K0M A;  3CNM A;  1BIR A;  3X3Y A;  1JBS A;  3FG3 A;  3EB8 A;  4NHF A;  2L1S A;  3EF8 A;  3F40 A;  3CXC 2;  1UGH I;  5M19 A;  3DZL A;  4RNT A;  3VF1 A;  3KSP A;  2MC8 A;  3GWR A;  5KP1 A;  4HM0 B;  1DVD A;  3K5T A;  1ISK A;  1AQZ A;  2HMN B;  5BIR A;  1E3R A;  1TTO A;  4HZ9 B;  1EG9 B;  4CJN A;  2OTJ 3;  3Q3F A;  4XB5 A;  3GZY B;  3BU4 A;  4HOH A;  4O8S A;  5G1K A;  1FW7 A;  4N6T A;  4KT3 B;  1BSE A;  4EXR A;  3SX1 A;  2CG0 A;  1UCI A;  3FF0 A;  3SED A;  2YX9 A;  3ECF A;  1WMP A;  1JKG A;  1ROV A;  4HM7 B;  1E97 A;  4KZ1 A;  1VQL 3;  1UI8 A;  4R4K A;  3QK9 A;  4MMZ B;  3N9H A;  1DET A;  1W7C A;  3WHO A;  2RFR A;  1YHQ 3;  3CCS 3;  1STD A;  2SBL A;  3OW2 2;  1O7W B;  1VQM 3;  3CC4 3;  1QAF A;  4HM1 B;  2M7O A;  3AMO A;  3LH4 A;  5IG0 A;  1VQQ A;  4KFD A;  1RGK A;  1IT7 A;  3PYJ A;  3WMD A;  1A67 A;  1RCL A;  3NV0 A;  4LZI A;  2IUJ A;  3RNT A;  1I2F A;  1I3F A;  2KXG A;  1EA2 A;  3FZW A;  4GB5 A;  2ZHX B;  1K9M 4;  4K1V A;  1GY6 A;  3NM7 A;  1EQK A;  4BTX A;  1JZO A;  3LXU X;  3CU3 A;  3DGL A;  5AII A;  1I2G A;  1D6U A;  4FMA A;  4XBT A;  1N8Q A;  1RN4 A;  1RGL A;  1BNJ A;  1OHP A;  1LOV A;  3SLU A;  1JJ2 2;  2GSP A;  1V57 A;  2XEP A;  5IEO A;  2IA7 A;  3I0Y A;  3IMA B;  4FMB A;  5AEW B;  1MWU A;  2K54 A;  1NB5 I;  1Q81 4;  2D42 A;  4K61 A;  3X3X A;  4LYL B;  4IPB A;  1JN5 A;  5BVB A;  1ZS7 A;  5EVH A;  4LMI A;  1IYY A;  1ASK A;  3DGN A;  3KKG A;  3CC7 3;  2HML B;  6RNT A;  3DY5 A;  1PY3 A;  1YJW 3;  1JB2 A;  2O3O A;  3FSD A;  5DRE A;  1I0X A;  3T8N A;  2C10 A;  4N6O B;  4EYC A;  1JB5 A;  2FXT A;  1RMS A;  3SYU A;  4K90 B;  1US1 A;  7STD A;  3X40 A;  1RSN A;  4R9K A;  2PZV A;  1ULI B;  2QIY A;  1Q40 B;  4CDL A;  3GZR A;  1JBT A;  2P09 A;  2SAR A;  3AGN A;  3G0K A;  4HM3 B;  2UUG C;  4N6N B;  5M1A A;  1FGO A;  1VQ6 3;  1TIJ A;  4N3V A;  5AI1 A;  3S67 A;  1IT8 A;  1T5Y A;  1T3B A;  2ZDJ A;  3BNE A;  2YFJ B;  4LGQ A;  3AMO B;  4BTY A;  1WQL B;  1YGW A;  1UI7 A;  4BL3 A;  3NBJ A;  1LXE A;  3NM2 A;  1RGA A;  2F56 A;  3WR2 A;  3RGR A;  3X41 A;  1I2E A;  1MGW A;  6GSP A;  4G1M B;  2RGQ A;  2OQE C;  4N6L A;  1VQN 3;  2QA4 3;  1ZX2 A;  4O2H A;  4X2O A;  3CME 3;  2WGQ A;  1TU5 A;  3HII A;  5D82 A;  1W2Z A;  3UJM A;  3F9S A;  3J7Y d;  2ZA4 A;  2WOH A;  1I3I A;  1BNE A;  4WP5 A;  3FCS B;  3LTD A;  8RNT A;  2KAA A;  4XDV A;  3WOD G;  4HZB B;  3CPW 2;  4RNY A;  1VQ4 3;  2P0M A;  3ROB A;  1DMM A;  3K9M C;  1AVL A;  3CCM 3;  1VQ5 3;  3CCV 3;  1OAC A;  4ILF A;  2GU3 A;  5M18 A;  2OQE A;  4HM5 B;  2BHM A;  1LOY A;  2O9U X;  3N8B A;  4AEQ A;  1IDP A;  5AIF A;  3BIR A;  1Q7Y 4;  1BNG A;  3SVA A;  1BSD A;  1EUI C;  2CFG A;  2CW9 A;  1NJI 4;  1O7P B;  1VZZ A;  3O8Y A;  4KVH A;  1GMQ A;  1B20 A;  4HM2 B;  2CK3 H;  1LOW A;  2UGI A;  3Q2P A;  4IIA A;  1A2K A;  3D3L A;  1RGG A;  1RRH A;  3QRD A;  4FMC A;  1D6Z A;  1M1X B;  5KP3 A;  1LOX A;  1YJ9 3;  1RN7 A;  1F8N A;  1OGZ A;  1TFK A;  2QGU A;  1FYS A;  2GEX A;  2ML6 A;  4IT7 A;  4LSO A;  5FW5 A;  2XR8 B;  1YGE A;  2W04 A;  2RNT A;  5JPP A;  2HMJ B;  1RGH A;  3ZG0 A;  3AGO A;  4WHA A;  1BRK A;  1W6Y A;  1Q86 4;  2YFL B;  7RNT A;  3LZA A;  5HGR A;  1GMR A;  5CK6 A;  1B27 A;  1W5Z A;  3KN4 A;  2OOV A;  1BRS A;  1EKM A;  3MYT A;  3MG1 A;  1K28 A;  4X2H A;  3CCU 3;  4O02 B;  2W56 B;  3A5E A;  3CCR 3;  4KFE A;  1VQ9 3;  1MWT A;  1IV9 A;  4WYK A;  4BU4 A;  4J5K A;  4KFF A;  1HKX A;  3B7C A;  1BGS A;  1O7N B;  1QMA A;  4FCJ A;  4R1K A;  1IU7 A;  1LNI A;  3HOH A;  3JUP A;  4XBY A;  3DUK A;  1W4N A;  2KRT A;  2W03 A;  3S29 A;  2KF6 A;  1SPU A;  3Q90 A;  1EEJ A;  4MMX B;  4QWT A;  7GSP A;  3CCJ 3;  2GU1 A;  1JZD A;  4FMD A;  1UW1 A;  1RN1 A;  3CNX A;  4HM8 B;  3HZP A;  1K8A 4;  1FZU A;  1TUH A;  2A15 A;  3MPH A;  1NWW A;  2Z6B A;  3KFQ C;  5CF1 A;  1SIH A;  4FCM A;  4WYK B;  1NNV A;  1E3V A;  1BSB A;  1N5P A;  1BSC A;  2E2U A;  2CKF B;  2HMK B;  4MEI A;  4U13 A;  1OHO A;  2W9Q A;  2XGL A;  1BRH A;  4O3V A;  1GS3 A;  1W00 A;  2H0G A;  3UB1 A;  1GSP A;  1Z1S A;  2OTL 3;  2ML5 A;  4I4K A;  3PS8 A;  2KF3 A;  1OHS A;  3VSY A;  3WOF B;  4MJD A;  1FA3 A;  1B2Z A;  2KF4 A;  3OXA A;  2Y73 A;  1W6G A;  1RGF A;  3I55 3;  1PFP A;  1UCJ A;  2CX1 A;  3NUV A;  1BUJ A;  3T8U A;  2HMO B;  1C54 A;  3DGY A;  3DMC A;  1BRI A;  1UGI A;  2CX0 A;  2UX0 A;  5CXO A;  1GOY A;  3MG3 A;  1N8R 4;  3DGM A;  2BNG A;  5EEO A;  1TRP A;  2BMQ B;  1MGR A;  4LEH A;  3NX0 A;  1VQK 3;  3FLJ A;  3NV0 B;  1SQW A;  4H61 A;  1BU4 A;  2FGT A;  2C4B A;  3RDE A;  4K1U A;  1B2M A;  3LML A;  3K63 A;  3F8X A;  3PCR A;  4L8O A;  1WMN A;  3FF2 A;  1M1K 4;  3EN8 A;  1FGQ A;  2WGO A;  3EQQ B;  3EX9 A;  2IY2 A;  3VGN A;  3GZX B;  1B2U A;  1X1X A;  3DGO A;  1HYF A;  3B8L A;  2CWU A;  1DMN A;  5BXQ A;  1Q7H A;  1UUW B;  1ULJ B;  1JN5 B;  3E99 A;  1T2H A;  4JF8 A;  1PU4 A;  1BRN L;  2CC3 A;  1IV7 A;  2WOF A;  2IUK A;  3G8Z A;  1Q9E A;  3LYG A;  2FNQ A;  1QVF 2;  1RNB A;  1TFO A;  1Q82 4;  1MWR A;  3S5C A;  2RSX A;  3KSE D;  3DXO A;  3HK4 A;  1BRG A;  2JQ5 A;  4Q53 A;  4EW5 A;  5KP4 A;  5TGN A;  2I9W A;  2XSO B;  1R4Y A;  1RLS A;  2Z7A A;  3NQZ A;  1I0V A;  1HU9 A;  4TX4 A;  3DH2 A;  3GRD A;  5AIH A;  3UNL A;  1G02 A;  1BNF A;  1OGX A;  2GEY A;  1M9G A;  3FKA A;  3UL5 A;  1G0T A;  1C7H A;  1UUG B;  3LTC A;  1IVV A;  1RCK A;  5AIG A;  1BNS A;  1O7H B;  2CWV A;  2ZL8 A;  3HIG A;  3JUN A;  3NHX A;  1JBR A;  1OCV A;  4AKY A;  2BT3 A;  1RGC A;  2CH9 A;  3EC9 A;  3EE1 A;  1K41 A;  1O7M B;  1YI2 3;  2R4I A;  3ALA A;  3G16 A;  3MHE A;  3G71 3;  1TRQ A;  3FG1 A;  1SJW A;  2CG1 A;  1QAK A;  1GYB A;  2E2V A;  5JPU A;  3I56 3;  5AEU B;  1GOU A;  2W2C A;  3A76 A;  3LT8 A;  1VQ8 3;  1V58 A;  3WA2 X;  1VQO 3;  1N9E A;  3KII A;  4JRF A;  4OK0 A;  2XFT A;  1DVC A;  3H51 A;  1OF5 A;  5IG3 A;  4I5Q A;  1U5O A;  4J9A A;  2AAE A;  1BVI A;  3EN1 B;  1QJG A;  2R41 A;  2WO0 A;  4NRE A;  3V99 A;  1YIJ 3;  1CYU A;  4XBX A;  1KC8 4;  4HYZ A;  1MNL A;  3DM8 A;  3GSP A;  2P05 A;  3SOA A;  1WNH A;  2GXF A;  3AHS A;  4DKI A;  3CD6 3;  4H3U A;  2GBW B;  3D79 A;  2L4V A;  2Z77 A;  3URP A;  3V98 A;  3CMA 3;  1BRJ A;  5JBS A;  5IF6 A;  2B1X B;  3L0R A;  1KSI A;  2CWT A;  2RCD A;  1OPY A;  3X3Z A;  2JDI H;  3M8C A;  2H0H A;  1OH0 A;  4EV5 A;  1MOL A;  3KCH A;  1X1W A;  2CFW A;  2IYJ A;  3K7C A;  2V1L A;  3ZG5 A;  1B3S A;  1CEW I;  1FUT A;  3BNB A;  2OCT A;  1UDI I;  3WA3 A;  2LYX A;  1N9J A;  1VQP 3;  5AYR B;  1BUQ A;  5CLK A;  1RHL A;  3RGA A;  3NBR A;  2BIR A;  4RZM A;  4WFO A;  4L7K A;  3U97 A;  4CCV A;  1I8V A;  1NDO B;  2F98 A;  4HJL B;  6STD A;  1IQX A;  2IMJ A;  3AHW A;  3MKI A;  2XF3 A;  1NO3 A;  3S27 A;  1NU3 A;  2HMM B;  1AY7 A;  3B4O A;  3SXX A;  5HOH A;  3PGB A;  2KF5 A;  4PEJ A;  3EHC A;  2F5M A;  5BU4 A;  3X42 A;  1AVK A;  3JVC A;  2Q07 A;  5FGO A;  3NXJ A;  3STD A;  5D81 A;  2BMR B;  1UUV B;  1RKY A;  3Q1C A;  5RNT A;  5IW9 A;  1M90 4;  1CYV A;  2GBX B;  3JUO A;  1A2V A;  2YFI B;  1FGT A;  1BNI A;  3IPT A;  3LTA A;  4RBN A;  3IJE B;  1WMO A;  5G2G A;  3G6E 3;  1YVS A;  2CHC A;  3BND A;  2F99 A;  3LT9 A;  4HAA A;  2CFK A;  3G4S 3;  1HZ1 A;  1NB3 I;  1KWI A;  2XH9 A;  3OX9 A;  2BMO B;  5A0O B;  2XGN A;  1IK3 A;  4N6M A;  3OV4 A;  3EJV A;  4GSP A;  1UCK A;  3K0Z A;  1JNQ A;  4XM4 A;  1A90 A;  1D6Y A;  3UL6 A;  1OUN A;  1AV4 A;  1Y4K A;  2W56 A;  5CF2 A;  1T2I A;  9RNT A;  2OOV C;  1GD3 A;  2MF7 A;  2E2T A;  3JUM A;  3CC2 3;  2LQV A;  1IQY A;  3BNC A;  1YJN 3;  3NQY A;  3KZT A;  4NPB A;  2PNC A;  3JUQ A;  3BLZ A;  3F7X A;  3FG4 A;  2P0X A;  4HBR A;  1TP6 A;  1JKG B;  1DYU A;  5AYS C;  3TDG A;  2Z76 A;  2QEX 3;  1FUS A;  3CPO A;  3FH1 A;  1U8C B;  4R80 A;  1W2B 2;  1RNT A;  5IG4 A;  1KD1 4;  3PXM A;  3FGY A;  4CPK A;  1B2X A;  4HVN A;  1YNV X;  1ROA A;  3H3H A;  1LQM B;  4HKV B;  4OUQ A;  4FCZ A;  3MSO A;  2STD A;  1W6C A;  5STD A;  3D5G A;  4HM6 B;  2BU4 A;  1X1U A;  3BB9 A;  3WOE B;  4ZM8 A;  3V92 A;  3EBT A;  1I70 A;  2H0I A;  1BAO A;  1FUW A;  2XFS A;  3GZB A;  4WWU C;  3F8H A;  1DMQ A;  3F7S A;  4J5G A;  3HX8 A;  1GD4 A;  1RGE A;  1BOX A;  2RBI A;  1L5G B;  4R9L A;  1IVX A;  3N54 B;  1STF I;  4J8T A;  2XSH B;  2W9P A;  1YIT 3;  1WTH A;  1VQ7 3;  4OVM A;  3ER7 A;  4GL6 A;  1B21 A;  1S5A A;  1K73 4;  1O7G B;  3S28 A;  5IG5 A;  1IQ8 A;  3B4P A;  1JRQ A;  2B24 B;  1YVB I;  2F86 B;  4STD A;  1RTU A;  1SAR A;  2F5W A;  5GSP A;  5I97 A;  5IER A;  3PCS A;  1QVG 2;  1Q42 A;  1OF5 B;  1LNH A;  3EBY A;  4RNZ A;  1LQG C;  1MWS A;  3NBB A;  1GOV A;  2INX A;  3CCL 3;  1B2S A;  1QAL A;  3D5I A;  1PYL A;  2CFL A;  2HOH A;  2K3D A;  2CIU A;  1S72 3;  5IEN A;  3F14 A;  5DRV A;  1IVW A;  4BL2 A;  4EBG A;  1GMP A;  1SII A;  3LTB A;  2KCD A;  5ELU A;  2OWP A;  4AKZ A;  1Q40 A;  3HI7 A;  5EQL A;  3OWY A;  5ELJ A;  5LC6 A;  1V74 A;  1KQS 2;  4ORL A;  1JV2 B;  1LVN A; 
#chains in the Genus database with same CATH homology
 2BO9 B;  3MWZ A;  1FGR A;  3CCE 3;  2Y74 A;  1ZO2 A;  1G96 A;  1IVU A;  2P38 A;  3SOY A;  8CHO A;  1FGM A;  3T0U A;  5D83 A;  4HM4 B;  1GY5 A;  1N5H A;  2W6J H;  4N6U A;  1JB4 A;  3OWU A;  1R4C A;  1W02 A;  5LC7 A;  4EV2 A;  1GY7 A;  2C11 A;  2D1W A;  3LOY A;  1RJO A;  3GAX A;  4L8P A;  3D9R A;  3MG2 A;  4EC6 A;  5IEP A;  2W0Q A;  4FR9 A;  1AR0 A;  3KE7 A;  4N6V 0;  3WDG B;  3U1W A;  1W01 A;  2CFD A;  3PZW A;  3OWS A;  1RRL A;  2XRX B;  1CQS A;  4XDW A;  3CCQ 3;  1J2B A;  4BTW A;  4MMY B;  2K0M A;  3CNM A;  3X3Y A;  3FG3 A;  3EB8 A;  4NHF A;  3F40 A;  3EF8 A;  3CXC 2;  3DZL A;  3VF1 A;  3KSP A;  2MC8 A;  3GWR A;  5KP1 A;  4HM0 B;  1DVD A;  3K5T A;  1ISK A;  2HMN B;  1E3R A;  4HZ9 B;  1EG9 B;  2OTJ 3;  1LVN A;  4XB5 A;  3GZY B;  4O8S A;  4N6T A;  4EXR A;  3SX1 A;  2CG0 A;  3SED A;  3FF0 A;  2YX9 A;  3ECF A;  1WMP A;  1JKG A;  1ROV A;  4HM7 B;  1E97 A;  4KZ1 A;  1VQL 3;  1UI8 A;  4R4K A;  3QK9 A;  4MMZ B;  3N9H A;  1W7C A;  2RFR A;  1YHQ 3;  3CCS 3;  1STD A;  2SBL A;  3OW2 2;  1O7W B;  1VQM 3;  3CC4 3;  1QAF A;  4HM1 B;  2M7O A;  3AMO A;  3LH4 A;  5IG0 A;  4KFD A;  1IT7 A;  3PYJ A;  3WMD A;  1A67 A;  3NV0 A;  4LZI A;  2IUJ A;  2KXG A;  1EA2 A;  3FZW A;  4GB5 A;  1K9M 4;  4K1V A;  1GY6 A;  3NM7 A;  1EQK A;  4BTX A;  3LXU X;  3CU3 A;  3DGL A;  5AII A;  1D6U A;  4FMA A;  4XBT A;  1N8Q A;  1OHP A;  3SLU A;  1JJ2 2;  2XEP A;  5IEO A;  2IA7 A;  3I0Y A;  3IMA B;  4FMB A;  5AEW B;  2K54 A;  1NB5 I;  1Q81 4;  2D42 A;  4K61 A;  3X3X A;  4IPB A;  1JN5 A;  5BVB A;  5EVH A;  4LMI A;  1ASK A;  3DGN A;  3KKG A;  3CC7 3;  2HML B;  3DY5 A;  1YJW 3;  2O3O A;  1JB2 A;  3FSD A;  5DRE A;  3T8N A;  4EYC A;  2C10 A;  4N6O B;  1JB5 A;  2FXT A;  4K90 B;  1US1 A;  7STD A;  3X40 A;  4R9K A;  2PZV A;  1ULI B;  2QIY A;  1Q40 B;  4CDL A;  3GZR A;  2P09 A;  4N6N B;  4HM3 B;  3G0K A;  1VQ6 3;  1FGO A;  1TIJ A;  4N3V A;  5AI1 A;  3S67 A;  1IT8 A;  1T5Y A;  2ZDJ A;  3BNE A;  2YFJ B;  4LGQ A;  3AMO B;  4BTY A;  1WQL B;  1UI7 A;  3NBJ A;  1LXE A;  3NM2 A;  3RGR A;  3X41 A;  4G1M B;  2RGQ A;  2OQE C;  4N6L A;  1VQN 3;  2QA4 3;  1ZX2 A;  4O2H A;  4X2O A;  3CME 3;  2WGQ A;  1TU5 A;  3HII A;  5D82 A;  1W2Z A;  3UJM A;  3F9S A;  3J7Y d;  2WOH A;  4WP5 A;  3FCS B;  3LTD A;  4XDV A;  3WOD G;  4HZB B;  3CPW 2;  4RNY A;  1VQ4 3;  2P0M A;  3ROB A;  1DMM A;  3K9M C;  1AVL A;  3CCM 3;  1VQ5 3;  3CCV 3;  1OAC A;  2GU3 A;  2OQE A;  4HM5 B;  2BHM A;  3N8B A;  2O9U X;  4AEQ A;  1Q7Y 4;  1IDP A;  5AIF A;  3SVA A;  2CW9 A;  2CFG A;  1NJI 4;  1O7P B;  1VZZ A;  3O8Y A;  4KVH A;  4HM2 B;  2CK3 H;  3Q2P A;  4IIA A;  1A2K A;  3D3L A;  1RRH A;  3QRD A;  4FMC A;  1D6Z A;  1M1X B;  5KP3 A;  1LOX A;  1YJ9 3;  1RN7 A;  1F8N A;  1OGZ A;  1TFK A;  2QGU A;  2GEX A;  4IT7 A;  2ML6 A;  4LSO A;  5FW5 A;  2XR8 B;  1YGE A;  2W04 A;  5JPP A;  2HMJ B;  4WHA A;  1W6Y A;  1Q86 4;  2YFL B;  3LZA A;  5HGR A;  5CK6 A;  1W5Z A;  3KN4 A;  2OOV A;  3CCU 3;  1EKM A;  3MYT A;  4X2H A;  3MG1 A;  1K28 A;  4O02 B;  2W56 B;  3CCR 3;  4KFE A;  1VQ9 3;  1IV9 A;  4WYK A;  4KFF A;  1HKX A;  3B7C A;  1O7N B;  1QMA A;  4FCJ A;  4R1K A;  1IU7 A;  3JUP A;  4XBY A;  3DUK A;  1W4N A;  2KRT A;  2W03 A;  3S29 A;  1SPU A;  3Q90 A;  4MMX B;  4QWT A;  3CCJ 3;  2GU1 A;  4FMD A;  1UW1 A;  3CNX A;  4HM8 B;  3HZP A;  1K8A 4;  1TUH A;  2A15 A;  3MPH A;  1NWW A;  2Z6B A;  3KFQ C;  5CF1 A;  1SIH A;  4FCM A;  4WYK B;  4MEI A;  1E3V A;  1N5P A;  2E2U A;  2CKF B;  2HMK B;  4U13 A;  1OHO A;  2W9Q A;  2XGL A;  4O3V A;  1GS3 A;  1W00 A;  3UB1 A;  1Z1S A;  2OTL 3;  2ML5 A;  4I4K A;  3PS8 A;  1OHS A;  3VSY A;  3WOF B;  4MJD A;  1FA3 A;  3OXA A;  2Y73 A;  1W6G A;  3I55 3;  1PFP A;  3NUV A;  3T8U A;  2HMO B;  3DMC A;  2UX0 A;  5CXO A;  3MG3 A;  1N8R 4;  3DGM A;  2BNG A;  5EEO A;  2BMQ B;  4LEH A;  3NX0 A;  1VQK 3;  3FLJ A;  3NV0 B;  1SQW A;  4H61 A;  2FGT A;  3RDE A;  4K1U A;  3LML A;  3K63 A;  3F8X A;  3PCR A;  4L8O A;  1WMN A;  3FF2 A;  1M1K 4;  3EN8 A;  1FGQ A;  2WGO A;  3EQQ B;  3EX9 A;  3VGN A;  3GZX B;  3DGO A;  3B8L A;  2CWU A;  1DMN A;  5BXQ A;  1UUW B;  3E99 A;  1ULJ B;  1JN5 B;  4JF8 A;  1PU4 A;  2CC3 A;  1IV7 A;  2WOF A;  2IUK A;  3G8Z A;  3LYG A;  2FNQ A;  1QVF 2;  1TFO A;  1Q82 4;  3S5C A;  2RSX A;  3KSE D;  3DXO A;  3HK4 A;  2JQ5 A;  4Q53 A;  5KP4 A;  5TGN A;  2I9W A;  2XSO B;  2Z7A A;  3NQZ A;  1HU9 A;  3UNL A;  4TX4 A;  3GRD A;  5AIH A;  1OGX A;  2GEY A;  1M9G A;  3FKA A;  3UL5 A;  1C7H A;  3LTC A;  1IVV A;  5AIG A;  3HIG A;  1O7H B;  2CWV A;  2ZL8 A;  3JUN A;  3NHX A;  1OCV A;  4AKY A;  2BT3 A;  3EC9 A;  3EE1 A;  2CH9 A;  1K41 A;  1O7M B;  1YI2 3;  2R4I A;  3ALA A;  3G16 A;  3MHE A;  3G71 3;  3FG1 A;  1SJW A;  2CG1 A;  1QAK A;  1GYB A;  2E2V A;  5JPU A;  3I56 3;  5AEU B;  2W2C A;  3A76 A;  3LT8 A;  1VQ8 3;  3WA2 X;  1VQO 3;  1N9E A;  3KII A;  4JRF A;  4OK0 A;  2XFT A;  1DVC A;  3H51 A;  1OF5 A;  5IG3 A;  1U5O A;  4J9A A;  3EN1 B;  1QJG A;  2WO0 A;  4NRE A;  3V99 A;  1YIJ 3;  1CYU A;  4XBX A;  1KC8 4;  4HYZ A;  1MNL A;  3DM8 A;  2P05 A;  3SOA A;  1WNH A;  2GXF A;  3CD6 3;  4H3U A;  2GBW B;  2L4V A;  2Z77 A;  3V98 A;  3CMA 3;  5JBS A;  5IF6 A;  2B1X B;  3L0R A;  1KSI A;  2CWT A;  2RCD A;  1OPY A;  3X3Z A;  2JDI H;  3M8C A;  1OH0 A;  4EV5 A;  1MOL A;  2CFW A;  3K7C A;  2V1L A;  1CEW I;  3BNB A;  2OCT A;  3WA3 A;  2LYX A;  1N9J A;  1VQP 3;  5AYR B;  1BUQ A;  5CLK A;  3RGA A;  3NBR A;  4RZM A;  4WFO A;  4L7K A;  3U97 A;  4CCV A;  2F98 A;  1NDO B;  4HJL B;  6STD A;  1IQX A;  2IMJ A;  3MKI A;  2XF3 A;  1NO3 A;  3S27 A;  1NU3 A;  2HMM B;  3B4O A;  3SXX A;  3PGB A;  4PEJ A;  3EHC A;  3X42 A;  1AVK A;  3JVC A;  5FGO A;  3NXJ A;  3STD A;  5D81 A;  2BMR B;  1UUV B;  1RKY A;  3Q1C A;  1M90 4;  5IW9 A;  1CYV A;  2GBX B;  3JUO A;  1A2V A;  2YFI B;  1FGT A;  3IPT A;  3LTA A;  5G2G A;  4RBN A;  3IJE B;  1WMO A;  3G6E 3;  2CHC A;  3BND A;  3LT9 A;  2F99 A;  2CFK A;  3G4S 3;  2XH9 A;  1NB3 I;  1KWI A;  3OX9 A;  2BMO B;  5A0O B;  2XGN A;  1IK3 A;  4N6M A;  3OV4 A;  3EJV A;  3K0Z A;  1JNQ A;  4XM4 A;  1A90 A;  1D6Y A;  3UL6 A;  1OUN A;  1AV4 A;  1Y4K A;  2W56 A;  5CF2 A;  2OOV C;  1GD3 A;  2MF7 A;  2E2T A;  3JUM A;  3CC2 3;  2LQV A;  1IQY A;  3BNC A;  1YJN 3;  3NQY A;  3KZT A;  2PNC A;  3JUQ A;  3BLZ A;  3F7X A;  3FG4 A;  2P0X A;  4HBR A;  1TP6 A;  1JKG B;  1DYU A;  5AYS C;  3TDG A;  2Z76 A;  2QEX 3;  3CPO A;  3FH1 A;  1U8C B;  4R80 A;  1W2B 2;  5IG4 A;  1KD1 4;  3PXM A;  3FGY A;  4HVN A;  1ROA A;  3H3H A;  4HKV B;  4OUQ A;  4FCZ A;  3MSO A;  2STD A;  1W6C A;  5STD A;  4HM6 B;  4ZM8 A;  3BB9 A;  3WOE B;  3V92 A;  3EBT A;  1FUW A;  2XFS A;  3GZB A;  4WWU C;  3F8H A;  1DMQ A;  3F7S A;  3HX8 A;  1GD4 A;  1L5G B;  4R9L A;  1IVX A;  3N54 B;  1STF I;  4J8T A;  2XSH B;  2W9P A;  1YIT 3;  1WTH A;  1VQ7 3;  4OVM A;  3ER7 A;  4GL6 A;  1S5A A;  1K73 4;  1O7G B;  3S28 A;  5IG5 A;  1IQ8 A;  3B4P A;  1JRQ A;  2B24 B;  1YVB I;  2F86 B;  4STD A;  5I97 A;  5IER A;  1QVG 2;  3PCS A;  1Q42 A;  1OF5 B;  1LNH A;  3EBY A;  4RNZ A;  3NBB A;  2INX A;  3CCL 3;  1QAL A;  2CFL A;  2CIU A;  1S72 3;  5IEN A;  3F14 A;  5DRV A;  1IVW A;  4EBG A;  1SII A;  3LTB A;  2KCD A;  5ELU A;  2OWP A;  4AKZ A;  1Q40 A;  3HI7 A;  5EQL A;  3OWY A;  5ELJ A;  5LC6 A;  1V74 A;  1KQS 2;  4ORL A;  1JV2 B;  2Q07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...