2GU3A

Ypmb protein from bacillus subtilis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
KEEGHEAAAAEAKKETDLAHVDQVETFVGKEKYYVVKGTDKKGTALYVWVPADKKAKILSKEAKEGISEDKAAKIIKDEGLVSKQKEVHLAREGNVLLWEVTYLDKEGQYSLSYVDFTTGKILKNITP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YpmB protein
publication title X-ray crystal structure of YpmB protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF17881 DUF5590 Domain of unknown function (DUF5590)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A01
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A02
2PNCA 4EV5A 3X3YA 3ALAA 1UI8A 1IVUA 1LVNA 2BT3A 2CG1A 3X41A 2CFWA 1D6YA 1UI7A 2OOVA 1QAFA 4KFDA 3AMOA 1OACA 3NBBA 1AV4A 1IVVA 2CWUA 5IW9A 4EV2A 1WMPA 1IVWA 1D6UA 3KN4A 3WA3A 2Y73A 1IQYA 2CFDA 2ZL8A 3X3ZA 4KFFA 2E2VA 2C10A 2E2UA 4BTWA 1US1A 1AVKA 1RKYA 2CFKA 1W6CA 1SIIA 3HIGA 3WA2X 2WGQA 1IVXA 1EKMA 2WO0A 1W5ZA 2CFLA 2E2TA 2CWTA 2D1WA 1TU5A 1D6ZA 1WMOA 3T0UA 1QAKA 2K0MA 1SIHA 1N9EA 2OQEA 1DYUA 3HI7A 1IQXA 2WOHA 1W4NA 2C11A 3MPHA 4BTXA 1SPUA 1AVLA 3AMOB 1JRQA 2CG0A 4BTYA 2WOFA 3NQZA 1W2ZA 2CFGA 2IA7A 1IU7A 2CWVA 4KFEA 3NQYA 3LOYA 2OOVC 3HIIA 3NBJA 3X3XA 3PGBA 4EXRA 2W0QA 2YX9A 1KSIA 1WMNA 2Y74A 3KIIA 3N9HA 3SXXA 1W7CA 1RJOA 2GU3A 3X42A 3K5TA 3X40A 3SX1A 1PU4A 1QALA 1A2VA 1W6GA 2OQEC
chains in the Genus database with same CATH superfamily
1VQQA 2F5WA 4N6TA 1I3IA 3FF2A 1B2SA 4AKYA 2OCTA 4HM4B 3T8UA 2BT3A 3H51A 2HMMB 1LNIA 2P0MA 3URPA 5LC6A 1RNBA 1O7MB 4LSOA 1WQLB 1D6YA 1UI7A 4J5GA 4JRFA 3EX9A 4HOHA 4KFDA 4HJLB 2MC8A 5D83A 3S29A 3CC73 3B4PA 1FGQA 4PEJA 4WYKB 3NBBA 2W03A 5BIRA 3WODG 1AV4A 1IVVA 2CWUA 3AHSA 3EHCA 1YGEA 3LTCA 1IVWA 1BNFA 3KN4A 1VQ63 5GSPA 1BRIA 1STDA 2Y73A 1LOWA 4XBTA 2L4VA 1IQYA 1K28A 4FMAA 3X3ZA 1UGIA 1GMQA 5IG5A 2E2VA 1RGHA 4N3VA 1ZX2A 1UCKA 4ZM8A 2CH9A 4HM6B 5BXQA 5AEWB 1BANA 1I2FA 2W9PA 4HKVB 3WMDA 2GU1A 2GBXB 1W6YA 3G4S3 1OGXA 3KKGA 1Q824 4N6UA 1O7HB 2P05A 2JDIH 4J8TA 1FYSA 1FGRA 2LQVA 2XRXB 3MG2A 2F5MA 4XBXA 4BU4A 1N8R4 1JN5A 1MNLA 3EQQB 1SQWA 4HM3B 1AVKA 1JZDA 3JUNA 1SIIA 1VQ73 5HOHA 2O3OA 2YFLB 3WA2X 3DMCA 1OHPA 1EKMA 3LYGA 3Q2PA 3CCJ3 1MWSA 3NUVA 3G8ZA 2E2TA 3WR2A 1OF5A 1TFKA 2H0GA 1I8VA 1RMSA 3K7CA 2YFIB 3OWYA 4N6LA 1ZS7A 2KF5A 5DRVA 2KAAA 3ZFZA 1DE3A 1U5OA 3OXAA 1UCLA 3PXMA 4HZBB 1BSCA 1DYUA 2SBLA 2CK3H 5IG4A 5KP3A 4G1MB 2K54A 1IQXA 5AYSC 1T2HA 1YVSA 3FG1A 1BVIA 2WOHA 2C11A 1B2ZA 1R4YA 1ZGXA 3FCSB 3FSDA 3KCHA 3MPHA 3MWZA 3IMAB 4K61A 3VF1A 4L7KA 3UJMA 3AMOB 3CPW2 5G1KA 5JBSA 1V57A 4X2OA 4BTYA 3AGOA 1M1XB 3WOFB 2GSPA 2BIRA 2CFGA 2IMJA 2CWVA 3GZBA 4KFEA 4AKZA 2ML6A 1G0TA 3SEDA 3PCSA 3K0ZA 1RRHA 1AR0A 2HMNB 3EN1B 2B24B 3HX8A 1TRQA 4HM1B 5IERA 5RNTA 3PGBA 3UB1A 2B1XB 6RNTA 4GB5A 1KSIA 5EEOA 1O7NB 4IT7A 3A5EA 3KSPA 3L0RA 1HZ1A 3LZAA 1BSDA 1HKXA 4R1KA 4CDLA 3X40A 2RBIA 1CYUA 4O02B 1PY3A 1LNHA 4O3VA 1JKGA 2RFRA 1W6GA 1RGEA 5KP1A 3DGNA 4RNZA 1RGAA 5AIIA 1V74A 2MF7A 3LXUX 3NBRA 1GOVA 2FXTA 4LYLB 1A2PA 3GZRA 2PNCA 1N9JA 5EQLA 3X3YA 1FUSA 1LQMB 1UI8A 1IVUA 1M904 1LVNA 4R4KA 1UUWB 1W02A 5G2GA 4LGQA 2L1SA 4R9LA 2XR8B 4K90B 1FUTA 1Q864 3PCRA 3F7SA 3SYUA 3NHXA 1VQ93 2XH9A 5IENA 3EN8A 3LTBA 2W2CA 3CD63 3GSPA 2Z76A 3WOEB 1W01A 3IJEB 1TIJA 3DXOA 3AMOA 1S5AA 1NB3I 1EA2A 1RGGA 3D79A 3KSED 1GY7A 4GHOA 5AYRB 3F8HA 3FZWA 4MJDA 3G16A 2BU4A 5IW9A 1VQK3 2H0IA 3OV4A 3CCV3 1VQ43 1N8QA 3DGOA 1RCKA 3CCL3 1D6UA 1RDSA 1GMRA 3EBTA 4ILFA 3WA3A 2BMRB 4LEHA 1NJI4 1A2KA 3LH4A 1YI23 2CFDA 1J2BA 1A90A 3V98A 4KFFA 4L8OA 1GMPA 3F7XA 1L5GB 1YIJ3 3EBYA 1Q7Y4 4XDVA 1K41A 3LTAA 1BAOA 1BRNL 2KF4A 3UL5A 1CH0A 2KF3A 1W2B2 1G96A 3S27A 1X1YA 2V1LA 2E2UA 1YVBI 4MMZB 4EW5A 3MSOA 3BIRA 3T8NA 4BTWA 1KC84 2AAEA 3JVCA 1RGLA 1JBTA 1VQL3 1OH0A 2XGNA 2Z7AA 3DZLA 2K3DA 4WFOA 5ELUA 1DMMA 2CHCA 2W56A 2CFKA 1FGTA 3CPOA 1NB5I 3DY5A 4J5KA 2XFSA 4OK0A 1OHSA 1YGWA 2GXFA 4OUQA 1TJDA 2XEPA 3SVAA 2WO0A 1W5ZA 2IUKA 4LZIA 3OWSA 7RNTA 3ROBA 1X1WA 5AIGA 1NNVA 1TP6A 3FG3A 1X1UA 1K9M4 1IV7A 1TUHA 3JUPA 1WMOA 5FW5A 1I70A 1IT8A 4MMYB 1DMNA 3NV0B 2F86B 1N9EA 2CIUA 2FGTA 3WHOA 1K734 1IDPA 1ROVA 1DVDA 1B20A 1PYLA 1TRPA 2BHMA 2IYJA 4I4KA 5EVHA 1OCVA 4BTXA 1LRAA 2F56A 1JRQA 2CG0A 4FMDA 3D5GA 1TFOA 5IF6A 3HOHA 4EBGA 3CME3 1MWTA 1FZUA 3LTDA 1YJW3 1GYBA 4EC6A 1M1K4 3G713 2RCDA 2F98A 1W2ZA 3Q3FA 4DKIA 3CC23 2KXGA 4FMCA 3PZWA 3NQYA 1VQN3 2OWPA 2OTL3 3Q90A 1RTUA 3EJVA 5CXOA 3O8YA 3X3XA 1Q40B 4N6MA 1JBSA 3GWRA 2H0HA 4WHAA 3BNEA 2D42A 2I9WA 1AY7A 2YX9A 4Q53A 3CCR3 3UNLA 1WMNA 1IV9A 1Z1SA 3CCQ3 2OTJ3 1T5YA 4N6NB 1JNQA 3N9HA 1CQSA 1W7CA 3QK9A 4JF8A 3S67A 4H61A 2SARA 4WYKA 1FUWA 5FGOA 2BO9B 1WTHA 3CNXA 2STDA 3SX1A 1ZO2A 2UGIA 3GAXA 4I5QA 1AQZA 1RRLA 1IK3A 1EEJA 1RGKA 2M7OA 5M1AA 4HVNA 2CW9A 3ZG0A 5M19A 3BLZA 1VQP3 3NM2A 1RNTA 3UL6A 3CU3A 3QRDA 3VSYA 4AEQA 1LXEA 1BRHA 1UDII 1QVG2 1BSAA 7STDA 4HM8B 1Q7HA 1N5HA 2XGLA 3MG1A 2AADA 3CCE3 3F8XA 4U13A 4KZ1A 2CKFB 2OOVA 1E97A 3GZXB 1KQS2 1I0XA 5IG3A 1YIT3 1YJN3 3DGYA 2XSHB 1W00A 5CLKA 3F40A 1OHOA 1TTOA 4EV2A 3AHWA 1WMPA 3I563 3GRDA 2BNGA 2JQ5A 2J8XB 3E99A 5AI1A 1RGFA 3U97A 3D4AA 1F8NA 3FGYA 1FGMA 2RGQA 3LMLA 4HM7B 5M18A 1JBRA 1ULJB 2ZDJA 4N6OB 4QWTA 3DGLA 3HK4A 3MG3A 4FMBA 1MGRA 1O7WB 3CCS3 2UUGC 3RDEA 1GY5A 2C10A 4X2HA 2UX0A 2C4BA 3PYJA 2HMLB 1HYFA 1BUJA 5CK6A 4BL2A 1QMAA 5AIHA 1NU3A 1US1A 2KF6A 3NXJA 4K1VA 1VZZA 3B4OA 1RKYA 3ZG5A 1W6CA 2XFTA 5JPUA 3HIGA 2XF3A 3SLUA 2WGQA 1BRSA 1GD3A 4FR9A 1IVXA 1RCLA 3OWUA 4XB5A 3FF0A 1BSEA 3S28A 2CFLA 2RNTA 3K63A 3MKIA 1FA3A 1JB2A 1RN4A 4HM2B 1HU9A 3EB8A 1UUVB 1Y4KA 1D6ZA 3IPTA 5IEOA 3T0UA 2R4IA 3FKAA 2K0MA 3N8BA 1SIHA 3MHEA 1BSBA 5AIFA 5D81A 3SOYA 1YHQ3 1EQKA 3K9MC 4WP5A 1EUIC 3HI7A 4EYCA 1IYYA 4IIAA 2F99A 3OW22 1MOLA 2IY2A 1SPUA 3FH1A 5TGNA 1B21A 1BNIA 1BRJA 1JN5B 3BNBA 1I0VA 2ML5A 2W04A 3AGNA 1UW1A 3EE1A 4GL6A 3BNDA 3D3LA 7GSPA 1QVF2 4WWUC 1UGHI 4NREA 5A0OB 2WOFA 2KCDA 3NM7A 6GSPA 3ECFA 2W9QA 1Q42A 3NQZA 4STDA 3KE7A 4RNYA 4KT3B 5LC7A 1IU7A 1ULIB 1OF5B 2Q07A 1GOYA 2INXA 1Q9EA 3A76A 3LOYA 1NO3A 1UCJA 5CF2A 1FW7A 1JZOA 1RSNA 1X1XA 2P0XA 4EXRA 2HMOB 3ER7A 1RLSA 1YNVX 1B3SA 3G0KA 2Z6BA 1OUNA 3LT8A 3SXXA 4IPBA 1RJOA 2F4YA 2GU3A 3U1WA 3X42A 2CX0A 3K5TA 1JB4A 2YFJB 5DREA 2CX1A 2HOHA 1LOVA 4HZ9B 1BOXA 3I0YA 1A2VA 1B27A 1MGWA 4CPKA 2KRTA 2WGOA 1G02A 2BMQB 1DVCA 4EV5A 2QGUA 3KFQC 3I553 1MWUA 3ALAA 2LYXA 2CG1A 2QA43 3EF8A 4HM5B 2XSOB 4ORLA 3X41A 1VQ53 5KP4A 3CMA3 1QJGA 3DGMA 1T3BA 2CFWA 5HGRA 1RN1A 1SJWA 1STFI 5IEPA 3GZYB 1QAFA 3F14A 1GD4A 3N54B 1JB5A 1OACA 3EC9A 1O7GB 1A67A 3DUKA 3NX0A 5STDA 3RGAA 3JUQA 1BNEA 1UCIA 1FGOA 1NDOB 1RN7A 1M9GA 1JKGB 4CJNA 2GEXA 5BU4A 3JUOA 1LQGC 5I97A 3CCM3 3V92A 5ELJA 1YJ93 1ISKA 2ZL8A 5CF1A 1SARA 1RGCA 4HAAA 3DH2A 1VQ83 4MMXB 2ZA4A 3SOAA 3NV0A 2A15A 1JV2B 1GS3A 1U8CB 1Q814 1GSPA 3RNTA 3VGNA 1DETA 3WDGB 3HZPA 3M8CA 3BNCA 6STDA 2P09A 3KZTA 1RHLA 2HMKB 1BNRA 1KWIA 4K1UA 4MEIA 1S723 1I3FA 2W6JH 1VQO3 3DM8A 4R80A 1BGSA 1CEWI 3J7Yd 1EG9B 3Q1CA 1JJ22 4H3UA 1C54A 1MWRA 3V99A 4HYZA 1E3VA 3JUMA 1PFPA 4BL3A 3CXC2 2Z77A 1O7PB 4RZMA 1ROAA 3TDGA 2CWTA 4O2HA 3BU4A 3FLJA 2BMOB 3STDA 2D1WA 4NHFA 4HBRA 1TU5A 1GOUA 1Q40A 3PS8A 4J9AA 4XDWA 3CCU3 1QAKA 1NWWA 2OQEA 5D82A 8RNTA 1IQ8A 3CNMA 4NPBA 1W4NA 4FCZA 4LMIA 1VQM3 1I2GA 1BU4A 4FCMA 5BVBA 3LT9A 1KD14 4GSPA 3D5IA 1AVLA 2CC3A 4XM4A 3H3HA 2RSXA 1LOXA 3CC43 2W56B 4FCJA 4O8SA 2R41A 5JPPA 1CYVA 1UUGB 2FNQA 4R9KA 2IA7A 3D9RA 4CCVA 3G6E3 1ASKA 5IG0A 1BNJA 1V58A 4L8PA 1T2IA 3BB9A 1OGZA 2OOVC 3B8LA 3S5CA 3HIIA 3NBJA 1N5PA 4KVHA 1B2MA 3OX9A 1E3RA 1GY6A 2W0QA 5G1LA 3RGRA 2HMJB 4BIRA 1BRGA 2QEX3 1DMQA 2QIYA 3B7CA 1K8A4 2P38A 2Y74A 1LOYA 2O9UX 1BNSA 3FG4A 3KIIA 4HM0B 5AEUB 1BNGA 2GBWB 1WNHA 1BIRA 1B2UA 4N6V0 1PU4A 4RBNA 2IUJA 2OQEC 1OPYA 2PZVA 3F9SA 4OVMA 4TX4A 8CHOA 1QALA 2GEYA 9RNTA 1BUQA 1IT7A 4RNTA 2ZHXB 3MYTA 1BRKA 1I2EA 1C7HA 4XBYA 1B2XA 1R4CA
chains in the Genus database with same CATH topology
4N6TA 3FF2A 4AKYA 2OCTA 4HM4B 3T8UA 2BT3A 3H51A 2HMMB 2P0MA 5LC6A 1O7MB 4LSOA 1WQLB 1D6YA 1UI7A 4JRFA 3EX9A 4KFDA 4HJLB 2MC8A 5D83A 3S29A 3CC73 3B4PA 1FGQA 4PEJA 4WYKB 3NBBA 2W03A 3WODG 2CWUA 1AV4A 1IVVA 3EHCA 1YGEA 3LTCA 1IVWA 3KN4A 1VQ63 2Y73A 1STDA 4XBTA 2L4VA 1IQYA 1K28A 4FMAA 3X3ZA 5IG5A 2E2VA 4N3VA 1ZX2A 4ZM8A 2CH9A 4HM6B 5BXQA 5AEWB 2W9PA 4HKVB 3WMDA 2GU1A 2GBXB 1W6YA 3G4S3 1OGXA 3KKGA 1Q824 4N6UA 1O7HB 2P05A 2JDIH 4J8TA 1FGRA 2LQVA 2XRXB 3MG2A 4XBXA 1N8R4 1JN5A 1MNLA 3EQQB 1SQWA 4HM3B 1AVKA 3JUNA 1SIIA 1VQ73 2O3OA 2YFLB 3WA2X 3DMCA 1OHPA 1EKMA 3LYGA 3Q2PA 3CCJ3 3NUVA 3G8ZA 2E2TA 1OF5A 1TFKA 4N6LA 3K7CA 2YFIB 3OWYA 5DRVA 1U5OA 3OXAA 3PXMA 4HZBB 1DYUA 2SBLA 2CK3H 5IG4A 5KP3A 4G1MB 2K54A 1IQXA 5AYSC 3FG1A 2WOHA 3MPHA 2C11A 3MWZA 3FSDA 3FCSB 3OW22 3IMAB 4K61A 3VF1A 4L7KA 3UJMA 3AMOB 3CPW2 5JBSA 4X2OA 4BTYA 1M1XB 3WOFB 2CFGA 2IMJA 2CWVA 3GZBA 4KFEA 4AKZA 2ML6A 3SEDA 3PCSA 3K0ZA 1RRHA 1AR0A 2HMNB 3EN1B 2B24B 3HX8A 4HM1B 5IERA 3PGBA 3UB1A 2B1XB 4GB5A 1KSIA 5EEOA 1O7NB 4IT7A 3LZAA 3KSPA 3L0RA 1HKXA 4R1KA 4CDLA 3X40A 1CYUA 4O02B 4O3VA 1LNHA 1JKGA 2RFRA 1W6GA 5KP1A 3DGNA 4RNZA 5AIIA 1V74A 2MF7A 3LXUX 3NBRA 2FXTA 3GZRA 2PNCA 1N9JA 5EQLA 3X3YA 1UI8A 1IVUA 1M904 1LVNA 4R4KA 1UUWB 1W02A 5G2GA 4LGQA 4R9LA 2XR8B 4K90B 1Q864 3PCRA 3F7SA 3NHXA 1VQ93 2XH9A 5IENA 3EN8A 3LTBA 2W2CA 3CD63 2Z76A 3WOEB 1W01A 3IJEB 1TIJA 3DXOA 3AMOA 1S5AA 1NB3I 1EA2A 3KSED 1GY7A 5AYRB 3F8HA 3FZWA 4MJDA 3G16A 5IW9A 1VQK3 3OV4A 3CCV3 1VQ43 1N8QA 3DGOA 3CCL3 1D6UA 3EBTA 3WA3A 2BMRB 4LEHA 1NJI4 1A2KA 3LH4A 1YI23 2CFDA 1J2BA 1A90A 3V98A 4KFFA 4L8OA 3F7XA 1L5GB 1YIJ3 3EBYA 1Q7Y4 4XDVA 1K41A 3LTAA 3UL5A 1W2B2 1G96A 3S27A 2V1LA 2E2UA 1YVBI 4MMZB 3MSOA 3T8NA 1KC84 4BTWA 3JVCA 1VQL3 1OH0A 2XGNA 2Z7AA 3DZLA 4WFOA 5ELUA 1DMMA 2CHCA 2W56A 2CFKA 1FGTA 3CPOA 1NB5I 3DY5A 2XFSA 4OK0A 1OHSA 2GXFA 4OUQA 2XEPA 3SVAA 2WO0A 1W5ZA 2IUKA 4LZIA 3OWSA 3ROBA 5AIGA 1TP6A 3FG3A 1K9M4 1IV7A 1TUHA 3JUPA 1WMOA 5FW5A 1IT8A 4MMYB 1DMNA 3NV0B 2F86B 1N9EA 2CIUA 2FGTA 1K734 1IDPA 1ROVA 1DVDA 4I4KA 2BHMA 5EVHA 1OCVA 4BTXA 1JRQA 2CG0A 4FMDA 1TFOA 5IF6A 4EBGA 3LTDA 1YJW3 1GYBA 4EC6A 1M1K4 3G713 2RCDA 2F98A 1W2ZA 3CC23 2KXGA 4FMCA 3PZWA 3NQYA 1VQN3 2OWPA 2OTL3 3Q90A 3EJVA 5CXOA 3O8YA 3X3XA 1Q40B 4N6MA 3GWRA 4WHAA 3BNEA 2D42A 2I9WA 2YX9A 4Q53A 3CCR3 3UNLA 1WMNA 1IV9A 1Z1SA 3CCQ3 2OTJ3 1T5YA 4N6NB 1JNQA 3N9HA 1CQSA 1W7CA 3QK9A 4JF8A 3S67A 4H61A 4WYKA 1FUWA 5FGOA 2BO9B 1WTHA 3CNXA 2STDA 3SX1A 1ZO2A 3GAXA 1RRLA 1IK3A 3CME3 2M7OA 4HVNA 2CW9A 3BLZA 1VQP3 3NM2A 3UL6A 3CU3A 3QRDA 3VSYA 4AEQA 1LXEA 1QVG2 7STDA 4HM8B 1N5HA 2XGLA 3MG1A 3CCE3 3F8XA 4U13A 4KZ1A 2CKFB 2OOVA 1E97A 3GZXB 1KQS2 5IG3A 1YIT3 1YJN3 2XSHB 1W00A 5CLKA 3F40A 1OHOA 4EV2A 1WMPA 3I563 3GRDA 2BNGA 2JQ5A 3E99A 5AI1A 3U97A 1F8NA 3FGYA 1FGMA 2RGQA 3LMLA 4HM7B 1ULJB 2ZDJA 4N6OB 4QWTA 3DGLA 3HK4A 3MG3A 4FMBA 1O7WB 3CCS3 3RDEA 1GY5A 2C10A 4X2HA 2UX0A 3PYJA 2HMLB 5CK6A 1QMAA 5AIHA 1NU3A 1US1A 3NXJA 4K1VA 1VZZA 3B4OA 1RKYA 1W6CA 2XFTA 5JPUA 3HIGA 2XF3A 3SLUA 2WGQA 4FR9A 1GD3A 4XB5A 1IVXA 3OWUA 3FF0A 3S28A 2CFLA 3K63A 3MKIA 1FA3A 1JB2A 4HM2B 1HU9A 3EB8A 1UUVB 1Y4KA 1D6ZA 3IPTA 5IEOA 3T0UA 2R4IA 3FKAA 2K0MA 3N8BA 1SIHA 3MHEA 5AIFA 5D81A 3SOYA 1YHQ3 1EQKA 3K9MC 4WP5A 3HI7A 4EYCA 4IIAA 2F99A 1MOLA 1SPUA 3FH1A 5TGNA 1JN5B 3BNBA 2ML5A 2W04A 4GL6A 3EE1A 1UW1A 1QVF2 3BNDA 3D3LA 4WWUC 4NREA 5A0OB 2WOFA 2KCDA 3NM7A 3ECFA 2W9QA 1Q42A 3NQZA 4STDA 3KE7A 4RNYA 5LC7A 1IU7A 1ULIB 1OF5B 2Q07A 2INXA 5CF2A 3A76A 3LOYA 1NO3A 2P0XA 4EXRA 2HMOB 3ER7A 3G0KA 2Z6BA 1OUNA 3LT8A 3SXXA 4IPBA 1RJOA 3U1WA 2GU3A 3X42A 3K5TA 1JB4A 2YFJB 5DREA 4HZ9B 3I0YA 1A2VA 2KRTA 2WGOA 2BMQB 1DVCA 4EV5A 2QGUA 3KFQC 3I553 3ALAA 2LYXA 2CG1A 2QA43 3EF8A 4HM5B 2XSOB 4ORLA 3X41A 1VQ53 5KP4A 3CMA3 1QJGA 3DGMA 2CFWA 5HGRA 1SJWA 1STFI 5IEPA 3GZYB 1QAFA 3F14A 1GD4A 3N54B 1JB5A 1OACA 3EC9A 1O7GB 1A67A 3DUKA 3NX0A 5STDA 3RGAA 3JUQA 1FGOA 1NDOB 1RN7A 1M9GA 1JKGB 2GEXA 3JUOA 5I97A 3CCM3 3V92A 5ELJA 1YJ93 1ISKA 2ZL8A 5CF1A 1VQ83 4MMXB 3SOAA 3NV0A 2A15A 1JV2B 1GS3A 1U8CB 1Q814 6STDA 3VGNA 3WDGB 3HZPA 3M8CA 3BNCA 2P09A 3KZTA 2HMKB 1KWIA 4K1UA 4MEIA 1S723 2W6JH 1VQO3 3DM8A 4R80A 1CEWI 3J7Yd 1EG9B 3Q1CA 1JJ22 4H3UA 3V99A 4HYZA 3JUMA 1PFPA 3CXC2 2Z77A 1O7PB 4RZMA 1ROAA 3TDGA 2CWTA 4O2HA 3FLJA 2BMOB 3STDA 2D1WA 4NHFA 4HBRA 1TU5A 3PS8A 1Q40A 3CCU3 4J9AA 4XDWA 1QAKA 1NWWA 2OQEA 5D82A 1IQ8A 3CNMA 1W4NA 4FCZA 4LMIA 1VQM3 4FCMA 1KD14 5BVBA 3LT9A 1AVLA 2CC3A 4XM4A 3H3HA 2RSXA 1LOXA 3CC43 2W56B 4FCJA 4O8SA 5JPPA 1CYVA 2FNQA 4R9KA 2IA7A 3D9RA 4CCVA 1ASKA 5IG0A 4L8PA 3BB9A 1OGZA 2OOVC 3B8LA 3S5CA 3HIIA 3NBJA 1N5PA 4KVHA 3OX9A 1E3RA 1GY6A 2W0QA 3RGRA 2HMJB 2QEX3 1DMQA 2QIYA 3B7CA 1K8A4 2P38A 2Y74A 3KIIA 2O9UX 3FG4A 4HM0B 5AEUB 2GBWB 1WNHA 4N6V0 1PU4A 4RBNA 2IUJA 2PZVA 1OPYA 3F9SA 4OVMA 4TX4A 8CHOA 3G6E3 1QALA 2GEYA 1BUQA 1IT7A 3MYTA 2OQEC 1C7HA 4XBYA 1E3VA 1R4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNC A;  4EV5 A;  3X3Y A;  3ALA A;  1UI8 A;  1IVU A;  1LVN A;  2BT3 A;  2CG1 A;  3X41 A;  2CFW A;  1D6Y A;  1UI7 A;  2OOV A;  1QAF A;  4KFD A;  3AMO A;  1OAC A;  3NBB A;  1AV4 A;  1IVV A;  2CWU A;  5IW9 A;  4EV2 A;  1WMP A;  1IVW A;  1D6U A;  3KN4 A;  3WA3 A;  2Y73 A;  1IQY A;  2CFD A;  2ZL8 A;  3X3Z A;  4KFF A;  2E2V A;  2C10 A;  2E2U A;  4BTW A;  1US1 A;  1AVK A;  1RKY A;  2CFK A;  1W6C A;  1SII A;  3HIG A;  3WA2 X;  2WGQ A;  1IVX A;  1EKM A;  2WO0 A;  1W5Z A;  2CFL A;  2E2T A;  2CWT A;  2D1W A;  1TU5 A;  1D6Z A;  1WMO A;  3T0U A;  1QAK A;  2K0M A;  1SIH A;  1N9E A;  2OQE A;  1DYU A;  3HI7 A;  1IQX A;  2WOH A;  1W4N A;  2C11 A;  3MPH A;  4BTX A;  1SPU A;  1AVL A;  3AMO B;  1JRQ A;  2CG0 A;  4BTY A;  2WOF A;  3NQZ A;  1W2Z A;  2CFG A;  2IA7 A;  1IU7 A;  2CWV A;  4KFE A;  3NQY A;  3LOY A;  2OOV C;  3HII A;  3NBJ A;  3X3X A;  3PGB A;  4EXR A;  2W0Q A;  2YX9 A;  1KSI A;  1WMN A;  2Y74 A;  3KII A;  3N9H A;  3SXX A;  1W7C A;  1RJO A;  2GU3 A;  3X42 A;  3K5T A;  3X40 A;  3SX1 A;  1PU4 A;  1QAL A;  1A2V A;  1W6G A;  2OQE C; 
#chains in the Genus database with same CATH topology
 1VQQ A;  2F5W A;  4N6T A;  1I3I A;  3FF2 A;  1B2S A;  4AKY A;  2OCT A;  4HM4 B;  3T8U A;  2BT3 A;  3H51 A;  2HMM B;  1LNI A;  2P0M A;  3URP A;  5LC6 A;  1RNB A;  1O7M B;  4LSO A;  1WQL B;  1D6Y A;  1UI7 A;  4J5G A;  4JRF A;  3EX9 A;  4HOH A;  4KFD A;  4HJL B;  2MC8 A;  5D83 A;  3S29 A;  3CC7 3;  3B4P A;  1FGQ A;  4PEJ A;  4WYK B;  3NBB A;  2W03 A;  5BIR A;  3WOD G;  1AV4 A;  1IVV A;  2CWU A;  3AHS A;  3EHC A;  1YGE A;  3LTC A;  1IVW A;  1BNF A;  3KN4 A;  1VQ6 3;  5GSP A;  1BRI A;  1STD A;  2Y73 A;  1LOW A;  4XBT A;  2L4V A;  1IQY A;  1K28 A;  4FMA A;  3X3Z A;  1UGI A;  1GMQ A;  5IG5 A;  2E2V A;  1RGH A;  4N3V A;  1ZX2 A;  1UCK A;  4ZM8 A;  2CH9 A;  4HM6 B;  5BXQ A;  5AEW B;  1BAN A;  1I2F A;  2W9P A;  4HKV B;  3WMD A;  2GU1 A;  2GBX B;  1W6Y A;  3G4S 3;  1OGX A;  3KKG A;  1Q82 4;  4N6U A;  1O7H B;  2P05 A;  2JDI H;  4J8T A;  1FYS A;  1FGR A;  2LQV A;  2XRX B;  3MG2 A;  2F5M A;  4XBX A;  4BU4 A;  1N8R 4;  1JN5 A;  1MNL A;  3EQQ B;  1SQW A;  4HM3 B;  1AVK A;  1JZD A;  3JUN A;  1SII A;  1VQ7 3;  5HOH A;  2O3O A;  2YFL B;  3WA2 X;  3DMC A;  1OHP A;  1EKM A;  3LYG A;  3Q2P A;  3CCJ 3;  1MWS A;  3NUV A;  3G8Z A;  2E2T A;  3WR2 A;  1OF5 A;  1TFK A;  2H0G A;  1I8V A;  1RMS A;  3K7C A;  2YFI B;  3OWY A;  4N6L A;  1ZS7 A;  2KF5 A;  5DRV A;  2KAA A;  3ZFZ A;  1DE3 A;  1U5O A;  3OXA A;  1UCL A;  3PXM A;  4HZB B;  1BSC A;  1DYU A;  2SBL A;  2CK3 H;  5IG4 A;  5KP3 A;  4G1M B;  2K54 A;  1IQX A;  5AYS C;  1T2H A;  1YVS A;  3FG1 A;  1BVI A;  2WOH A;  2C11 A;  1B2Z A;  1R4Y A;  1ZGX A;  3FCS B;  3FSD A;  3KCH A;  3MPH A;  3MWZ A;  3IMA B;  4K61 A;  3VF1 A;  4L7K A;  3UJM A;  3AMO B;  3CPW 2;  5G1K A;  5JBS A;  1V57 A;  4X2O A;  4BTY A;  3AGO A;  1M1X B;  3WOF B;  2GSP A;  2BIR A;  2CFG A;  2IMJ A;  2CWV A;  3GZB A;  4KFE A;  4AKZ A;  2ML6 A;  1G0T A;  3SED A;  3PCS A;  3K0Z A;  1RRH A;  1AR0 A;  2HMN B;  3EN1 B;  2B24 B;  3HX8 A;  1TRQ A;  4HM1 B;  5IER A;  5RNT A;  3PGB A;  3UB1 A;  2B1X B;  6RNT A;  4GB5 A;  1KSI A;  5EEO A;  1O7N B;  4IT7 A;  3A5E A;  3KSP A;  3L0R A;  1HZ1 A;  3LZA A;  1BSD A;  1HKX A;  4R1K A;  4CDL A;  3X40 A;  2RBI A;  1CYU A;  4O02 B;  1PY3 A;  1LNH A;  4O3V A;  1JKG A;  2RFR A;  1W6G A;  1RGE A;  5KP1 A;  3DGN A;  4RNZ A;  1RGA A;  5AII A;  1V74 A;  2MF7 A;  3LXU X;  3NBR A;  1GOV A;  2FXT A;  4LYL B;  1A2P A;  3GZR A;  2PNC A;  1N9J A;  5EQL A;  3X3Y A;  1FUS A;  1LQM B;  1UI8 A;  1IVU A;  1M90 4;  1LVN A;  4R4K A;  1UUW B;  1W02 A;  5G2G A;  4LGQ A;  2L1S A;  4R9L A;  2XR8 B;  4K90 B;  1FUT A;  1Q86 4;  3PCR A;  3F7S A;  3SYU A;  3NHX A;  1VQ9 3;  2XH9 A;  5IEN A;  3EN8 A;  3LTB A;  2W2C A;  3CD6 3;  3GSP A;  2Z76 A;  3WOE B;  1W01 A;  3IJE B;  1TIJ A;  3DXO A;  3AMO A;  1S5A A;  1NB3 I;  1EA2 A;  1RGG A;  3D79 A;  3KSE D;  1GY7 A;  4GHO A;  5AYR B;  3F8H A;  3FZW A;  4MJD A;  3G16 A;  2BU4 A;  5IW9 A;  1VQK 3;  2H0I A;  3OV4 A;  3CCV 3;  1VQ4 3;  1N8Q A;  3DGO A;  1RCK A;  3CCL 3;  1D6U A;  1RDS A;  1GMR A;  3EBT A;  4ILF A;  3WA3 A;  2BMR B;  4LEH A;  1NJI 4;  1A2K A;  3LH4 A;  1YI2 3;  2CFD A;  1J2B A;  1A90 A;  3V98 A;  4KFF A;  4L8O A;  1GMP A;  3F7X A;  1L5G B;  1YIJ 3;  3EBY A;  1Q7Y 4;  4XDV A;  1K41 A;  3LTA A;  1BAO A;  1BRN L;  2KF4 A;  3UL5 A;  1CH0 A;  2KF3 A;  1W2B 2;  1G96 A;  3S27 A;  1X1Y A;  2V1L A;  2E2U A;  1YVB I;  4MMZ B;  4EW5 A;  3MSO A;  3BIR A;  3T8N A;  4BTW A;  1KC8 4;  2AAE A;  3JVC A;  1RGL A;  1JBT A;  1VQL 3;  1OH0 A;  2XGN A;  2Z7A A;  3DZL A;  2K3D A;  4WFO A;  5ELU A;  1DMM A;  2CHC A;  2W56 A;  2CFK A;  1FGT A;  3CPO A;  1NB5 I;  3DY5 A;  4J5K A;  2XFS A;  4OK0 A;  1OHS A;  1YGW A;  2GXF A;  4OUQ A;  1TJD A;  2XEP A;  3SVA A;  2WO0 A;  1W5Z A;  2IUK A;  4LZI A;  3OWS A;  7RNT A;  3ROB A;  1X1W A;  5AIG A;  1NNV A;  1TP6 A;  3FG3 A;  1X1U A;  1K9M 4;  1IV7 A;  1TUH A;  3JUP A;  1WMO A;  5FW5 A;  1I70 A;  1IT8 A;  4MMY B;  1DMN A;  3NV0 B;  2F86 B;  1N9E A;  2CIU A;  2FGT A;  3WHO A;  1K73 4;  1IDP A;  1ROV A;  1DVD A;  1B20 A;  1PYL A;  1TRP A;  2BHM A;  2IYJ A;  4I4K A;  5EVH A;  1OCV A;  4BTX A;  1LRA A;  2F56 A;  1JRQ A;  2CG0 A;  4FMD A;  3D5G A;  1TFO A;  5IF6 A;  3HOH A;  4EBG A;  3CME 3;  1MWT A;  1FZU A;  3LTD A;  1YJW 3;  1GYB A;  4EC6 A;  1M1K 4;  3G71 3;  2RCD A;  2F98 A;  1W2Z A;  3Q3F A;  4DKI A;  3CC2 3;  2KXG A;  4FMC A;  3PZW A;  3NQY A;  1VQN 3;  2OWP A;  2OTL 3;  3Q90 A;  1RTU A;  3EJV A;  5CXO A;  3O8Y A;  3X3X A;  1Q40 B;  4N6M A;  1JBS A;  3GWR A;  2H0H A;  4WHA A;  3BNE A;  2D42 A;  2I9W A;  1AY7 A;  2YX9 A;  4Q53 A;  3CCR 3;  3UNL A;  1WMN A;  1IV9 A;  1Z1S A;  3CCQ 3;  2OTJ 3;  1T5Y A;  4N6N B;  1JNQ A;  3N9H A;  1CQS A;  1W7C A;  3QK9 A;  4JF8 A;  3S67 A;  4H61 A;  2SAR A;  4WYK A;  1FUW A;  5FGO A;  2BO9 B;  1WTH A;  3CNX A;  2STD A;  3SX1 A;  1ZO2 A;  2UGI A;  3GAX A;  4I5Q A;  1AQZ A;  1RRL A;  1IK3 A;  1EEJ A;  1RGK A;  2M7O A;  5M1A A;  4HVN A;  2CW9 A;  3ZG0 A;  5M19 A;  3BLZ A;  1VQP 3;  3NM2 A;  1RNT A;  3UL6 A;  3CU3 A;  3QRD A;  3VSY A;  4AEQ A;  1LXE A;  1BRH A;  1UDI I;  1QVG 2;  1BSA A;  7STD A;  4HM8 B;  1Q7H A;  1N5H A;  2XGL A;  3MG1 A;  2AAD A;  3CCE 3;  3F8X A;  4U13 A;  4KZ1 A;  2CKF B;  2OOV A;  1E97 A;  3GZX B;  1KQS 2;  1I0X A;  5IG3 A;  1YIT 3;  1YJN 3;  3DGY A;  2XSH B;  1W00 A;  5CLK A;  3F40 A;  1OHO A;  1TTO A;  4EV2 A;  3AHW A;  1WMP A;  3I56 3;  3GRD A;  2BNG A;  2JQ5 A;  2J8X B;  3E99 A;  5AI1 A;  1RGF A;  3U97 A;  3D4A A;  1F8N A;  3FGY A;  1FGM A;  2RGQ A;  3LML A;  4HM7 B;  5M18 A;  1JBR A;  1ULJ B;  2ZDJ A;  4N6O B;  4QWT A;  3DGL A;  3HK4 A;  3MG3 A;  4FMB A;  1MGR A;  1O7W B;  3CCS 3;  2UUG C;  3RDE A;  1GY5 A;  2C10 A;  4X2H A;  2UX0 A;  2C4B A;  3PYJ A;  2HML B;  1HYF A;  1BUJ A;  5CK6 A;  4BL2 A;  1QMA A;  5AIH A;  1NU3 A;  1US1 A;  2KF6 A;  3NXJ A;  4K1V A;  1VZZ A;  3B4O A;  1RKY A;  3ZG5 A;  1W6C A;  2XFT A;  5JPU A;  3HIG A;  2XF3 A;  3SLU A;  2WGQ A;  1BRS A;  1GD3 A;  4FR9 A;  1IVX A;  1RCL A;  3OWU A;  4XB5 A;  3FF0 A;  1BSE A;  3S28 A;  2CFL A;  2RNT A;  3K63 A;  3MKI A;  1FA3 A;  1JB2 A;  1RN4 A;  4HM2 B;  1HU9 A;  3EB8 A;  1UUV B;  1Y4K A;  1D6Z A;  3IPT A;  5IEO A;  3T0U A;  2R4I A;  3FKA A;  2K0M A;  3N8B A;  1SIH A;  3MHE A;  1BSB A;  5AIF A;  5D81 A;  3SOY A;  1YHQ 3;  1EQK A;  3K9M C;  4WP5 A;  1EUI C;  3HI7 A;  4EYC A;  1IYY A;  4IIA A;  2F99 A;  3OW2 2;  1MOL A;  2IY2 A;  1SPU A;  3FH1 A;  5TGN A;  1B21 A;  1BNI A;  1BRJ A;  1JN5 B;  3BNB A;  1I0V A;  2ML5 A;  2W04 A;  3AGN A;  1UW1 A;  3EE1 A;  4GL6 A;  3BND A;  3D3L A;  7GSP A;  1QVF 2;  4WWU C;  1UGH I;  4NRE A;  5A0O B;  2WOF A;  2KCD A;  3NM7 A;  6GSP A;  3ECF A;  2W9Q A;  1Q42 A;  3NQZ A;  4STD A;  3KE7 A;  4RNY A;  4KT3 B;  5LC7 A;  1IU7 A;  1ULI B;  1OF5 B;  2Q07 A;  1GOY A;  2INX A;  1Q9E A;  3A76 A;  3LOY A;  1NO3 A;  1UCJ A;  5CF2 A;  1FW7 A;  1JZO A;  1RSN A;  1X1X A;  2P0X A;  4EXR A;  2HMO B;  3ER7 A;  1RLS A;  1YNV X;  1B3S A;  3G0K A;  2Z6B A;  1OUN A;  3LT8 A;  3SXX A;  4IPB A;  1RJO A;  2F4Y A;  2GU3 A;  3U1W A;  3X42 A;  2CX0 A;  3K5T A;  1JB4 A;  2YFJ B;  5DRE A;  2CX1 A;  2HOH A;  1LOV A;  4HZ9 B;  1BOX A;  3I0Y A;  1A2V A;  1B27 A;  1MGW A;  4CPK A;  2KRT A;  2WGO A;  1G02 A;  2BMQ B;  1DVC A;  4EV5 A;  2QGU A;  3KFQ C;  3I55 3;  1MWU A;  3ALA A;  2LYX A;  2CG1 A;  2QA4 3;  3EF8 A;  4HM5 B;  2XSO B;  4ORL A;  3X41 A;  1VQ5 3;  5KP4 A;  3CMA 3;  1QJG A;  3DGM A;  1T3B A;  2CFW A;  5HGR A;  1RN1 A;  1SJW A;  1STF I;  5IEP A;  3GZY B;  1QAF A;  3F14 A;  1GD4 A;  3N54 B;  1JB5 A;  1OAC A;  3EC9 A;  1O7G B;  1A67 A;  3DUK A;  3NX0 A;  5STD A;  3RGA A;  3JUQ A;  1BNE A;  1UCI A;  1FGO A;  1NDO B;  1RN7 A;  1M9G A;  1JKG B;  4CJN A;  2GEX A;  5BU4 A;  3JUO A;  1LQG C;  5I97 A;  3CCM 3;  3V92 A;  5ELJ A;  1YJ9 3;  1ISK A;  2ZL8 A;  5CF1 A;  1SAR A;  1RGC A;  4HAA A;  3DH2 A;  1VQ8 3;  4MMX B;  2ZA4 A;  3SOA A;  3NV0 A;  2A15 A;  1JV2 B;  1GS3 A;  1U8C B;  1Q81 4;  1GSP A;  3RNT A;  3VGN A;  1DET A;  3WDG B;  3HZP A;  3M8C A;  3BNC A;  6STD A;  2P09 A;  3KZT A;  1RHL A;  2HMK B;  1BNR A;  1KWI A;  4K1U A;  4MEI A;  1S72 3;  1I3F A;  2W6J H;  1VQO 3;  3DM8 A;  4R80 A;  1BGS A;  1CEW I;  3J7Y d;  1EG9 B;  3Q1C A;  1JJ2 2;  4H3U A;  1C54 A;  1MWR A;  3V99 A;  4HYZ A;  1E3V A;  3JUM A;  1PFP A;  4BL3 A;  3CXC 2;  2Z77 A;  1O7P B;  4RZM A;  1ROA A;  3TDG A;  2CWT A;  4O2H A;  3BU4 A;  3FLJ A;  2BMO B;  3STD A;  2D1W A;  4NHF A;  4HBR A;  1TU5 A;  1GOU A;  1Q40 A;  3PS8 A;  4J9A A;  4XDW A;  3CCU 3;  1QAK A;  1NWW A;  2OQE A;  5D82 A;  8RNT A;  1IQ8 A;  3CNM A;  4NPB A;  1W4N A;  4FCZ A;  4LMI A;  1VQM 3;  1I2G A;  1BU4 A;  4FCM A;  5BVB A;  3LT9 A;  1KD1 4;  4GSP A;  3D5I A;  1AVL A;  2CC3 A;  4XM4 A;  3H3H A;  2RSX A;  1LOX A;  3CC4 3;  2W56 B;  4FCJ A;  4O8S A;  2R41 A;  5JPP A;  1CYV A;  1UUG B;  2FNQ A;  4R9K A;  2IA7 A;  3D9R A;  4CCV A;  3G6E 3;  1ASK A;  5IG0 A;  1BNJ A;  1V58 A;  4L8P A;  1T2I A;  3BB9 A;  1OGZ A;  2OOV C;  3B8L A;  3S5C A;  3HII A;  3NBJ A;  1N5P A;  4KVH A;  1B2M A;  3OX9 A;  1E3R A;  1GY6 A;  2W0Q A;  5G1L A;  3RGR A;  2HMJ B;  4BIR A;  1BRG A;  2QEX 3;  1DMQ A;  2QIY A;  3B7C A;  1K8A 4;  2P38 A;  2Y74 A;  1LOY A;  2O9U X;  1BNS A;  3FG4 A;  3KII A;  4HM0 B;  5AEU B;  1BNG A;  2GBW B;  1WNH A;  1BIR A;  1B2U A;  4N6V 0;  1PU4 A;  4RBN A;  2IUJ A;  2OQE C;  1OPY A;  2PZV A;  3F9S A;  4OVM A;  4TX4 A;  8CHO A;  1QAL A;  2GEY A;  9RNT A;  1BUQ A;  1IT7 A;  4RNT A;  2ZHX B;  3MYT A;  1BRK A;  1I2E A;  1C7H A;  4XBY A;  1B2X A;  1R4C A; 
#chains in the Genus database with same CATH homology
 4N6T A;  3FF2 A;  4AKY A;  2OCT A;  4HM4 B;  3T8U A;  2BT3 A;  3H51 A;  2HMM B;  2P0M A;  5LC6 A;  1O7M B;  4LSO A;  1WQL B;  1D6Y A;  1UI7 A;  4JRF A;  3EX9 A;  4KFD A;  4HJL B;  2MC8 A;  5D83 A;  3S29 A;  3CC7 3;  3B4P A;  1FGQ A;  4PEJ A;  4WYK B;  3NBB A;  2W03 A;  3WOD G;  2CWU A;  1AV4 A;  1IVV A;  3EHC A;  1YGE A;  3LTC A;  1IVW A;  3KN4 A;  1VQ6 3;  2Y73 A;  1STD A;  4XBT A;  2L4V A;  1IQY A;  1K28 A;  4FMA A;  3X3Z A;  5IG5 A;  2E2V A;  4N3V A;  1ZX2 A;  4ZM8 A;  2CH9 A;  4HM6 B;  5BXQ A;  5AEW B;  2W9P A;  4HKV B;  3WMD A;  2GU1 A;  2GBX B;  1W6Y A;  3G4S 3;  1OGX A;  3KKG A;  1Q82 4;  4N6U A;  1O7H B;  2P05 A;  2JDI H;  4J8T A;  1FGR A;  2LQV A;  2XRX B;  3MG2 A;  4XBX A;  1N8R 4;  1JN5 A;  1MNL A;  3EQQ B;  1SQW A;  4HM3 B;  1AVK A;  3JUN A;  1SII A;  1VQ7 3;  2O3O A;  2YFL B;  3WA2 X;  3DMC A;  1OHP A;  1EKM A;  3LYG A;  3Q2P A;  3CCJ 3;  3NUV A;  3G8Z A;  2E2T A;  1OF5 A;  1TFK A;  4N6L A;  3K7C A;  2YFI B;  3OWY A;  5DRV A;  1U5O A;  3OXA A;  3PXM A;  4HZB B;  1DYU A;  2SBL A;  2CK3 H;  5IG4 A;  5KP3 A;  4G1M B;  2K54 A;  1IQX A;  5AYS C;  3FG1 A;  2WOH A;  3MPH A;  2C11 A;  3MWZ A;  3FSD A;  3FCS B;  3OW2 2;  3IMA B;  4K61 A;  3VF1 A;  4L7K A;  3UJM A;  3AMO B;  3CPW 2;  5JBS A;  4X2O A;  4BTY A;  1M1X B;  3WOF B;  2CFG A;  2IMJ A;  2CWV A;  3GZB A;  4KFE A;  4AKZ A;  2ML6 A;  3SED A;  3PCS A;  3K0Z A;  1RRH A;  1AR0 A;  2HMN B;  3EN1 B;  2B24 B;  3HX8 A;  4HM1 B;  5IER A;  3PGB A;  3UB1 A;  2B1X B;  4GB5 A;  1KSI A;  5EEO A;  1O7N B;  4IT7 A;  3LZA A;  3KSP A;  3L0R A;  1HKX A;  4R1K A;  4CDL A;  3X40 A;  1CYU A;  4O02 B;  4O3V A;  1LNH A;  1JKG A;  2RFR A;  1W6G A;  5KP1 A;  3DGN A;  4RNZ A;  5AII A;  1V74 A;  2MF7 A;  3LXU X;  3NBR A;  2FXT A;  3GZR A;  2PNC A;  1N9J A;  5EQL A;  3X3Y A;  1UI8 A;  1IVU A;  1M90 4;  1LVN A;  4R4K A;  1UUW B;  1W02 A;  5G2G A;  4LGQ A;  4R9L A;  2XR8 B;  4K90 B;  1Q86 4;  3PCR A;  3F7S A;  3NHX A;  1VQ9 3;  2XH9 A;  5IEN A;  3EN8 A;  3LTB A;  2W2C A;  3CD6 3;  2Z76 A;  3WOE B;  1W01 A;  3IJE B;  1TIJ A;  3DXO A;  3AMO A;  1S5A A;  1NB3 I;  1EA2 A;  3KSE D;  1GY7 A;  5AYR B;  3F8H A;  3FZW A;  4MJD A;  3G16 A;  5IW9 A;  1VQK 3;  3OV4 A;  3CCV 3;  1VQ4 3;  1N8Q A;  3DGO A;  3CCL 3;  1D6U A;  3EBT A;  3WA3 A;  2BMR B;  4LEH A;  1NJI 4;  1A2K A;  3LH4 A;  1YI2 3;  2CFD A;  1J2B A;  1A90 A;  3V98 A;  4KFF A;  4L8O A;  3F7X A;  1L5G B;  1YIJ 3;  3EBY A;  1Q7Y 4;  4XDV A;  1K41 A;  3LTA A;  3UL5 A;  1W2B 2;  1G96 A;  3S27 A;  2V1L A;  2E2U A;  1YVB I;  4MMZ B;  3MSO A;  3T8N A;  1KC8 4;  4BTW A;  3JVC A;  1VQL 3;  1OH0 A;  2XGN A;  2Z7A A;  3DZL A;  4WFO A;  5ELU A;  1DMM A;  2CHC A;  2W56 A;  2CFK A;  1FGT A;  3CPO A;  1NB5 I;  3DY5 A;  2XFS A;  4OK0 A;  1OHS A;  2GXF A;  4OUQ A;  2XEP A;  3SVA A;  2WO0 A;  1W5Z A;  2IUK A;  4LZI A;  3OWS A;  3ROB A;  5AIG A;  1TP6 A;  3FG3 A;  1K9M 4;  1IV7 A;  1TUH A;  3JUP A;  1WMO A;  5FW5 A;  1IT8 A;  4MMY B;  1DMN A;  3NV0 B;  2F86 B;  1N9E A;  2CIU A;  2FGT A;  1K73 4;  1IDP A;  1ROV A;  1DVD A;  4I4K A;  2BHM A;  5EVH A;  1OCV A;  4BTX A;  1JRQ A;  2CG0 A;  4FMD A;  1TFO A;  5IF6 A;  4EBG A;  3LTD A;  1YJW 3;  1GYB A;  4EC6 A;  1M1K 4;  3G71 3;  2RCD A;  2F98 A;  1W2Z A;  3CC2 3;  2KXG A;  4FMC A;  3PZW A;  3NQY A;  1VQN 3;  2OWP A;  2OTL 3;  3Q90 A;  3EJV A;  5CXO A;  3O8Y A;  3X3X A;  1Q40 B;  4N6M A;  3GWR A;  4WHA A;  3BNE A;  2D42 A;  2I9W A;  2YX9 A;  4Q53 A;  3CCR 3;  3UNL A;  1WMN A;  1IV9 A;  1Z1S A;  3CCQ 3;  2OTJ 3;  1T5Y A;  4N6N B;  1JNQ A;  3N9H A;  1CQS A;  1W7C A;  3QK9 A;  4JF8 A;  3S67 A;  4H61 A;  4WYK A;  1FUW A;  5FGO A;  2BO9 B;  1WTH A;  3CNX A;  2STD A;  3SX1 A;  1ZO2 A;  3GAX A;  1RRL A;  1IK3 A;  3CME 3;  2M7O A;  4HVN A;  2CW9 A;  3BLZ A;  1VQP 3;  3NM2 A;  3UL6 A;  3CU3 A;  3QRD A;  3VSY A;  4AEQ A;  1LXE A;  1QVG 2;  7STD A;  4HM8 B;  1N5H A;  2XGL A;  3MG1 A;  3CCE 3;  3F8X A;  4U13 A;  4KZ1 A;  2CKF B;  2OOV A;  1E97 A;  3GZX B;  1KQS 2;  5IG3 A;  1YIT 3;  1YJN 3;  2XSH B;  1W00 A;  5CLK A;  3F40 A;  1OHO A;  4EV2 A;  1WMP A;  3I56 3;  3GRD A;  2BNG A;  2JQ5 A;  3E99 A;  5AI1 A;  3U97 A;  1F8N A;  3FGY A;  1FGM A;  2RGQ A;  3LML A;  4HM7 B;  1ULJ B;  2ZDJ A;  4N6O B;  4QWT A;  3DGL A;  3HK4 A;  3MG3 A;  4FMB A;  1O7W B;  3CCS 3;  3RDE A;  1GY5 A;  2C10 A;  4X2H A;  2UX0 A;  3PYJ A;  2HML B;  5CK6 A;  1QMA A;  5AIH A;  1NU3 A;  1US1 A;  3NXJ A;  4K1V A;  1VZZ A;  3B4O A;  1RKY A;  1W6C A;  2XFT A;  5JPU A;  3HIG A;  2XF3 A;  3SLU A;  2WGQ A;  4FR9 A;  1GD3 A;  4XB5 A;  1IVX A;  3OWU A;  3FF0 A;  3S28 A;  2CFL A;  3K63 A;  3MKI A;  1FA3 A;  1JB2 A;  4HM2 B;  1HU9 A;  3EB8 A;  1UUV B;  1Y4K A;  1D6Z A;  3IPT A;  5IEO A;  3T0U A;  2R4I A;  3FKA A;  2K0M A;  3N8B A;  1SIH A;  3MHE A;  5AIF A;  5D81 A;  3SOY A;  1YHQ 3;  1EQK A;  3K9M C;  4WP5 A;  3HI7 A;  4EYC A;  4IIA A;  2F99 A;  1MOL A;  1SPU A;  3FH1 A;  5TGN A;  1JN5 B;  3BNB A;  2ML5 A;  2W04 A;  4GL6 A;  3EE1 A;  1UW1 A;  1QVF 2;  3BND A;  3D3L A;  4WWU C;  4NRE A;  5A0O B;  2WOF A;  2KCD A;  3NM7 A;  3ECF A;  2W9Q A;  1Q42 A;  3NQZ A;  4STD A;  3KE7 A;  4RNY A;  5LC7 A;  1IU7 A;  1ULI B;  1OF5 B;  2Q07 A;  2INX A;  5CF2 A;  3A76 A;  3LOY A;  1NO3 A;  2P0X A;  4EXR A;  2HMO B;  3ER7 A;  3G0K A;  2Z6B A;  1OUN A;  3LT8 A;  3SXX A;  4IPB A;  1RJO A;  3U1W A;  2GU3 A;  3X42 A;  3K5T A;  1JB4 A;  2YFJ B;  5DRE A;  4HZ9 B;  3I0Y A;  1A2V A;  2KRT A;  2WGO A;  2BMQ B;  1DVC A;  4EV5 A;  2QGU A;  3KFQ C;  3I55 3;  3ALA A;  2LYX A;  2CG1 A;  2QA4 3;  3EF8 A;  4HM5 B;  2XSO B;  4ORL A;  3X41 A;  1VQ5 3;  5KP4 A;  3CMA 3;  1QJG A;  3DGM A;  2CFW A;  5HGR A;  1SJW A;  1STF I;  5IEP A;  3GZY B;  1QAF A;  3F14 A;  1GD4 A;  3N54 B;  1JB5 A;  1OAC A;  3EC9 A;  1O7G B;  1A67 A;  3DUK A;  3NX0 A;  5STD A;  3RGA A;  3JUQ A;  1FGO A;  1NDO B;  1RN7 A;  1M9G A;  1JKG B;  2GEX A;  3JUO A;  5I97 A;  3CCM 3;  3V92 A;  5ELJ A;  1YJ9 3;  1ISK A;  2ZL8 A;  5CF1 A;  1VQ8 3;  4MMX B;  3SOA A;  3NV0 A;  2A15 A;  1JV2 B;  1GS3 A;  1U8C B;  1Q81 4;  6STD A;  3VGN A;  3WDG B;  3HZP A;  3M8C A;  3BNC A;  2P09 A;  3KZT A;  2HMK B;  1KWI A;  4K1U A;  4MEI A;  1S72 3;  2W6J H;  1VQO 3;  3DM8 A;  4R80 A;  1CEW I;  3J7Y d;  1EG9 B;  3Q1C A;  1JJ2 2;  4H3U A;  3V99 A;  4HYZ A;  3JUM A;  1PFP A;  3CXC 2;  2Z77 A;  1O7P B;  4RZM A;  1ROA A;  3TDG A;  2CWT A;  4O2H A;  3FLJ A;  2BMO B;  3STD A;  2D1W A;  4NHF A;  4HBR A;  1TU5 A;  3PS8 A;  1Q40 A;  3CCU 3;  4J9A A;  4XDW A;  1QAK A;  1NWW A;  2OQE A;  5D82 A;  1IQ8 A;  3CNM A;  1W4N A;  4FCZ A;  4LMI A;  1VQM 3;  4FCM A;  1KD1 4;  5BVB A;  3LT9 A;  1AVL A;  2CC3 A;  4XM4 A;  3H3H A;  2RSX A;  1LOX A;  3CC4 3;  2W56 B;  4FCJ A;  4O8S A;  5JPP A;  1CYV A;  2FNQ A;  4R9K A;  2IA7 A;  3D9R A;  4CCV A;  1ASK A;  5IG0 A;  4L8P A;  3BB9 A;  1OGZ A;  2OOV C;  3B8L A;  3S5C A;  3HII A;  3NBJ A;  1N5P A;  4KVH A;  3OX9 A;  1E3R A;  1GY6 A;  2W0Q A;  3RGR A;  2HMJ B;  2QEX 3;  1DMQ A;  2QIY A;  3B7C A;  1K8A 4;  2P38 A;  2Y74 A;  3KII A;  2O9U X;  3FG4 A;  4HM0 B;  5AEU B;  2GBW B;  1WNH A;  4N6V 0;  1PU4 A;  4RBN A;  2IUJ A;  2PZV A;  1OPY A;  3F9S A;  4OVM A;  4TX4 A;  8CHO A;  3G6E 3;  1QAL A;  2GEY A;  1BUQ A;  1IT7 A;  3MYT A;  2OQE C;  1C7H A;  4XBY A;  1E3V A;  1R4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...