2GU3A

Ypmb protein from bacillus subtilis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
KEEGHEAAAAEAKKETDLAHVDQVETFVGKEKYYVVKGTDKKGTALYVWVPADKKAKILSKEAKEGISEDKAAKIIKDEGLVSKQKEVHLAREGNVLLWEVTYLDKEGQYSLSYVDFTTGKILKNITP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of YpmB protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
molecule keywords YpmB protein
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF17881 DUF5590 Domain of unknown function (DUF5590)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A01
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A02
1W6GA 3HIIA 1AVLA 2OQEC 2CG1A 1WMPA 2CG0A 3AMOB 1QAKA 3T0UA 2WO0A 3HIGA 2CFGA 3X40A 3X3XA 1D6YA 3WA3A 2BT3A 1UI7A 1A2VA 1PU4A 2Y73A 2IA7A 1IVWA 1W2ZA 1N9EA 1SPUA 1QAFA 1AVKA 2GU3A 1KSIA 3LOYA 3X41A 1EKMA 1RKYA 4EXRA 3HI7A 3NBBA 3PGBA 5IW9A 1UI8A 2Y74A 2C11A 3SXXA 1IVUA 1W4NA 1SIIA 3NQZA 4BTXA 3X3YA 2E2UA 4KFDA 2CFLA 1QALA 1AV4A 1D6UA 1WMOA 2E2VA 4KFFA 3KIIA 1W6CA 3X42A 3N9HA 2OQEA 1DYUA 1WMNA 2CFKA 1IVXA 3SX1A 1RJOA 2CWTA 2WOHA 1JRQA 4EV5A 3K5TA 2CWUA 2PNCA 2YX9A 3NBJA 1US1A 1IQYA 3NQYA 2OOVA 3MPHA 1IU7A 2W0QA 1IVVA 2WOFA 2CWVA 4KFEA 2K0MA 3KN4A 1TU5A 1OACA 2CFWA 1LVNA 1IQXA 2E2TA 4BTWA 3ALAA 2D1WA 3X3ZA 1SIHA 2ZL8A 1D6ZA 2WGQA 3WA2X 4BTYA 3AMOA 2C10A 1W5ZA 1W7CA 4EV2A 2OOVC 2CFDA
chains in the Genus database with same CATH superfamily
4HM6B 2P0MA 4K61A 2P0XA 1NWWA 1Q40B 1AVLA 5BU4A 3S28A 2WGOA 1WMPA 5AEWB 2GBXB 2W9PA 3Q2PA 4RNTA 3KCHA 1BNGA 3ZG5A 4G1MB 2WO0A 6GSPA 2XSOB 2R4IA 4OVMA 4BU4A 2CFGA 1X1XA 1FGRA 1UGHI 2SBLA 1BRKA 1ZGXA 2UGIA 1LOVA 5LC6A 1UUVB 1BU4A 1SJWA 3WA3A 1R4YA 3CCQ3 1UI7A 1A2VA 1Q9EA 4XDVA 2BO9B 1I2EA 2I9WA 3NXJA 2Y73A 1O7MB 1TUHA 3V98A 1PYLA 1ULIB 1TIJA 1BSDA 3EQQB 1DVCA 1UW1A 3B8LA 3GWRA 1OCVA 3F8HA 3JUQA 3KSPA 5IEOA 1BANA 1K9M4 3EE1A 3A76A 3BNDA 3F14A 4FR9A 1O7NB 3U97A 7GSPA 1AVKA 1W6YA 1G0TA 5IERA 9RNTA 1HZ1A 1JNQA 2AAEA 1BSAA 1SARA 1EQKA 1BNIA 1TP6A 8CHOA 2YFLB 4N6LA 4OUQA 1LXEA 1FGQA 1N9JA 4HOHA 2C11A 1R4CA 3I563 1CEWI 3D4AA 3FZWA 3FG3A 2HOHA 3KZTA 3LT8A 3NHXA 1I3FA 1Z1SA 3X3YA 1M9GA 2Z6BA 3D5GA 3OX9A 2E2UA 1PFPA 3DM8A 2OTJ3 1MWTA 2RBIA 4KFDA 3UL5A 1IK3A 3CCJ3 2KXGA 3HK4A 1X1YA 1QALA 4CJNA 1OHOA 3DXOA 3I0YA 3OWYA 1U8CB 4KFFA 3KIIA 1BNRA 3CCE3 2INXA 5AIHA 3G8ZA 2Z76A 3KKGA 1DYUA 2C4BA 1TRQA 3M8CA 1NB5I 2XFSA 3UL6A 4AKYA 3FSDA 5BIRA 4FMDA 2BHMA 2XR8B 3LTBA 4HM0B 3J7Yd 1W02A 3BB9A 3I553 3F7SA 2QIYA 5BXQA 1NB3I 2CWUA 2YX9A 3AGOA 3JUOA 1RN1A 1OHPA 1US1A 1EG9B 3NV0B 4XB5A 5G2GA 1IU7A 1RMSA 2W0QA 2UUGC 4RBNA 3U1WA 4EBGA 1T5YA 4LZIA 4I4KA 4FCMA 1IVVA 1JB4A 2XF3A 3GZXB 4I5QA 3PCRA 1YGWA 3NBRA 1N5PA 1FW7A 2Z77A 4FCJA 1IQXA 2E2TA 1Q42A 1VZZA 3D5IA 3NX0A 2FNQA 1I2FA 2W9QA 1GY7A 4HZ9B 5D83A 5M1AA 7RNTA 1OGZA 1RGKA 2KAAA 1SIHA 3LT9A 4J5KA 1RDSA 2W2CA 3D9RA 2BMOB 1RRLA 1AY7A 2GSPA 1MGWA 3JUPA 2Q07A 3K63A 1FUTA 5AEUB 1ROVA 1JB5A 3Q1CA 1RGAA 1RCKA 1LOXA 3A5EA 1BRIA 1BNFA 3LZAA 5FW5A 3SVAA 3NM7A 1GS3A 3MSOA 4EYCA 1QMAA 2ZDJA 3G16A 2IMJA 2OOVC 4XBYA 1AQZA 1LOWA 3CCM3 5A0OB 1QVF2 1RGLA 3RNTA 1O7PB 2LYXA 1CYVA 2CG1A 3B4OA 4LGQA 2RFRA 1QAKA 4J8TA 3K9MC 3T0UA 3OXAA 1AR0A 5IG5A 3MG3A 3DGMA 1Q824 3X3XA 1VQ53 1WNHA 1RGEA 3DGYA 1O7GB 2BT3A 2BMRB 3EC9A 3G6E3 5ELJA 1DVDA 2B24B 1UGIA 2F98A 1VQ83 1V74A 1KWIA 4XM4A 1YIJ3 1V57A 4R4KA 5CLKA 1W2ZA 1B2XA 3F40A 1M904 1N9EA 1OH0A 2XH9A 2CHCA 2V1LA 5G1KA 1GMRA 4CDLA 3HOHA 1BRJA 3X41A 1UCLA 3BNBA 2ML5A 3CCR3 3E99A 3NV0A 5EEOA 1RKYA 4STDA 1JN5A 1FGOA 3AHWA 3CCS3 3WHOA 3NBBA 3PGBA 3F7XA 5IW9A 1MWSA 5HOHA 4N6OB 3GSPA 2KF4A 1W4NA 3EX9A 4MJDA 1U5OA 3MG1A 3WMDA 7STDA 2PZVA 1NDOB 1CH0A 5AI1A 4H61A 1L5GB 5FGOA 1Q7Y4 3GAXA 5ELUA 2CC3A 4HAAA 1BRNL 1JZDA 4BTXA 3LTDA 4JF8A 3DH2A 1WTHA 1Q7HA 1KD14 3CC43 1ROAA 5D81A 1VQ63 1K41A 1YGEA 1RSNA 2GXFA 4GL6A 3LXUX 3S67A 8RNTA 1JBTA 1BNJA 1GD3A 2H0IA 1W01A 3FKAA 4HM2B 1S723 4WYKA 4FMCA 3LMLA 4LSOA 3OWUA 1I2GA 1YNVX 3LTAA 4RNZA 1B3SA 1TTOA 5EVHA 3EB8A 3K0ZA 3ZG0A 5IENA 1BVIA 3L0RA 4FMBA 4R9KA 1W2B2 3G713 2CFKA 4FMAA 1DMNA 1BSCA 1YIT3 4HYZA 4BIRA 2BMQB 1IVXA 2CX1A 1T3BA 3URPA 1JRQA 4DKIA 3NBJA 5AYSC 1BNEA 5CF2A 1K28A 1IT8A 2KCDA 4OK0A 3SLUA 3NQYA 1C7HA 3O8YA 2STDA 3CME3 3MPHA 3B4PA 3FCSB 1FGMA 5DREA 3CC23 1BRGA 1RGCA 4K1VA 3STDA 3BLZA 3IPTA 3MYTA 4KVHA 2WOFA 3HZPA 3WOEB 4KFEA 2AADA 1HKXA 2K0MA 1TU5A 3EN8A 5KP4A 3RDEA 3SEDA 2F4YA 2CFWA 3VGNA 2CX0A 1NNVA 3ALAA 1TFKA 4MMZB 5RNTA 2XSHB 2JDIH 1UCJA 2HMMB 2ML6A 3DMCA 1B20A 3H51A 1VQP3 2ZL8A 2SARA 1D6ZA 2WGQA 3V99A 3N8BA 1FUWA 4LEHA 1RN7A 1BNSA 4R80A 5CXOA 4CCVA 4NPBA 3Q3FA 2C10A 1LOYA 4HM4B 1IV7A 1W7CA 2HMLB 3RGAA 4EV2A 6STDA 1V58A 4AKZA 5CK6A 4HM3B 4EC6A 5BVBA 1Q40A 4CPKA 1JV2B 1FUSA 1N8QA 1ISKA 5IG4A 2RCDA 2LQVA 1X1WA 3F8XA 4HM1B 4HVNA 4MMXB 2CG0A 2OCTA 3AMOB 3WDGB 4WFOA 2KF5A 3HIGA 2QEX3 1ASKA 4WHAA 3EF8A 3MWZA 1IQ8A 1D6YA 1VQO3 3G4S3 4KT3B 4WWUC 2M7OA 5IEPA 5KP1A 4NHFA 1VQ93 1E3VA 1PU4A 4HJLB 2H0HA 1RCLA 2IA7A 3JVCA 2P38A 1GD4A 3CPW2 1C54A 1F8NA 2OTL3 2F56A 1FYSA 5G1LA 3TDGA 1STDA 1JBRA 2XGLA 3CNXA 3OV4A 1VQL3 1B2ZA 1QAFA 5I97A 1FA3A 2GU1A 1OF5A 1KSIA 1LQGC 3LOYA 3WODG 2K54A 1EKMA 3EJVA 3V92A 1X1UA 3SYUA 2CK3H 1LNHA 4K1UA 1A90A 3KSED 3PZWA 5DRVA 4ZM8A 1UI8A 3EBYA 2FXTA 1YI23 3CXC2 4LMIA 3S27A 1EA2A 1KC84 3CMA3 3FF0A 3CCV3 1GY5A 4HM7B 4WYKB 1GOVA 2L4VA 1JKGA 1RGGA 1LRAA 1RNTA 2HMKB 1M1K4 4U13A 1MNLA 2GEXA 1Q814 1A2PA 6RNTA 2O3OA 2BU4A 4Q53A 1T2IA 3UJMA 3PXMA 3GZRA 3F9SA 1AV4A 2E2VA 1IYYA 1RGHA 1OPYA 2CW9A 1NJI4 4WP5A 3JUNA 3CNMA 1STFI 2MF7A 3N9HA 3WR2A 2GEYA 1RGFA 1LQMB 1JKGB 3GZYB 1JN5B 2R41A 2K3DA 1HU9A 3D3LA 2RSXA 3PCSA 5AYRB 1RJOA 2JQ5A 1B27A 3CCU3 2FGTA 1YJN3 2CWTA 1KQS2 5IG3A 4NREA 4O8SA 4XBTA 1ULJB 1T2HA 1BIRA 3K5TA 5JBSA 4RZMA 2PNCA 3S5CA 2B1XB 1UUGB 3AHSA 3LH4A 3VSYA 3CPOA 1IQYA 4TX4A 4L8PA 4IT7A 5GSPA 2RGQA 1BSBA 3ROBA 1GMPA 5CF1A 5M18A 2KF3A 2BIRA 4X2OA 3DGOA 2XRXB 4MEIA 1GOUA 2UX0A 1RHLA 5LC7A 2IUJA 1VQ43 1LVNA 2F5WA 5STDA 1J2BA 2D1WA 4ORLA 4HZBB 4FCZA 3X3ZA 1A67A 1EEJA 1BAOA 4N6TA 5JPPA 2QGUA 2W6JH 3KE7A 4N3VA 3WA2X 2CH9A 1OHSA 4BTYA 4O3VA 3FF2A 1E97A 2P09A 3GZBA 2MC8A 2HMJB 2W56A 3AMOA 3OWSA 4HM8B 2F86B 1B2UA 3K7CA 1RNBA 3NUVA 1MWRA 1S5AA 4GHOA 1HYFA 1UUWB 2KF6A 2O9UX 5AIFA 1K8A4 1DMQA 4HM5B 4EW5A 1IV9A 1W6GA 2HMOB 4LYLB 3HIIA 2OQEC 5AIGA 4L7KA 1I0VA 4J9AA 4L8OA 1UDII 2IYJA 2H0GA 2W56B 3DUKA 3G0KA 1A2KA 1VQM3 1VQ73 1EUIC 1N8R4 1G02A 1UCIA 1PY3A 4R1KA 3FLJA 4XBXA 1BRHA 1ZX2A 3X40A 4O2HA 1RN4A 3MHEA 3VF1A 4MMYB 1OF5B 1YVBI 2F5MA 3T8UA 1TFOA 3S29A 4X2HA 5AIIA 1N5HA 2L1SA 3FG4A 1DE3A 2KRTA 1I70A 3N54B 4K90B 1IVWA 2W04A 3JUMA 1B2SA 2P05A 5IG0A 4AEQA 1CYUA 3GRDA 1ZO2A 5TGNA 3ZFZA 2IY2A 1SPUA 3RGRA 2GU3A 1W00A 1K734 1VQQA 3AGNA 3Q90A 1BOXA 1IT7A 2RNTA 1IDPA 1OUNA 2F99A 2J8XB 5IF6A 4EXRA 3FG1A 2A15A 3HI7A 2IUKA 1TJDA 5D82A 1BGSA 3OW22 1B21A 4BL3A 4HBRA 2CKFB 2HMNB 2Y74A 1Q864 1I0XA 3SXXA 3FGYA 1IVUA 4PEJA 1VQN3 1BUJA 3IMAB 1SIIA 1WQLB 3CU3A 1RTUA 3EHCA 4KZ1A 2D42A 3QRDA 2GBWB 1NO3A 4N6NB 3NQZA 4BL2A 5M19A 1GSPA 3SOAA 2Z7AA 1M1XB 2CIUA 3QK9A 1CQSA 2OWPA 2XGNA 1DMMA 1I8VA 4IPBA 1LNIA 3UB1A 2W03A 2CFLA 3ECFA 3MKIA 1D6UA 1WMOA 3LYGA 2BNGA 2YFIB 1G96A 1BRSA 1JBSA 4GSPA 1RRHA 3CC73 1W6CA 2XEPA 1GY6A 3EN1B 5HGRA 1I3IA 3X42A 1B2MA 2OQEA 1JJ22 1WMNA 3BNCA 3MG2A 5KP3A 1OGXA 5EQLA 5JPUA 3CD63 1YJW3 4JRFA 3D79A 3DGNA 3SX1A 1QJGA 1NU3A 1TRPA 4N6UA 3BU4A 3UNLA 1YJ93 1ZS7A 1GMQA 2WOHA 3PS8A 4EV5A 1FGTA 1DETA 4ILFA 1GOYA 3T8NA 2ZHXB 2OOVA 4N6V0 3EBTA 1O7HB 4RNYA 2QA43 3FH1A 4R9LA 1RLSA 2CWVA 2YFJB 4H3UA 4GB5A 1MWUA 3KN4A 1OACA 1YVSA 3WOFB 3IJEB 4IIAA 4N6MA 1MOLA 1UCKA 4XDWA 4O02B 2XFTA 3BNEA 3DGLA 3DY5A 4BTWA 3LTCA 3NM2A 1SQWA 3BIRA 3SOYA 1FZUA 3PYJA 1VQK3 4J5GA 1JZOA 3KFQC 3ER7A 1MGRA 1QVG2 2ZA4A 3DZLA 1Y4KA 3H3HA 1GYBA 4QWTA 1JB2A 1E3RA 3CCL3 4HKVB 3HX8A 1W5ZA 1BUQA 1O7WB 3B7CA 1YHQ3 1BSEA 2CFDA
chains in the Genus database with same CATH topology
4HM6B 2P0MA 4K61A 2P0XA 1NWWA 1Q40B 1AVLA 3S28A 2WGOA 1WMPA 5AEWB 2GBXB 2W9PA 3Q2PA 4G1MB 2WO0A 2XSOB 2R4IA 4OVMA 2CFGA 1FGRA 2SBLA 3WA3A 5LC6A 1UUVB 1SJWA 3CCQ3 1UI7A 1A2VA 4XDVA 2BO9B 2I9WA 3NXJA 2Y73A 1O7MB 1TUHA 3V98A 1ULIB 1TIJA 3GWRA 1DVCA 3B8LA 1UW1A 1OCVA 3F8HA 3JUQA 3KSPA 5IEOA 1K9M4 3EE1A 3A76A 3BNDA 3F14A 4FR9A 1O7NB 3U97A 1AVKA 1W6YA 5IERA 1JNQA 1EQKA 1TP6A 8CHOA 2YFLB 4N6LA 4OUQA 1LXEA 1FGQA 1N9JA 2C11A 1R4CA 3I563 1CEWI 3FZWA 3FG3A 3KZTA 3LT8A 3NHXA 1Z1SA 3X3YA 1M9GA 2Z6BA 3OX9A 2E2UA 1PFPA 3DM8A 2OTJ3 1IK3A 3UL5A 4KFDA 3CCJ3 2KXGA 3HK4A 1QALA 1OHOA 3DXOA 3I0YA 3OWYA 1U8CB 4KFFA 3KIIA 3CCE3 2INXA 5AIHA 3G8ZA 2Z76A 3KKGA 1DYUA 3M8CA 1NB5I 2XFSA 3UL6A 4AKYA 3FSDA 4FMDA 2BHMA 2XR8B 3LTBA 4HM0B 3J7Yd 1W02A 3BB9A 3I553 3F7SA 2QIYA 5BXQA 1NB3I 2CWUA 2YX9A 3JUOA 1OHPA 1US1A 1EG9B 3NV0B 4XB5A 5G2GA 1IU7A 2W0QA 4RBNA 3U1WA 4EBGA 1T5YA 4LZIA 4I4KA 4FCMA 1IVVA 1JB4A 2XF3A 3GZXB 3PCRA 3NBRA 1N5PA 2Z77A 4FCJA 1IQXA 1Q42A 1VZZA 2E2TA 3NX0A 5D83A 2FNQA 2W9QA 4HZ9B 1GY7A 4BTWA 1OGZA 3LT9A 1SIHA 2W2CA 3D9RA 2BMOB 1RRLA 3JUPA 2Q07A 3K63A 5AEUB 1ROVA 1JB5A 3Q1CA 1LOXA 3SVAA 3LZAA 5FW5A 3NM7A 1GS3A 3MSOA 4EYCA 1QMAA 2ZDJA 3G16A 2OOVC 2IMJA 4XBYA 3CCM3 5A0OB 1QVF2 1O7PB 2LYXA 1CYVA 2CG1A 3B4OA 4LGQA 2RFRA 1QAKA 4J8TA 3K9MC 3T0UA 3OXAA 1AR0A 5IG5A 3MG3A 3DGMA 1Q824 3X3XA 1VQ53 1WNHA 1O7GB 2BT3A 2BMRB 3EC9A 3G6E3 5ELJA 1DVDA 2B24B 2F98A 1VQ83 1V74A 1KWIA 4XM4A 1YIJ3 4R4KA 5CLKA 1W2ZA 3F40A 1M904 1N9EA 1OH0A 2XH9A 2CHCA 2V1LA 4CDLA 3X41A 3BNBA 3CCR3 2ML5A 3E99A 3NV0A 5EEOA 1RKYA 4STDA 1JN5A 1FGOA 3CCS3 3NBBA 3PGBA 3F7XA 5IW9A 4N6OB 1W4NA 3EX9A 4MJDA 1U5OA 3MG1A 3WMDA 7STDA 2PZVA 1NDOB 5AI1A 4H61A 1L5GB 5FGOA 1Q7Y4 3GAXA 5ELUA 2CC3A 4BTXA 3LTDA 4JF8A 1WTHA 1KD14 3CC43 1ROAA 5D81A 1VQ63 1K41A 1YGEA 2GXFA 4GL6A 3LXUX 3S67A 1GD3A 3FKAA 1W01A 1S723 4HM2B 4WYKA 4FMCA 3LMLA 4LSOA 3OWUA 3LTAA 4RNZA 5IENA 5EVHA 3EB8A 3K0ZA 4R9KA 3L0RA 4FMBA 1W2B2 3G713 2CFKA 4FMAA 1DMNA 1YIT3 4HYZA 2BMQB 1IVXA 1JRQA 3NBJA 5AYSC 5CF2A 1K28A 1IT8A 2KCDA 4OK0A 3SLUA 3NQYA 1C7HA 3O8YA 2STDA 3CME3 3MPHA 3B4PA 3FCSB 1FGMA 5DREA 3CC23 4K1VA 3STDA 3BLZA 3IPTA 3MYTA 4KVHA 2WOFA 3HZPA 3WOEB 4KFEA 1HKXA 2K0MA 1TU5A 3EN8A 5KP4A 3RDEA 3SEDA 2CFWA 3VGNA 3ALAA 1TFKA 4MMZB 2XSHB 2JDIH 2HMMB 2ML6A 3DMCA 3H51A 1VQP3 2ZL8A 1D6ZA 2WGQA 3V99A 3N8BA 1FUWA 4LEHA 1RN7A 4R80A 5CXOA 4CCVA 2C10A 4HM4B 1IV7A 1W7CA 2HMLB 3RGAA 4EV2A 6STDA 4AKZA 5CK6A 4HM3B 4EC6A 5BVBA 1Q40A 1JV2B 1N8QA 1ISKA 5IG4A 2RCDA 2LQVA 3F8XA 4HM1B 4HVNA 4MMXB 2CG0A 2OCTA 3AMOB 3WDGB 4WFOA 3HIGA 2QEX3 1ASKA 4WHAA 3EF8A 3MWZA 1IQ8A 1D6YA 1VQO3 3G4S3 4WWUC 2M7OA 5IEPA 5KP1A 4NHFA 1VQ93 1E3VA 1PU4A 4HJLB 2IA7A 3JVCA 2P38A 1GD4A 3CPW2 1F8NA 2OTL3 3TDGA 1STDA 2XGLA 3CNXA 3OV4A 1VQL3 1QAFA 5I97A 1FA3A 2GU1A 1OF5A 1KSIA 3LOYA 3WODG 2K54A 1EKMA 3EJVA 3V92A 2CK3H 1LNHA 4K1UA 1A90A 3KSED 3PZWA 5DRVA 4ZM8A 1UI8A 3EBYA 2FXTA 1YI23 3CXC2 4LMIA 3S27A 1EA2A 1KC84 3CMA3 3FF0A 3CCV3 1GY5A 4HM7B 4WYKB 2L4VA 1JKGA 1M1K4 2HMKB 4U13A 1MNLA 2GEXA 1Q814 2O3OA 4Q53A 3UJMA 3PXMA 3GZRA 3F9SA 1AV4A 2E2VA 1OPYA 2CW9A 1NJI4 4WP5A 3JUNA 3CNMA 1STFI 2MF7A 3N9HA 2GEYA 1JKGB 3GZYB 1JN5B 1HU9A 3D3LA 2RSXA 3PCSA 5AYRB 1RJOA 2JQ5A 3CCU3 2FGTA 1YJN3 2CWTA 1KQS2 5IG3A 4NREA 4O8SA 4XBTA 1ULJB 5JBSA 3K5TA 4RZMA 2PNCA 3S5CA 2B1XB 3LH4A 3VSYA 3CPOA 1IQYA 4TX4A 4L8PA 4IT7A 3ROBA 2RGQA 5CF1A 4X2OA 3DGOA 2XRXB 4MEIA 2UX0A 5LC7A 2IUJA 1VQ43 1LVNA 5STDA 1J2BA 2D1WA 4ORLA 4HZBB 4FCZA 3X3ZA 1A67A 4N6TA 5JPPA 2QGUA 2W6JH 3KE7A 4N3VA 3WA2X 2CH9A 1OHSA 4BTYA 4O3VA 3FF2A 1E97A 2P09A 3GZBA 2MC8A 2HMJB 2W56A 3AMOA 3OWSA 4HM8B 2F86B 3K7CA 3NUVA 1S5AA 1UUWB 2O9UX 5AIFA 1K8A4 1DMQA 4HM5B 1IV9A 1W6GA 2HMOB 3HIIA 2OQEC 5AIGA 4L7KA 4J9AA 4L8OA 1VQM3 2W56B 3DUKA 3G0KA 1A2KA 1VQ73 1N8R4 4R1KA 4XBXA 3FLJA 1ZX2A 3X40A 4O2HA 3VF1A 3MHEA 4MMYB 1OF5B 1YVBI 3T8UA 1TFOA 3S29A 4X2HA 5AIIA 1N5HA 3FG4A 2KRTA 3N54B 4K90B 1IVWA 2W04A 3JUMA 5IG0A 2P05A 4AEQA 1CYUA 3GRDA 1ZO2A 5TGNA 1SPUA 3RGRA 2GU3A 1W00A 1K734 3Q90A 1IT7A 1IDPA 1OUNA 2F99A 5IF6A 4EXRA 3FG1A 2A15A 3HI7A 2IUKA 5D82A 3OW22 4HBRA 2CKFB 2HMNB 2Y74A 1Q864 3SXXA 1VQN3 3FGYA 1IVUA 4PEJA 3IMAB 1SIIA 1WQLB 3CU3A 3EHCA 4KZ1A 2D42A 3QRDA 2GBWB 1NO3A 4N6NB 3NQZA 3SOAA 2Z7AA 1M1XB 2CIUA 3QK9A 2XGNA 1CQSA 2OWPA 1DMMA 4IPBA 3UB1A 2W03A 2CFLA 3ECFA 3MKIA 1D6UA 1WMOA 3LYGA 2BNGA 2YFIB 1G96A 1RRHA 3CC73 1W6CA 2XEPA 1GY6A 3EN1B 5HGRA 3X42A 2OQEA 1JJ22 1WMNA 3BNCA 3MG2A 5KP3A 1OGXA 5EQLA 5JPUA 3CD63 1YJW3 4JRFA 3DGNA 3SX1A 1QJGA 1NU3A 3UNLA 4N6UA 1YJ93 2WOHA 3PS8A 4EV5A 1FGTA 3T8NA 2OOVA 4N6V0 3EBTA 1O7HB 4RNYA 2QA43 3FH1A 4R9LA 2CWVA 2YFJB 4H3UA 4GB5A 3KN4A 1OACA 3WOFB 3IJEB 4IIAA 4N6MA 1MOLA 4XDWA 4O02B 2XFTA 3BNEA 3DGLA 3DY5A 3LTCA 3NM2A 1SQWA 3SOYA 3PYJA 1VQK3 3KFQC 3ER7A 1QVG2 3DZLA 1Y4KA 3H3HA 1GYBA 4QWTA 1JB2A 1E3RA 3CCL3 4HKVB 3HX8A 1W5ZA 1BUQA 1O7WB 3B7CA 1YHQ3 3EQQB 2CFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6G A;  3HII A;  1AVL A;  2OQE C;  2CG1 A;  1WMP A;  2CG0 A;  3AMO B;  1QAK A;  3T0U A;  2WO0 A;  3HIG A;  2CFG A;  3X40 A;  3X3X A;  1D6Y A;  3WA3 A;  2BT3 A;  1UI7 A;  1A2V A;  1PU4 A;  2Y73 A;  2IA7 A;  1IVW A;  1W2Z A;  1N9E A;  1SPU A;  1QAF A;  1AVK A;  2GU3 A;  1KSI A;  3LOY A;  3X41 A;  1EKM A;  1RKY A;  4EXR A;  3HI7 A;  3NBB A;  3PGB A;  5IW9 A;  1UI8 A;  2Y74 A;  2C11 A;  3SXX A;  1IVU A;  1W4N A;  1SII A;  3NQZ A;  4BTX A;  3X3Y A;  2E2U A;  4KFD A;  2CFL A;  1QAL A;  1AV4 A;  1D6U A;  1WMO A;  2E2V A;  4KFF A;  3KII A;  1W6C A;  3X42 A;  3N9H A;  2OQE A;  1DYU A;  1WMN A;  2CFK A;  1IVX A;  3SX1 A;  1RJO A;  2CWT A;  2WOH A;  1JRQ A;  4EV5 A;  3K5T A;  2CWU A;  2PNC A;  2YX9 A;  3NBJ A;  1US1 A;  1IQY A;  3NQY A;  2OOV A;  3MPH A;  1IU7 A;  2W0Q A;  1IVV A;  2WOF A;  2CWV A;  4KFE A;  2K0M A;  3KN4 A;  1TU5 A;  1OAC A;  2CFW A;  1LVN A;  1IQX A;  2E2T A;  4BTW A;  3ALA A;  2D1W A;  3X3Z A;  1SIH A;  2ZL8 A;  1D6Z A;  2WGQ A;  3WA2 X;  4BTY A;  3AMO A;  2C10 A;  1W5Z A;  1W7C A;  4EV2 A;  2OOV C;  2CFD A; 
#chains in the Genus database with same CATH topology
 4HM6 B;  2P0M A;  4K61 A;  2P0X A;  1NWW A;  1Q40 B;  1AVL A;  5BU4 A;  3S28 A;  2WGO A;  1WMP A;  5AEW B;  2GBX B;  2W9P A;  3Q2P A;  4RNT A;  3KCH A;  1BNG A;  3ZG5 A;  4G1M B;  2WO0 A;  6GSP A;  2XSO B;  2R4I A;  4OVM A;  4BU4 A;  2CFG A;  1X1X A;  1FGR A;  1UGH I;  2SBL A;  1BRK A;  1ZGX A;  2UGI A;  1LOV A;  5LC6 A;  1UUV B;  1BU4 A;  1SJW A;  3WA3 A;  1R4Y A;  3CCQ 3;  1UI7 A;  1A2V A;  1Q9E A;  4XDV A;  2BO9 B;  1I2E A;  2I9W A;  3NXJ A;  2Y73 A;  1O7M B;  1TUH A;  3V98 A;  1PYL A;  1ULI B;  1TIJ A;  1BSD A;  3EQQ B;  1DVC A;  1UW1 A;  3B8L A;  3GWR A;  1OCV A;  3F8H A;  3JUQ A;  3KSP A;  5IEO A;  1BAN A;  1K9M 4;  3EE1 A;  3A76 A;  3BND A;  3F14 A;  4FR9 A;  1O7N B;  3U97 A;  7GSP A;  1AVK A;  1W6Y A;  1G0T A;  5IER A;  9RNT A;  1HZ1 A;  1JNQ A;  2AAE A;  1BSA A;  1SAR A;  1EQK A;  1BNI A;  1TP6 A;  8CHO A;  2YFL B;  4N6L A;  4OUQ A;  1LXE A;  1FGQ A;  1N9J A;  4HOH A;  2C11 A;  1R4C A;  3I56 3;  1CEW I;  3D4A A;  3FZW A;  3FG3 A;  2HOH A;  3KZT A;  3LT8 A;  3NHX A;  1I3F A;  1Z1S A;  3X3Y A;  1M9G A;  2Z6B A;  3D5G A;  3OX9 A;  2E2U A;  1PFP A;  3DM8 A;  2OTJ 3;  1MWT A;  2RBI A;  4KFD A;  3UL5 A;  1IK3 A;  3CCJ 3;  2KXG A;  3HK4 A;  1X1Y A;  1QAL A;  4CJN A;  1OHO A;  3DXO A;  3I0Y A;  3OWY A;  1U8C B;  4KFF A;  3KII A;  1BNR A;  3CCE 3;  2INX A;  5AIH A;  3G8Z A;  2Z76 A;  3KKG A;  1DYU A;  2C4B A;  1TRQ A;  3M8C A;  1NB5 I;  2XFS A;  3UL6 A;  4AKY A;  3FSD A;  5BIR A;  4FMD A;  2BHM A;  2XR8 B;  3LTB A;  4HM0 B;  3J7Y d;  1W02 A;  3BB9 A;  3I55 3;  3F7S A;  2QIY A;  5BXQ A;  1NB3 I;  2CWU A;  2YX9 A;  3AGO A;  3JUO A;  1RN1 A;  1OHP A;  1US1 A;  1EG9 B;  3NV0 B;  4XB5 A;  5G2G A;  1IU7 A;  1RMS A;  2W0Q A;  2UUG C;  4RBN A;  3U1W A;  4EBG A;  1T5Y A;  4LZI A;  4I4K A;  4FCM A;  1IVV A;  1JB4 A;  2XF3 A;  3GZX B;  4I5Q A;  3PCR A;  1YGW A;  3NBR A;  1N5P A;  1FW7 A;  2Z77 A;  4FCJ A;  1IQX A;  2E2T A;  1Q42 A;  1VZZ A;  3D5I A;  3NX0 A;  2FNQ A;  1I2F A;  2W9Q A;  1GY7 A;  4HZ9 B;  5D83 A;  5M1A A;  7RNT A;  1OGZ A;  1RGK A;  2KAA A;  1SIH A;  3LT9 A;  4J5K A;  1RDS A;  2W2C A;  3D9R A;  2BMO B;  1RRL A;  1AY7 A;  2GSP A;  1MGW A;  3JUP A;  2Q07 A;  3K63 A;  1FUT A;  5AEU B;  1ROV A;  1JB5 A;  3Q1C A;  1RGA A;  1RCK A;  1LOX A;  3A5E A;  1BRI A;  1BNF A;  3LZA A;  5FW5 A;  3SVA A;  3NM7 A;  1GS3 A;  3MSO A;  4EYC A;  1QMA A;  2ZDJ A;  3G16 A;  2IMJ A;  2OOV C;  4XBY A;  1AQZ A;  1LOW A;  3CCM 3;  5A0O B;  1QVF 2;  1RGL A;  3RNT A;  1O7P B;  2LYX A;  1CYV A;  2CG1 A;  3B4O A;  4LGQ A;  2RFR A;  1QAK A;  4J8T A;  3K9M C;  3T0U A;  3OXA A;  1AR0 A;  5IG5 A;  3MG3 A;  3DGM A;  1Q82 4;  3X3X A;  1VQ5 3;  1WNH A;  1RGE A;  3DGY A;  1O7G B;  2BT3 A;  2BMR B;  3EC9 A;  3G6E 3;  5ELJ A;  1DVD A;  2B24 B;  1UGI A;  2F98 A;  1VQ8 3;  1V74 A;  1KWI A;  4XM4 A;  1YIJ 3;  1V57 A;  4R4K A;  5CLK A;  1W2Z A;  1B2X A;  3F40 A;  1M90 4;  1N9E A;  1OH0 A;  2XH9 A;  2CHC A;  2V1L A;  5G1K A;  1GMR A;  4CDL A;  3HOH A;  1BRJ A;  3X41 A;  1UCL A;  3BNB A;  2ML5 A;  3CCR 3;  3E99 A;  3NV0 A;  5EEO A;  1RKY A;  4STD A;  1JN5 A;  1FGO A;  3AHW A;  3CCS 3;  3WHO A;  3NBB A;  3PGB A;  3F7X A;  5IW9 A;  1MWS A;  5HOH A;  4N6O B;  3GSP A;  2KF4 A;  1W4N A;  3EX9 A;  4MJD A;  1U5O A;  3MG1 A;  3WMD A;  7STD A;  2PZV A;  1NDO B;  1CH0 A;  5AI1 A;  4H61 A;  1L5G B;  5FGO A;  1Q7Y 4;  3GAX A;  5ELU A;  2CC3 A;  4HAA A;  1BRN L;  1JZD A;  4BTX A;  3LTD A;  4JF8 A;  3DH2 A;  1WTH A;  1Q7H A;  1KD1 4;  3CC4 3;  1ROA A;  5D81 A;  1VQ6 3;  1K41 A;  1YGE A;  1RSN A;  2GXF A;  4GL6 A;  3LXU X;  3S67 A;  8RNT A;  1JBT A;  1BNJ A;  1GD3 A;  2H0I A;  1W01 A;  3FKA A;  4HM2 B;  1S72 3;  4WYK A;  4FMC A;  3LML A;  4LSO A;  3OWU A;  1I2G A;  1YNV X;  3LTA A;  4RNZ A;  1B3S A;  1TTO A;  5EVH A;  3EB8 A;  3K0Z A;  3ZG0 A;  5IEN A;  1BVI A;  3L0R A;  4FMB A;  4R9K A;  1W2B 2;  3G71 3;  2CFK A;  4FMA A;  1DMN A;  1BSC A;  1YIT 3;  4HYZ A;  4BIR A;  2BMQ B;  1IVX A;  2CX1 A;  1T3B A;  3URP A;  1JRQ A;  4DKI A;  3NBJ A;  5AYS C;  1BNE A;  5CF2 A;  1K28 A;  1IT8 A;  2KCD A;  4OK0 A;  3SLU A;  3NQY A;  1C7H A;  3O8Y A;  2STD A;  3CME 3;  3MPH A;  3B4P A;  3FCS B;  1FGM A;  5DRE A;  3CC2 3;  1BRG A;  1RGC A;  4K1V A;  3STD A;  3BLZ A;  3IPT A;  3MYT A;  4KVH A;  2WOF A;  3HZP A;  3WOE B;  4KFE A;  2AAD A;  1HKX A;  2K0M A;  1TU5 A;  3EN8 A;  5KP4 A;  3RDE A;  3SED A;  2F4Y A;  2CFW A;  3VGN A;  2CX0 A;  1NNV A;  3ALA A;  1TFK A;  4MMZ B;  5RNT A;  2XSH B;  2JDI H;  1UCJ A;  2HMM B;  2ML6 A;  3DMC A;  1B20 A;  3H51 A;  1VQP 3;  2ZL8 A;  2SAR A;  1D6Z A;  2WGQ A;  3V99 A;  3N8B A;  1FUW A;  4LEH A;  1RN7 A;  1BNS A;  4R80 A;  5CXO A;  4CCV A;  4NPB A;  3Q3F A;  2C10 A;  1LOY A;  4HM4 B;  1IV7 A;  1W7C A;  2HML B;  3RGA A;  4EV2 A;  6STD A;  1V58 A;  4AKZ A;  5CK6 A;  4HM3 B;  4EC6 A;  5BVB A;  1Q40 A;  4CPK A;  1JV2 B;  1FUS A;  1N8Q A;  1ISK A;  5IG4 A;  2RCD A;  2LQV A;  1X1W A;  3F8X A;  4HM1 B;  4HVN A;  4MMX B;  2CG0 A;  2OCT A;  3AMO B;  3WDG B;  4WFO A;  2KF5 A;  3HIG A;  2QEX 3;  1ASK A;  4WHA A;  3EF8 A;  3MWZ A;  1IQ8 A;  1D6Y A;  1VQO 3;  3G4S 3;  4KT3 B;  4WWU C;  2M7O A;  5IEP A;  5KP1 A;  4NHF A;  1VQ9 3;  1E3V A;  1PU4 A;  4HJL B;  2H0H A;  1RCL A;  2IA7 A;  3JVC A;  2P38 A;  1GD4 A;  3CPW 2;  1C54 A;  1F8N A;  2OTL 3;  2F56 A;  1FYS A;  5G1L A;  3TDG A;  1STD A;  1JBR A;  2XGL A;  3CNX A;  3OV4 A;  1VQL 3;  1B2Z A;  1QAF A;  5I97 A;  1FA3 A;  2GU1 A;  1OF5 A;  1KSI A;  1LQG C;  3LOY A;  3WOD G;  2K54 A;  1EKM A;  3EJV A;  3V92 A;  1X1U A;  3SYU A;  2CK3 H;  1LNH A;  4K1U A;  1A90 A;  3KSE D;  3PZW A;  5DRV A;  4ZM8 A;  1UI8 A;  3EBY A;  2FXT A;  1YI2 3;  3CXC 2;  4LMI A;  3S27 A;  1EA2 A;  1KC8 4;  3CMA 3;  3FF0 A;  3CCV 3;  1GY5 A;  4HM7 B;  4WYK B;  1GOV A;  2L4V A;  1JKG A;  1RGG A;  1LRA A;  1RNT A;  2HMK B;  1M1K 4;  4U13 A;  1MNL A;  2GEX A;  1Q81 4;  1A2P A;  6RNT A;  2O3O A;  2BU4 A;  4Q53 A;  1T2I A;  3UJM A;  3PXM A;  3GZR A;  3F9S A;  1AV4 A;  2E2V A;  1IYY A;  1RGH A;  1OPY A;  2CW9 A;  1NJI 4;  4WP5 A;  3JUN A;  3CNM A;  1STF I;  2MF7 A;  3N9H A;  3WR2 A;  2GEY A;  1RGF A;  1LQM B;  1JKG B;  3GZY B;  1JN5 B;  2R41 A;  2K3D A;  1HU9 A;  3D3L A;  2RSX A;  3PCS A;  5AYR B;  1RJO A;  2JQ5 A;  1B27 A;  3CCU 3;  2FGT A;  1YJN 3;  2CWT A;  1KQS 2;  5IG3 A;  4NRE A;  4O8S A;  4XBT A;  1ULJ B;  1T2H A;  1BIR A;  3K5T A;  5JBS A;  4RZM A;  2PNC A;  3S5C A;  2B1X B;  1UUG B;  3AHS A;  3LH4 A;  3VSY A;  3CPO A;  1IQY A;  4TX4 A;  4L8P A;  4IT7 A;  5GSP A;  2RGQ A;  1BSB A;  3ROB A;  1GMP A;  5CF1 A;  5M18 A;  2KF3 A;  2BIR A;  4X2O A;  3DGO A;  2XRX B;  4MEI A;  1GOU A;  2UX0 A;  1RHL A;  5LC7 A;  2IUJ A;  1VQ4 3;  1LVN A;  2F5W A;  5STD A;  1J2B A;  2D1W A;  4ORL A;  4HZB B;  4FCZ A;  3X3Z A;  1A67 A;  1EEJ A;  1BAO A;  4N6T A;  5JPP A;  2QGU A;  2W6J H;  3KE7 A;  4N3V A;  3WA2 X;  2CH9 A;  1OHS A;  4BTY A;  4O3V A;  3FF2 A;  1E97 A;  2P09 A;  3GZB A;  2MC8 A;  2HMJ B;  2W56 A;  3AMO A;  3OWS A;  4HM8 B;  2F86 B;  1B2U A;  3K7C A;  1RNB A;  3NUV A;  1MWR A;  1S5A A;  4GHO A;  1HYF A;  1UUW B;  2KF6 A;  2O9U X;  5AIF A;  1K8A 4;  1DMQ A;  4HM5 B;  4EW5 A;  1IV9 A;  1W6G A;  2HMO B;  4LYL B;  3HII A;  2OQE C;  5AIG A;  4L7K A;  1I0V A;  4J9A A;  4L8O A;  1UDI I;  2IYJ A;  2H0G A;  2W56 B;  3DUK A;  3G0K A;  1A2K A;  1VQM 3;  1VQ7 3;  1EUI C;  1N8R 4;  1G02 A;  1UCI A;  1PY3 A;  4R1K A;  3FLJ A;  4XBX A;  1BRH A;  1ZX2 A;  3X40 A;  4O2H A;  1RN4 A;  3MHE A;  3VF1 A;  4MMY B;  1OF5 B;  1YVB I;  2F5M A;  3T8U A;  1TFO A;  3S29 A;  4X2H A;  5AII A;  1N5H A;  2L1S A;  3FG4 A;  1DE3 A;  2KRT A;  1I70 A;  3N54 B;  4K90 B;  1IVW A;  2W04 A;  3JUM A;  1B2S A;  2P05 A;  5IG0 A;  4AEQ A;  1CYU A;  3GRD A;  1ZO2 A;  5TGN A;  3ZFZ A;  2IY2 A;  1SPU A;  3RGR A;  2GU3 A;  1W00 A;  1K73 4;  1VQQ A;  3AGN A;  3Q90 A;  1BOX A;  1IT7 A;  2RNT A;  1IDP A;  1OUN A;  2F99 A;  2J8X B;  5IF6 A;  4EXR A;  3FG1 A;  2A15 A;  3HI7 A;  2IUK A;  1TJD A;  5D82 A;  1BGS A;  3OW2 2;  1B21 A;  4BL3 A;  4HBR A;  2CKF B;  2HMN B;  2Y74 A;  1Q86 4;  1I0X A;  3SXX A;  3FGY A;  1IVU A;  4PEJ A;  1VQN 3;  1BUJ A;  3IMA B;  1SII A;  1WQL B;  3CU3 A;  1RTU A;  3EHC A;  4KZ1 A;  2D42 A;  3QRD A;  2GBW B;  1NO3 A;  4N6N B;  3NQZ A;  4BL2 A;  5M19 A;  1GSP A;  3SOA A;  2Z7A A;  1M1X B;  2CIU A;  3QK9 A;  1CQS A;  2OWP A;  2XGN A;  1DMM A;  1I8V A;  4IPB A;  1LNI A;  3UB1 A;  2W03 A;  2CFL A;  3ECF A;  3MKI A;  1D6U A;  1WMO A;  3LYG A;  2BNG A;  2YFI B;  1G96 A;  1BRS A;  1JBS A;  4GSP A;  1RRH A;  3CC7 3;  1W6C A;  2XEP A;  1GY6 A;  3EN1 B;  5HGR A;  1I3I A;  3X42 A;  1B2M A;  2OQE A;  1JJ2 2;  1WMN A;  3BNC A;  3MG2 A;  5KP3 A;  1OGX A;  5EQL A;  5JPU A;  3CD6 3;  1YJW 3;  4JRF A;  3D79 A;  3DGN A;  3SX1 A;  1QJG A;  1NU3 A;  1TRP A;  4N6U A;  3BU4 A;  3UNL A;  1YJ9 3;  1ZS7 A;  1GMQ A;  2WOH A;  3PS8 A;  4EV5 A;  1FGT A;  1DET A;  4ILF A;  1GOY A;  3T8N A;  2ZHX B;  2OOV A;  4N6V 0;  3EBT A;  1O7H B;  4RNY A;  2QA4 3;  3FH1 A;  4R9L A;  1RLS A;  2CWV A;  2YFJ B;  4H3U A;  4GB5 A;  1MWU A;  3KN4 A;  1OAC A;  1YVS A;  3WOF B;  3IJE B;  4IIA A;  4N6M A;  1MOL A;  1UCK A;  4XDW A;  4O02 B;  2XFT A;  3BNE A;  3DGL A;  3DY5 A;  4BTW A;  3LTC A;  3NM2 A;  1SQW A;  3BIR A;  3SOY A;  1FZU A;  3PYJ A;  1VQK 3;  4J5G A;  1JZO A;  3KFQ C;  3ER7 A;  1MGR A;  1QVG 2;  2ZA4 A;  3DZL A;  1Y4K A;  3H3H A;  1GYB A;  4QWT A;  1JB2 A;  1E3R A;  3CCL 3;  4HKV B;  3HX8 A;  1W5Z A;  1BUQ A;  1O7W B;  3B7C A;  1YHQ 3;  1BSE A;  2CFD A; 
#chains in the Genus database with same CATH homology
 4HM6 B;  2P0M A;  4K61 A;  2P0X A;  1NWW A;  1Q40 B;  1AVL A;  3S28 A;  2WGO A;  1WMP A;  5AEW B;  2GBX B;  2W9P A;  3Q2P A;  4G1M B;  2WO0 A;  2XSO B;  2R4I A;  4OVM A;  2CFG A;  1FGR A;  2SBL A;  3WA3 A;  5LC6 A;  1UUV B;  1SJW A;  3CCQ 3;  1UI7 A;  1A2V A;  4XDV A;  2BO9 B;  2I9W A;  3NXJ A;  2Y73 A;  1O7M B;  1TUH A;  3V98 A;  1ULI B;  1TIJ A;  3GWR A;  1DVC A;  3B8L A;  1UW1 A;  1OCV A;  3F8H A;  3JUQ A;  3KSP A;  5IEO A;  1K9M 4;  3EE1 A;  3A76 A;  3BND A;  3F14 A;  4FR9 A;  1O7N B;  3U97 A;  1AVK A;  1W6Y A;  5IER A;  1JNQ A;  1EQK A;  1TP6 A;  8CHO A;  2YFL B;  4N6L A;  4OUQ A;  1LXE A;  1FGQ A;  1N9J A;  2C11 A;  1R4C A;  3I56 3;  1CEW I;  3FZW A;  3FG3 A;  3KZT A;  3LT8 A;  3NHX A;  1Z1S A;  3X3Y A;  1M9G A;  2Z6B A;  3OX9 A;  2E2U A;  1PFP A;  3DM8 A;  2OTJ 3;  1IK3 A;  3UL5 A;  4KFD A;  3CCJ 3;  2KXG A;  3HK4 A;  1QAL A;  1OHO A;  3DXO A;  3I0Y A;  3OWY A;  1U8C B;  4KFF A;  3KII A;  3CCE 3;  2INX A;  5AIH A;  3G8Z A;  2Z76 A;  3KKG A;  1DYU A;  3M8C A;  1NB5 I;  2XFS A;  3UL6 A;  4AKY A;  3FSD A;  4FMD A;  2BHM A;  2XR8 B;  3LTB A;  4HM0 B;  3J7Y d;  1W02 A;  3BB9 A;  3I55 3;  3F7S A;  2QIY A;  5BXQ A;  1NB3 I;  2CWU A;  2YX9 A;  3JUO A;  1OHP A;  1US1 A;  1EG9 B;  3NV0 B;  4XB5 A;  5G2G A;  1IU7 A;  2W0Q A;  4RBN A;  3U1W A;  4EBG A;  1T5Y A;  4LZI A;  4I4K A;  4FCM A;  1IVV A;  1JB4 A;  2XF3 A;  3GZX B;  3PCR A;  3NBR A;  1N5P A;  2Z77 A;  4FCJ A;  1IQX A;  1Q42 A;  1VZZ A;  2E2T A;  3NX0 A;  5D83 A;  2FNQ A;  2W9Q A;  4HZ9 B;  1GY7 A;  4BTW A;  1OGZ A;  3LT9 A;  1SIH A;  2W2C A;  3D9R A;  2BMO B;  1RRL A;  3JUP A;  2Q07 A;  3K63 A;  5AEU B;  1ROV A;  1JB5 A;  3Q1C A;  1LOX A;  3SVA A;  3LZA A;  5FW5 A;  3NM7 A;  1GS3 A;  3MSO A;  4EYC A;  1QMA A;  2ZDJ A;  3G16 A;  2OOV C;  2IMJ A;  4XBY A;  3CCM 3;  5A0O B;  1QVF 2;  1O7P B;  2LYX A;  1CYV A;  2CG1 A;  3B4O A;  4LGQ A;  2RFR A;  1QAK A;  4J8T A;  3K9M C;  3T0U A;  3OXA A;  1AR0 A;  5IG5 A;  3MG3 A;  3DGM A;  1Q82 4;  3X3X A;  1VQ5 3;  1WNH A;  1O7G B;  2BT3 A;  2BMR B;  3EC9 A;  3G6E 3;  5ELJ A;  1DVD A;  2B24 B;  2F98 A;  1VQ8 3;  1V74 A;  1KWI A;  4XM4 A;  1YIJ 3;  4R4K A;  5CLK A;  1W2Z A;  3F40 A;  1M90 4;  1N9E A;  1OH0 A;  2XH9 A;  2CHC A;  2V1L A;  4CDL A;  3X41 A;  3BNB A;  3CCR 3;  2ML5 A;  3E99 A;  3NV0 A;  5EEO A;  1RKY A;  4STD A;  1JN5 A;  1FGO A;  3CCS 3;  3NBB A;  3PGB A;  3F7X A;  5IW9 A;  4N6O B;  1W4N A;  3EX9 A;  4MJD A;  1U5O A;  3MG1 A;  3WMD A;  7STD A;  2PZV A;  1NDO B;  5AI1 A;  4H61 A;  1L5G B;  5FGO A;  1Q7Y 4;  3GAX A;  5ELU A;  2CC3 A;  4BTX A;  3LTD A;  4JF8 A;  1WTH A;  1KD1 4;  3CC4 3;  1ROA A;  5D81 A;  1VQ6 3;  1K41 A;  1YGE A;  2GXF A;  4GL6 A;  3LXU X;  3S67 A;  1GD3 A;  3FKA A;  1W01 A;  1S72 3;  4HM2 B;  4WYK A;  4FMC A;  3LML A;  4LSO A;  3OWU A;  3LTA A;  4RNZ A;  5IEN A;  5EVH A;  3EB8 A;  3K0Z A;  4R9K A;  3L0R A;  4FMB A;  1W2B 2;  3G71 3;  2CFK A;  4FMA A;  1DMN A;  1YIT 3;  4HYZ A;  2BMQ B;  1IVX A;  1JRQ A;  3NBJ A;  5AYS C;  5CF2 A;  1K28 A;  1IT8 A;  2KCD A;  4OK0 A;  3SLU A;  3NQY A;  1C7H A;  3O8Y A;  2STD A;  3CME 3;  3MPH A;  3B4P A;  3FCS B;  1FGM A;  5DRE A;  3CC2 3;  4K1V A;  3STD A;  3BLZ A;  3IPT A;  3MYT A;  4KVH A;  2WOF A;  3HZP A;  3WOE B;  4KFE A;  1HKX A;  2K0M A;  1TU5 A;  3EN8 A;  5KP4 A;  3RDE A;  3SED A;  2CFW A;  3VGN A;  3ALA A;  1TFK A;  4MMZ B;  2XSH B;  2JDI H;  2HMM B;  2ML6 A;  3DMC A;  3H51 A;  1VQP 3;  2ZL8 A;  1D6Z A;  2WGQ A;  3V99 A;  3N8B A;  1FUW A;  4LEH A;  1RN7 A;  4R80 A;  5CXO A;  4CCV A;  2C10 A;  4HM4 B;  1IV7 A;  1W7C A;  2HML B;  3RGA A;  4EV2 A;  6STD A;  4AKZ A;  5CK6 A;  4HM3 B;  4EC6 A;  5BVB A;  1Q40 A;  1JV2 B;  1N8Q A;  1ISK A;  5IG4 A;  2RCD A;  2LQV A;  3F8X A;  4HM1 B;  4HVN A;  4MMX B;  2CG0 A;  2OCT A;  3AMO B;  3WDG B;  4WFO A;  3HIG A;  2QEX 3;  1ASK A;  4WHA A;  3EF8 A;  3MWZ A;  1IQ8 A;  1D6Y A;  1VQO 3;  3G4S 3;  4WWU C;  2M7O A;  5IEP A;  5KP1 A;  4NHF A;  1VQ9 3;  1E3V A;  1PU4 A;  4HJL B;  2IA7 A;  3JVC A;  2P38 A;  1GD4 A;  3CPW 2;  1F8N A;  2OTL 3;  3TDG A;  1STD A;  2XGL A;  3CNX A;  3OV4 A;  1VQL 3;  1QAF A;  5I97 A;  1FA3 A;  2GU1 A;  1OF5 A;  1KSI A;  3LOY A;  3WOD G;  2K54 A;  1EKM A;  3EJV A;  3V92 A;  2CK3 H;  1LNH A;  4K1U A;  1A90 A;  3KSE D;  3PZW A;  5DRV A;  4ZM8 A;  1UI8 A;  3EBY A;  2FXT A;  1YI2 3;  3CXC 2;  4LMI A;  3S27 A;  1EA2 A;  1KC8 4;  3CMA 3;  3FF0 A;  3CCV 3;  1GY5 A;  4HM7 B;  4WYK B;  2L4V A;  1JKG A;  1M1K 4;  2HMK B;  4U13 A;  1MNL A;  2GEX A;  1Q81 4;  2O3O A;  4Q53 A;  3UJM A;  3PXM A;  3GZR A;  3F9S A;  1AV4 A;  2E2V A;  1OPY A;  2CW9 A;  1NJI 4;  4WP5 A;  3JUN A;  3CNM A;  1STF I;  2MF7 A;  3N9H A;  2GEY A;  1JKG B;  3GZY B;  1JN5 B;  1HU9 A;  3D3L A;  2RSX A;  3PCS A;  5AYR B;  1RJO A;  2JQ5 A;  3CCU 3;  2FGT A;  1YJN 3;  2CWT A;  1KQS 2;  5IG3 A;  4NRE A;  4O8S A;  4XBT A;  1ULJ B;  5JBS A;  3K5T A;  4RZM A;  2PNC A;  3S5C A;  2B1X B;  3LH4 A;  3VSY A;  3CPO A;  1IQY A;  4TX4 A;  4L8P A;  4IT7 A;  3ROB A;  2RGQ A;  5CF1 A;  4X2O A;  3DGO A;  2XRX B;  4MEI A;  2UX0 A;  5LC7 A;  2IUJ A;  1VQ4 3;  1LVN A;  5STD A;  1J2B A;  2D1W A;  4ORL A;  4HZB B;  4FCZ A;  3X3Z A;  1A67 A;  4N6T A;  5JPP A;  2QGU A;  2W6J H;  3KE7 A;  4N3V A;  3WA2 X;  2CH9 A;  1OHS A;  4BTY A;  4O3V A;  3FF2 A;  1E97 A;  2P09 A;  3GZB A;  2MC8 A;  2HMJ B;  2W56 A;  3AMO A;  3OWS A;  4HM8 B;  2F86 B;  3K7C A;  3NUV A;  1S5A A;  1UUW B;  2O9U X;  5AIF A;  1K8A 4;  1DMQ A;  4HM5 B;  1IV9 A;  1W6G A;  2HMO B;  3HII A;  2OQE C;  5AIG A;  4L7K A;  4J9A A;  4L8O A;  1VQM 3;  2W56 B;  3DUK A;  3G0K A;  1A2K A;  1VQ7 3;  1N8R 4;  4R1K A;  4XBX A;  3FLJ A;  1ZX2 A;  3X40 A;  4O2H A;  3VF1 A;  3MHE A;  4MMY B;  1OF5 B;  1YVB I;  3T8U A;  1TFO A;  3S29 A;  4X2H A;  5AII A;  1N5H A;  3FG4 A;  2KRT A;  3N54 B;  4K90 B;  1IVW A;  2W04 A;  3JUM A;  5IG0 A;  2P05 A;  4AEQ A;  1CYU A;  3GRD A;  1ZO2 A;  5TGN A;  1SPU A;  3RGR A;  2GU3 A;  1W00 A;  1K73 4;  3Q90 A;  1IT7 A;  1IDP A;  1OUN A;  2F99 A;  5IF6 A;  4EXR A;  3FG1 A;  2A15 A;  3HI7 A;  2IUK A;  5D82 A;  3OW2 2;  4HBR A;  2CKF B;  2HMN B;  2Y74 A;  1Q86 4;  3SXX A;  1VQN 3;  3FGY A;  1IVU A;  4PEJ A;  3IMA B;  1SII A;  1WQL B;  3CU3 A;  3EHC A;  4KZ1 A;  2D42 A;  3QRD A;  2GBW B;  1NO3 A;  4N6N B;  3NQZ A;  3SOA A;  2Z7A A;  1M1X B;  2CIU A;  3QK9 A;  2XGN A;  1CQS A;  2OWP A;  1DMM A;  4IPB A;  3UB1 A;  2W03 A;  2CFL A;  3ECF A;  3MKI A;  1D6U A;  1WMO A;  3LYG A;  2BNG A;  2YFI B;  1G96 A;  1RRH A;  3CC7 3;  1W6C A;  2XEP A;  1GY6 A;  3EN1 B;  5HGR A;  3X42 A;  2OQE A;  1JJ2 2;  1WMN A;  3BNC A;  3MG2 A;  5KP3 A;  1OGX A;  5EQL A;  5JPU A;  3CD6 3;  1YJW 3;  4JRF A;  3DGN A;  3SX1 A;  1QJG A;  1NU3 A;  3UNL A;  4N6U A;  1YJ9 3;  2WOH A;  3PS8 A;  4EV5 A;  1FGT A;  3T8N A;  2OOV A;  4N6V 0;  3EBT A;  1O7H B;  4RNY A;  2QA4 3;  3FH1 A;  4R9L A;  2CWV A;  2YFJ B;  4H3U A;  4GB5 A;  3KN4 A;  1OAC A;  3WOF B;  3IJE B;  4IIA A;  4N6M A;  1MOL A;  4XDW A;  4O02 B;  2XFT A;  3BNE A;  3DGL A;  3DY5 A;  3LTC A;  3NM2 A;  1SQW A;  3SOY A;  3PYJ A;  1VQK 3;  3KFQ C;  3ER7 A;  1QVG 2;  3DZL A;  1Y4K A;  3H3H A;  1GYB A;  4QWT A;  1JB2 A;  1E3R A;  3CCL 3;  4HKV B;  3HX8 A;  1W5Z A;  1BUQ A;  1O7W B;  3B7C A;  1YHQ 3;  3EQQ B;  2CFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...