2GU3A

Ypmb protein from bacillus subtilis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
KEEGHEAAAAEAKKETDLAHVDQVETFVGKEKYYVVKGTDKKGTALYVWVPADKKAKILSKEAKEGISEDKAAKIIKDEGLVSKQKEVHLAREGNVLLWEVTYLDKEGQYSLSYVDFTTGKILKNITP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YpmB protein
publication title X-ray crystal structure of YpmB protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF17881 DUF5590 Domain of unknown function (DUF5590)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A01
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu3A02
1LVNA 1AVLA 2WOHA 1PU4A 1US1A 2E2UA 3NQZA 3AMOA 3X3ZA 4EXRA 2Y73A 2CWTA 1IVVA 2OOVC 2W0QA 3X3XA 2ZL8A 1RJOA 3T0UA 2WGQA 3N9HA 4KFFA 4BTWA 2D1WA 1IVWA 1A2VA 3KIIA 1QAFA 2C11A 1W7CA 1UI7A 2OQEA 2K0MA 1DYUA 3NBJA 1WMPA 2BT3A 4BTXA 4KFEA 2WO0A 2CFWA 1WMOA 1QALA 3PGBA 3K5TA 1SIHA 4KFDA 1W2ZA 3KN4A 3MPHA 1SIIA 1KSIA 2CFGA 1JRQA 4EV5A 2OQEC 4BTYA 3WA2X 2IA7A 3SXXA 3ALAA 2WOFA 1W6CA 3NBBA 1SPUA 1W4NA 2PNCA 1IQYA 1AVKA 3LOYA 3X42A 1W5ZA 2GU3A 1EKMA 1N9EA 2CG1A 1RKYA 2CWVA 4EV2A 3WA3A 1IU7A 3X3YA 2E2VA 3X40A 2CWUA 5IW9A 1D6UA 2E2TA 1TU5A 2CFDA 1IVUA 1OACA 2CFLA 1AV4A 2CFKA 1WMNA 2YX9A 2C10A 1QAKA 3X41A 3AMOB 1D6ZA 3HIIA 3NQYA 1UI8A 2OOVA 2CG0A 3HIGA 3HI7A 1D6YA 1IVXA 3SX1A 1W6GA 1IQXA 2Y74A
chains in the Genus database with same CATH superfamily
1AVLA 2M7OA 4RNZA 4I4KA 2ZHXB 1LQMB 1Q824 3T8NA 3DZLA 4O8SA 4O2HA 5HOHA 5KP1A 3Q90A 4K1UA 1Q42A 1ZO2A 2JQ5A 3HOHA 3NQZA 3AMOA 4N6NB 2B1XB 3X3ZA 1Q814 4X2HA 3LYGA 4XM4A 4XDWA 5BIRA 3MWZA 5IG0A 1N5PA 5M1AA 2H0GA 1O7HB 1ROAA 1RGLA 2BMQB 1RJOA 1UGHI 1YJW3 3N9HA 1IDPA 1BIRA 4KFFA 3UL5A 4BTWA 1MGRA 2IUKA 2XR8B 1OPYA 3ER7A 3GRDA 3O8YA 1UI7A 2RFRA 3EE1A 2XSOB 4CPKA 2KAAA 3MKIA 2F86B 2GBXB 1C54A 1AR0A 2W04A 1Y4KA 1LNHA 4G1MB 1WMPA 2BT3A 4LZIA 2RSXA 4KFEA 1QVG2 1FUTA 5KP4A 2WO0A 2CFWA 5ELJA 3PGBA 4EBGA 2Q07A 5I97A 5DRVA 1STFI 4R9KA 1N8QA 4GSPA 4MMYB 5D82A 1IT7A 4U13A 3CCJ3 1T2IA 1FUWA 4CJNA 1GYBA 2XFTA 1C7HA 3JUQA 4FCJA 1RRLA 1B2UA 3D5IA 1KSIA 2P05A 4J9AA 3DGYA 4N6MA 1NWWA 4J5GA 1VQ83 1V74A 1BNEA 3PXMA 2CX0A 1M904 3WODG 1UUWB 2IA7A 3SXXA 1RGFA 1TIJA 4LYLB 4X2OA 2GBWB 4FMDA 1I0VA 5STDA 3VF1A 1GOYA 3FZWA 1BNJA 4IT7A 1ZS7A 4HKVB 4LEHA 5G2GA 4KT3B 3S29A 1GSPA 4IIAA 1BRJA 7STDA 2Z7AA 3G8ZA 5D83A 5AYRB 2HMJB 1BU4A 3GZRA 1GS3A 4RNYA 4TX4A 1W5ZA 3X42A 1RNBA 2GU3A 3BNBA 1N9EA 2CG1A 1QVF2 1GD4A 2CWVA 3N8BA 1OUNA 1ZX2A 6STDA 1YHQ3 6GSPA 1BSCA 1STDA 5AEUB 1RGKA 4ILFA 1BSAA 2OTJ3 3GZXB 2ML5A 2KRTA 4EC6A 5IF6A 3PZWA 2E2TA 4HM1B 1TU5A 5AEWB 1QMAA 1JN5A 3SLUA 1IVUA 3KSPA 1AY7A 5BXQA 2CFKA 4O3VA 2Z76A 3KCHA 2H0IA 3NV0B 1K9M4 2HMMB 1QAKA 3LTCA 1BOXA 2QA43 1BAOA 4OVMA 1TTOA 1PFPA 2IYJA 3G6E3 3G713 3STDA 4MMZB 1VQM3 3PCSA 1D6ZA 3Q2PA 4N3VA 2CC3A 3NXJA 2YFIB 1LRAA 3OWSA 1M1K4 3MG2A 4N6UA 2OTL3 3F14A 2XEPA 2INXA 2Z77A 5G1KA 3FG4A 4MJDA 3D9RA 1JZOA 1UI8A 2OOVA 1JBRA 1CYUA 3LXUX 1UGIA 4FCZA 3S67A 2UGIA 2GU1A 3HI7A 1I3IA 1N9JA 1BVIA 4GB5A 1BNRA 1RGGA 3KZTA 4R80A 4AEQA 1UCJA 1GMRA 3B4OA 3JUOA 1A2PA 3FCSB 4AKZA 2FNQA 2ML6A 4L8OA 1PU4A 4NHFA 1US1A 1JZDA 1J2BA 4EW5A 1B21A 3HX8A 3SOYA 3GSPA 4O02B 4STDA 1HZ1A 1IVVA 2OOVC 3QRDA 3LTDA 4XB5A 3BLZA 5GSPA 3X3XA 1W00A 1EUIC 4BL2A 5A0OB 1MWUA 2P0XA 5AIIA 1VQ53 1RN7A 1T3BA 8RNTA 3CCS3 2RCDA 3CMA3 2D1WA 1IVWA 4GL6A 2PZVA 2CIUA 4LMIA 3SEDA 1PY3A 2AADA 2H0HA 2XGLA 3WDGB 1RCLA 1MWRA 3CD63 4RZMA 1DYUA 1GY6A 3NBJA 2K3DA 1OF5A 4J5KA 2BHMA 2QGUA 1VQ63 4BTXA 1BANA 5AI1A 6RNTA 1WMOA 1QALA 1E3RA 3F7XA 3D3LA 1KQS2 1T2HA 1BSBA 9RNTA 1TRQA 1RDSA 1W2ZA 1GMQA 3ROBA 1FGTA 4HBRA 5JPPA 1HKXA 2IUJA 4FCMA 3B8LA 3S28A 3EB8A 1YGEA 3HK4A 1VQQA 5IEPA 3SOAA 3F9SA 3B7CA 4N6LA 2GEYA 1RHLA 1E3VA 2STDA 3I563 2KF6A 2ZDJA 3IMAB 2B24B 4XDVA 1RMSA 3ALAA 1OH0A 3TDGA 3CC43 3D5GA 1LNIA 2W9QA 2LQVA 1CH0A 1B27A 1JNQA 2W6JH 2MF7A 1W4NA 3MSOA 1ULIB 4LSOA 4H61A 1IQYA 2GSPA 1AVKA 1LOWA 1DVDA 3KSED 1CEWI 1RNTA 1DETA 1O7WB 2J8XB 1JB4A 3Q1CA 1NJI4 1O7NB 1FA3A 1RN4A 1YJ93 3CPW2 2KF4A 1BRKA 3WA3A 1BRNL 1LOYA 3CME3 2WGOA 1DMNA 1Q40B 1YVSA 3BU4A 3FLJA 1MWTA 2CWUA 2W2CA 5IG3A 5IW9A 1O7PB 3H3HA 3CCE3 3CCU3 3CNMA 3AGNA 3DGLA 1YNVX 1JB2A 1BSEA 2CFDA 2RBIA 1VQ73 3DMCA 1AV4A 2CX1A 3NX0A 4N6V0 1A67A 1NU3A 1MGWA 2YX9A 3DGOA 2C10A 3FH1A 3G16A 3WOEB 3WMDA 1U8CB 4HM5B 2KF5A 3WOFB 4WFOA 3NUVA 3UB1A 1VQ43 2FGTA 3LT9A 3HIIA 5IENA 1Q7HA 2MC8A 1GOVA 5LC7A 5ELUA 1RN1A 1IK3A 2JDIH 1UDII 1TRPA 2F98A 3Q3FA 4HZBB 5CF2A 1R4CA 1VQ93 1GY5A 3AHSA 1OHPA 3RNTA 2CG0A 3NBRA 3ZFZA 1I2EA 4HAAA 3DM8A 1DMMA 5KP3A 1N8R4 3HZPA 2L4VA 3B4PA 4WYKB 2KXGA 1RRHA 3EHCA 4OK0A 2BO9B 4OUQA 5FGOA 4BIRA 3DH2A 4HJLB 4WWUC 3BNDA 1OHOA 1BGSA 2WOHA 3NV0A 2IMJA 2BU4A 7GSPA 1W2B2 1YGWA 4I5QA 5IG4A 1WQLB 1DVCA 1RGCA 2F99A 4MEIA 4QWTA 3A76A 1O7GB 3GZBA 5AIFA 1RGEA 1K41A 2HOHA 1NO3A 3K7CA 2Y73A 1VQL3 1EG9B 1FGMA 2KCDA 2W0QA 2W03A 2R4IA 1UCKA 2ZL8A 4XBYA 3CC73 1GY7A 1ISKA 1LQGC 1W01A 1IV9A 2WGQA 1B2ZA 1I8VA 2YFLB 3CPOA 2W56A 4HM6B 2XRXB 1JBTA 1VZZA 3FF0A 1AQZA 1RSNA 3CCR3 1Q864 2UUGC 1HYFA 1QAFA 1CYVA 3EF8A 1G02A 3LMLA 2C11A 1W7CA 3EC9A 2OQEA 1L5GB 1OCVA 1E97A 4HZ9B 2RGQA 3DY5A 3FG3A 1NB5I 2I9WA 1UCLA 1MOLA 3RGRA 1UUVB 3VSYA 2KF3A 1EA2A 8CHOA 1B2XA 2QIYA 1SARA 3KFQC 2SARA 4ZM8A 1SIHA 2CH9A 2C4BA 4DKIA 3KN4A 4HOHA 1RLSA 3G4S3 2UX0A 3I553 1PYLA 2L1SA 3K9MC 5M18A 1X1UA 1JKGB 4H3UA 1KWIA 1W6YA 3ZG5A 5IG5A 3KE7A 4EV5A 1K28A 1JBSA 3AGOA 2OQEC 3EJVA 1I0XA 3V92A 3WA2X 2V1LA 2AAEA 2WOFA 1BRGA 1VQN3 1TJDA 4HM0B 3DUKA 1O7MB 3A5EA 1SPUA 4L7KA 3UL6A 1BRHA 3D79A 1JJ22 3F8HA 1OHSA 2F5WA 2HMOB 4J8TA 1FW7A 1M9GA 2K54A 4GHOA 3U1WA 1TFOA 3LOYA 2P38A 4K61A 4HM4B 1RKYA 5CXOA 5EEOA 2P0MA 1X1WA 3QK9A 3NHXA 3CCL3 3PS8A 4EV2A 2OWPA 4FR9A 1IU7A 3X3YA 2E2VA 1A90A 1MWSA 4FMCA 3X40A 2CW9A 1D6UA 3FGYA 4WP5A 2HMKB 5EQLA 3MG3A 1K8A4 5CF1A 4HVNA 3RDEA 1S5AA 2CFLA 3EBYA 1RGAA 1WMNA 2BMOB 3LTAA 2BNGA 1YVBI 2XSHB 3EN8A 4FMAA 3V99A 1BRIA 1A2KA 3AMOB 1LXEA 3EN1B 2HMLB 1ULJB 4IPBA 1M1XB 1FGRA 4NREA 5JBSA 1I3FA 3OX9A 3EBTA 5BU4A 5M19A 3SYUA 1FUSA 3G0KA 3LTBA 3NQYA 5TGNA 1I70A 3EX9A 2P09A 4R4KA 1TFKA 1YJN3 1RCKA 4N6TA 5FW5A 3JUMA 1Q40A 1IYYA 1GD3A 3FF2A 5AIHA 1EQKA 4PEJA 1D6YA 1IVXA 3SX1A 3BNCA 1W6GA 2BIRA 1LVNA 1IQ8A 4K1VA 4KZ1A 3F40A 1BUJA 4ORLA 3FKAA 1G0TA 1DE3A 1I2FA 3CCV3 1QJGA 1ZGXA 1WTHA 1B3SA 4L8PA 2D42A 1Q9EA 1V57A 1ASKA 5AIGA 2XH9A 3U97A 2E2UA 1IT8A 1CQSA 2IY2A 5EVHA 3S27A 1UW1A 3OV4A 4RNTA 4EXRA 3CCQ3 1V58A 1NNVA 2CWTA 1U5OA 4BU4A 2XFSA 3I0YA 1KD14 1YI23 3IPTA 3T0UA 3PCRA 3DGNA 3OWUA 2A15A 3K0ZA 3NM2A 1GMPA 3OXAA 3JUNA 4HYZA 1IV7A 4AKYA 1A2VA 3KIIA 4R9LA 5RNTA 1JV2B 1UCIA 1BNGA 1VQO3 1KC84 4K90B 1SQWA 1G96A 3GZYB 1B2SA 1F8NA 3BB9A 3JUPA 2K0MA 4XBTA 2FXTA 2BMRB 4CCVA 4WYKA 3D4AA 1FYSA 1NDOB 5BVBA 1VQK3 1ROVA 1BRSA 2CKFB 3GAXA 5IEOA 3URPA 3CU3A 1FGOA 2W9PA 4KVHA 4XBXA 2LYXA 2GXFA 2R41A 3K5TA 4KFDA 5IERA 1B2MA 1RTUA 1BUQA 1LOXA 4HM2B 3NM7A 3EQQB 2HMNB 3OW22 1K734 3BNEA 3MPHA 1UUGB 1SIIA 1W02A 3PYJA 5CLKA 1S723 3S5CA 2CFGA 1NB3I 3LH4A 1JRQA 3CC23 1SJWA 1JN5B 1HU9A 4BTYA 4EYCA 4WHAA 3MHEA 1T5YA 5HGRA 1TUHA 2F4YA 1Q7Y4 5DREA 3M8CA 1MNLA 1B20A 1W6CA 3MYTA 1YIT3 1WNHA 2XGNA 4JRFA 3BIRA 3NBBA 3SVAA 2O9UX 2OCTA 3UJMA 2PNCA 3E99A 7RNTA 3L0RA 3JVCA 5AYSC 1VQP3 1YIJ3 1BNIA 3ZG0A 3WHOA 3KKGA 4LGQA 4RBNA 3OWYA 1EKMA 1FGQA 4HM3B 2W56B 1OGXA 2YFJB 3GWRA 1FZUA 4FMBA 3CNXA 1TP6A 1Z1SA 3IJEB 3WR2A 4NPBA 5CK6A 1JKGA 5G1LA 2CK3H 3DGMA 4N6OB 1BNFA 3RGAA 5JPUA 4MMXB 3FSDA 5D81A 4CDLA 2Z6BA 3FG1A 3CCM3 1DMQA 1OACA 1I2GA 1X1XA 3V98A 4JF8A 2CHCA 2RNTA 3CXC2 3LT8A 3X41A 2XF3A 5LC6A 1JB5A 1RGHA 3J7Yd 3ECFA 2SBLA 3UNLA 1BSDA 3N54B 3F7SA 3MG1A 2O3OA 3H51A 2F5MA 4R1KA 3VGNA 4Q53A 3F8XA 4HM8B 1X1YA 2F56A 3AHWA 4BL3A 3K63A 1OGZA 3DXOA 2GEXA 2QEX3 2ZA4A 3LZAA 3HIGA 1N5HA 3T8UA 1BNSA 1GOUA 1OF5B 1LOVA 1IQXA 1R4YA 1EEJA 4HM7B 2Y74A
chains in the Genus database with same CATH topology
1AVLA 2M7OA 4RNZA 4I4KA 1Q824 3T8NA 3DZLA 4O8SA 4O2HA 5KP1A 3Q90A 4K1UA 1Q42A 1ZO2A 2JQ5A 3NQZA 4N6NB 3AMOA 1Q814 2B1XB 3X3ZA 4X2HA 3LYGA 4XM4A 4XDWA 3MWZA 5IG0A 1N5PA 1O7HB 1ROAA 2BMQB 1RJOA 1YJW3 3N9HA 1IDPA 4KFFA 4BTWA 3UL5A 2IUKA 2XR8B 1OPYA 3ER7A 3GRDA 3O8YA 1UI7A 2RFRA 3EE1A 2XSOB 3MKIA 2F86B 2GBXB 1AR0A 2W04A 1Y4KA 1LNHA 4G1MB 1WMPA 2BT3A 4LZIA 2RSXA 4KFEA 1QVG2 5KP4A 2WO0A 2CFWA 5ELJA 3PGBA 4EBGA 2Q07A 5I97A 5DRVA 1STFI 4R9KA 1N8QA 4MMYB 5D82A 1IT7A 4U13A 3CCJ3 1FUWA 1GYBA 2XFTA 1C7HA 3JUQA 4FCJA 1RRLA 1KSIA 2P05A 4J9AA 4N6MA 1NWWA 1VQ83 1V74A 3PXMA 1M904 3WODG 1UUWB 2IA7A 3SXXA 1TIJA 4X2OA 2GBWB 4FMDA 3VF1A 5STDA 3FZWA 4IT7A 4LEHA 4HKVB 5G2GA 3S29A 4IIAA 7STDA 2Z7AA 3G8ZA 5D83A 5AYRB 2HMJB 3GZRA 1GS3A 4RNYA 4TX4A 1W5ZA 3X42A 2GU3A 3BNBA 1N9EA 2CG1A 1QVF2 1GD4A 2CWVA 3N8BA 1OUNA 1ZX2A 6STDA 1YHQ3 1STDA 5AEUB 2OTJ3 3GZXB 2ML5A 2KRTA 4EC6A 5IF6A 3PZWA 2E2TA 4HM1B 1TU5A 5AEWB 1QMAA 1JN5A 3SLUA 1IVUA 3KSPA 5BXQA 2CFKA 4O3VA 2Z76A 3NV0B 1K9M4 2HMMB 1QAKA 3LTCA 2QA43 4OVMA 1PFPA 3G6E3 3G713 3STDA 4MMZB 1VQM3 3PCSA 1D6ZA 3Q2PA 4N3VA 2CC3A 3NXJA 2YFIB 3OWSA 1M1K4 3MG2A 4N6UA 2OTL3 3F14A 2XEPA 2INXA 2Z77A 3FG4A 4MJDA 3D9RA 1UI8A 2OOVA 1CYUA 3LXUX 4FCZA 3S67A 2GU1A 3HI7A 1N9JA 4GB5A 3KZTA 4R80A 4AEQA 3B4OA 3JUOA 3FCSB 4AKZA 2FNQA 2ML6A 4L8OA 1PU4A 4NHFA 1US1A 1J2BA 3SOYA 3HX8A 4O02B 4STDA 1IVVA 2OOVC 3QRDA 3LTDA 4XB5A 3BLZA 3X3XA 1W00A 5A0OB 2P0XA 5AIIA 1VQ53 1RN7A 3CCS3 2RCDA 3CMA3 2D1WA 1IVWA 4GL6A 2PZVA 2CIUA 4LMIA 3SEDA 3WDGB 2XGLA 3CD63 4RZMA 1DYUA 1GY6A 3NBJA 1OF5A 2BHMA 2QGUA 1VQ63 4BTXA 5AI1A 1WMOA 1QALA 1E3RA 3F7XA 3D3LA 1KQS2 1W2ZA 3ROBA 1FGTA 4HBRA 5JPPA 1HKXA 2IUJA 4FCMA 3B8LA 3S28A 3EB8A 1YGEA 3HK4A 5IEPA 3SOAA 3F9SA 3B7CA 4N6LA 2GEYA 1E3VA 2STDA 3I563 2ZDJA 3IMAB 2B24B 4XDVA 3ALAA 3CC43 1OH0A 3TDGA 2W9QA 2LQVA 1JNQA 2W6JH 2MF7A 1W4NA 3MSOA 1ULIB 4LSOA 4H61A 1IQYA 1AVKA 1DVDA 3KSED 1CEWI 1O7WB 3Q1CA 1JB4A 1NJI4 1O7NB 1FA3A 1YJ93 3CPW2 3WA3A 3CME3 2WGOA 1DMNA 1Q40B 3FLJA 2CWUA 2W2CA 5IG3A 5IW9A 1O7PB 3H3HA 3CCE3 3CCU3 3CNMA 3DGLA 2CFDA 1JB2A 1VQ73 3DMCA 1AV4A 3NX0A 4N6V0 1A67A 1NU3A 2YX9A 3G16A 3DGOA 2C10A 3FH1A 3WOEB 3WMDA 1U8CB 4HM5B 3WOFB 4WFOA 3NUVA 3UB1A 1VQ43 2FGTA 3LT9A 3HIIA 5IENA 2MC8A 5LC7A 5ELUA 1IK3A 2JDIH 2F98A 5CF2A 4HZBB 1VQ93 1R4CA 1GY5A 1OHPA 2CG0A 3NBRA 3DM8A 1DMMA 5KP3A 1N8R4 3HZPA 2L4VA 3B4PA 4WYKB 2KXGA 1RRHA 3EHCA 4OK0A 2BO9B 4OUQA 5FGOA 4HJLB 4WWUC 3BNDA 1OHOA 2WOHA 3NV0A 2IMJA 1W2B2 5IG4A 1WQLB 1DVCA 2F99A 4MEIA 4QWTA 3A76A 1O7GB 3GZBA 5AIFA 1K41A 3K7CA 1NO3A 2Y73A 1VQL3 1EG9B 1FGMA 2KCDA 2W0QA 2W03A 2R4IA 2ZL8A 4XBYA 3CC73 1GY7A 1ISKA 3CPOA 1W01A 1IV9A 2WGQA 2YFLB 2W56A 4HM6B 2XRXB 1VZZA 3FF0A 3CCR3 1Q864 1QAFA 1CYVA 3EF8A 3LMLA 2C11A 1W7CA 3EC9A 2OQEA 1L5GB 1OCVA 1E97A 4HZ9B 2RGQA 3DY5A 3FG3A 1NB5I 2I9WA 1MOLA 3RGRA 1UUVB 3VSYA 1EA2A 8CHOA 2QIYA 3KFQC 4ZM8A 1SIHA 2CH9A 3KN4A 3G4S3 2UX0A 3I553 3K9MC 1JKGB 4H3UA 1KWIA 1W6YA 5IG5A 3KE7A 4EV5A 1K28A 2OQEC 3EJVA 3V92A 3WA2X 2V1LA 2WOFA 1VQN3 4HM0B 3DUKA 1O7MB 1SPUA 4L7KA 3UL6A 1JJ22 3F8HA 1OHSA 2HMOB 4J8TA 1M9GA 2K54A 3U1WA 1TFOA 3LOYA 2P38A 4K61A 4HM4B 1RKYA 5CXOA 5EEOA 2P0MA 3CCL3 3QK9A 3NHXA 3PS8A 4EV2A 2OWPA 4FR9A 1IU7A 3X3YA 2E2VA 1A90A 4FMCA 3X40A 2CW9A 1D6UA 3FGYA 4WP5A 2HMKB 5EQLA 3MG3A 1K8A4 5CF1A 4HVNA 3RDEA 1S5AA 2CFLA 3EBYA 1WMNA 2BMOB 3LTAA 2BNGA 1YVBI 2XSHB 3EN8A 4FMAA 3V99A 1A2KA 3AMOB 1LXEA 3EN1B 2HMLB 1ULJB 4IPBA 1M1XB 1FGRA 4NREA 5JBSA 3OX9A 3EBTA 3NQYA 3G0KA 3LTBA 5TGNA 3EX9A 2P09A 4R4KA 1TFKA 1YJN3 4N6TA 5FW5A 3JUMA 1Q40A 1GD3A 3FF2A 5AIHA 1EQKA 4PEJA 1D6YA 1IVXA 3SX1A 3BNCA 1W6GA 1LVNA 1IQ8A 4K1VA 4KZ1A 3F40A 4ORLA 3FKAA 3CCV3 1QJGA 1WTHA 4L8PA 2D42A 1ASKA 5AIGA 2XH9A 3U97A 2E2UA 1IT8A 1CQSA 5EVHA 3S27A 1UW1A 3OV4A 4EXRA 3CCQ3 2CWTA 1U5OA 2XFSA 3I0YA 1KD14 1YI23 3IPTA 3T0UA 3PCRA 3DGNA 3OWUA 2A15A 3K0ZA 3NM2A 3OXAA 3JUNA 4HYZA 1IV7A 4AKYA 1A2VA 3KIIA 4R9LA 1JV2B 1VQO3 1KC84 4K90B 1SQWA 1G96A 3GZYB 3JUPA 1F8NA 3BB9A 2K0MA 4XBTA 2FXTA 2BMRB 4CCVA 4WYKA 1NDOB 5BVBA 1VQK3 1ROVA 2CKFB 3GAXA 5IEOA 3CU3A 1FGOA 2W9PA 4KVHA 4XBXA 2LYXA 2GXFA 3K5TA 4KFDA 5IERA 1BUQA 1LOXA 4HM2B 3NM7A 3EQQB 2HMNB 3OW22 1K734 3BNEA 3MPHA 1SIIA 1W02A 3PYJA 5CLKA 1S723 3S5CA 2CFGA 1NB3I 3LH4A 1JRQA 3CC23 1SJWA 1JN5B 1HU9A 4BTYA 4EYCA 4WHAA 3MHEA 1T5YA 5HGRA 1TUHA 1Q7Y4 5DREA 3M8CA 1MNLA 1W6CA 3MYTA 1YIT3 1WNHA 2XGNA 4JRFA 3NBBA 3SVAA 2O9UX 2OCTA 3UJMA 2PNCA 3E99A 3L0RA 3JVCA 5AYSC 1VQP3 1YIJ3 3KKGA 4LGQA 4RBNA 3OWYA 1EKMA 1FGQA 4HM3B 2W56B 1OGXA 2YFJB 3GWRA 4FMBA 3CNXA 1TP6A 1Z1SA 3IJEB 5CK6A 1JKGA 2CK3H 3DGMA 4N6OB 3RGAA 5JPUA 4MMXB 3FSDA 5D81A 4CDLA 2Z6BA 3FG1A 3CCM3 1DMQA 1OACA 3V98A 4JF8A 2CHCA 3CXC2 3LT8A 3X41A 2XF3A 5LC6A 1JB5A 3J7Yd 3ECFA 2SBLA 3UNLA 3N54B 3F7SA 3MG1A 2O3OA 3H51A 4R1KA 3VGNA 4Q53A 3F8XA 4HM8B 3K63A 1OGZA 3DXOA 2GEXA 2QEX3 3LZAA 3HIGA 1N5HA 3T8UA 1OF5B 1IQXA 4HM7B 2Y74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LVN A;  1AVL A;  2WOH A;  1PU4 A;  1US1 A;  2E2U A;  3NQZ A;  3AMO A;  3X3Z A;  4EXR A;  2Y73 A;  2CWT A;  1IVV A;  2OOV C;  2W0Q A;  3X3X A;  2ZL8 A;  1RJO A;  3T0U A;  2WGQ A;  3N9H A;  4KFF A;  4BTW A;  2D1W A;  1IVW A;  1A2V A;  3KII A;  1QAF A;  2C11 A;  1W7C A;  1UI7 A;  2OQE A;  2K0M A;  1DYU A;  3NBJ A;  1WMP A;  2BT3 A;  4BTX A;  4KFE A;  2WO0 A;  2CFW A;  1WMO A;  1QAL A;  3PGB A;  3K5T A;  1SIH A;  4KFD A;  1W2Z A;  3KN4 A;  3MPH A;  1SII A;  1KSI A;  2CFG A;  1JRQ A;  4EV5 A;  2OQE C;  4BTY A;  3WA2 X;  2IA7 A;  3SXX A;  3ALA A;  2WOF A;  1W6C A;  3NBB A;  1SPU A;  1W4N A;  2PNC A;  1IQY A;  1AVK A;  3LOY A;  3X42 A;  1W5Z A;  2GU3 A;  1EKM A;  1N9E A;  2CG1 A;  1RKY A;  2CWV A;  4EV2 A;  3WA3 A;  1IU7 A;  3X3Y A;  2E2V A;  3X40 A;  2CWU A;  5IW9 A;  1D6U A;  2E2T A;  1TU5 A;  2CFD A;  1IVU A;  1OAC A;  2CFL A;  1AV4 A;  2CFK A;  1WMN A;  2YX9 A;  2C10 A;  1QAK A;  3X41 A;  3AMO B;  1D6Z A;  3HII A;  3NQY A;  1UI8 A;  2OOV A;  2CG0 A;  3HIG A;  3HI7 A;  1D6Y A;  1IVX A;  3SX1 A;  1W6G A;  1IQX A;  2Y74 A; 
#chains in the Genus database with same CATH topology
 1AVL A;  2M7O A;  4RNZ A;  4I4K A;  2ZHX B;  1LQM B;  1Q82 4;  3T8N A;  3DZL A;  4O8S A;  4O2H A;  5HOH A;  5KP1 A;  3Q90 A;  4K1U A;  1Q42 A;  1ZO2 A;  2JQ5 A;  3HOH A;  3NQZ A;  3AMO A;  4N6N B;  2B1X B;  3X3Z A;  1Q81 4;  4X2H A;  3LYG A;  4XM4 A;  4XDW A;  5BIR A;  3MWZ A;  5IG0 A;  1N5P A;  5M1A A;  2H0G A;  1O7H B;  1ROA A;  1RGL A;  2BMQ B;  1RJO A;  1UGH I;  1YJW 3;  3N9H A;  1IDP A;  1BIR A;  4KFF A;  3UL5 A;  4BTW A;  1MGR A;  2IUK A;  2XR8 B;  1OPY A;  3ER7 A;  3GRD A;  3O8Y A;  1UI7 A;  2RFR A;  3EE1 A;  2XSO B;  4CPK A;  2KAA A;  3MKI A;  2F86 B;  2GBX B;  1C54 A;  1AR0 A;  2W04 A;  1Y4K A;  1LNH A;  4G1M B;  1WMP A;  2BT3 A;  4LZI A;  2RSX A;  4KFE A;  1QVG 2;  1FUT A;  5KP4 A;  2WO0 A;  2CFW A;  5ELJ A;  3PGB A;  4EBG A;  2Q07 A;  5I97 A;  5DRV A;  1STF I;  4R9K A;  1N8Q A;  4GSP A;  4MMY B;  5D82 A;  1IT7 A;  4U13 A;  3CCJ 3;  1T2I A;  1FUW A;  4CJN A;  1GYB A;  2XFT A;  1C7H A;  3JUQ A;  4FCJ A;  1RRL A;  1B2U A;  3D5I A;  1KSI A;  2P05 A;  4J9A A;  3DGY A;  4N6M A;  1NWW A;  4J5G A;  1VQ8 3;  1V74 A;  1BNE A;  3PXM A;  2CX0 A;  1M90 4;  3WOD G;  1UUW B;  2IA7 A;  3SXX A;  1RGF A;  1TIJ A;  4LYL B;  4X2O A;  2GBW B;  4FMD A;  1I0V A;  5STD A;  3VF1 A;  1GOY A;  3FZW A;  1BNJ A;  4IT7 A;  1ZS7 A;  4HKV B;  4LEH A;  5G2G A;  4KT3 B;  3S29 A;  1GSP A;  4IIA A;  1BRJ A;  7STD A;  2Z7A A;  3G8Z A;  5D83 A;  5AYR B;  2HMJ B;  1BU4 A;  3GZR A;  1GS3 A;  4RNY A;  4TX4 A;  1W5Z A;  3X42 A;  1RNB A;  2GU3 A;  3BNB A;  1N9E A;  2CG1 A;  1QVF 2;  1GD4 A;  2CWV A;  3N8B A;  1OUN A;  1ZX2 A;  6STD A;  1YHQ 3;  6GSP A;  1BSC A;  1STD A;  5AEU B;  1RGK A;  4ILF A;  1BSA A;  2OTJ 3;  3GZX B;  2ML5 A;  2KRT A;  4EC6 A;  5IF6 A;  3PZW A;  2E2T A;  4HM1 B;  1TU5 A;  5AEW B;  1QMA A;  1JN5 A;  3SLU A;  1IVU A;  3KSP A;  1AY7 A;  5BXQ A;  2CFK A;  4O3V A;  2Z76 A;  3KCH A;  2H0I A;  3NV0 B;  1K9M 4;  2HMM B;  1QAK A;  3LTC A;  1BOX A;  2QA4 3;  1BAO A;  4OVM A;  1TTO A;  1PFP A;  2IYJ A;  3G6E 3;  3G71 3;  3STD A;  4MMZ B;  1VQM 3;  3PCS A;  1D6Z A;  3Q2P A;  4N3V A;  2CC3 A;  3NXJ A;  2YFI B;  1LRA A;  3OWS A;  1M1K 4;  3MG2 A;  4N6U A;  2OTL 3;  3F14 A;  2XEP A;  2INX A;  2Z77 A;  5G1K A;  3FG4 A;  4MJD A;  3D9R A;  1JZO A;  1UI8 A;  2OOV A;  1JBR A;  1CYU A;  3LXU X;  1UGI A;  4FCZ A;  3S67 A;  2UGI A;  2GU1 A;  3HI7 A;  1I3I A;  1N9J A;  1BVI A;  4GB5 A;  1BNR A;  1RGG A;  3KZT A;  4R80 A;  4AEQ A;  1UCJ A;  1GMR A;  3B4O A;  3JUO A;  1A2P A;  3FCS B;  4AKZ A;  2FNQ A;  2ML6 A;  4L8O A;  1PU4 A;  4NHF A;  1US1 A;  1JZD A;  1J2B A;  4EW5 A;  1B21 A;  3HX8 A;  3SOY A;  3GSP A;  4O02 B;  4STD A;  1HZ1 A;  1IVV A;  2OOV C;  3QRD A;  3LTD A;  4XB5 A;  3BLZ A;  5GSP A;  3X3X A;  1W00 A;  1EUI C;  4BL2 A;  5A0O B;  1MWU A;  2P0X A;  5AII A;  1VQ5 3;  1RN7 A;  1T3B A;  8RNT A;  3CCS 3;  2RCD A;  3CMA 3;  2D1W A;  1IVW A;  4GL6 A;  2PZV A;  2CIU A;  4LMI A;  3SED A;  1PY3 A;  2AAD A;  2H0H A;  2XGL A;  3WDG B;  1RCL A;  1MWR A;  3CD6 3;  4RZM A;  1DYU A;  1GY6 A;  3NBJ A;  2K3D A;  1OF5 A;  4J5K A;  2BHM A;  2QGU A;  1VQ6 3;  4BTX A;  1BAN A;  5AI1 A;  6RNT A;  1WMO A;  1QAL A;  1E3R A;  3F7X A;  3D3L A;  1KQS 2;  1T2H A;  1BSB A;  9RNT A;  1TRQ A;  1RDS A;  1W2Z A;  1GMQ A;  3ROB A;  1FGT A;  4HBR A;  5JPP A;  1HKX A;  2IUJ A;  4FCM A;  3B8L A;  3S28 A;  3EB8 A;  1YGE A;  3HK4 A;  1VQQ A;  5IEP A;  3SOA A;  3F9S A;  3B7C A;  4N6L A;  2GEY A;  1RHL A;  1E3V A;  2STD A;  3I56 3;  2KF6 A;  2ZDJ A;  3IMA B;  2B24 B;  4XDV A;  1RMS A;  3ALA A;  1OH0 A;  3TDG A;  3CC4 3;  3D5G A;  1LNI A;  2W9Q A;  2LQV A;  1CH0 A;  1B27 A;  1JNQ A;  2W6J H;  2MF7 A;  1W4N A;  3MSO A;  1ULI B;  4LSO A;  4H61 A;  1IQY A;  2GSP A;  1AVK A;  1LOW A;  1DVD A;  3KSE D;  1CEW I;  1RNT A;  1DET A;  1O7W B;  2J8X B;  1JB4 A;  3Q1C A;  1NJI 4;  1O7N B;  1FA3 A;  1RN4 A;  1YJ9 3;  3CPW 2;  2KF4 A;  1BRK A;  3WA3 A;  1BRN L;  1LOY A;  3CME 3;  2WGO A;  1DMN A;  1Q40 B;  1YVS A;  3BU4 A;  3FLJ A;  1MWT A;  2CWU A;  2W2C A;  5IG3 A;  5IW9 A;  1O7P B;  3H3H A;  3CCE 3;  3CCU 3;  3CNM A;  3AGN A;  3DGL A;  1YNV X;  1JB2 A;  1BSE A;  2CFD A;  2RBI A;  1VQ7 3;  3DMC A;  1AV4 A;  2CX1 A;  3NX0 A;  4N6V 0;  1A67 A;  1NU3 A;  1MGW A;  2YX9 A;  3DGO A;  2C10 A;  3FH1 A;  3G16 A;  3WOE B;  3WMD A;  1U8C B;  4HM5 B;  2KF5 A;  3WOF B;  4WFO A;  3NUV A;  3UB1 A;  1VQ4 3;  2FGT A;  3LT9 A;  3HII A;  5IEN A;  1Q7H A;  2MC8 A;  1GOV A;  5LC7 A;  5ELU A;  1RN1 A;  1IK3 A;  2JDI H;  1UDI I;  1TRP A;  2F98 A;  3Q3F A;  4HZB B;  5CF2 A;  1R4C A;  1VQ9 3;  1GY5 A;  3AHS A;  1OHP A;  3RNT A;  2CG0 A;  3NBR A;  3ZFZ A;  1I2E A;  4HAA A;  3DM8 A;  1DMM A;  5KP3 A;  1N8R 4;  3HZP A;  2L4V A;  3B4P A;  4WYK B;  2KXG A;  1RRH A;  3EHC A;  4OK0 A;  2BO9 B;  4OUQ A;  5FGO A;  4BIR A;  3DH2 A;  4HJL B;  4WWU C;  3BND A;  1OHO A;  1BGS A;  2WOH A;  3NV0 A;  2IMJ A;  2BU4 A;  7GSP A;  1W2B 2;  1YGW A;  4I5Q A;  5IG4 A;  1WQL B;  1DVC A;  1RGC A;  2F99 A;  4MEI A;  4QWT A;  3A76 A;  1O7G B;  3GZB A;  5AIF A;  1RGE A;  1K41 A;  2HOH A;  1NO3 A;  3K7C A;  2Y73 A;  1VQL 3;  1EG9 B;  1FGM A;  2KCD A;  2W0Q A;  2W03 A;  2R4I A;  1UCK A;  2ZL8 A;  4XBY A;  3CC7 3;  1GY7 A;  1ISK A;  1LQG C;  1W01 A;  1IV9 A;  2WGQ A;  1B2Z A;  1I8V A;  2YFL B;  3CPO A;  2W56 A;  4HM6 B;  2XRX B;  1JBT A;  1VZZ A;  3FF0 A;  1AQZ A;  1RSN A;  3CCR 3;  1Q86 4;  2UUG C;  1HYF A;  1QAF A;  1CYV A;  3EF8 A;  1G02 A;  3LML A;  2C11 A;  1W7C A;  3EC9 A;  2OQE A;  1L5G B;  1OCV A;  1E97 A;  4HZ9 B;  2RGQ A;  3DY5 A;  3FG3 A;  1NB5 I;  2I9W A;  1UCL A;  1MOL A;  3RGR A;  1UUV B;  3VSY A;  2KF3 A;  1EA2 A;  8CHO A;  1B2X A;  2QIY A;  1SAR A;  3KFQ C;  2SAR A;  4ZM8 A;  1SIH A;  2CH9 A;  2C4B A;  4DKI A;  3KN4 A;  4HOH A;  1RLS A;  3G4S 3;  2UX0 A;  3I55 3;  1PYL A;  2L1S A;  3K9M C;  5M18 A;  1X1U A;  1JKG B;  4H3U A;  1KWI A;  1W6Y A;  3ZG5 A;  5IG5 A;  3KE7 A;  4EV5 A;  1K28 A;  1JBS A;  3AGO A;  2OQE C;  3EJV A;  1I0X A;  3V92 A;  3WA2 X;  2V1L A;  2AAE A;  2WOF A;  1BRG A;  1VQN 3;  1TJD A;  4HM0 B;  3DUK A;  1O7M B;  3A5E A;  1SPU A;  4L7K A;  3UL6 A;  1BRH A;  3D79 A;  1JJ2 2;  3F8H A;  1OHS A;  2F5W A;  2HMO B;  4J8T A;  1FW7 A;  1M9G A;  2K54 A;  4GHO A;  3U1W A;  1TFO A;  3LOY A;  2P38 A;  4K61 A;  4HM4 B;  1RKY A;  5CXO A;  5EEO A;  2P0M A;  1X1W A;  3QK9 A;  3NHX A;  3CCL 3;  3PS8 A;  4EV2 A;  2OWP A;  4FR9 A;  1IU7 A;  3X3Y A;  2E2V A;  1A90 A;  1MWS A;  4FMC A;  3X40 A;  2CW9 A;  1D6U A;  3FGY A;  4WP5 A;  2HMK B;  5EQL A;  3MG3 A;  1K8A 4;  5CF1 A;  4HVN A;  3RDE A;  1S5A A;  2CFL A;  3EBY A;  1RGA A;  1WMN A;  2BMO B;  3LTA A;  2BNG A;  1YVB I;  2XSH B;  3EN8 A;  4FMA A;  3V99 A;  1BRI A;  1A2K A;  3AMO B;  1LXE A;  3EN1 B;  2HML B;  1ULJ B;  4IPB A;  1M1X B;  1FGR A;  4NRE A;  5JBS A;  1I3F A;  3OX9 A;  3EBT A;  5BU4 A;  5M19 A;  3SYU A;  1FUS A;  3G0K A;  3LTB A;  3NQY A;  5TGN A;  1I70 A;  3EX9 A;  2P09 A;  4R4K A;  1TFK A;  1YJN 3;  1RCK A;  4N6T A;  5FW5 A;  3JUM A;  1Q40 A;  1IYY A;  1GD3 A;  3FF2 A;  5AIH A;  1EQK A;  4PEJ A;  1D6Y A;  1IVX A;  3SX1 A;  3BNC A;  1W6G A;  2BIR A;  1LVN A;  1IQ8 A;  4K1V A;  4KZ1 A;  3F40 A;  1BUJ A;  4ORL A;  3FKA A;  1G0T A;  1DE3 A;  1I2F A;  3CCV 3;  1QJG A;  1ZGX A;  1WTH A;  1B3S A;  4L8P A;  2D42 A;  1Q9E A;  1V57 A;  1ASK A;  5AIG A;  2XH9 A;  3U97 A;  2E2U A;  1IT8 A;  1CQS A;  2IY2 A;  5EVH A;  3S27 A;  1UW1 A;  3OV4 A;  4RNT A;  4EXR A;  3CCQ 3;  1V58 A;  1NNV A;  2CWT A;  1U5O A;  4BU4 A;  2XFS A;  3I0Y A;  1KD1 4;  1YI2 3;  3IPT A;  3T0U A;  3PCR A;  3DGN A;  3OWU A;  2A15 A;  3K0Z A;  3NM2 A;  1GMP A;  3OXA A;  3JUN A;  4HYZ A;  1IV7 A;  4AKY A;  1A2V A;  3KII A;  4R9L A;  5RNT A;  1JV2 B;  1UCI A;  1BNG A;  1VQO 3;  1KC8 4;  4K90 B;  1SQW A;  1G96 A;  3GZY B;  1B2S A;  1F8N A;  3BB9 A;  3JUP A;  2K0M A;  4XBT A;  2FXT A;  2BMR B;  4CCV A;  4WYK A;  3D4A A;  1FYS A;  1NDO B;  5BVB A;  1VQK 3;  1ROV A;  1BRS A;  2CKF B;  3GAX A;  5IEO A;  3URP A;  3CU3 A;  1FGO A;  2W9P A;  4KVH A;  4XBX A;  2LYX A;  2GXF A;  2R41 A;  3K5T A;  4KFD A;  5IER A;  1B2M A;  1RTU A;  1BUQ A;  1LOX A;  4HM2 B;  3NM7 A;  3EQQ B;  2HMN B;  3OW2 2;  1K73 4;  3BNE A;  3MPH A;  1UUG B;  1SII A;  1W02 A;  3PYJ A;  5CLK A;  1S72 3;  3S5C A;  2CFG A;  1NB3 I;  3LH4 A;  1JRQ A;  3CC2 3;  1SJW A;  1JN5 B;  1HU9 A;  4BTY A;  4EYC A;  4WHA A;  3MHE A;  1T5Y A;  5HGR A;  1TUH A;  2F4Y A;  1Q7Y 4;  5DRE A;  3M8C A;  1MNL A;  1B20 A;  1W6C A;  3MYT A;  1YIT 3;  1WNH A;  2XGN A;  4JRF A;  3BIR A;  3NBB A;  3SVA A;  2O9U X;  2OCT A;  3UJM A;  2PNC A;  3E99 A;  7RNT A;  3L0R A;  3JVC A;  5AYS C;  1VQP 3;  1YIJ 3;  1BNI A;  3ZG0 A;  3WHO A;  3KKG A;  4LGQ A;  4RBN A;  3OWY A;  1EKM A;  1FGQ A;  4HM3 B;  2W56 B;  1OGX A;  2YFJ B;  3GWR A;  1FZU A;  4FMB A;  3CNX A;  1TP6 A;  1Z1S A;  3IJE B;  3WR2 A;  4NPB A;  5CK6 A;  1JKG A;  5G1L A;  2CK3 H;  3DGM A;  4N6O B;  1BNF A;  3RGA A;  5JPU A;  4MMX B;  3FSD A;  5D81 A;  4CDL A;  2Z6B A;  3FG1 A;  3CCM 3;  1DMQ A;  1OAC A;  1I2G A;  1X1X A;  3V98 A;  4JF8 A;  2CHC A;  2RNT A;  3CXC 2;  3LT8 A;  3X41 A;  2XF3 A;  5LC6 A;  1JB5 A;  1RGH A;  3J7Y d;  3ECF A;  2SBL A;  3UNL A;  1BSD A;  3N54 B;  3F7S A;  3MG1 A;  2O3O A;  3H51 A;  2F5M A;  4R1K A;  3VGN A;  4Q53 A;  3F8X A;  4HM8 B;  1X1Y A;  2F56 A;  3AHW A;  4BL3 A;  3K63 A;  1OGZ A;  3DXO A;  2GEX A;  2QEX 3;  2ZA4 A;  3LZA A;  3HIG A;  1N5H A;  3T8U A;  1BNS A;  1GOU A;  1OF5 B;  1LOV A;  1IQX A;  1R4Y A;  1EEJ A;  4HM7 B;  2Y74 A; 
#chains in the Genus database with same CATH homology
 1AVL A;  2M7O A;  4RNZ A;  4I4K A;  1Q82 4;  3T8N A;  3DZL A;  4O8S A;  4O2H A;  5KP1 A;  3Q90 A;  4K1U A;  1Q42 A;  1ZO2 A;  2JQ5 A;  3NQZ A;  4N6N B;  3AMO A;  1Q81 4;  2B1X B;  3X3Z A;  4X2H A;  3LYG A;  4XM4 A;  4XDW A;  3MWZ A;  5IG0 A;  1N5P A;  1O7H B;  1ROA A;  2BMQ B;  1RJO A;  1YJW 3;  3N9H A;  1IDP A;  4KFF A;  4BTW A;  3UL5 A;  2IUK A;  2XR8 B;  1OPY A;  3ER7 A;  3GRD A;  3O8Y A;  1UI7 A;  2RFR A;  3EE1 A;  2XSO B;  3MKI A;  2F86 B;  2GBX B;  1AR0 A;  2W04 A;  1Y4K A;  1LNH A;  4G1M B;  1WMP A;  2BT3 A;  4LZI A;  2RSX A;  4KFE A;  1QVG 2;  5KP4 A;  2WO0 A;  2CFW A;  5ELJ A;  3PGB A;  4EBG A;  2Q07 A;  5I97 A;  5DRV A;  1STF I;  4R9K A;  1N8Q A;  4MMY B;  5D82 A;  1IT7 A;  4U13 A;  3CCJ 3;  1FUW A;  1GYB A;  2XFT A;  1C7H A;  3JUQ A;  4FCJ A;  1RRL A;  1KSI A;  2P05 A;  4J9A A;  4N6M A;  1NWW A;  1VQ8 3;  1V74 A;  3PXM A;  1M90 4;  3WOD G;  1UUW B;  2IA7 A;  3SXX A;  1TIJ A;  4X2O A;  2GBW B;  4FMD A;  3VF1 A;  5STD A;  3FZW A;  4IT7 A;  4LEH A;  4HKV B;  5G2G A;  3S29 A;  4IIA A;  7STD A;  2Z7A A;  3G8Z A;  5D83 A;  5AYR B;  2HMJ B;  3GZR A;  1GS3 A;  4RNY A;  4TX4 A;  1W5Z A;  3X42 A;  2GU3 A;  3BNB A;  1N9E A;  2CG1 A;  1QVF 2;  1GD4 A;  2CWV A;  3N8B A;  1OUN A;  1ZX2 A;  6STD A;  1YHQ 3;  1STD A;  5AEU B;  2OTJ 3;  3GZX B;  2ML5 A;  2KRT A;  4EC6 A;  5IF6 A;  3PZW A;  2E2T A;  4HM1 B;  1TU5 A;  5AEW B;  1QMA A;  1JN5 A;  3SLU A;  1IVU A;  3KSP A;  5BXQ A;  2CFK A;  4O3V A;  2Z76 A;  3NV0 B;  1K9M 4;  2HMM B;  1QAK A;  3LTC A;  2QA4 3;  4OVM A;  1PFP A;  3G6E 3;  3G71 3;  3STD A;  4MMZ B;  1VQM 3;  3PCS A;  1D6Z A;  3Q2P A;  4N3V A;  2CC3 A;  3NXJ A;  2YFI B;  3OWS A;  1M1K 4;  3MG2 A;  4N6U A;  2OTL 3;  3F14 A;  2XEP A;  2INX A;  2Z77 A;  3FG4 A;  4MJD A;  3D9R A;  1UI8 A;  2OOV A;  1CYU A;  3LXU X;  4FCZ A;  3S67 A;  2GU1 A;  3HI7 A;  1N9J A;  4GB5 A;  3KZT A;  4R80 A;  4AEQ A;  3B4O A;  3JUO A;  3FCS B;  4AKZ A;  2FNQ A;  2ML6 A;  4L8O A;  1PU4 A;  4NHF A;  1US1 A;  1J2B A;  3SOY A;  3HX8 A;  4O02 B;  4STD A;  1IVV A;  2OOV C;  3QRD A;  3LTD A;  4XB5 A;  3BLZ A;  3X3X A;  1W00 A;  5A0O B;  2P0X A;  5AII A;  1VQ5 3;  1RN7 A;  3CCS 3;  2RCD A;  3CMA 3;  2D1W A;  1IVW A;  4GL6 A;  2PZV A;  2CIU A;  4LMI A;  3SED A;  3WDG B;  2XGL A;  3CD6 3;  4RZM A;  1DYU A;  1GY6 A;  3NBJ A;  1OF5 A;  2BHM A;  2QGU A;  1VQ6 3;  4BTX A;  5AI1 A;  1WMO A;  1QAL A;  1E3R A;  3F7X A;  3D3L A;  1KQS 2;  1W2Z A;  3ROB A;  1FGT A;  4HBR A;  5JPP A;  1HKX A;  2IUJ A;  4FCM A;  3B8L A;  3S28 A;  3EB8 A;  1YGE A;  3HK4 A;  5IEP A;  3SOA A;  3F9S A;  3B7C A;  4N6L A;  2GEY A;  1E3V A;  2STD A;  3I56 3;  2ZDJ A;  3IMA B;  2B24 B;  4XDV A;  3ALA A;  3CC4 3;  1OH0 A;  3TDG A;  2W9Q A;  2LQV A;  1JNQ A;  2W6J H;  2MF7 A;  1W4N A;  3MSO A;  1ULI B;  4LSO A;  4H61 A;  1IQY A;  1AVK A;  1DVD A;  3KSE D;  1CEW I;  1O7W B;  3Q1C A;  1JB4 A;  1NJI 4;  1O7N B;  1FA3 A;  1YJ9 3;  3CPW 2;  3WA3 A;  3CME 3;  2WGO A;  1DMN A;  1Q40 B;  3FLJ A;  2CWU A;  2W2C A;  5IG3 A;  5IW9 A;  1O7P B;  3H3H A;  3CCE 3;  3CCU 3;  3CNM A;  3DGL A;  2CFD A;  1JB2 A;  1VQ7 3;  3DMC A;  1AV4 A;  3NX0 A;  4N6V 0;  1A67 A;  1NU3 A;  2YX9 A;  3G16 A;  3DGO A;  2C10 A;  3FH1 A;  3WOE B;  3WMD A;  1U8C B;  4HM5 B;  3WOF B;  4WFO A;  3NUV A;  3UB1 A;  1VQ4 3;  2FGT A;  3LT9 A;  3HII A;  5IEN A;  2MC8 A;  5LC7 A;  5ELU A;  1IK3 A;  2JDI H;  2F98 A;  5CF2 A;  4HZB B;  1VQ9 3;  1R4C A;  1GY5 A;  1OHP A;  2CG0 A;  3NBR A;  3DM8 A;  1DMM A;  5KP3 A;  1N8R 4;  3HZP A;  2L4V A;  3B4P A;  4WYK B;  2KXG A;  1RRH A;  3EHC A;  4OK0 A;  2BO9 B;  4OUQ A;  5FGO A;  4HJL B;  4WWU C;  3BND A;  1OHO A;  2WOH A;  3NV0 A;  2IMJ A;  1W2B 2;  5IG4 A;  1WQL B;  1DVC A;  2F99 A;  4MEI A;  4QWT A;  3A76 A;  1O7G B;  3GZB A;  5AIF A;  1K41 A;  3K7C A;  1NO3 A;  2Y73 A;  1VQL 3;  1EG9 B;  1FGM A;  2KCD A;  2W0Q A;  2W03 A;  2R4I A;  2ZL8 A;  4XBY A;  3CC7 3;  1GY7 A;  1ISK A;  3CPO A;  1W01 A;  1IV9 A;  2WGQ A;  2YFL B;  2W56 A;  4HM6 B;  2XRX B;  1VZZ A;  3FF0 A;  3CCR 3;  1Q86 4;  1QAF A;  1CYV A;  3EF8 A;  3LML A;  2C11 A;  1W7C A;  3EC9 A;  2OQE A;  1L5G B;  1OCV A;  1E97 A;  4HZ9 B;  2RGQ A;  3DY5 A;  3FG3 A;  1NB5 I;  2I9W A;  1MOL A;  3RGR A;  1UUV B;  3VSY A;  1EA2 A;  8CHO A;  2QIY A;  3KFQ C;  4ZM8 A;  1SIH A;  2CH9 A;  3KN4 A;  3G4S 3;  2UX0 A;  3I55 3;  3K9M C;  1JKG B;  4H3U A;  1KWI A;  1W6Y A;  5IG5 A;  3KE7 A;  4EV5 A;  1K28 A;  2OQE C;  3EJV A;  3V92 A;  3WA2 X;  2V1L A;  2WOF A;  1VQN 3;  4HM0 B;  3DUK A;  1O7M B;  1SPU A;  4L7K A;  3UL6 A;  1JJ2 2;  3F8H A;  1OHS A;  2HMO B;  4J8T A;  1M9G A;  2K54 A;  3U1W A;  1TFO A;  3LOY A;  2P38 A;  4K61 A;  4HM4 B;  1RKY A;  5CXO A;  5EEO A;  2P0M A;  3CCL 3;  3QK9 A;  3NHX A;  3PS8 A;  4EV2 A;  2OWP A;  4FR9 A;  1IU7 A;  3X3Y A;  2E2V A;  1A90 A;  4FMC A;  3X40 A;  2CW9 A;  1D6U A;  3FGY A;  4WP5 A;  2HMK B;  5EQL A;  3MG3 A;  1K8A 4;  5CF1 A;  4HVN A;  3RDE A;  1S5A A;  2CFL A;  3EBY A;  1WMN A;  2BMO B;  3LTA A;  2BNG A;  1YVB I;  2XSH B;  3EN8 A;  4FMA A;  3V99 A;  1A2K A;  3AMO B;  1LXE A;  3EN1 B;  2HML B;  1ULJ B;  4IPB A;  1M1X B;  1FGR A;  4NRE A;  5JBS A;  3OX9 A;  3EBT A;  3NQY A;  3G0K A;  3LTB A;  5TGN A;  3EX9 A;  2P09 A;  4R4K A;  1TFK A;  1YJN 3;  4N6T A;  5FW5 A;  3JUM A;  1Q40 A;  1GD3 A;  3FF2 A;  5AIH A;  1EQK A;  4PEJ A;  1D6Y A;  1IVX A;  3SX1 A;  3BNC A;  1W6G A;  1LVN A;  1IQ8 A;  4K1V A;  4KZ1 A;  3F40 A;  4ORL A;  3FKA A;  3CCV 3;  1QJG A;  1WTH A;  4L8P A;  2D42 A;  1ASK A;  5AIG A;  2XH9 A;  3U97 A;  2E2U A;  1IT8 A;  1CQS A;  5EVH A;  3S27 A;  1UW1 A;  3OV4 A;  4EXR A;  3CCQ 3;  2CWT A;  1U5O A;  2XFS A;  3I0Y A;  1KD1 4;  1YI2 3;  3IPT A;  3T0U A;  3PCR A;  3DGN A;  3OWU A;  2A15 A;  3K0Z A;  3NM2 A;  3OXA A;  3JUN A;  4HYZ A;  1IV7 A;  4AKY A;  1A2V A;  3KII A;  4R9L A;  1JV2 B;  1VQO 3;  1KC8 4;  4K90 B;  1SQW A;  1G96 A;  3GZY B;  3JUP A;  1F8N A;  3BB9 A;  2K0M A;  4XBT A;  2FXT A;  2BMR B;  4CCV A;  4WYK A;  1NDO B;  5BVB A;  1VQK 3;  1ROV A;  2CKF B;  3GAX A;  5IEO A;  3CU3 A;  1FGO A;  2W9P A;  4KVH A;  4XBX A;  2LYX A;  2GXF A;  3K5T A;  4KFD A;  5IER A;  1BUQ A;  1LOX A;  4HM2 B;  3NM7 A;  3EQQ B;  2HMN B;  3OW2 2;  1K73 4;  3BNE A;  3MPH A;  1SII A;  1W02 A;  3PYJ A;  5CLK A;  1S72 3;  3S5C A;  2CFG A;  1NB3 I;  3LH4 A;  1JRQ A;  3CC2 3;  1SJW A;  1JN5 B;  1HU9 A;  4BTY A;  4EYC A;  4WHA A;  3MHE A;  1T5Y A;  5HGR A;  1TUH A;  1Q7Y 4;  5DRE A;  3M8C A;  1MNL A;  1W6C A;  3MYT A;  1YIT 3;  1WNH A;  2XGN A;  4JRF A;  3NBB A;  3SVA A;  2O9U X;  2OCT A;  3UJM A;  2PNC A;  3E99 A;  3L0R A;  3JVC A;  5AYS C;  1VQP 3;  1YIJ 3;  3KKG A;  4LGQ A;  4RBN A;  3OWY A;  1EKM A;  1FGQ A;  4HM3 B;  2W56 B;  1OGX A;  2YFJ B;  3GWR A;  4FMB A;  3CNX A;  1TP6 A;  1Z1S A;  3IJE B;  5CK6 A;  1JKG A;  2CK3 H;  3DGM A;  4N6O B;  3RGA A;  5JPU A;  4MMX B;  3FSD A;  5D81 A;  4CDL A;  2Z6B A;  3FG1 A;  3CCM 3;  1DMQ A;  1OAC A;  3V98 A;  4JF8 A;  2CHC A;  3CXC 2;  3LT8 A;  3X41 A;  2XF3 A;  5LC6 A;  1JB5 A;  3J7Y d;  3ECF A;  2SBL A;  3UNL A;  3N54 B;  3F7S A;  3MG1 A;  2O3O A;  3H51 A;  4R1K A;  3VGN A;  4Q53 A;  3F8X A;  4HM8 B;  3K63 A;  1OGZ A;  3DXO A;  2GEX A;  2QEX 3;  3LZA A;  3HIG A;  1N5H A;  3T8U A;  1OF5 B;  1IQX A;  4HM7 B;  2Y74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...