2GBXB

Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
170
structure length
170
Chain Sequence
QIPVTPDVHYDIEAHYRAEVRMFQTGQYREWLQGMVAEDIHYWMPIYEQRLTRDRRPDPTPDDAAIYNDDFGELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAGNGELDVLSNILVYRNRRQTEVTVHTLGREDKLRRDGNGFKVFRRKLILDARVTQDKNLYFFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
molecule keywords Biphenyl 2,3-Dioxygenase Alpha Subunit
total genus 42
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gbxB00
1OHOA 3G0KA 5KP1A 5CF2A 4HM2B 5CLKA 4GB5A 3B4PA 5CK6A 3SOYA 3OWSA 1S5AA 5G2GA 5IG0A 1Q40A 4X2OA 5JPPA 3Q90A 4LGQA 3DXOA 2QGUA 1HKXA 3OWYA 3NHXA 4IIAA 1E3RA 2GEXA 2IMJA 3H51A 3FLJA 2GBXB 1VZZA 4WWUC 3FF0A 5IF6A 5CXOA 3DM8A 3G8ZA 5KP3A 1JN5B 2HMOB 4L7KA 4XDVA 3GZYB 1OF5A 3GZRA 2INXA 3D9RA 3FKAA 4H3UA 2B1XB 1JB5A 3B8LA 4WYKA 2BNGA 2CKFB 3F8XA 3SOAA 4LEHA 1OUNA 1W00A 3RGAA 2HMLB 1E97A 1GY6A 3MKIA 4XB5A 3NUVA 4HZ9B 3OV4A 4HZBB 3HZPA 3B4OA 3T8NA 3ROBA 5AEUB 3UJMA 1U5OA 3EF8A 4OUQA 1JKGA 5IG5A 1C7HA 2F98A 4K1UA 3S5CA 1IDPA 1STDA 3T8UA 4X2HA 4HJLB 5EVHA 4HM3B 5HGRA 1BUQA 1OF5B 2RCDA 2Z77A 6STDA 4XDWA 4OVMA 1A2KA 4K1VA 5AIIA 1DMQA 1OHSA 2HMKB 2XR8B 3GWRA 3JUQA 2YFJB 3KSPA 5AIGA 3E99A 3FGYA 1O7GB 3HX8A 4PEJA 1Q40B 4L8OA 3A76A 2PZVA 4KVHA 4HM0B 3STDA 3FZWA 2STDA 2UX0A 4HM4B 4I4KA 4L8PA 2XRXB 4Q53A 5D83A 5AIFA 5IERA 5BVBA 4HM5B 4WP5A 1WQLB 1K41A 3EJVA 3M8CA 2HMNB 4HM7B 5TGNA 1NDOB 1O7WB 2F99A 3GRDA 3G16A 3GZXB 3HK4A 4U13A 3K7CA 3EHCA 3LZAA 3CPOA 8CHOA 3UNLA 2GEYA 5D81A 4HKVB 3FF2A 2GBWB 3MSOA 1Z1SA 2I9WA 3CNMA 1EG9B 3DZLA 1UUWB 3NM2A 3NV0A 5FW5A 3NBRA 3CU3A 3JUPA 3CNXA 3MG3A 3KKGA 5IENA 3EN1B 1NWWA 2YFLB 3MHEA 3LYGA 1UUVB 1ULIB 3NV0B 1DMNA 1OGXA 2F86B 3MG1A 3BLZA 1JN5A 3NXJA 4R9LA 3VSYA 3B7CA 3GZBA 1W01A 3IPTA 3F7XA 1CQSA 4RZMA 5IEOA 4R1KA 3VGNA 5AEWB 1E3VA 3FSDA 3K0ZA 4HM8B 4HM6B 3ER7A 5CF1A 1ZO2A 2RGQA 1O7MB 1W6YA 2Z76A 5STDA 1GYBA 1OGZA 1GY7A 4LMIA 1OHPA 1TUHA 4HM1B 4XBYA 3KZTA 3ECFA 2Z7AA 1ZX2A 3H3HA 1SJWA 3OXAA 4STDA 4XM4A 3RGRA 5BXQA 3SEDA 1JKGB 2HMJB 3F40A 5JPUA 3JUOA 4WYKB 1OCVA 4HVNA 3MYTA 4ORLA 4J8TA 1JB2A 4FCJA 7STDA 2XSOB 2BMQB 1ISKA 3EN8A 3F8HA 4CDLA 1ULJB 2A15A 5IG4A 3JUNA 1O7HB 1EA2A 1W02A 2YFIB 2R4IA 3BB9A 2HMMB 3DMCA 1TP6A 3I0YA 1Q42A 1QJGA 2BMOB 3EBTA 2OWPA 3F14A 2K54A 2W2CA 3OWUA 1DMMA 3OX9A 2RFRA 5AI1A 3EQQB 1GS3A 3EC9A 2QIYA 1AR0A 4J9AA 5D82A 5AIHA 5DREA 1OH0A 3DUKA 3WMDA 3EBYA 2CHCA 3EX9A 5IG3A 1OPYA 1ASKA 2GXFA 4XBXA 3MG2A 5KP4A 3F7SA 1O7NB 1GY5A 2B24B 4N3VA 1QMAA 2JQ5A 1NU3A 2XSHB 3JUMA 2BMRB 1O7PB 3KE7A 3F9SA 4MJDA 4R9KA 4XBTA 5DRVA 1JB4A 5IEPA 4FCMA 3FH1A
chains in the Genus database with same CATH superfamily
2CWTA 2FNQA 5KP1A 4HM2B 5CLKA 1RGEA 4BU4A 4GB5A 3BIRA 3G4S3 3BNCA 5G2GA 1Q40A 1DYUA 1SIHA 2JDIH 1W6CA 2QGUA 3DXOA 2PNCA 4N6TA 2GEXA 1JNQA 3FLJA 1VZZA 4N6MA 1W6GA 3G8ZA 3K9MC 3X40A 4XDVA 1VQ73 3GZYB 5A0OB 1KD14 1RCKA 4MMYB 3B8LA 1IVVA 2WO0A 3CC73 2BO9B 1BU4A 3Q3FA 3SOAA 1W00A 4CPKA 3MKIA 3D5GA 1LQGC 1V74A 3I563 3CCV3 3N54B 2SARA 2W9QA 1CH0A 3OV4A 6GSPA 2KCDA 1LOVA 3PZWA 1JKGA 1T2IA 1V57A 5IG5A 4K1UA 1IDPA 1STDA 1IVWA 1A2PA 1R4YA 1LXEA 1RRLA 1RGFA 2RCDA 4J5KA 1PU4A 1RNBA 4K90B 4NPBA 1UCKA 2XR8B 1QVF2 3JUQA 1MOLA 2YFJB 5GSPA 1B21A 3FGYA 1PFPA 1LOXA 1Q40B 1DETA 1BRIA 3FZWA 4HM4B 2UX0A 2XRXB 3QRDA 5AIFA 1S723 5BVBA 1RCLA 2O9UX 4EW5A 3CCJ3 3AGNA 3U1WA 1O7WB 3GRDA 4HOHA 3WA3A 1BRHA 3CD63 2OTJ3 1IV9A 3LZAA 4O02B 1B27A 8CHOA 3CCL3 5D81A 1AVKA 1EQKA 1W5ZA 2I9WA 3DZLA 3NV0A 2KRTA 3Q2PA 4FCZA 1N9JA 3WR2A 3MG3A 3SVAA 5IENA 1K28A 3L0RA 1ULIB 3NV0B 2F86B 3NXJA 4AKYA 1VQ53 3VSYA 1JN5A 5IEOA 1N5HA 1W01A 1B2XA 2OOVA 1Q824 1NB5I 4HM8B 1VQO3 2RGQA 2HOHA 1GD3A 1W6YA 2LYXA 1GYBA 1QAFA 2MC8A 4LMIA 4RNZA 4XBYA 3H3HA 1F8NA 4XM4A 3RGRA 1TU5A 1FA3A 5BXQA 1ROAA 4N6LA 1LVNA 3DH2A 4WYKB 1Y4KA 1HZ1A 3DY5A 1JB2A 4FCJA 4KZ1A 2XSOB 2Q07A 1ISKA 1PYLA 1SARA 3EN8A 3V98A 1UCJA 2RNTA 2OCTA 1QJGA 7GSPA 1UDII 3GSPA 2IY2A 3RDEA 4CCVA 2OWPA 3OWUA 2P0MA 2W2CA 2ML6A 3EQQB 2QIYA 1AR0A 2OQEC 1BSCA 1IQYA 1JRQA 1OH0A 3DUKA 3WMDA 1KSIA 2CHCA 3EX9A 1FGRA 3HOHA 2R41A 1ASKA 1JJ22 2GXFA 3JVCA 3LTDA 4XBXA 5KP4A 1NO3A 1M1XB 4O2HA 2JQ5A 3AGOA 1W2ZA 3KSED 1FZUA 1FUSA 1RKYA 2XGLA 1X1WA 1EKMA 1US1A 2C10A 4EV5A 1OACA 5CK6A 1YIJ3 1N8R4 1QAKA 1GSPA 1S5AA 3K63A 5I97A 4N6UA 5JPPA 1B2SA 4LGQA 7RNTA 1RGCA 3OWYA 3CCM3 1IT7A 4IIAA 2GBXB 4WWUC 1BRNL 1EEJA 4GHOA 3QK9A 5IF6A 1Q864 1LNIA 3WOEB 1UCLA 4N6V0 2HMOB 1IQ8A 4L7KA 3PCRA 1OF5A 3FKAA 1BNIA 2B1XB 2F4YA 5ELJA 2BNGA 2QA43 3F8XA 1WMNA 1IK3A 1OUNA 1I3IA 2W0QA 1E97A 3I553 1GY6A 4LSOA 1VQM3 2Z6BA 3DGYA 3K5TA 5AEUB 3CCS3 4LYLB 3ROBA 1K734 4CJNA 3WHOA 1IV7A 4OUQA 1IQXA 2F98A 2CFKA 1N8QA 1N9EA 4X2HA 1BANA 3DGMA 4O3VA 2KF4A 1BRJA 1A2KA 3UB1A 5AIGA 5CXOA 1V58A 1O7GB 2J8XB 1I70A 3A76A 1DVDA 2CIUA 3TDGA 3AMOA 2D1WA 4L8PA 3D3LA 3NM7A 5IERA 4WFOA 4MMZB 4HM5B 3FG3A 3LT8A 4EC6A 1BNEA 1G02A 1CEWI 1G96A 4WP5A 1WTHA 3BNBA 5IW9A 3M8CA 1GMRA 1RGAA 4HM7B 1MWSA 1TTOA 3HK4A 5BIRA 3G16A 3GZXB 3IJEB 4U13A 1BUJA 2AADA 2XGNA 2GEYA 3T0UA 4HKVB 2GBWB 3MSOA 2IUJA 3NM2A 1EG9B 2IYJA 4G1MB 1RDSA 4MEIA 3X42A 3JUPA 2ZA4A 5EQLA 3EN1B 1NWWA 1QALA 1SIIA 2YFLB 1LOWA 1UUVB 3DGLA 1DVCA 3MG1A 1BNRA 3BLZA 4GL6A 2F56A 1YVSA 2GU1A 5AEWB 1E3VA 1MWTA 1UCIA 4HM6B 5CF1A 1ZO2A 4I5QA 5HOHA 3X3YA 4KFDA 1QVG2 4MMXB 4ILFA 1IYYA 1TUHA 3KZTA 2Z7AA 1ZX2A 4STDA 4DKIA 4GSPA 3PS8A 3X3ZA 5JPUA 3F40A 1I2FA 1BSEA 3MYTA 4HVNA 4ORLA 4EV2A 4J8TA 4HAAA 3PYJA 3IMAB 1GMPA 1I0XA 1RGGA 4KFEA 7STDA 1KC84 2XF3A 2A15A 2H0HA 2KF5A 2P09A 1EUIC 1X1UA 3KN4A 2R4IA 1GOVA 3SYUA 3CPW2 1Q42A 1L5GB 2BMOB 1AV4A 2SBLA 1BNGA 3ALAA 3FG4A 2RFRA 3OX9A 2W56B 1GS3A 1BGSA 1I3FA 2CK3H 1JZDA 5AIHA 2ZHXB 1M9GA 2XFSA 3UL5A 1YHQ3 1BRKA 4QWTA 2CC3A 3EBYA 3S67A 2CW9A 3WDGB 2P05A 1TFOA 4O8SA 1T5YA 3MG2A 3NX0A 1RMSA 3F7SA 3KIIA 1QMAA 1DE3A 3JUMA 3KE7A 3F9SA 4R9KA 5IEPA 2CWUA 3FH1A 2QEX3 1OHOA 3O8YA 2O3OA 3UL6A 2L1SA 2CFGA 3B4PA 1JBRA 3OWSA 3URPA 1ROVA 5IG0A 1AQZA 4JRFA 4KFFA 1BNJA 1YGEA 3NHXA 2IMJA 1IU7A 2ZDJA 3H51A 1VQ83 1I2EA 2LQVA 1YJN3 3NQZA 1JBTA 2GSPA 5KP3A 2W6JH 1JN5B 4HYZA 3GZRA 1IT8A 2W9PA 2INXA 2K3DA 2D42A 1UI7A 3D9RA 4FMAA 2XFTA 1YNVX 3GAXA 1IVXA 1JB5A 1FGQA 1YI23 3AHSA 1GOUA 2HMLB 1JBSA 1TIJA 3NUVA 5RNTA 4HZ9B 1VQ43 2GU3A 2UGIA 3HZPA 1LOYA 3B4OA 4HZBB 3T8NA 4TX4A 3UJMA 5G1LA 1U5OA 1UUGB 3D4AA 1HYFA 1BIRA 1BNFA 2E2UA 4HM3B 1W7CA 1OF5B 2Z77A 1FGMA 4XDWA 2WGOA 3EB8A 1FGTA 4OVMA 5AIIA 1DMQA 3GWRA 3KSPA 1TFKA 3A5EA 2ML5A 1JZOA 4L8OA 2PZVA 3MPHA 1K9M4 2BHMA 4Q53A 1K8A4 3BU4A 3V99A 1SQWA 1JV2B 3LXUX 1WQLB 4BL2A 1K41A 1U8CB 3HI7A 1BSBA 2CWVA 2MF7A 3CMA3 3K7CA 2CX0A 3EHCA 5G1KA 3CPOA 3UNLA 4KT3B 4BTYA 1SPUA 3FF2A 1RGKA 1VQ93 1A2VA 1GOYA 1KWIA 1UUWB 1X1YA 3FCSB 2KF3A 2P0XA 3FG1A 3CU3A 5FW5A 5LC6A 3V92A 3CME3 1RJOA 3CCE3 2OTL3 1MWRA 1AVLA 1BNSA 1RTUA 3LYGA 1NJI4 3LT9A 1A67A 1W4NA 3SLUA 1OGXA 1RLSA 3IPTA 1RGHA 2K0MA 1YIT3 3F7XA 1M904 4R1KA 1VQQA 5LC7A 4ZM8A 1BSAA 3K0ZA 1G0TA 3ER7A 3MWZA 3DGOA 1PY3A 3PXMA 1MGWA 5STDA 1OGZA 1GY7A 1T2HA 1I8VA 2YX9A 1OHPA 4HBRA 3S5CA 3ECFA 3OXAA 3LTAA 2WOHA 3WODG 1JKGB 2HMJB 3S28A 3JUOA 1OCVA 3NBJA 1Q7Y4 1YVBI 3BNDA 1I2GA 3LMLA 2KAAA 1WMOA 4RBNA 3J7Yd 3CCQ3 3F8HA 4CDLA 1ULJB 3LOYA 1O7HB 1IVUA 1X1XA 4LZIA 3BB9A 3I0YA 3DMCA 1TP6A 2FXTA 5AI1A 2K54A 1LNHA 5HGRA 5TGNA 8RNTA 1GD4A 3EC9A 5DREA 2IA7A 3HIGA 1RN7A 2OQEA 1OPYA 2E2TA 1VQN3 3EE1A 1BSDA 4H61A 1B2UA 2CFWA 3AMOB 3VF1A 2B24B 1D6UA 1NU3A 2BMRB 3RNTA 1ZS7A 5DRVA 1NNVA 1Q9EA 1RN1A 1JB4A 1D6YA 2CG1A 3STDA 1B2ZA 5M19A 3OW22 3G0KA 5CF2A 2H0IA 3PGBA 1UGHI 4IT7A 1TRQA 4FMDA 3SOYA 3X41A 2F5MA 1M1K4 4X2OA 4WHAA 6RNTA 3KCHA 2L4VA 3Q90A 3LTCA 1HKXA 2V1LA 1WNHA 1TRPA 3D79A 1E3RA 2WOFA 1YJW3 1J2BA 1N5PA 2KXGA 3FF0A 3DM8A 5JBSA 2CX1A 1TJDA 2IUKA 1D6ZA 4R4KA 2KF6A 2RSXA 4H3UA 1MWUA 4WYKA 3D5IA 2M7OA 2CKFB 1I0VA 4BTWA 4LEHA 3ZG5A 1VQK3 3RGAA 3LH4A 4NREA 3WOFB 4XB5A 3CC23 1BRGA 3N8BA 3CXC2 3EF8A 2F5WA 5M18A 1C7HA 3SXXA 1UI8A 3T8UA 1FUWA 9RNTA 2CG0A 4AKZA 2WGQA 4HJLB 5EVHA 3HIIA 1RRHA 1BUQA 6STDA 3CCU3 4K1VA 1UGIA 1OHSA 2HMKB 5BU4A 1BVIA 1FW7A 2AAEA 3E99A 1R4CA 3HX8A 4IPBA 4PEJA 4AEQA 4KVHA 4HM0B 2ZL8A 2STDA 4I4KA 5D83A 4BIRA 3CCR3 2P38A 5FGOA 2W56A 1RSNA 2XH9A 2RBIA 4NHFA 3EJVA 2HMNB 4N6OB 1NDOB 2F99A 2FGTA 5ELUA 5M1AA 3N9HA 4FR9A 1RGLA 1Z1SA 3CNMA 3NQYA 1W2B2 3CC43 3NBRA 1WMPA 5AYRB 3S27A 4BL3A 3CNXA 2OOVC 2CFLA 2E2VA 3KKGA 1BRSA 1CYVA 5EEOA 3MHEA 4K61A 4J5GA 1BOXA 1MGRA 1DMNA 4JF8A 3NBBA 4R9LA 1ZGXA 3B7CA 3GZBA 4RNTA 3X3XA 4EXRA 1CQSA 4RZMA 3VGNA 1YGWA 1LRAA 3DGNA 1A90A 1NB3I 3FSDA 1STFI 3PCSA 2Y73A 2W04A 5AYSC 3LTBA 1O7MB 2Z76A 4OK0A 3ZFZA 3WA2X 4EYCA 1VQP3 1FYSA 4HM1B 2UUGC 1B3SA 1FGOA 1SJWA 3BNEA 1MNLA 3SEDA 1UW1A 3AHWA 2C4BA 1B20A 1BAOA 2CFDA 1C54A 2BU4A 2BMQB 1RNTA 1Q814 3U97A 2C11A 4FMBA 3G713 1KQS2 1RHLA 5IG4A 3JUNA 1W02A 1EA2A 1B2MA 2YFIB 4R80A 2HMMB 1RN4A 1HU9A 1T3BA 2Y74A 3Q1CA 3ZG0A 4EBGA 3EBTA 1VQL3 3F14A 1DMMA 1AY7A 3G6E3 4J9AA 5D82A 2W03A 4N6NB 1CYUA 3S29A 5IG3A 4FMCA 2H0GA 3KFQC 2CH9A 2XEPA 3SX1A 1VQ63 1O7NB 1GY5A 1LQMB 1GMQA 4N3VA 2XSHB 4XBTA 1O7PB 4MJDA 1YJ93 1FUTA 2BT3A 4BTXA 1Q7HA 4RNYA 2BIRA 4FCMA
chains in the Genus database with same CATH topology
2CWTA 2FNQA 5KP1A 4HM2B 5CLKA 4GB5A 3G4S3 3BNCA 5G2GA 1Q40A 1DYUA 1SIHA 2JDIH 1W6CA 2QGUA 3DXOA 2PNCA 4N6TA 2GEXA 1JNQA 3FLJA 1VZZA 4N6MA 1W6GA 3G8ZA 3K9MC 3X40A 4XDVA 1VQ73 3GZYB 5A0OB 1KD14 4MMYB 3B8LA 1IVVA 2WO0A 3CC73 2BO9B 3SOAA 1W00A 3MKIA 1V74A 3I563 3CCV3 3N54B 2W9QA 3OV4A 2KCDA 3PZWA 1JKGA 5IG5A 4K1UA 1IDPA 1STDA 1IVWA 1LXEA 1RRLA 2RCDA 1PU4A 4K90B 2XR8B 1QVF2 3JUQA 1MOLA 2YFJB 3FGYA 1PFPA 1LOXA 1Q40B 3FZWA 4HM4B 2UX0A 2XRXB 3QRDA 5AIFA 1S723 5BVBA 2O9UX 3CCJ3 3U1WA 1O7WB 3GRDA 3WA3A 3CD63 2OTJ3 1IV9A 3LZAA 4O02B 8CHOA 3CCL3 5D81A 1AVKA 1EQKA 1W5ZA 2I9WA 3DZLA 3NV0A 2KRTA 3Q2PA 4FCZA 1N9JA 3MG3A 3SVAA 5IENA 1K28A 3L0RA 1ULIB 3NV0B 2F86B 3NXJA 4AKYA 1VQ53 3VSYA 1JN5A 5IEOA 1N5HA 1W01A 2OOVA 1Q824 1NB5I 4HM8B 1VQO3 2RGQA 1GD3A 1W6YA 2LYXA 1GYBA 1QAFA 2MC8A 4LMIA 4RNZA 4XBYA 3H3HA 1F8NA 4XM4A 3RGRA 1TU5A 1FA3A 5BXQA 1ROAA 4N6LA 1LVNA 4WYKB 1Y4KA 3DY5A 1JB2A 4FCJA 4KZ1A 2XSOB 2Q07A 1ISKA 3EN8A 3V98A 2OCTA 1QJGA 3RDEA 4CCVA 2OWPA 3OWUA 2P0MA 2W2CA 2ML6A 3EQQB 2QIYA 1AR0A 2OQEC 1IQYA 1JRQA 1OH0A 3DUKA 3WMDA 1KSIA 2CHCA 3EX9A 1FGRA 1ASKA 1JJ22 2GXFA 3JVCA 3LTDA 4XBXA 5KP4A 1NO3A 1M1XB 4O2HA 2JQ5A 1W2ZA 3KSED 1RKYA 2XGLA 1EKMA 1US1A 2C10A 4EV5A 1OACA 5CK6A 1YIJ3 1N8R4 1QAKA 1S5AA 3K63A 4N6UA 5JPPA 4LGQA 3OWYA 3CCM3 1IT7A 4IIAA 2GBXB 4WWUC 5IF6A 3QK9A 1Q864 3WOEB 4N6V0 2HMOB 1IQ8A 4L7KA 3PCRA 1OF5A 3FKAA 2B1XB 5ELJA 2BNGA 2QA43 3F8XA 1WMNA 1IK3A 1OUNA 2W0QA 3I553 1E97A 1GY6A 4LSOA 1VQM3 2Z6BA 3K5TA 5AEUB 3CCS3 3ROBA 1K734 1IV7A 4OUQA 1IQXA 2F98A 2CFKA 1N8QA 1N9EA 4X2HA 3DGMA 4O3VA 1A2KA 3UB1A 5AIGA 5CXOA 1O7GB 3A76A 1DVDA 2CIUA 3TDGA 3AMOA 2D1WA 4L8PA 3D3LA 3NM7A 5IERA 4WFOA 4MMZB 4HM5B 3FG3A 3LT8A 4EC6A 1CEWI 1G96A 4WP5A 1WTHA 3BNBA 5IW9A 3M8CA 4HM7B 3HK4A 3G16A 3GZXB 3IJEB 4U13A 2XGNA 2GEYA 3T0UA 4HKVB 2GBWB 3MSOA 2IUJA 3NM2A 1EG9B 4G1MB 4MEIA 3X42A 3JUPA 5EQLA 3EN1B 1NWWA 1QALA 1SIIA 2YFLB 1UUVB 3DGLA 1DVCA 3MG1A 3BLZA 4GL6A 2GU1A 5AEWB 1E3VA 4HM6B 5CF1A 1ZO2A 3X3YA 4KFDA 1QVG2 4MMXB 1TUHA 3KZTA 2Z7AA 1ZX2A 4STDA 3PS8A 3X3ZA 5JPUA 3F40A 4HVNA 3MYTA 4EV2A 4ORLA 4J8TA 3PYJA 3IMAB 4KFEA 7STDA 1KC84 2XF3A 2A15A 2P09A 3KN4A 2R4IA 3CPW2 1Q42A 1L5GB 2BMOB 1AV4A 2SBLA 3ALAA 3FG4A 2RFRA 3OX9A 2W56B 1GS3A 2CK3H 5AIHA 1M9GA 2XFSA 3UL5A 1YHQ3 4QWTA 2CC3A 3EBYA 3S67A 2CW9A 3WDGB 2P05A 1TFOA 4O8SA 1T5YA 3MG2A 3NX0A 3F7SA 3KIIA 1QMAA 3JUMA 3KE7A 3F9SA 4R9KA 5IEPA 2CWUA 3FH1A 2QEX3 1OHOA 3O8YA 2O3OA 3UL6A 2CFGA 3B4PA 3OWSA 1ROVA 5IG0A 4JRFA 4KFFA 1YGEA 3NHXA 2IMJA 1IU7A 2ZDJA 3H51A 1VQ83 2LQVA 1YJN3 3NQZA 5KP3A 2W6JH 1JN5B 4HYZA 3GZRA 1IT8A 2W9PA 2INXA 2D42A 1UI7A 3D9RA 4FMAA 2XFTA 3GAXA 1IVXA 1JB5A 1FGQA 1YI23 2HMLB 1TIJA 3NUVA 4HZ9B 1VQ43 2GU3A 4HZBB 3HZPA 3B4OA 3T8NA 4TX4A 3UJMA 1U5OA 2E2UA 4HM3B 1W7CA 1OF5B 2Z77A 1FGMA 4XDWA 2WGOA 3EB8A 1FGTA 4OVMA 5AIIA 1DMQA 3GWRA 3KSPA 1TFKA 2ML5A 4L8OA 2PZVA 3MPHA 1K9M4 2BHMA 4Q53A 1K8A4 3V99A 1SQWA 1JV2B 3LXUX 1WQLB 1K41A 1U8CB 3HI7A 2CWVA 2MF7A 3CMA3 3K7CA 3EHCA 3CPOA 3UNLA 4BTYA 1SPUA 3FF2A 1VQ93 1A2VA 1KWIA 3FCSB 1UUWB 3FG1A 5FW5A 2P0XA 5LC6A 3CU3A 3CCE3 3V92A 2OTL3 3CME3 1RJOA 1AVLA 1NJI4 3LYGA 3LT9A 1A67A 1W4NA 3SLUA 1OGXA 1YIT3 3IPTA 2K0MA 3F7XA 1M904 4R1KA 5LC7A 4ZM8A 3K0ZA 3ER7A 3MWZA 3DGOA 3PXMA 5STDA 1OGZA 1GY7A 2YX9A 4HBRA 1OHPA 3S5CA 3ECFA 3OXAA 3LTAA 2WOHA 3WODG 1JKGB 2HMJB 3S28A 3JUOA 1OCVA 3NBJA 1Q7Y4 1YVBI 3BNDA 3LMLA 4RBNA 3J7Yd 1WMOA 3CCQ3 3F8HA 4CDLA 1ULJB 3LOYA 1O7HB 1IVUA 4LZIA 3BB9A 3I0YA 3DMCA 1TP6A 2FXTA 5AI1A 2K54A 1LNHA 5HGRA 5TGNA 3EC9A 1GD4A 5DREA 2IA7A 3HIGA 1RN7A 2OQEA 1OPYA 2E2TA 1VQN3 3EE1A 4H61A 2CFWA 3AMOB 3VF1A 2B24B 1D6UA 1NU3A 2BMRB 5DRVA 3OW22 1JB4A 1D6YA 2CG1A 3STDA 3G0KA 5CF2A 3PGBA 4IT7A 3SOYA 4FMDA 3X41A 1M1K4 4X2OA 4WHAA 3Q90A 2L4VA 3LTCA 1HKXA 2V1LA 1WNHA 1YJW3 1E3RA 2WOFA 1J2BA 1N5PA 2KXGA 3FF0A 3DM8A 5JBSA 2IUKA 1D6ZA 4R4KA 2RSXA 4H3UA 4WYKA 2M7OA 2CKFB 4BTWA 4LEHA 1VQK3 3RGAA 3LH4A 4NREA 3WOFB 4XB5A 3CC23 3N8BA 3CXC2 3EF8A 1FUWA 1C7HA 3SXXA 1UI8A 3T8UA 2CG0A 4AKZA 2WGQA 4HJLB 5EVHA 3HIIA 1RRHA 1BUQA 6STDA 3CCU3 4K1VA 1OHSA 2HMKB 3E99A 3HX8A 1R4CA 4IPBA 4PEJA 4AEQA 4KVHA 4HM0B 2ZL8A 2STDA 4I4KA 5D83A 3CCR3 2P38A 5FGOA 2W56A 2XH9A 4NHFA 3EJVA 2HMNB 4N6OB 1NDOB 2F99A 2FGTA 5ELUA 3N9HA 4FR9A 1Z1SA 3CNMA 3NQYA 1W2B2 3CC43 3NBRA 1WMPA 5AYRB 3S27A 3CNXA 2OOVC 2CFLA 2E2VA 3KKGA 5EEOA 1CYVA 5I97A 3MHEA 4K61A 1DMNA 4JF8A 3NBBA 4R9LA 3X3XA 3B7CA 3GZBA 4EXRA 1CQSA 4RZMA 3VGNA 3DGNA 1A90A 1NB3I 3FSDA 1STFI 3PCSA 2Y73A 2W04A 5AYSC 3LTBA 1O7MB 2Z76A 4OK0A 3WA2X 4EYCA 1VQP3 4HM1B 1FGOA 1SJWA 3BNEA 1MNLA 3SEDA 1UW1A 2CFDA 2BMQB 1Q814 3U97A 2C11A 4FMBA 3G713 1KQS2 5IG4A 3JUNA 1W02A 1EA2A 2YFIB 4R80A 2HMMB 2Y74A 1HU9A 3Q1CA 4EBGA 3EBTA 1VQL3 3F14A 1DMMA 3G6E3 4J9AA 5D82A 2W03A 4N6NB 1CYUA 3S29A 5IG3A 4FMCA 3KFQC 3SX1A 2CH9A 2XEPA 1VQ63 1O7NB 1GY5A 4N3VA 2XSHB 4XBTA 1O7PB 4MJDA 1YJ93 2BT3A 4BTXA 4RNYA 4FCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHO A;  3G0K A;  5KP1 A;  5CF2 A;  4HM2 B;  5CLK A;  4GB5 A;  3B4P A;  5CK6 A;  3SOY A;  3OWS A;  1S5A A;  5G2G A;  5IG0 A;  1Q40 A;  4X2O A;  5JPP A;  3Q90 A;  4LGQ A;  3DXO A;  2QGU A;  1HKX A;  3OWY A;  3NHX A;  4IIA A;  1E3R A;  2GEX A;  2IMJ A;  3H51 A;  3FLJ A;  2GBX B;  1VZZ A;  4WWU C;  3FF0 A;  5IF6 A;  5CXO A;  3DM8 A;  3G8Z A;  5KP3 A;  1JN5 B;  2HMO B;  4L7K A;  4XDV A;  3GZY B;  1OF5 A;  3GZR A;  2INX A;  3D9R A;  3FKA A;  4H3U A;  2B1X B;  1JB5 A;  3B8L A;  4WYK A;  2BNG A;  2CKF B;  3F8X A;  3SOA A;  4LEH A;  1OUN A;  1W00 A;  3RGA A;  2HML B;  1E97 A;  1GY6 A;  3MKI A;  4XB5 A;  3NUV A;  4HZ9 B;  3OV4 A;  4HZB B;  3HZP A;  3B4O A;  3T8N A;  3ROB A;  5AEU B;  3UJM A;  1U5O A;  3EF8 A;  4OUQ A;  1JKG A;  5IG5 A;  1C7H A;  2F98 A;  4K1U A;  3S5C A;  1IDP A;  1STD A;  3T8U A;  4X2H A;  4HJL B;  5EVH A;  4HM3 B;  5HGR A;  1BUQ A;  1OF5 B;  2RCD A;  2Z77 A;  6STD A;  4XDW A;  4OVM A;  1A2K A;  4K1V A;  5AII A;  1DMQ A;  1OHS A;  2HMK B;  2XR8 B;  3GWR A;  3JUQ A;  2YFJ B;  3KSP A;  5AIG A;  3E99 A;  3FGY A;  1O7G B;  3HX8 A;  4PEJ A;  1Q40 B;  4L8O A;  3A76 A;  2PZV A;  4KVH A;  4HM0 B;  3STD A;  3FZW A;  2STD A;  2UX0 A;  4HM4 B;  4I4K A;  4L8P A;  2XRX B;  4Q53 A;  5D83 A;  5AIF A;  5IER A;  5BVB A;  4HM5 B;  4WP5 A;  1WQL B;  1K41 A;  3EJV A;  3M8C A;  2HMN B;  4HM7 B;  5TGN A;  1NDO B;  1O7W B;  2F99 A;  3GRD A;  3G16 A;  3GZX B;  3HK4 A;  4U13 A;  3K7C A;  3EHC A;  3LZA A;  3CPO A;  8CHO A;  3UNL A;  2GEY A;  5D81 A;  4HKV B;  3FF2 A;  2GBW B;  3MSO A;  1Z1S A;  2I9W A;  3CNM A;  1EG9 B;  3DZL A;  1UUW B;  3NM2 A;  3NV0 A;  5FW5 A;  3NBR A;  3CU3 A;  3JUP A;  3CNX A;  3MG3 A;  3KKG A;  5IEN A;  3EN1 B;  1NWW A;  2YFL B;  3MHE A;  3LYG A;  1UUV B;  1ULI B;  3NV0 B;  1DMN A;  1OGX A;  2F86 B;  3MG1 A;  3BLZ A;  1JN5 A;  3NXJ A;  4R9L A;  3VSY A;  3B7C A;  3GZB A;  1W01 A;  3IPT A;  3F7X A;  1CQS A;  4RZM A;  5IEO A;  4R1K A;  3VGN A;  5AEW B;  1E3V A;  3FSD A;  3K0Z A;  4HM8 B;  4HM6 B;  3ER7 A;  5CF1 A;  1ZO2 A;  2RGQ A;  1O7M B;  1W6Y A;  2Z76 A;  5STD A;  1GYB A;  1OGZ A;  1GY7 A;  4LMI A;  1OHP A;  1TUH A;  4HM1 B;  4XBY A;  3KZT A;  3ECF A;  2Z7A A;  1ZX2 A;  3H3H A;  1SJW A;  3OXA A;  4STD A;  4XM4 A;  3RGR A;  5BXQ A;  3SED A;  1JKG B;  2HMJ B;  3F40 A;  5JPU A;  3JUO A;  4WYK B;  1OCV A;  4HVN A;  3MYT A;  4ORL A;  4J8T A;  1JB2 A;  4FCJ A;  7STD A;  2XSO B;  2BMQ B;  1ISK A;  3EN8 A;  3F8H A;  4CDL A;  1ULJ B;  2A15 A;  5IG4 A;  3JUN A;  1O7H B;  1EA2 A;  1W02 A;  2YFI B;  2R4I A;  3BB9 A;  2HMM B;  3DMC A;  1TP6 A;  3I0Y A;  1Q42 A;  1QJG A;  2BMO B;  3EBT A;  2OWP A;  3F14 A;  2K54 A;  2W2C A;  3OWU A;  1DMM A;  3OX9 A;  2RFR A;  5AI1 A;  3EQQ B;  1GS3 A;  3EC9 A;  2QIY A;  1AR0 A;  4J9A A;  5D82 A;  5AIH A;  5DRE A;  1OH0 A;  3DUK A;  3WMD A;  3EBY A;  2CHC A;  3EX9 A;  5IG3 A;  1OPY A;  1ASK A;  2GXF A;  4XBX A;  3MG2 A;  5KP4 A;  3F7S A;  1O7N B;  1GY5 A;  2B24 B;  4N3V A;  1QMA A;  2JQ5 A;  1NU3 A;  2XSH B;  3JUM A;  2BMR B;  1O7P B;  3KE7 A;  3F9S A;  4MJD A;  4R9K A;  4XBT A;  5DRV A;  1JB4 A;  5IEP A;  4FCM A;  3FH1 A; 
#chains in the Genus database with same CATH topology
 2CWT A;  2FNQ A;  5KP1 A;  4HM2 B;  5CLK A;  1RGE A;  4BU4 A;  4GB5 A;  3BIR A;  3G4S 3;  3BNC A;  5G2G A;  1Q40 A;  1DYU A;  1SIH A;  2JDI H;  1W6C A;  2QGU A;  3DXO A;  2PNC A;  4N6T A;  2GEX A;  1JNQ A;  3FLJ A;  1VZZ A;  4N6M A;  1W6G A;  3G8Z A;  3K9M C;  3X40 A;  4XDV A;  1VQ7 3;  3GZY B;  5A0O B;  1KD1 4;  1RCK A;  4MMY B;  3B8L A;  1IVV A;  2WO0 A;  3CC7 3;  2BO9 B;  1BU4 A;  3Q3F A;  3SOA A;  1W00 A;  4CPK A;  3MKI A;  3D5G A;  1LQG C;  1V74 A;  3I56 3;  3CCV 3;  3N54 B;  2SAR A;  2W9Q A;  1CH0 A;  3OV4 A;  6GSP A;  2KCD A;  1LOV A;  3PZW A;  1JKG A;  1T2I A;  1V57 A;  5IG5 A;  4K1U A;  1IDP A;  1STD A;  1IVW A;  1A2P A;  1R4Y A;  1LXE A;  1RRL A;  1RGF A;  2RCD A;  4J5K A;  1PU4 A;  1RNB A;  4K90 B;  4NPB A;  1UCK A;  2XR8 B;  1QVF 2;  3JUQ A;  1MOL A;  2YFJ B;  5GSP A;  1B21 A;  3FGY A;  1PFP A;  1LOX A;  1Q40 B;  1DET A;  1BRI A;  3FZW A;  4HM4 B;  2UX0 A;  2XRX B;  3QRD A;  5AIF A;  1S72 3;  5BVB A;  1RCL A;  2O9U X;  4EW5 A;  3CCJ 3;  3AGN A;  3U1W A;  1O7W B;  3GRD A;  4HOH A;  3WA3 A;  1BRH A;  3CD6 3;  2OTJ 3;  1IV9 A;  3LZA A;  4O02 B;  1B27 A;  8CHO A;  3CCL 3;  5D81 A;  1AVK A;  1EQK A;  1W5Z A;  2I9W A;  3DZL A;  3NV0 A;  2KRT A;  3Q2P A;  4FCZ A;  1N9J A;  3WR2 A;  3MG3 A;  3SVA A;  5IEN A;  1K28 A;  3L0R A;  1ULI B;  3NV0 B;  2F86 B;  3NXJ A;  4AKY A;  1VQ5 3;  3VSY A;  1JN5 A;  5IEO A;  1N5H A;  1W01 A;  1B2X A;  2OOV A;  1Q82 4;  1NB5 I;  4HM8 B;  1VQO 3;  2RGQ A;  2HOH A;  1GD3 A;  1W6Y A;  2LYX A;  1GYB A;  1QAF A;  2MC8 A;  4LMI A;  4RNZ A;  4XBY A;  3H3H A;  1F8N A;  4XM4 A;  3RGR A;  1TU5 A;  1FA3 A;  5BXQ A;  1ROA A;  4N6L A;  1LVN A;  3DH2 A;  4WYK B;  1Y4K A;  1HZ1 A;  3DY5 A;  1JB2 A;  4FCJ A;  4KZ1 A;  2XSO B;  2Q07 A;  1ISK A;  1PYL A;  1SAR A;  3EN8 A;  3V98 A;  1UCJ A;  2RNT A;  2OCT A;  1QJG A;  7GSP A;  1UDI I;  3GSP A;  2IY2 A;  3RDE A;  4CCV A;  2OWP A;  3OWU A;  2P0M A;  2W2C A;  2ML6 A;  3EQQ B;  2QIY A;  1AR0 A;  2OQE C;  1BSC A;  1IQY A;  1JRQ A;  1OH0 A;  3DUK A;  3WMD A;  1KSI A;  2CHC A;  3EX9 A;  1FGR A;  3HOH A;  2R41 A;  1ASK A;  1JJ2 2;  2GXF A;  3JVC A;  3LTD A;  4XBX A;  5KP4 A;  1NO3 A;  1M1X B;  4O2H A;  2JQ5 A;  3AGO A;  1W2Z A;  3KSE D;  1FZU A;  1FUS A;  1RKY A;  2XGL A;  1X1W A;  1EKM A;  1US1 A;  2C10 A;  4EV5 A;  1OAC A;  5CK6 A;  1YIJ 3;  1N8R 4;  1QAK A;  1GSP A;  1S5A A;  3K63 A;  5I97 A;  4N6U A;  5JPP A;  1B2S A;  4LGQ A;  7RNT A;  1RGC A;  3OWY A;  3CCM 3;  1IT7 A;  4IIA A;  2GBX B;  4WWU C;  1BRN L;  1EEJ A;  4GHO A;  3QK9 A;  5IF6 A;  1Q86 4;  1LNI A;  3WOE B;  1UCL A;  4N6V 0;  2HMO B;  1IQ8 A;  4L7K A;  3PCR A;  1OF5 A;  3FKA A;  1BNI A;  2B1X B;  2F4Y A;  5ELJ A;  2BNG A;  2QA4 3;  3F8X A;  1WMN A;  1IK3 A;  1OUN A;  1I3I A;  2W0Q A;  1E97 A;  3I55 3;  1GY6 A;  4LSO A;  1VQM 3;  2Z6B A;  3DGY A;  3K5T A;  5AEU B;  3CCS 3;  4LYL B;  3ROB A;  1K73 4;  4CJN A;  3WHO A;  1IV7 A;  4OUQ A;  1IQX A;  2F98 A;  2CFK A;  1N8Q A;  1N9E A;  4X2H A;  1BAN A;  3DGM A;  4O3V A;  2KF4 A;  1BRJ A;  1A2K A;  3UB1 A;  5AIG A;  5CXO A;  1V58 A;  1O7G B;  2J8X B;  1I70 A;  3A76 A;  1DVD A;  2CIU A;  3TDG A;  3AMO A;  2D1W A;  4L8P A;  3D3L A;  3NM7 A;  5IER A;  4WFO A;  4MMZ B;  4HM5 B;  3FG3 A;  3LT8 A;  4EC6 A;  1BNE A;  1G02 A;  1CEW I;  1G96 A;  4WP5 A;  1WTH A;  3BNB A;  5IW9 A;  3M8C A;  1GMR A;  1RGA A;  4HM7 B;  1MWS A;  1TTO A;  3HK4 A;  5BIR A;  3G16 A;  3GZX B;  3IJE B;  4U13 A;  1BUJ A;  2AAD A;  2XGN A;  2GEY A;  3T0U A;  4HKV B;  2GBW B;  3MSO A;  2IUJ A;  3NM2 A;  1EG9 B;  2IYJ A;  4G1M B;  1RDS A;  4MEI A;  3X42 A;  3JUP A;  2ZA4 A;  5EQL A;  3EN1 B;  1NWW A;  1QAL A;  1SII A;  2YFL B;  1LOW A;  1UUV B;  3DGL A;  1DVC A;  3MG1 A;  1BNR A;  3BLZ A;  4GL6 A;  2F56 A;  1YVS A;  2GU1 A;  5AEW B;  1E3V A;  1MWT A;  1UCI A;  4HM6 B;  5CF1 A;  1ZO2 A;  4I5Q A;  5HOH A;  3X3Y A;  4KFD A;  1QVG 2;  4MMX B;  4ILF A;  1IYY A;  1TUH A;  3KZT A;  2Z7A A;  1ZX2 A;  4STD A;  4DKI A;  4GSP A;  3PS8 A;  3X3Z A;  5JPU A;  3F40 A;  1I2F A;  1BSE A;  3MYT A;  4HVN A;  4ORL A;  4EV2 A;  4J8T A;  4HAA A;  3PYJ A;  3IMA B;  1GMP A;  1I0X A;  1RGG A;  4KFE A;  7STD A;  1KC8 4;  2XF3 A;  2A15 A;  2H0H A;  2KF5 A;  2P09 A;  1EUI C;  1X1U A;  3KN4 A;  2R4I A;  1GOV A;  3SYU A;  3CPW 2;  1Q42 A;  1L5G B;  2BMO B;  1AV4 A;  2SBL A;  1BNG A;  3ALA A;  3FG4 A;  2RFR A;  3OX9 A;  2W56 B;  1GS3 A;  1BGS A;  1I3F A;  2CK3 H;  1JZD A;  5AIH A;  2ZHX B;  1M9G A;  2XFS A;  3UL5 A;  1YHQ 3;  1BRK A;  4QWT A;  2CC3 A;  3EBY A;  3S67 A;  2CW9 A;  3WDG B;  2P05 A;  1TFO A;  4O8S A;  1T5Y A;  3MG2 A;  3NX0 A;  1RMS A;  3F7S A;  3KII A;  1QMA A;  1DE3 A;  3JUM A;  3KE7 A;  3F9S A;  4R9K A;  5IEP A;  2CWU A;  3FH1 A;  2QEX 3;  1OHO A;  3O8Y A;  2O3O A;  3UL6 A;  2L1S A;  2CFG A;  3B4P A;  1JBR A;  3OWS A;  3URP A;  1ROV A;  5IG0 A;  1AQZ A;  4JRF A;  4KFF A;  1BNJ A;  1YGE A;  3NHX A;  2IMJ A;  1IU7 A;  2ZDJ A;  3H51 A;  1VQ8 3;  1I2E A;  2LQV A;  1YJN 3;  3NQZ A;  1JBT A;  2GSP A;  5KP3 A;  2W6J H;  1JN5 B;  4HYZ A;  3GZR A;  1IT8 A;  2W9P A;  2INX A;  2K3D A;  2D42 A;  1UI7 A;  3D9R A;  4FMA A;  2XFT A;  1YNV X;  3GAX A;  1IVX A;  1JB5 A;  1FGQ A;  1YI2 3;  3AHS A;  1GOU A;  2HML B;  1JBS A;  1TIJ A;  3NUV A;  5RNT A;  4HZ9 B;  1VQ4 3;  2GU3 A;  2UGI A;  3HZP A;  1LOY A;  3B4O A;  4HZB B;  3T8N A;  4TX4 A;  3UJM A;  5G1L A;  1U5O A;  1UUG B;  3D4A A;  1HYF A;  1BIR A;  1BNF A;  2E2U A;  4HM3 B;  1W7C A;  1OF5 B;  2Z77 A;  1FGM A;  4XDW A;  2WGO A;  3EB8 A;  1FGT A;  4OVM A;  5AII A;  1DMQ A;  3GWR A;  3KSP A;  1TFK A;  3A5E A;  2ML5 A;  1JZO A;  4L8O A;  2PZV A;  3MPH A;  1K9M 4;  2BHM A;  4Q53 A;  1K8A 4;  3BU4 A;  3V99 A;  1SQW A;  1JV2 B;  3LXU X;  1WQL B;  4BL2 A;  1K41 A;  1U8C B;  3HI7 A;  1BSB A;  2CWV A;  2MF7 A;  3CMA 3;  3K7C A;  2CX0 A;  3EHC A;  5G1K A;  3CPO A;  3UNL A;  4KT3 B;  4BTY A;  1SPU A;  3FF2 A;  1RGK A;  1VQ9 3;  1A2V A;  1GOY A;  1KWI A;  1UUW B;  1X1Y A;  3FCS B;  2KF3 A;  2P0X A;  3FG1 A;  3CU3 A;  5FW5 A;  5LC6 A;  3V92 A;  3CME 3;  1RJO A;  3CCE 3;  2OTL 3;  1MWR A;  1AVL A;  1BNS A;  1RTU A;  3LYG A;  1NJI 4;  3LT9 A;  1A67 A;  1W4N A;  3SLU A;  1OGX A;  1RLS A;  3IPT A;  1RGH A;  2K0M A;  1YIT 3;  3F7X A;  1M90 4;  4R1K A;  1VQQ A;  5LC7 A;  4ZM8 A;  1BSA A;  3K0Z A;  1G0T A;  3ER7 A;  3MWZ A;  3DGO A;  1PY3 A;  3PXM A;  1MGW A;  5STD A;  1OGZ A;  1GY7 A;  1T2H A;  1I8V A;  2YX9 A;  1OHP A;  4HBR A;  3S5C A;  3ECF A;  3OXA A;  3LTA A;  2WOH A;  3WOD G;  1JKG B;  2HMJ B;  3S28 A;  3JUO A;  1OCV A;  3NBJ A;  1Q7Y 4;  1YVB I;  3BND A;  1I2G A;  3LML A;  2KAA A;  1WMO A;  4RBN A;  3J7Y d;  3CCQ 3;  3F8H A;  4CDL A;  1ULJ B;  3LOY A;  1O7H B;  1IVU A;  1X1X A;  4LZI A;  3BB9 A;  3I0Y A;  3DMC A;  1TP6 A;  2FXT A;  5AI1 A;  2K54 A;  1LNH A;  5HGR A;  5TGN A;  8RNT A;  1GD4 A;  3EC9 A;  5DRE A;  2IA7 A;  3HIG A;  1RN7 A;  2OQE A;  1OPY A;  2E2T A;  1VQN 3;  3EE1 A;  1BSD A;  4H61 A;  1B2U A;  2CFW A;  3AMO B;  3VF1 A;  2B24 B;  1D6U A;  1NU3 A;  2BMR B;  3RNT A;  1ZS7 A;  5DRV A;  1NNV A;  1Q9E A;  1RN1 A;  1JB4 A;  1D6Y A;  2CG1 A;  3STD A;  1B2Z A;  5M19 A;  3OW2 2;  3G0K A;  5CF2 A;  2H0I A;  3PGB A;  1UGH I;  4IT7 A;  1TRQ A;  4FMD A;  3SOY A;  3X41 A;  2F5M A;  1M1K 4;  4X2O A;  4WHA A;  6RNT A;  3KCH A;  2L4V A;  3Q90 A;  3LTC A;  1HKX A;  2V1L A;  1WNH A;  1TRP A;  3D79 A;  1E3R A;  2WOF A;  1YJW 3;  1J2B A;  1N5P A;  2KXG A;  3FF0 A;  3DM8 A;  5JBS A;  2CX1 A;  1TJD A;  2IUK A;  1D6Z A;  4R4K A;  2KF6 A;  2RSX A;  4H3U A;  1MWU A;  4WYK A;  3D5I A;  2M7O A;  2CKF B;  1I0V A;  4BTW A;  4LEH A;  3ZG5 A;  1VQK 3;  3RGA A;  3LH4 A;  4NRE A;  3WOF B;  4XB5 A;  3CC2 3;  1BRG A;  3N8B A;  3CXC 2;  3EF8 A;  2F5W A;  5M18 A;  1C7H A;  3SXX A;  1UI8 A;  3T8U A;  1FUW A;  9RNT A;  2CG0 A;  4AKZ A;  2WGQ A;  4HJL B;  5EVH A;  3HII A;  1RRH A;  1BUQ A;  6STD A;  3CCU 3;  4K1V A;  1UGI A;  1OHS A;  2HMK B;  5BU4 A;  1BVI A;  1FW7 A;  2AAE A;  3E99 A;  1R4C A;  3HX8 A;  4IPB A;  4PEJ A;  4AEQ A;  4KVH A;  4HM0 B;  2ZL8 A;  2STD A;  4I4K A;  5D83 A;  4BIR A;  3CCR 3;  2P38 A;  5FGO A;  2W56 A;  1RSN A;  2XH9 A;  2RBI A;  4NHF A;  3EJV A;  2HMN B;  4N6O B;  1NDO B;  2F99 A;  2FGT A;  5ELU A;  5M1A A;  3N9H A;  4FR9 A;  1RGL A;  1Z1S A;  3CNM A;  3NQY A;  1W2B 2;  3CC4 3;  3NBR A;  1WMP A;  5AYR B;  3S27 A;  4BL3 A;  3CNX A;  2OOV C;  2CFL A;  2E2V A;  3KKG A;  1BRS A;  1CYV A;  5EEO A;  3MHE A;  4K61 A;  4J5G A;  1BOX A;  1MGR A;  1DMN A;  4JF8 A;  3NBB A;  4R9L A;  1ZGX A;  3B7C A;  3GZB A;  4RNT A;  3X3X A;  4EXR A;  1CQS A;  4RZM A;  3VGN A;  1YGW A;  1LRA A;  3DGN A;  1A90 A;  1NB3 I;  3FSD A;  1STF I;  3PCS A;  2Y73 A;  2W04 A;  5AYS C;  3LTB A;  1O7M B;  2Z76 A;  4OK0 A;  3ZFZ A;  3WA2 X;  4EYC A;  1VQP 3;  1FYS A;  4HM1 B;  2UUG C;  1B3S A;  1FGO A;  1SJW A;  3BNE A;  1MNL A;  3SED A;  1UW1 A;  3AHW A;  2C4B A;  1B20 A;  1BAO A;  2CFD A;  1C54 A;  2BU4 A;  2BMQ B;  1RNT A;  1Q81 4;  3U97 A;  2C11 A;  4FMB A;  3G71 3;  1KQS 2;  1RHL A;  5IG4 A;  3JUN A;  1W02 A;  1EA2 A;  1B2M A;  2YFI B;  4R80 A;  2HMM B;  1RN4 A;  1HU9 A;  1T3B A;  2Y74 A;  3Q1C A;  3ZG0 A;  4EBG A;  3EBT A;  1VQL 3;  3F14 A;  1DMM A;  1AY7 A;  3G6E 3;  4J9A A;  5D82 A;  2W03 A;  4N6N B;  1CYU A;  3S29 A;  5IG3 A;  4FMC A;  2H0G A;  3KFQ C;  2CH9 A;  2XEP A;  3SX1 A;  1VQ6 3;  1O7N B;  1GY5 A;  1LQM B;  1GMQ A;  4N3V A;  2XSH B;  4XBT A;  1O7P B;  4MJD A;  1YJ9 3;  1FUT A;  2BT3 A;  4BTX A;  1Q7H A;  4RNY A;  2BIR A;  4FCM A; 
#chains in the Genus database with same CATH homology
 2CWT A;  2FNQ A;  5KP1 A;  4HM2 B;  5CLK A;  4GB5 A;  3G4S 3;  3BNC A;  5G2G A;  1Q40 A;  1DYU A;  1SIH A;  2JDI H;  1W6C A;  2QGU A;  3DXO A;  2PNC A;  4N6T A;  2GEX A;  1JNQ A;  3FLJ A;  1VZZ A;  4N6M A;  1W6G A;  3G8Z A;  3K9M C;  3X40 A;  4XDV A;  1VQ7 3;  3GZY B;  5A0O B;  1KD1 4;  4MMY B;  3B8L A;  1IVV A;  2WO0 A;  3CC7 3;  2BO9 B;  3SOA A;  1W00 A;  3MKI A;  1V74 A;  3I56 3;  3CCV 3;  3N54 B;  2W9Q A;  3OV4 A;  2KCD A;  3PZW A;  1JKG A;  5IG5 A;  4K1U A;  1IDP A;  1STD A;  1IVW A;  1LXE A;  1RRL A;  2RCD A;  1PU4 A;  4K90 B;  2XR8 B;  1QVF 2;  3JUQ A;  1MOL A;  2YFJ B;  3FGY A;  1PFP A;  1LOX A;  1Q40 B;  3FZW A;  4HM4 B;  2UX0 A;  2XRX B;  3QRD A;  5AIF A;  1S72 3;  5BVB A;  2O9U X;  3CCJ 3;  3U1W A;  1O7W B;  3GRD A;  3WA3 A;  3CD6 3;  2OTJ 3;  1IV9 A;  3LZA A;  4O02 B;  8CHO A;  3CCL 3;  5D81 A;  1AVK A;  1EQK A;  1W5Z A;  2I9W A;  3DZL A;  3NV0 A;  2KRT A;  3Q2P A;  4FCZ A;  1N9J A;  3MG3 A;  3SVA A;  5IEN A;  1K28 A;  3L0R A;  1ULI B;  3NV0 B;  2F86 B;  3NXJ A;  4AKY A;  1VQ5 3;  3VSY A;  1JN5 A;  5IEO A;  1N5H A;  1W01 A;  2OOV A;  1Q82 4;  1NB5 I;  4HM8 B;  1VQO 3;  2RGQ A;  1GD3 A;  1W6Y A;  2LYX A;  1GYB A;  1QAF A;  2MC8 A;  4LMI A;  4RNZ A;  4XBY A;  3H3H A;  1F8N A;  4XM4 A;  3RGR A;  1TU5 A;  1FA3 A;  5BXQ A;  1ROA A;  4N6L A;  1LVN A;  4WYK B;  1Y4K A;  3DY5 A;  1JB2 A;  4FCJ A;  4KZ1 A;  2XSO B;  2Q07 A;  1ISK A;  3EN8 A;  3V98 A;  2OCT A;  1QJG A;  3RDE A;  4CCV A;  2OWP A;  3OWU A;  2P0M A;  2W2C A;  2ML6 A;  3EQQ B;  2QIY A;  1AR0 A;  2OQE C;  1IQY A;  1JRQ A;  1OH0 A;  3DUK A;  3WMD A;  1KSI A;  2CHC A;  3EX9 A;  1FGR A;  1ASK A;  1JJ2 2;  2GXF A;  3JVC A;  3LTD A;  4XBX A;  5KP4 A;  1NO3 A;  1M1X B;  4O2H A;  2JQ5 A;  1W2Z A;  3KSE D;  1RKY A;  2XGL A;  1EKM A;  1US1 A;  2C10 A;  4EV5 A;  1OAC A;  5CK6 A;  1YIJ 3;  1N8R 4;  1QAK A;  1S5A A;  3K63 A;  4N6U A;  5JPP A;  4LGQ A;  3OWY A;  3CCM 3;  1IT7 A;  4IIA A;  2GBX B;  4WWU C;  5IF6 A;  3QK9 A;  1Q86 4;  3WOE B;  4N6V 0;  2HMO B;  1IQ8 A;  4L7K A;  3PCR A;  1OF5 A;  3FKA A;  2B1X B;  5ELJ A;  2BNG A;  2QA4 3;  3F8X A;  1WMN A;  1IK3 A;  1OUN A;  2W0Q A;  3I55 3;  1E97 A;  1GY6 A;  4LSO A;  1VQM 3;  2Z6B A;  3K5T A;  5AEU B;  3CCS 3;  3ROB A;  1K73 4;  1IV7 A;  4OUQ A;  1IQX A;  2F98 A;  2CFK A;  1N8Q A;  1N9E A;  4X2H A;  3DGM A;  4O3V A;  1A2K A;  3UB1 A;  5AIG A;  5CXO A;  1O7G B;  3A76 A;  1DVD A;  2CIU A;  3TDG A;  3AMO A;  2D1W A;  4L8P A;  3D3L A;  3NM7 A;  5IER A;  4WFO A;  4MMZ B;  4HM5 B;  3FG3 A;  3LT8 A;  4EC6 A;  1CEW I;  1G96 A;  4WP5 A;  1WTH A;  3BNB A;  5IW9 A;  3M8C A;  4HM7 B;  3HK4 A;  3G16 A;  3GZX B;  3IJE B;  4U13 A;  2XGN A;  2GEY A;  3T0U A;  4HKV B;  2GBW B;  3MSO A;  2IUJ A;  3NM2 A;  1EG9 B;  4G1M B;  4MEI A;  3X42 A;  3JUP A;  5EQL A;  3EN1 B;  1NWW A;  1QAL A;  1SII A;  2YFL B;  1UUV B;  3DGL A;  1DVC A;  3MG1 A;  3BLZ A;  4GL6 A;  2GU1 A;  5AEW B;  1E3V A;  4HM6 B;  5CF1 A;  1ZO2 A;  3X3Y A;  4KFD A;  1QVG 2;  4MMX B;  1TUH A;  3KZT A;  2Z7A A;  1ZX2 A;  4STD A;  3PS8 A;  3X3Z A;  5JPU A;  3F40 A;  4HVN A;  3MYT A;  4EV2 A;  4ORL A;  4J8T A;  3PYJ A;  3IMA B;  4KFE A;  7STD A;  1KC8 4;  2XF3 A;  2A15 A;  2P09 A;  3KN4 A;  2R4I A;  3CPW 2;  1Q42 A;  1L5G B;  2BMO B;  1AV4 A;  2SBL A;  3ALA A;  3FG4 A;  2RFR A;  3OX9 A;  2W56 B;  1GS3 A;  2CK3 H;  5AIH A;  1M9G A;  2XFS A;  3UL5 A;  1YHQ 3;  4QWT A;  2CC3 A;  3EBY A;  3S67 A;  2CW9 A;  3WDG B;  2P05 A;  1TFO A;  4O8S A;  1T5Y A;  3MG2 A;  3NX0 A;  3F7S A;  3KII A;  1QMA A;  3JUM A;  3KE7 A;  3F9S A;  4R9K A;  5IEP A;  2CWU A;  3FH1 A;  2QEX 3;  1OHO A;  3O8Y A;  2O3O A;  3UL6 A;  2CFG A;  3B4P A;  3OWS A;  1ROV A;  5IG0 A;  4JRF A;  4KFF A;  1YGE A;  3NHX A;  2IMJ A;  1IU7 A;  2ZDJ A;  3H51 A;  1VQ8 3;  2LQV A;  1YJN 3;  3NQZ A;  5KP3 A;  2W6J H;  1JN5 B;  4HYZ A;  3GZR A;  1IT8 A;  2W9P A;  2INX A;  2D42 A;  1UI7 A;  3D9R A;  4FMA A;  2XFT A;  3GAX A;  1IVX A;  1JB5 A;  1FGQ A;  1YI2 3;  2HML B;  1TIJ A;  3NUV A;  4HZ9 B;  1VQ4 3;  2GU3 A;  4HZB B;  3HZP A;  3B4O A;  3T8N A;  4TX4 A;  3UJM A;  1U5O A;  2E2U A;  4HM3 B;  1W7C A;  1OF5 B;  2Z77 A;  1FGM A;  4XDW A;  2WGO A;  3EB8 A;  1FGT A;  4OVM A;  5AII A;  1DMQ A;  3GWR A;  3KSP A;  1TFK A;  2ML5 A;  4L8O A;  2PZV A;  3MPH A;  1K9M 4;  2BHM A;  4Q53 A;  1K8A 4;  3V99 A;  1SQW A;  1JV2 B;  3LXU X;  1WQL B;  1K41 A;  1U8C B;  3HI7 A;  2CWV A;  2MF7 A;  3CMA 3;  3K7C A;  3EHC A;  3CPO A;  3UNL A;  4BTY A;  1SPU A;  3FF2 A;  1VQ9 3;  1A2V A;  1KWI A;  3FCS B;  1UUW B;  3FG1 A;  5FW5 A;  2P0X A;  5LC6 A;  3CU3 A;  3CCE 3;  3V92 A;  2OTL 3;  3CME 3;  1RJO A;  1AVL A;  1NJI 4;  3LYG A;  3LT9 A;  1A67 A;  1W4N A;  3SLU A;  1OGX A;  1YIT 3;  3IPT A;  2K0M A;  3F7X A;  1M90 4;  4R1K A;  5LC7 A;  4ZM8 A;  3K0Z A;  3ER7 A;  3MWZ A;  3DGO A;  3PXM A;  5STD A;  1OGZ A;  1GY7 A;  2YX9 A;  4HBR A;  1OHP A;  3S5C A;  3ECF A;  3OXA A;  3LTA A;  2WOH A;  3WOD G;  1JKG B;  2HMJ B;  3S28 A;  3JUO A;  1OCV A;  3NBJ A;  1Q7Y 4;  1YVB I;  3BND A;  3LML A;  4RBN A;  3J7Y d;  1WMO A;  3CCQ 3;  3F8H A;  4CDL A;  1ULJ B;  3LOY A;  1O7H B;  1IVU A;  4LZI A;  3BB9 A;  3I0Y A;  3DMC A;  1TP6 A;  2FXT A;  5AI1 A;  2K54 A;  1LNH A;  5HGR A;  5TGN A;  3EC9 A;  1GD4 A;  5DRE A;  2IA7 A;  3HIG A;  1RN7 A;  2OQE A;  1OPY A;  2E2T A;  1VQN 3;  3EE1 A;  4H61 A;  2CFW A;  3AMO B;  3VF1 A;  2B24 B;  1D6U A;  1NU3 A;  2BMR B;  5DRV A;  3OW2 2;  1JB4 A;  1D6Y A;  2CG1 A;  3STD A;  3G0K A;  5CF2 A;  3PGB A;  4IT7 A;  3SOY A;  4FMD A;  3X41 A;  1M1K 4;  4X2O A;  4WHA A;  3Q90 A;  2L4V A;  3LTC A;  1HKX A;  2V1L A;  1WNH A;  1YJW 3;  1E3R A;  2WOF A;  1J2B A;  1N5P A;  2KXG A;  3FF0 A;  3DM8 A;  5JBS A;  2IUK A;  1D6Z A;  4R4K A;  2RSX A;  4H3U A;  4WYK A;  2M7O A;  2CKF B;  4BTW A;  4LEH A;  1VQK 3;  3RGA A;  3LH4 A;  4NRE A;  3WOF B;  4XB5 A;  3CC2 3;  3N8B A;  3CXC 2;  3EF8 A;  1FUW A;  1C7H A;  3SXX A;  1UI8 A;  3T8U A;  2CG0 A;  4AKZ A;  2WGQ A;  4HJL B;  5EVH A;  3HII A;  1RRH A;  1BUQ A;  6STD A;  3CCU 3;  4K1V A;  1OHS A;  2HMK B;  3E99 A;  3HX8 A;  1R4C A;  4IPB A;  4PEJ A;  4AEQ A;  4KVH A;  4HM0 B;  2ZL8 A;  2STD A;  4I4K A;  5D83 A;  3CCR 3;  2P38 A;  5FGO A;  2W56 A;  2XH9 A;  4NHF A;  3EJV A;  2HMN B;  4N6O B;  1NDO B;  2F99 A;  2FGT A;  5ELU A;  3N9H A;  4FR9 A;  1Z1S A;  3CNM A;  3NQY A;  1W2B 2;  3CC4 3;  3NBR A;  1WMP A;  5AYR B;  3S27 A;  3CNX A;  2OOV C;  2CFL A;  2E2V A;  3KKG A;  5EEO A;  1CYV A;  5I97 A;  3MHE A;  4K61 A;  1DMN A;  4JF8 A;  3NBB A;  4R9L A;  3X3X A;  3B7C A;  3GZB A;  4EXR A;  1CQS A;  4RZM A;  3VGN A;  3DGN A;  1A90 A;  1NB3 I;  3FSD A;  1STF I;  3PCS A;  2Y73 A;  2W04 A;  5AYS C;  3LTB A;  1O7M B;  2Z76 A;  4OK0 A;  3WA2 X;  4EYC A;  1VQP 3;  4HM1 B;  1FGO A;  1SJW A;  3BNE A;  1MNL A;  3SED A;  1UW1 A;  2CFD A;  2BMQ B;  1Q81 4;  3U97 A;  2C11 A;  4FMB A;  3G71 3;  1KQS 2;  5IG4 A;  3JUN A;  1W02 A;  1EA2 A;  2YFI B;  4R80 A;  2HMM B;  2Y74 A;  1HU9 A;  3Q1C A;  4EBG A;  3EBT A;  1VQL 3;  3F14 A;  1DMM A;  3G6E 3;  4J9A A;  5D82 A;  2W03 A;  4N6N B;  1CYU A;  3S29 A;  5IG3 A;  4FMC A;  3KFQ C;  3SX1 A;  2CH9 A;  2XEP A;  1VQ6 3;  1O7N B;  1GY5 A;  4N3V A;  2XSH B;  4XBT A;  1O7P B;  4MJD A;  1YJ9 3;  2BT3 A;  4BTX A;  4RNY A;  4FCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...