2GBXB

Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
170
structure length
170
Chain Sequence
QIPVTPDVHYDIEAHYRAEVRMFQTGQYREWLQGMVAEDIHYWMPIYEQRLTRDRRPDPTPDDAAIYNDDFGELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAGNGELDVLSNILVYRNRRQTEVTVHTLGREDKLRRDGNGFKVFRRKLILDARVTQDKNLYFFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biphenyl 2,3-Dioxygenase Alpha Subunit
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
total genus 42
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gbxB00
1Q42A 3KKGA 1ISKA 4FCJA 4HM0B 4KVHA 3NV0B 3MG1A 4HKVB 1OUNA 1ULJB 3HZPA 1OHSA 2HMLB 2XSHB 5DRVA 1GS3A 4L7KA 1WQLB 4LGQA 4CDLA 4ORLA 3FZWA 1OHPA 1SJWA 3JUNA 3VSYA 4HJLB 1JN5A 3EBTA 5CK6A 1IDPA 2Z7AA 3OWUA 2F86B 3EQQB 2HMMB 4WP5A 2HMNB 3FSDA 1OF5B 4GB5A 2UX0A 1OGZA 4HM1B 5AEUB 5G2GA 1C7HA 3NHXA 3F9SA 4U13A 3CU3A 4HVNA 5AIFA 3B8LA 5CXOA 3MKIA 5DREA 3EJVA 4WWUC 3ROBA 3ECFA 5FW5A 4R9KA 1TP6A 4RZMA 3OWYA 4H3UA 2GXFA 3F7SA 2B24B 3K7CA 3DM8A 4HM4B 4XBYA 2GEYA 4HM5B 1OCVA 5IG4A 4PEJA 1GYBA 2I9WA 3KE7A 1DMMA 1O7NB 1ZO2A 4X2HA 2BNGA 1W6YA 1JB5A 1A2KA 4WYKA 4J8TA 3E99A 5AI1A 5BXQA 3MG3A 3IPTA 5AEWB 2QGUA 1W01A 5BVBA 2GEXA 1JN5B 3JUPA 1DMQA 1ZX2A 3FF2A 1STDA 3DUKA 3FF0A 1QJGA 1O7MB 1S5AA 5HGRA 3B4OA 3NUVA 4N3VA 3ER7A 3GRDA 3EX9A 1JKGB 2F98A 2B1XB 5IG0A 2CHCA 4XB5A 1U5OA 2YFJB 5CF2A 3GZYB 3CNXA 2RGQA 3B4PA 5IERA 8CHOA 1BUQA 1E3VA 3BLZA 3F40A 3GZXB 2XRXB 1VZZA 3G16A 3JUQA 3G0KA 2RFRA 3I0YA 5CLKA 2GBXB 3UJMA 2HMOB 4IIAA 5CF1A 3NV0A 2INXA 3NBRA 1ULIB 5TGNA 3GZRA 1AR0A 1NDOB 1EA2A 5KP4A 4Q53A 3T8NA 2Z76A 3MG2A 1NU3A 1E3RA 5AIGA 3WMDA 3UNLA 5IF6A 1HKXA 5KP3A 1W00A 4L8OA 3A76A 4LMIA 6STDA 3B7CA 3FH1A 2BMOB 5AIIA 4HM2B 3HK4A 4K1UA 5IG5A 3G8ZA 3RGAA 4R1KA 2OWPA 3EN1B 3HX8A 4I4KA 3OXAA 1OF5A 5EVHA 2HMJB 3OV4A 1O7HB 3F7XA 4OUQA 2JQ5A 1Q40A 4XDVA 5STDA 3MSOA 3NXJA 2BMRB 3F14A 1GY6A 1O7PB 3RGRA 2A15A 2BMQB 2YFLB 1OPYA 2K54A 3VGNA 3FGYA 5D81A 1CQSA 5JPPA 3LYGA 4HM3B 3M8CA 4STDA 3KZTA 2GBWB 1GY5A 1Z1SA 5IG3A 5IEPA 3KSPA 1OH0A 1K41A 4HM6B 1W02A 3CPOA 4HZBB 5D82A 1JB2A 2HMKB 1ASKA 2YFIB 3K0ZA 5KP1A 3F8XA 1OHOA 7STDA 3H51A 1O7GB 2XSOB 4R9LA 3F8HA 3SOYA 5IENA 4X2OA 4OVMA 1E97A 1O7WB 3DMCA 3FKAA 4XDWA 5JPUA 1DMNA 3JUOA 2RCDA 2IMJA 2R4IA 3JUMA 1QMAA 3SOAA 4XBTA 3MYTA 2Z77A 1UUVB 4MJDA 3EHCA 3DXOA 3OX9A 3NM2A 4HZ9B 4WYKB 4HM7B 1Q40B 1JKGA 1EG9B 3MHEA 3LZAA 3CNMA 4XBXA 4LEHA 3FLJA 1NWWA 3GWRA 2QIYA 3EC9A 3EBYA 3T8UA 5AIHA 3EF8A 2F99A 5D83A 3STDA 3BB9A 4L8PA 2W2CA 2PZVA 3H3HA 3SEDA 4K1VA 1OGXA 3EN8A 4XM4A 1TUHA 4FCMA 2STDA 4J9AA 1GY7A 3Q90A 3S5CA 5IEOA 2XR8B 3GZBA 3DZLA 3D9RA 3OWSA 2CKFB 1UUWB 1JB4A 4HM8B
chains in the Genus database with same CATH superfamily
4ILFA 3CCU3 4R80A 1Q42A 1LOVA 3AHSA 2CX1A 1RN7A 3ALAA 1BVIA 3NM7A 3KKGA 4RBNA 1W2B2 1ISKA 2WGQA 4FCJA 4HAAA 4HOHA 1R4YA 1GOYA 1JJ22 4LYLB 2W6JH 4BU4A 2CWVA 2IY2A 3FG4A 3LT8A 3NX0A 2O3OA 4HM0B 4KVHA 1KD14 1QVF2 1IQXA 3NV0B 3CCS3 3PZWA 2XGNA 4N6NB 1QAFA 3MG1A 4HKVB 1OUNA 1RRHA 1BGSA 3EE1A 1T5YA 3IJEB 3T0UA 1YIJ3 1ULJB 3HZPA 1OHSA 2D1WA 3PCSA 3D3LA 4NREA 5GSPA 1TJDA 4OK0A 3AGNA 2D42A 3LH4A 1BSBA 1UCIA 2CK3H 2HMLB 3GAXA 3QK9A 1FW7A 2XSHB 5DRVA 1GS3A 1TIJA 4KFFA 4N6UA 1IVXA 4RNZA 2FGTA 1TRQA 1LNHA 4L7KA 1WQLB 1BRNL 4LGQA 4CDLA 4ORLA 1YIT3 4R4KA 3FZWA 5A0OB 1RKYA 1OHPA 1VQO3 8RNTA 2CG0A 1K8A4 1SJWA 3JUNA 3VSYA 1EQKA 2GU1A 2RBIA 1JN5A 2W0QA 3EBTA 1IDPA 4HJLB 5CK6A 2C11A 2QEX3 2JDIH 1V57A 3HIGA 3D5GA 3SX1A 3BU4A 2KF4A 2OOVA 2Z7AA 1GSPA 3OWUA 1G02A 3CCM3 1AV4A 2F86B 2HOHA 1UGHI 3EQQB 5JBSA 2HMMB 4WP5A 1RMSA 2HMNB 2R41A 3FSDA 3QRDA 1OF5B 3U97A 4GB5A 3FCSB 2UX0A 2OQEA 1NNVA 1N5PA 5HOHA 2CFKA 1OGZA 4HM1B 5AEUB 5G2GA 4N6TA 3URPA 1C7HA 3NHXA 3I563 4LSOA 3F9SA 4U13A 3PCRA 4BTXA 3CU3A 4HVNA 4IPBA 1HYFA 1MWRA 5AIFA 3CCR3 2W9QA 3OW22 3FG1A 1DVDA 3B8LA 5CXOA 1A2VA 1BSEA 1RGKA 4K90B 1X1YA 4O02B 4CJNA 3FG3A 1GMQA 3MKIA 5DREA 1BSDA 3EJVA 4WWUC 1VQP3 3ROBA 4AKZA 1LOXA 3ECFA 5FW5A 2YX9A 1K28A 1FGRA 1TP6A 3AHWA 3LT9A 4R9KA 7RNTA 3CCE3 1BUJA 2BHMA 4RZMA 2XGLA 1I2EA 3UB1A 2UGIA 1NB5I 1SQWA 1KWIA 3OWYA 1BSAA 3NQYA 4H3UA 1BU4A 2GXFA 3NQZA 1B2UA 1UCLA 1VQ93 1BAOA 1YVSA 1GOVA 2FXTA 1A67A 3F7SA 3KN4A 4MMZB 2KF5A 2CIUA 4EW5A 2B24B 4K61A 3K7CA 4EV5A 5RNTA 3DM8A 3RDEA 4HM4B 5AYSC 3S5CA 1NO3A 1K9M4 4XBYA 3X3XA 1STFI 2WGOA 1MWSA 1BRGA 2GEYA 2KF3A 2XFTA 4HM5B 1IQ8A 2OCTA 1OCVA 4FR9A 5IG4A 1CYVA 4PEJA 4RNYA 1GYBA 1YHQ3 2I9WA 3KE7A 4AEQA 1BNGA 2OTJ3 1DE3A 1DMMA 1O7NB 1IK3A 4GSPA 1ZO2A 2O9UX 4X2HA 2BNGA 5G1KA 1W6YA 1JB5A 1TU5A 2M7OA 5AYRB 1A2KA 1NJI4 4WYKA 3LTBA 4J8TA 1N5HA 3DGLA 4NHFA 1ZS7A 5LC7A 3E99A 2L1SA 3L0RA 1YJW3 5G1LA 1Q7Y4 1IV9A 5AI1A 1MGWA 3CC73 5BXQA 1BRHA 2F4YA 3LTCA 3IPTA 3MG3A 5AEWB 1RHLA 2E2VA 2QGUA 4RNTA 1WMOA 3DGOA 3UL6A 4KT3B 1JRQA 1W01A 2P0XA 3KSED 2MC8A 1I2FA 1RJOA 4DKIA 1QALA 1BANA 2IUJA 5BVBA 1VQ63 2GEXA 3NBJA 2CFWA 1GMRA 2LQVA 1JN5B 3JUPA 3LMLA 1N9EA 3CC43 1DMQA 1GD4A 4BIRA 1ZX2A 4BL2A 3J7Yd 2ZL8A 1JZOA 3FF2A 1RSNA 1STDA 4KFDA 3DUKA 2CH9A 3FF0A 1QJGA 3K5TA 2KRTA 1SARA 1UW1A 1JBRA 1FGMA 1O7MB 4O8SA 1S5AA 4GHOA 3WODG 5HGRA 3KCHA 1YGWA 3B4OA 3PXMA 4EYCA 2P05A 3NUVA 4N3VA 2J8XB 5BU4A 1I3IA 2L4VA 2CX0A 3ER7A 3GRDA 3HI7A 3S28A 4TX4A 3EX9A 1JKGB 5ELUA 2F98A 2B1XB 2SBLA 2QA43 5IG0A 3VF1A 2CHCA 1I8VA 4XB5A 4CPKA 2GU3A 4J5GA 3MPHA 2OTL3 4I5QA 2LYXA 2W56A 1U5OA 1RLSA 2YFJB 5CF2A 1I2GA 2Q07A 3AMOB 3GZYB 3CNXA 2RGQA 3D5IA 3B4PA 5IERA 1BOXA 8CHOA 1I70A 4AKYA 4MEIA 1BUQA 2SARA 1B27A 4WHAA 1KC84 1IV7A 1U8CB 4GL6A 1E3VA 3TDGA 3EB8A 3BLZA 2CW9A 3F40A 3ZG0A 1IQYA 1RGCA 3GZXB 4EXRA 3K9MC 1PU4A 2XRXB 1N8QA 1VZZA 3G16A 3JUQA 3G0KA 3NBBA 1B21A 3CD63 1RGLA 3I553 2RFRA 3I0YA 5CLKA 2H0GA 2IA7A 1WTHA 2GBXB 3UJMA 1BRJA 1M1K4 2HMOB 2FNQA 1US1A 4IIAA 1SPUA 5CF1A 3NV0A 3DGMA 1FUSA 4N6LA 1D6YA 1VQ53 1VQ73 3N54B 2KCDA 3DGYA 2INXA 3NBRA 1ULIB 2KAAA 1UCKA 5TGNA 3GZRA 1AR0A 2CFGA 3CC23 1D6UA 1NDOB 4NPBA 1BNFA 4N6OB 1RGEA 1IT8A 4WFOA 1EA2A 5KP4A 1W6CA 4Q53A 3DH2A 3T8NA 1VQQA 1T2IA 2Z76A 3MG2A 1HU9A 1UUGB 2CFDA 3CCV3 1NU3A 1JBSA 3LTAA 3BNCA 3PS8A 1W2ZA 1Q814 1VQK3 1E3RA 2CG1A 5AIGA 1B3SA 1Q864 3S67A 3WMDA 3WA3A 1IYYA 3UNLA 5IF6A 1G96A 1HKXA 1DVCA 3N8BA 5KP3A 1W00A 4L8OA 3A76A 4LMIA 6STDA 1LQMB 3B7CA 3FH1A 3BNDA 3Q2PA 1TFKA 2BMOB 1K734 1L5GB 1LOYA 2XH9A 3U1WA 4FMCA 3PGBA 5AIIA 4HM2B 3HK4A 4K1UA 1C54A 3WDGB 3GSPA 3HOHA 2H0HA 1VQ83 5IG5A 1BRSA 2KF6A 1RGGA 3CCQ3 4FMAA 3G8ZA 3RGAA 3KIIA 1JNQA 4R1KA 1RGHA 4EV2A 1PFPA 2OWPA 3EN1B 3HX8A 2WOFA 4I4KA 1B2XA 2XEPA 1MOLA 1VQN3 3OXAA 2KXGA 4ZM8A 1OF5A 2XF3A 5EVHA 1TFOA 3G6E3 2E2UA 1GOUA 2HMJB 3AGOA 3OV4A 1Y4KA 1BNRA 3D4AA 3V98A 1BIRA 1O7HB 3F7XA 1AVKA 4OUQA 1YVBI 1Q40A 2E2TA 1WMNA 2JQ5A 2K0MA 4XDVA 5STDA 4BL3A 3MSOA 1B2ZA 3NXJA 3CME3 4N6MA 1MNLA 1X1WA 2BMRB 3F14A 1GY6A 2F5MA 1KSIA 4JF8A 3X42A 3BNBA 1O7PB 1OACA 3BNEA 3CPW2 3RGRA 3WR2A 2IYJA 2IUKA 4FCZA 2A15A 1SIHA 2V1LA 2BMQB 1RNTA 1W4NA 2YFLB 1OPYA 5ELJA 4LZIA 1BSCA 2Y73A 2C4BA 1S723 2K54A 3VGNA 1WNHA 3FGYA 5D81A 2BT3A 1CQSA 5JPPA 3LYGA 4HM3B 3M8CA 1V74A 2BO9B 4O2HA 4STDA 3KZTA 2GBWB 1GY5A 1Z1SA 1ROAA 3SXXA 5IG3A 5IEPA 3X3YA 3KSPA 3G4S3 2H0IA 1BNJA 1OH0A 2RNTA 2P38A 3K63A 1JV2B 3CCJ3 1BRIA 1RGFA 1I0XA 1NB3I 1K41A 4HM6B 1W02A 3CPOA 4HZBB 5D82A 1YJN3 1FUWA 4BTYA 2ML5A 3PYJA 1JB2A 1KQS2 2CWUA 2AAEA 2HMKB 1A2PA 1ASKA 1RDSA 1FA3A 1RCLA 2YFIB 3X40A 1YJ93 1MWUA 1B2MA 3K0ZA 3SLUA 2UUGC 3ZG5A 5M1AA 5KP1A 2RSXA 3F8XA 3ZFZA 1OHOA 3WHOA 7STDA 5EQLA 3H51A 2CWTA 2CFLA 2ZDJA 1O7GB 2XSOB 1I3FA 2K3DA 4R9LA 3F8HA 3SOYA 5IENA 3RNTA 4X2OA 3WOEB 1N8R4 1IVVA 4OVMA 3DGNA 1RN4A 1BNIA 1LNIA 1WMPA 1F8NA 1UI8A 2ML6A 1RN1A 1IVWA 1CH0A 1FGQA 5LC6A 1E97A 1PYLA 1M904 1VQL3 4QWTA 1O7WB 1A90A 1YNVX 2BIRA 3DY5A 3SVAA 3DMCA 1R4CA 1LRAA 3FKAA 4XDWA 1W6GA 3V92A 1Q824 1QVG2 1GD3A 3MWZA 5JPUA 7GSPA 1FYSA 2CC3A 1DMNA 3JUOA 6RNTA 3LTDA 4N6V0 1UI7A 2RCDA 3A5EA 2C10A 4CCVA 1Q7HA 2P09A 2IMJA 1CYUA 2R4IA 1G0TA 3D79A 3JUMA 4H61A 1QMAA 1I0VA 1IVUA 4HBRA 1V58A 5M18A 3SOAA 4BTWA 1D6ZA 1TTOA 1UDII 4JRFA 3X41A 5M19A 1MWTA 4XBTA 3BIRA 3MYTA 2Z77A 1EEJA 1JBTA 1T2HA 1IU7A 1UUVB 4MJDA 3EHCA 3DXOA 1HZ1A 1GMPA 3CCL3 3OX9A 3NM2A 1DYUA 1IT7A 1EKMA 1FZUA 1RTUA 1UGIA 4KFEA 9RNTA 4HZ9B 4WYKB 1AVLA 3Q1CA 3LXUX 1Q40B 2ZHXB 4HM7B 3G713 1FGOA 1JKGA 1YI23 1T3BA 1ROVA 1EG9B 4FMBA 1BNEA 3MHEA 2PNCA 5BIRA 2MF7A 1EUIC 4G1MB 1N9JA 3LZAA 3AMOA 3S27A 4EBGA 3CNMA 1PY3A 4XBXA 4LEHA 3FLJA 1FUTA 1NWWA 1B20A 2WO0A 3GWRA 2QIYA 6GSPA 3EC9A 3EBYA 1VQM3 3T8UA 5AIHA 3JVCA 1SIIA 1CEWI 1BNSA 2P0MA 3EF8A 3WA2X 3WOFB 5IW9A 4HYZA 4MMYB 2W03A 4IT7A 3UL5A 1M1XB 2F99A 1B2SA 2W04A 4MMXB 1X1UA 1JZDA 1W5ZA 3BB9A 5D83A 5FGOA 2ZA4A 3STDA 1RCKA 4L8PA 4KZ1A 3S29A 2W2CA 1W7CA 2AADA 1LOWA 3CXC2 2PZVA 3H3HA 5I97A 3SEDA 2Z6BA 4K1VA 1OGXA 3EN8A 3Q3FA 1AQZA 1J2BA 1TRPA 2Y74A 4XM4A 3IMAB 1TUHA 4FCMA 1UCJA 3V99A 1Q9EA 3N9HA 2STDA 4J9AA 1MGRA 3O8YA 1GY7A 3KFQC 3Q90A 2XFSA 5IEOA 2GSPA 1LXEA 1QAKA 2BU4A 2F5WA 2OOVC 2W9PA 2XR8B 3GZBA 4FMDA 3SYUA 1BRKA 3X3ZA 3DZLA 1RNBA 3D9RA 1M9GA 2WOHA 1RGAA 2W56B 3CMA3 1FGTA 3OWSA 1X1XA 2CKFB 4EC6A 1LQGC 1LVNA 1RRLA 4J5KA 1VQ43 1YGEA 1ZGXA 1DETA 5EEOA 1AY7A 1UUWB 2OQEC 2F56A 3LOYA 1JB4A 4HM8B 3HIIA 4O3VA
chains in the Genus database with same CATH topology
3CCU3 4R80A 1Q42A 1RN7A 3ALAA 3NM7A 3KKGA 4RBNA 1W2B2 1ISKA 2WGQA 4FCJA 1JJ22 2W6JH 2CWVA 3FG4A 3LT8A 4HM0B 3NX0A 2O3OA 4KVHA 1KD14 1QVF2 1IQXA 3NV0B 3CCS3 3PZWA 2XGNA 4N6NB 1QAFA 3MG1A 4HKVB 1OUNA 1RRHA 3EE1A 1T5YA 3IJEB 3T0UA 1YIJ3 1ULJB 3HZPA 1OHSA 2D1WA 3PCSA 3D3LA 4NREA 4OK0A 2D42A 3LH4A 2CK3H 3GAXA 2HMLB 3QK9A 2XSHB 5DRVA 1GS3A 1TIJA 4KFFA 4N6UA 1IVXA 4RNZA 2FGTA 1LNHA 4L7KA 1WQLB 4LGQA 4CDLA 4ORLA 1YIT3 4R4KA 3FZWA 5A0OB 1RKYA 1OHPA 1VQO3 1K8A4 2CG0A 1SJWA 3JUNA 3VSYA 1EQKA 2GU1A 4HJLB 1JN5A 2W0QA 3EBTA 1IDPA 5CK6A 2QEX3 2C11A 2JDIH 3HIGA 3SX1A 2OOVA 2Z7AA 3OWUA 3CCM3 1AV4A 2F86B 3EQQB 5JBSA 2HMMB 4WP5A 2HMNB 3FSDA 3QRDA 1OF5B 3U97A 4GB5A 3FCSB 2UX0A 2OQEA 1N5PA 2CFKA 1OGZA 4HM1B 5AEUB 5G2GA 4N6TA 1C7HA 3NHXA 3I563 4LSOA 3F9SA 4U13A 3PCRA 4BTXA 3CU3A 4HVNA 4IPBA 5AIFA 3CCR3 3OW22 2W9QA 3FG1A 1DVDA 3B8LA 5CXOA 1A2VA 4K90B 4O02B 3FG3A 3MKIA 5DREA 3EJVA 4WWUC 1VQP3 3ROBA 4AKZA 1LOXA 3ECFA 5FW5A 2YX9A 1K28A 1FGRA 1TP6A 3LT9A 4R9KA 3CCE3 2BHMA 4RZMA 2XGLA 3UB1A 1NB5I 1SQWA 1KWIA 3OWYA 3NQYA 4H3UA 2GXFA 3NQZA 1VQ93 2FXTA 1A67A 3F7SA 3KN4A 4MMZB 4EV5A 2CIUA 2B24B 4K61A 3K7CA 3DM8A 3RDEA 4HM4B 5AYSC 1NO3A 1K9M4 4XBYA 3X3XA 1STFI 2WGOA 2GEYA 4HM5B 2XFTA 1IQ8A 2OCTA 1OCVA 4FR9A 5IG4A 1CYVA 4PEJA 4RNYA 1GYBA 1YHQ3 2I9WA 3KE7A 4AEQA 2OTJ3 1DMMA 1O7NB 1IK3A 1ZO2A 2O9UX 4X2HA 2BNGA 1W6YA 1JB5A 1TU5A 2M7OA 5AYRB 1A2KA 1NJI4 4WYKA 3LTBA 4J8TA 1N5HA 3DGLA 4NHFA 5LC7A 3E99A 3L0RA 1YJW3 1Q7Y4 1IV9A 5AI1A 3CC73 5BXQA 3MG3A 3LTCA 3IPTA 5AEWB 2E2VA 2QGUA 1WMOA 3DGOA 3UL6A 2MC8A 1JRQA 1W01A 2P0XA 3KSED 1RJOA 1QALA 2IUJA 1VQ63 5BVBA 2GEXA 3NBJA 2CFWA 2LQVA 1JN5B 3JUPA 3LMLA 1N9EA 3CC43 1DMQA 1GD4A 1ZX2A 3J7Yd 2ZL8A 3FF2A 1STDA 4KFDA 3DUKA 2CH9A 3FF0A 1QJGA 3K5TA 2KRTA 1UW1A 1FGMA 1O7MB 4O8SA 1S5AA 3WODG 5HGRA 3B4OA 3PXMA 4EYCA 2P05A 3NUVA 4N3VA 3ER7A 2L4VA 3GRDA 3HI7A 3S28A 4TX4A 3EX9A 1JKGB 5ELUA 2F98A 2B1XB 2SBLA 2QA43 5IG0A 3VF1A 2CHCA 4XB5A 2GU3A 2OTL3 3MPHA 2LYXA 2W56A 1U5OA 2YFJB 5CF2A 2Q07A 3AMOB 3GZYB 3CNXA 2RGQA 3B4PA 5IERA 8CHOA 4AKYA 1BUQA 4MEIA 4WHAA 1KC84 1IV7A 1U8CB 4GL6A 1E3VA 3TDGA 3EB8A 3BLZA 2CW9A 3F40A 1IQYA 3GZXB 4EXRA 3K9MC 1PU4A 2XRXB 1N8QA 1VZZA 3G16A 3JUQA 3G0KA 3NBBA 3CD63 3I553 2RFRA 3I0YA 5CLKA 2IA7A 1WTHA 2GBXB 3UJMA 1M1K4 2HMOB 2FNQA 1US1A 4IIAA 1SPUA 5CF1A 3NV0A 3DGMA 4N6LA 1D6YA 1VQ53 1VQ73 3N54B 2KCDA 2INXA 3NBRA 1ULIB 5TGNA 3GZRA 2CFGA 1AR0A 3CC23 1D6UA 1NDOB 4N6OB 1IT8A 4WFOA 1EA2A 5KP4A 1W6CA 4Q53A 3T8NA 2Z76A 3MG2A 1HU9A 2CFDA 3CCV3 1NU3A 3LTAA 3BNCA 3PS8A 1W2ZA 1Q814 1VQK3 1E3RA 2CG1A 5AIGA 1Q864 3S67A 3WMDA 3WA3A 3UNLA 5IF6A 1G96A 1HKXA 1DVCA 3N8BA 5KP3A 1W00A 4L8OA 3A76A 4LMIA 6STDA 3B7CA 3FH1A 3BNDA 3Q2PA 1TFKA 2BMOB 1K734 1L5GB 2XH9A 3U1WA 4FMCA 3PGBA 5AIIA 4HM2B 3HK4A 4K1UA 3WDGB 1VQ83 5IG5A 3CCQ3 4FMAA 3G8ZA 3RGAA 3KIIA 1JNQA 4R1KA 4EV2A 1PFPA 2OWPA 3EN1B 3HX8A 2WOFA 4I4KA 2XEPA 1MOLA 1VQN3 3OXAA 2KXGA 4ZM8A 1OF5A 2XF3A 5EVHA 1TFOA 3G6E3 2E2UA 2HMJB 3OV4A 1Y4KA 3V98A 1O7HB 3F7XA 1AVKA 4OUQA 1YVBI 1Q40A 2E2TA 1WMNA 2JQ5A 2K0MA 4XDVA 5STDA 3MSOA 3NXJA 3CME3 4N6MA 1MNLA 2BMRB 3F14A 1GY6A 3X42A 1KSIA 4JF8A 3BNBA 1O7PB 1OACA 3BNEA 3CPW2 3RGRA 4FCZA 2IUKA 2A15A 1SIHA 2V1LA 2BMQB 1W4NA 2YFLB 1OPYA 5ELJA 4LZIA 2Y73A 1S723 2K54A 3VGNA 1WNHA 3FGYA 5D81A 2BT3A 1CQSA 5JPPA 3LYGA 4HM3B 3M8CA 1V74A 2BO9B 4O2HA 4STDA 3KZTA 2GBWB 1GY5A 1Z1SA 1ROAA 3SXXA 5IG3A 5IEPA 3X3YA 3KSPA 3G4S3 1OH0A 2P38A 3K63A 1JV2B 3CCJ3 1NB3I 1K41A 4HM6B 1W02A 3CPOA 4HZBB 5D82A 1YJN3 1FUWA 4BTYA 2ML5A 3PYJA 1JB2A 1KQS2 2CWUA 2HMKB 1ASKA 1FA3A 2YFIB 3X40A 1YJ93 3K0ZA 3SLUA 5KP1A 2RSXA 3F8XA 1OHOA 7STDA 5EQLA 3H51A 2CWTA 2CFLA 2ZDJA 1O7GB 2XSOB 4R9LA 3F8HA 3SOYA 5IENA 4X2OA 3WOEB 1N8R4 1IVVA 4OVMA 3DGNA 1WMPA 1F8NA 1UI8A 2ML6A 1M904 1IVWA 1FGQA 5LC6A 1E97A 1VQL3 4QWTA 1O7WB 1A90A 3SVAA 3DY5A 3DMCA 1R4CA 3FKAA 4XDWA 1W6GA 3V92A 1Q824 1QVG2 1GD3A 3MWZA 5JPUA 2CC3A 1DMNA 3JUOA 3LTDA 4N6V0 1UI7A 2RCDA 2C10A 4CCVA 2P09A 2IMJA 1CYUA 2R4IA 3JUMA 4H61A 1QMAA 1IVUA 4HBRA 3SOAA 4BTWA 1D6ZA 4JRFA 3X41A 4XBTA 3MYTA 2Z77A 1IU7A 1UUVB 4MJDA 3EHCA 3DXOA 3CCL3 3OX9A 3NM2A 1DYUA 1IT7A 1EKMA 4KFEA 4HZ9B 4WYKB 1AVLA 3Q1CA 3LXUX 1Q40B 4HM7B 3G713 1FGOA 1JKGA 1YI23 1ROVA 1EG9B 4FMBA 3MHEA 2PNCA 2MF7A 4G1MB 1N9JA 3LZAA 3AMOA 3S27A 4EBGA 3CNMA 4XBXA 4LEHA 3FLJA 1NWWA 3GWRA 2WO0A 2QIYA 3EC9A 3EBYA 1VQM3 3T8UA 5AIHA 3JVCA 1SIIA 1CEWI 2P0MA 3EF8A 3WA2X 3WOFB 5IW9A 4HYZA 4MMYB 2W03A 4IT7A 3UL5A 1M1XB 2F99A 2W04A 4MMXB 5D83A 1W5ZA 3STDA 3BB9A 5FGOA 4L8PA 4KZ1A 3S29A 2W2CA 1W7CA 3CXC2 2PZVA 3H3HA 5I97A 3SEDA 2Z6BA 4K1VA 1OGXA 3EN8A 1J2BA 2Y74A 4XM4A 3IMAB 1TUHA 4FCMA 3V99A 3N9HA 2STDA 4J9AA 3O8YA 1GY7A 3KFQC 3Q90A 2XFSA 5IEOA 2OOVC 1LXEA 1QAKA 2W9PA 2XR8B 3GZBA 3S5CA 3X3ZA 4FMDA 3DZLA 3D9RA 1M9GA 2WOHA 2W56B 3CMA3 1FGTA 3OWSA 2CKFB 4EC6A 1LVNA 1RRLA 1VQ43 1YGEA 5EEOA 1UUWB 2OQEC 3LOYA 1JB4A 4HM8B 3HIIA 4O3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q42 A;  3KKG A;  1ISK A;  4FCJ A;  4HM0 B;  4KVH A;  3NV0 B;  3MG1 A;  4HKV B;  1OUN A;  1ULJ B;  3HZP A;  1OHS A;  2HML B;  2XSH B;  5DRV A;  1GS3 A;  4L7K A;  1WQL B;  4LGQ A;  4CDL A;  4ORL A;  3FZW A;  1OHP A;  1SJW A;  3JUN A;  3VSY A;  4HJL B;  1JN5 A;  3EBT A;  5CK6 A;  1IDP A;  2Z7A A;  3OWU A;  2F86 B;  3EQQ B;  2HMM B;  4WP5 A;  2HMN B;  3FSD A;  1OF5 B;  4GB5 A;  2UX0 A;  1OGZ A;  4HM1 B;  5AEU B;  5G2G A;  1C7H A;  3NHX A;  3F9S A;  4U13 A;  3CU3 A;  4HVN A;  5AIF A;  3B8L A;  5CXO A;  3MKI A;  5DRE A;  3EJV A;  4WWU C;  3ROB A;  3ECF A;  5FW5 A;  4R9K A;  1TP6 A;  4RZM A;  3OWY A;  4H3U A;  2GXF A;  3F7S A;  2B24 B;  3K7C A;  3DM8 A;  4HM4 B;  4XBY A;  2GEY A;  4HM5 B;  1OCV A;  5IG4 A;  4PEJ A;  1GYB A;  2I9W A;  3KE7 A;  1DMM A;  1O7N B;  1ZO2 A;  4X2H A;  2BNG A;  1W6Y A;  1JB5 A;  1A2K A;  4WYK A;  4J8T A;  3E99 A;  5AI1 A;  5BXQ A;  3MG3 A;  3IPT A;  5AEW B;  2QGU A;  1W01 A;  5BVB A;  2GEX A;  1JN5 B;  3JUP A;  1DMQ A;  1ZX2 A;  3FF2 A;  1STD A;  3DUK A;  3FF0 A;  1QJG A;  1O7M B;  1S5A A;  5HGR A;  3B4O A;  3NUV A;  4N3V A;  3ER7 A;  3GRD A;  3EX9 A;  1JKG B;  2F98 A;  2B1X B;  5IG0 A;  2CHC A;  4XB5 A;  1U5O A;  2YFJ B;  5CF2 A;  3GZY B;  3CNX A;  2RGQ A;  3B4P A;  5IER A;  8CHO A;  1BUQ A;  1E3V A;  3BLZ A;  3F40 A;  3GZX B;  2XRX B;  1VZZ A;  3G16 A;  3JUQ A;  3G0K A;  2RFR A;  3I0Y A;  5CLK A;  2GBX B;  3UJM A;  2HMO B;  4IIA A;  5CF1 A;  3NV0 A;  2INX A;  3NBR A;  1ULI B;  5TGN A;  3GZR A;  1AR0 A;  1NDO B;  1EA2 A;  5KP4 A;  4Q53 A;  3T8N A;  2Z76 A;  3MG2 A;  1NU3 A;  1E3R A;  5AIG A;  3WMD A;  3UNL A;  5IF6 A;  1HKX A;  5KP3 A;  1W00 A;  4L8O A;  3A76 A;  4LMI A;  6STD A;  3B7C A;  3FH1 A;  2BMO B;  5AII A;  4HM2 B;  3HK4 A;  4K1U A;  5IG5 A;  3G8Z A;  3RGA A;  4R1K A;  2OWP A;  3EN1 B;  3HX8 A;  4I4K A;  3OXA A;  1OF5 A;  5EVH A;  2HMJ B;  3OV4 A;  1O7H B;  3F7X A;  4OUQ A;  2JQ5 A;  1Q40 A;  4XDV A;  5STD A;  3MSO A;  3NXJ A;  2BMR B;  3F14 A;  1GY6 A;  1O7P B;  3RGR A;  2A15 A;  2BMQ B;  2YFL B;  1OPY A;  2K54 A;  3VGN A;  3FGY A;  5D81 A;  1CQS A;  5JPP A;  3LYG A;  4HM3 B;  3M8C A;  4STD A;  3KZT A;  2GBW B;  1GY5 A;  1Z1S A;  5IG3 A;  5IEP A;  3KSP A;  1OH0 A;  1K41 A;  4HM6 B;  1W02 A;  3CPO A;  4HZB B;  5D82 A;  1JB2 A;  2HMK B;  1ASK A;  2YFI B;  3K0Z A;  5KP1 A;  3F8X A;  1OHO A;  7STD A;  3H51 A;  1O7G B;  2XSO B;  4R9L A;  3F8H A;  3SOY A;  5IEN A;  4X2O A;  4OVM A;  1E97 A;  1O7W B;  3DMC A;  3FKA A;  4XDW A;  5JPU A;  1DMN A;  3JUO A;  2RCD A;  2IMJ A;  2R4I A;  3JUM A;  1QMA A;  3SOA A;  4XBT A;  3MYT A;  2Z77 A;  1UUV B;  4MJD A;  3EHC A;  3DXO A;  3OX9 A;  3NM2 A;  4HZ9 B;  4WYK B;  4HM7 B;  1Q40 B;  1JKG A;  1EG9 B;  3MHE A;  3LZA A;  3CNM A;  4XBX A;  4LEH A;  3FLJ A;  1NWW A;  3GWR A;  2QIY A;  3EC9 A;  3EBY A;  3T8U A;  5AIH A;  3EF8 A;  2F99 A;  5D83 A;  3STD A;  3BB9 A;  4L8P A;  2W2C A;  2PZV A;  3H3H A;  3SED A;  4K1V A;  1OGX A;  3EN8 A;  4XM4 A;  1TUH A;  4FCM A;  2STD A;  4J9A A;  1GY7 A;  3Q90 A;  3S5C A;  5IEO A;  2XR8 B;  3GZB A;  3DZL A;  3D9R A;  3OWS A;  2CKF B;  1UUW B;  1JB4 A;  4HM8 B; 
#chains in the Genus database with same CATH topology
 4ILF A;  3CCU 3;  4R80 A;  1Q42 A;  1LOV A;  3AHS A;  2CX1 A;  1RN7 A;  3ALA A;  1BVI A;  3NM7 A;  3KKG A;  4RBN A;  1W2B 2;  1ISK A;  2WGQ A;  4FCJ A;  4HAA A;  4HOH A;  1R4Y A;  1GOY A;  1JJ2 2;  4LYL B;  2W6J H;  4BU4 A;  2CWV A;  2IY2 A;  3FG4 A;  3LT8 A;  3NX0 A;  2O3O A;  4HM0 B;  4KVH A;  1KD1 4;  1QVF 2;  1IQX A;  3NV0 B;  3CCS 3;  3PZW A;  2XGN A;  4N6N B;  1QAF A;  3MG1 A;  4HKV B;  1OUN A;  1RRH A;  1BGS A;  3EE1 A;  1T5Y A;  3IJE B;  3T0U A;  1YIJ 3;  1ULJ B;  3HZP A;  1OHS A;  2D1W A;  3PCS A;  3D3L A;  4NRE A;  5GSP A;  1TJD A;  4OK0 A;  3AGN A;  2D42 A;  3LH4 A;  1BSB A;  1UCI A;  2CK3 H;  2HML B;  3GAX A;  3QK9 A;  1FW7 A;  2XSH B;  5DRV A;  1GS3 A;  1TIJ A;  4KFF A;  4N6U A;  1IVX A;  4RNZ A;  2FGT A;  1TRQ A;  1LNH A;  4L7K A;  1WQL B;  1BRN L;  4LGQ A;  4CDL A;  4ORL A;  1YIT 3;  4R4K A;  3FZW A;  5A0O B;  1RKY A;  1OHP A;  1VQO 3;  8RNT A;  2CG0 A;  1K8A 4;  1SJW A;  3JUN A;  3VSY A;  1EQK A;  2GU1 A;  2RBI A;  1JN5 A;  2W0Q A;  3EBT A;  1IDP A;  4HJL B;  5CK6 A;  2C11 A;  2QEX 3;  2JDI H;  1V57 A;  3HIG A;  3D5G A;  3SX1 A;  3BU4 A;  2KF4 A;  2OOV A;  2Z7A A;  1GSP A;  3OWU A;  1G02 A;  3CCM 3;  1AV4 A;  2F86 B;  2HOH A;  1UGH I;  3EQQ B;  5JBS A;  2HMM B;  4WP5 A;  1RMS A;  2HMN B;  2R41 A;  3FSD A;  3QRD A;  1OF5 B;  3U97 A;  4GB5 A;  3FCS B;  2UX0 A;  2OQE A;  1NNV A;  1N5P A;  5HOH A;  2CFK A;  1OGZ A;  4HM1 B;  5AEU B;  5G2G A;  4N6T A;  3URP A;  1C7H A;  3NHX A;  3I56 3;  4LSO A;  3F9S A;  4U13 A;  3PCR A;  4BTX A;  3CU3 A;  4HVN A;  4IPB A;  1HYF A;  1MWR A;  5AIF A;  3CCR 3;  2W9Q A;  3OW2 2;  3FG1 A;  1DVD A;  3B8L A;  5CXO A;  1A2V A;  1BSE A;  1RGK A;  4K90 B;  1X1Y A;  4O02 B;  4CJN A;  3FG3 A;  1GMQ A;  3MKI A;  5DRE A;  1BSD A;  3EJV A;  4WWU C;  1VQP 3;  3ROB A;  4AKZ A;  1LOX A;  3ECF A;  5FW5 A;  2YX9 A;  1K28 A;  1FGR A;  1TP6 A;  3AHW A;  3LT9 A;  4R9K A;  7RNT A;  3CCE 3;  1BUJ A;  2BHM A;  4RZM A;  2XGL A;  1I2E A;  3UB1 A;  2UGI A;  1NB5 I;  1SQW A;  1KWI A;  3OWY A;  1BSA A;  3NQY A;  4H3U A;  1BU4 A;  2GXF A;  3NQZ A;  1B2U A;  1UCL A;  1VQ9 3;  1BAO A;  1YVS A;  1GOV A;  2FXT A;  1A67 A;  3F7S A;  3KN4 A;  4MMZ B;  2KF5 A;  2CIU A;  4EW5 A;  2B24 B;  4K61 A;  3K7C A;  4EV5 A;  5RNT A;  3DM8 A;  3RDE A;  4HM4 B;  5AYS C;  3S5C A;  1NO3 A;  1K9M 4;  4XBY A;  3X3X A;  1STF I;  2WGO A;  1MWS A;  1BRG A;  2GEY A;  2KF3 A;  2XFT A;  4HM5 B;  1IQ8 A;  2OCT A;  1OCV A;  4FR9 A;  5IG4 A;  1CYV A;  4PEJ A;  4RNY A;  1GYB A;  1YHQ 3;  2I9W A;  3KE7 A;  4AEQ A;  1BNG A;  2OTJ 3;  1DE3 A;  1DMM A;  1O7N B;  1IK3 A;  4GSP A;  1ZO2 A;  2O9U X;  4X2H A;  2BNG A;  5G1K A;  1W6Y A;  1JB5 A;  1TU5 A;  2M7O A;  5AYR B;  1A2K A;  1NJI 4;  4WYK A;  3LTB A;  4J8T A;  1N5H A;  3DGL A;  4NHF A;  1ZS7 A;  5LC7 A;  3E99 A;  2L1S A;  3L0R A;  1YJW 3;  5G1L A;  1Q7Y 4;  1IV9 A;  5AI1 A;  1MGW A;  3CC7 3;  5BXQ A;  1BRH A;  2F4Y A;  3LTC A;  3IPT A;  3MG3 A;  5AEW B;  1RHL A;  2E2V A;  2QGU A;  4RNT A;  1WMO A;  3DGO A;  3UL6 A;  4KT3 B;  1JRQ A;  1W01 A;  2P0X A;  3KSE D;  2MC8 A;  1I2F A;  1RJO A;  4DKI A;  1QAL A;  1BAN A;  2IUJ A;  5BVB A;  1VQ6 3;  2GEX A;  3NBJ A;  2CFW A;  1GMR A;  2LQV A;  1JN5 B;  3JUP A;  3LML A;  1N9E A;  3CC4 3;  1DMQ A;  1GD4 A;  4BIR A;  1ZX2 A;  4BL2 A;  3J7Y d;  2ZL8 A;  1JZO A;  3FF2 A;  1RSN A;  1STD A;  4KFD A;  3DUK A;  2CH9 A;  3FF0 A;  1QJG A;  3K5T A;  2KRT A;  1SAR A;  1UW1 A;  1JBR A;  1FGM A;  1O7M B;  4O8S A;  1S5A A;  4GHO A;  3WOD G;  5HGR A;  3KCH A;  1YGW A;  3B4O A;  3PXM A;  4EYC A;  2P05 A;  3NUV A;  4N3V A;  2J8X B;  5BU4 A;  1I3I A;  2L4V A;  2CX0 A;  3ER7 A;  3GRD A;  3HI7 A;  3S28 A;  4TX4 A;  3EX9 A;  1JKG B;  5ELU A;  2F98 A;  2B1X B;  2SBL A;  2QA4 3;  5IG0 A;  3VF1 A;  2CHC A;  1I8V A;  4XB5 A;  4CPK A;  2GU3 A;  4J5G A;  3MPH A;  2OTL 3;  4I5Q A;  2LYX A;  2W56 A;  1U5O A;  1RLS A;  2YFJ B;  5CF2 A;  1I2G A;  2Q07 A;  3AMO B;  3GZY B;  3CNX A;  2RGQ A;  3D5I A;  3B4P A;  5IER A;  1BOX A;  8CHO A;  1I70 A;  4AKY A;  4MEI A;  1BUQ A;  2SAR A;  1B27 A;  4WHA A;  1KC8 4;  1IV7 A;  1U8C B;  4GL6 A;  1E3V A;  3TDG A;  3EB8 A;  3BLZ A;  2CW9 A;  3F40 A;  3ZG0 A;  1IQY A;  1RGC A;  3GZX B;  4EXR A;  3K9M C;  1PU4 A;  2XRX B;  1N8Q A;  1VZZ A;  3G16 A;  3JUQ A;  3G0K A;  3NBB A;  1B21 A;  3CD6 3;  1RGL A;  3I55 3;  2RFR A;  3I0Y A;  5CLK A;  2H0G A;  2IA7 A;  1WTH A;  2GBX B;  3UJM A;  1BRJ A;  1M1K 4;  2HMO B;  2FNQ A;  1US1 A;  4IIA A;  1SPU A;  5CF1 A;  3NV0 A;  3DGM A;  1FUS A;  4N6L A;  1D6Y A;  1VQ5 3;  1VQ7 3;  3N54 B;  2KCD A;  3DGY A;  2INX A;  3NBR A;  1ULI B;  2KAA A;  1UCK A;  5TGN A;  3GZR A;  1AR0 A;  2CFG A;  3CC2 3;  1D6U A;  1NDO B;  4NPB A;  1BNF A;  4N6O B;  1RGE A;  1IT8 A;  4WFO A;  1EA2 A;  5KP4 A;  1W6C A;  4Q53 A;  3DH2 A;  3T8N A;  1VQQ A;  1T2I A;  2Z76 A;  3MG2 A;  1HU9 A;  1UUG B;  2CFD A;  3CCV 3;  1NU3 A;  1JBS A;  3LTA A;  3BNC A;  3PS8 A;  1W2Z A;  1Q81 4;  1VQK 3;  1E3R A;  2CG1 A;  5AIG A;  1B3S A;  1Q86 4;  3S67 A;  3WMD A;  3WA3 A;  1IYY A;  3UNL A;  5IF6 A;  1G96 A;  1HKX A;  1DVC A;  3N8B A;  5KP3 A;  1W00 A;  4L8O A;  3A76 A;  4LMI A;  6STD A;  1LQM B;  3B7C A;  3FH1 A;  3BND A;  3Q2P A;  1TFK A;  2BMO B;  1K73 4;  1L5G B;  1LOY A;  2XH9 A;  3U1W A;  4FMC A;  3PGB A;  5AII A;  4HM2 B;  3HK4 A;  4K1U A;  1C54 A;  3WDG B;  3GSP A;  3HOH A;  2H0H A;  1VQ8 3;  5IG5 A;  1BRS A;  2KF6 A;  1RGG A;  3CCQ 3;  4FMA A;  3G8Z A;  3RGA A;  3KII A;  1JNQ A;  4R1K A;  1RGH A;  4EV2 A;  1PFP A;  2OWP A;  3EN1 B;  3HX8 A;  2WOF A;  4I4K A;  1B2X A;  2XEP A;  1MOL A;  1VQN 3;  3OXA A;  2KXG A;  4ZM8 A;  1OF5 A;  2XF3 A;  5EVH A;  1TFO A;  3G6E 3;  2E2U A;  1GOU A;  2HMJ B;  3AGO A;  3OV4 A;  1Y4K A;  1BNR A;  3D4A A;  3V98 A;  1BIR A;  1O7H B;  3F7X A;  1AVK A;  4OUQ A;  1YVB I;  1Q40 A;  2E2T A;  1WMN A;  2JQ5 A;  2K0M A;  4XDV A;  5STD A;  4BL3 A;  3MSO A;  1B2Z A;  3NXJ A;  3CME 3;  4N6M A;  1MNL A;  1X1W A;  2BMR B;  3F14 A;  1GY6 A;  2F5M A;  1KSI A;  4JF8 A;  3X42 A;  3BNB A;  1O7P B;  1OAC A;  3BNE A;  3CPW 2;  3RGR A;  3WR2 A;  2IYJ A;  2IUK A;  4FCZ A;  2A15 A;  1SIH A;  2V1L A;  2BMQ B;  1RNT A;  1W4N A;  2YFL B;  1OPY A;  5ELJ A;  4LZI A;  1BSC A;  2Y73 A;  2C4B A;  1S72 3;  2K54 A;  3VGN A;  1WNH A;  3FGY A;  5D81 A;  2BT3 A;  1CQS A;  5JPP A;  3LYG A;  4HM3 B;  3M8C A;  1V74 A;  2BO9 B;  4O2H A;  4STD A;  3KZT A;  2GBW B;  1GY5 A;  1Z1S A;  1ROA A;  3SXX A;  5IG3 A;  5IEP A;  3X3Y A;  3KSP A;  3G4S 3;  2H0I A;  1BNJ A;  1OH0 A;  2RNT A;  2P38 A;  3K63 A;  1JV2 B;  3CCJ 3;  1BRI A;  1RGF A;  1I0X A;  1NB3 I;  1K41 A;  4HM6 B;  1W02 A;  3CPO A;  4HZB B;  5D82 A;  1YJN 3;  1FUW A;  4BTY A;  2ML5 A;  3PYJ A;  1JB2 A;  1KQS 2;  2CWU A;  2AAE A;  2HMK B;  1A2P A;  1ASK A;  1RDS A;  1FA3 A;  1RCL A;  2YFI B;  3X40 A;  1YJ9 3;  1MWU A;  1B2M A;  3K0Z A;  3SLU A;  2UUG C;  3ZG5 A;  5M1A A;  5KP1 A;  2RSX A;  3F8X A;  3ZFZ A;  1OHO A;  3WHO A;  7STD A;  5EQL A;  3H51 A;  2CWT A;  2CFL A;  2ZDJ A;  1O7G B;  2XSO B;  1I3F A;  2K3D A;  4R9L A;  3F8H A;  3SOY A;  5IEN A;  3RNT A;  4X2O A;  3WOE B;  1N8R 4;  1IVV A;  4OVM A;  3DGN A;  1RN4 A;  1BNI A;  1LNI A;  1WMP A;  1F8N A;  1UI8 A;  2ML6 A;  1RN1 A;  1IVW A;  1CH0 A;  1FGQ A;  5LC6 A;  1E97 A;  1PYL A;  1M90 4;  1VQL 3;  4QWT A;  1O7W B;  1A90 A;  1YNV X;  2BIR A;  3DY5 A;  3SVA A;  3DMC A;  1R4C A;  1LRA A;  3FKA A;  4XDW A;  1W6G A;  3V92 A;  1Q82 4;  1QVG 2;  1GD3 A;  3MWZ A;  5JPU A;  7GSP A;  1FYS A;  2CC3 A;  1DMN A;  3JUO A;  6RNT A;  3LTD A;  4N6V 0;  1UI7 A;  2RCD A;  3A5E A;  2C10 A;  4CCV A;  1Q7H A;  2P09 A;  2IMJ A;  1CYU A;  2R4I A;  1G0T A;  3D79 A;  3JUM A;  4H61 A;  1QMA A;  1I0V A;  1IVU A;  4HBR A;  1V58 A;  5M18 A;  3SOA A;  4BTW A;  1D6Z A;  1TTO A;  1UDI I;  4JRF A;  3X41 A;  5M19 A;  1MWT A;  4XBT A;  3BIR A;  3MYT A;  2Z77 A;  1EEJ A;  1JBT A;  1T2H A;  1IU7 A;  1UUV B;  4MJD A;  3EHC A;  3DXO A;  1HZ1 A;  1GMP A;  3CCL 3;  3OX9 A;  3NM2 A;  1DYU A;  1IT7 A;  1EKM A;  1FZU A;  1RTU A;  1UGI A;  4KFE A;  9RNT A;  4HZ9 B;  4WYK B;  1AVL A;  3Q1C A;  3LXU X;  1Q40 B;  2ZHX B;  4HM7 B;  3G71 3;  1FGO A;  1JKG A;  1YI2 3;  1T3B A;  1ROV A;  1EG9 B;  4FMB A;  1BNE A;  3MHE A;  2PNC A;  5BIR A;  2MF7 A;  1EUI C;  4G1M B;  1N9J A;  3LZA A;  3AMO A;  3S27 A;  4EBG A;  3CNM A;  1PY3 A;  4XBX A;  4LEH A;  3FLJ A;  1FUT A;  1NWW A;  1B20 A;  2WO0 A;  3GWR A;  2QIY A;  6GSP A;  3EC9 A;  3EBY A;  1VQM 3;  3T8U A;  5AIH A;  3JVC A;  1SII A;  1CEW I;  1BNS A;  2P0M A;  3EF8 A;  3WA2 X;  3WOF B;  5IW9 A;  4HYZ A;  4MMY B;  2W03 A;  4IT7 A;  3UL5 A;  1M1X B;  2F99 A;  1B2S A;  2W04 A;  4MMX B;  1X1U A;  1JZD A;  1W5Z A;  3BB9 A;  5D83 A;  5FGO A;  2ZA4 A;  3STD A;  1RCK A;  4L8P A;  4KZ1 A;  3S29 A;  2W2C A;  1W7C A;  2AAD A;  1LOW A;  3CXC 2;  2PZV A;  3H3H A;  5I97 A;  3SED A;  2Z6B A;  4K1V A;  1OGX A;  3EN8 A;  3Q3F A;  1AQZ A;  1J2B A;  1TRP A;  2Y74 A;  4XM4 A;  3IMA B;  1TUH A;  4FCM A;  1UCJ A;  3V99 A;  1Q9E A;  3N9H A;  2STD A;  4J9A A;  1MGR A;  3O8Y A;  1GY7 A;  3KFQ C;  3Q90 A;  2XFS A;  5IEO A;  2GSP A;  1LXE A;  1QAK A;  2BU4 A;  2F5W A;  2OOV C;  2W9P A;  2XR8 B;  3GZB A;  4FMD A;  3SYU A;  1BRK A;  3X3Z A;  3DZL A;  1RNB A;  3D9R A;  1M9G A;  2WOH A;  1RGA A;  2W56 B;  3CMA 3;  1FGT A;  3OWS A;  1X1X A;  2CKF B;  4EC6 A;  1LQG C;  1LVN A;  1RRL A;  4J5K A;  1VQ4 3;  1YGE A;  1ZGX A;  1DET A;  5EEO A;  1AY7 A;  1UUW B;  2OQE C;  2F56 A;  3LOY A;  1JB4 A;  4HM8 B;  3HII A;  4O3V A; 
#chains in the Genus database with same CATH homology
 3CCU 3;  4R80 A;  1Q42 A;  1RN7 A;  3ALA A;  3NM7 A;  3KKG A;  4RBN A;  1W2B 2;  1ISK A;  2WGQ A;  4FCJ A;  1JJ2 2;  2W6J H;  2CWV A;  3FG4 A;  3LT8 A;  4HM0 B;  3NX0 A;  2O3O A;  4KVH A;  1KD1 4;  1QVF 2;  1IQX A;  3NV0 B;  3CCS 3;  3PZW A;  2XGN A;  4N6N B;  1QAF A;  3MG1 A;  4HKV B;  1OUN A;  1RRH A;  3EE1 A;  1T5Y A;  3IJE B;  3T0U A;  1YIJ 3;  1ULJ B;  3HZP A;  1OHS A;  2D1W A;  3PCS A;  3D3L A;  4NRE A;  4OK0 A;  2D42 A;  3LH4 A;  2CK3 H;  3GAX A;  2HML B;  3QK9 A;  2XSH B;  5DRV A;  1GS3 A;  1TIJ A;  4KFF A;  4N6U A;  1IVX A;  4RNZ A;  2FGT A;  1LNH A;  4L7K A;  1WQL B;  4LGQ A;  4CDL A;  4ORL A;  1YIT 3;  4R4K A;  3FZW A;  5A0O B;  1RKY A;  1OHP A;  1VQO 3;  1K8A 4;  2CG0 A;  1SJW A;  3JUN A;  3VSY A;  1EQK A;  2GU1 A;  4HJL B;  1JN5 A;  2W0Q A;  3EBT A;  1IDP A;  5CK6 A;  2QEX 3;  2C11 A;  2JDI H;  3HIG A;  3SX1 A;  2OOV A;  2Z7A A;  3OWU A;  3CCM 3;  1AV4 A;  2F86 B;  3EQQ B;  5JBS A;  2HMM B;  4WP5 A;  2HMN B;  3FSD A;  3QRD A;  1OF5 B;  3U97 A;  4GB5 A;  3FCS B;  2UX0 A;  2OQE A;  1N5P A;  2CFK A;  1OGZ A;  4HM1 B;  5AEU B;  5G2G A;  4N6T A;  1C7H A;  3NHX A;  3I56 3;  4LSO A;  3F9S A;  4U13 A;  3PCR A;  4BTX A;  3CU3 A;  4HVN A;  4IPB A;  5AIF A;  3CCR 3;  3OW2 2;  2W9Q A;  3FG1 A;  1DVD A;  3B8L A;  5CXO A;  1A2V A;  4K90 B;  4O02 B;  3FG3 A;  3MKI A;  5DRE A;  3EJV A;  4WWU C;  1VQP 3;  3ROB A;  4AKZ A;  1LOX A;  3ECF A;  5FW5 A;  2YX9 A;  1K28 A;  1FGR A;  1TP6 A;  3LT9 A;  4R9K A;  3CCE 3;  2BHM A;  4RZM A;  2XGL A;  3UB1 A;  1NB5 I;  1SQW A;  1KWI A;  3OWY A;  3NQY A;  4H3U A;  2GXF A;  3NQZ A;  1VQ9 3;  2FXT A;  1A67 A;  3F7S A;  3KN4 A;  4MMZ B;  4EV5 A;  2CIU A;  2B24 B;  4K61 A;  3K7C A;  3DM8 A;  3RDE A;  4HM4 B;  5AYS C;  1NO3 A;  1K9M 4;  4XBY A;  3X3X A;  1STF I;  2WGO A;  2GEY A;  4HM5 B;  2XFT A;  1IQ8 A;  2OCT A;  1OCV A;  4FR9 A;  5IG4 A;  1CYV A;  4PEJ A;  4RNY A;  1GYB A;  1YHQ 3;  2I9W A;  3KE7 A;  4AEQ A;  2OTJ 3;  1DMM A;  1O7N B;  1IK3 A;  1ZO2 A;  2O9U X;  4X2H A;  2BNG A;  1W6Y A;  1JB5 A;  1TU5 A;  2M7O A;  5AYR B;  1A2K A;  1NJI 4;  4WYK A;  3LTB A;  4J8T A;  1N5H A;  3DGL A;  4NHF A;  5LC7 A;  3E99 A;  3L0R A;  1YJW 3;  1Q7Y 4;  1IV9 A;  5AI1 A;  3CC7 3;  5BXQ A;  3MG3 A;  3LTC A;  3IPT A;  5AEW B;  2E2V A;  2QGU A;  1WMO A;  3DGO A;  3UL6 A;  2MC8 A;  1JRQ A;  1W01 A;  2P0X A;  3KSE D;  1RJO A;  1QAL A;  2IUJ A;  1VQ6 3;  5BVB A;  2GEX A;  3NBJ A;  2CFW A;  2LQV A;  1JN5 B;  3JUP A;  3LML A;  1N9E A;  3CC4 3;  1DMQ A;  1GD4 A;  1ZX2 A;  3J7Y d;  2ZL8 A;  3FF2 A;  1STD A;  4KFD A;  3DUK A;  2CH9 A;  3FF0 A;  1QJG A;  3K5T A;  2KRT A;  1UW1 A;  1FGM A;  1O7M B;  4O8S A;  1S5A A;  3WOD G;  5HGR A;  3B4O A;  3PXM A;  4EYC A;  2P05 A;  3NUV A;  4N3V A;  3ER7 A;  2L4V A;  3GRD A;  3HI7 A;  3S28 A;  4TX4 A;  3EX9 A;  1JKG B;  5ELU A;  2F98 A;  2B1X B;  2SBL A;  2QA4 3;  5IG0 A;  3VF1 A;  2CHC A;  4XB5 A;  2GU3 A;  2OTL 3;  3MPH A;  2LYX A;  2W56 A;  1U5O A;  2YFJ B;  5CF2 A;  2Q07 A;  3AMO B;  3GZY B;  3CNX A;  2RGQ A;  3B4P A;  5IER A;  8CHO A;  4AKY A;  1BUQ A;  4MEI A;  4WHA A;  1KC8 4;  1IV7 A;  1U8C B;  4GL6 A;  1E3V A;  3TDG A;  3EB8 A;  3BLZ A;  2CW9 A;  3F40 A;  1IQY A;  3GZX B;  4EXR A;  3K9M C;  1PU4 A;  2XRX B;  1N8Q A;  1VZZ A;  3G16 A;  3JUQ A;  3G0K A;  3NBB A;  3CD6 3;  3I55 3;  2RFR A;  3I0Y A;  5CLK A;  2IA7 A;  1WTH A;  2GBX B;  3UJM A;  1M1K 4;  2HMO B;  2FNQ A;  1US1 A;  4IIA A;  1SPU A;  5CF1 A;  3NV0 A;  3DGM A;  4N6L A;  1D6Y A;  1VQ5 3;  1VQ7 3;  3N54 B;  2KCD A;  2INX A;  3NBR A;  1ULI B;  5TGN A;  3GZR A;  2CFG A;  1AR0 A;  3CC2 3;  1D6U A;  1NDO B;  4N6O B;  1IT8 A;  4WFO A;  1EA2 A;  5KP4 A;  1W6C A;  4Q53 A;  3T8N A;  2Z76 A;  3MG2 A;  1HU9 A;  2CFD A;  3CCV 3;  1NU3 A;  3LTA A;  3BNC A;  3PS8 A;  1W2Z A;  1Q81 4;  1VQK 3;  1E3R A;  2CG1 A;  5AIG A;  1Q86 4;  3S67 A;  3WMD A;  3WA3 A;  3UNL A;  5IF6 A;  1G96 A;  1HKX A;  1DVC A;  3N8B A;  5KP3 A;  1W00 A;  4L8O A;  3A76 A;  4LMI A;  6STD A;  3B7C A;  3FH1 A;  3BND A;  3Q2P A;  1TFK A;  2BMO B;  1K73 4;  1L5G B;  2XH9 A;  3U1W A;  4FMC A;  3PGB A;  5AII A;  4HM2 B;  3HK4 A;  4K1U A;  3WDG B;  1VQ8 3;  5IG5 A;  3CCQ 3;  4FMA A;  3G8Z A;  3RGA A;  3KII A;  1JNQ A;  4R1K A;  4EV2 A;  1PFP A;  2OWP A;  3EN1 B;  3HX8 A;  2WOF A;  4I4K A;  2XEP A;  1MOL A;  1VQN 3;  3OXA A;  2KXG A;  4ZM8 A;  1OF5 A;  2XF3 A;  5EVH A;  1TFO A;  3G6E 3;  2E2U A;  2HMJ B;  3OV4 A;  1Y4K A;  3V98 A;  1O7H B;  3F7X A;  1AVK A;  4OUQ A;  1YVB I;  1Q40 A;  2E2T A;  1WMN A;  2JQ5 A;  2K0M A;  4XDV A;  5STD A;  3MSO A;  3NXJ A;  3CME 3;  4N6M A;  1MNL A;  2BMR B;  3F14 A;  1GY6 A;  3X42 A;  1KSI A;  4JF8 A;  3BNB A;  1O7P B;  1OAC A;  3BNE A;  3CPW 2;  3RGR A;  4FCZ A;  2IUK A;  2A15 A;  1SIH A;  2V1L A;  2BMQ B;  1W4N A;  2YFL B;  1OPY A;  5ELJ A;  4LZI A;  2Y73 A;  1S72 3;  2K54 A;  3VGN A;  1WNH A;  3FGY A;  5D81 A;  2BT3 A;  1CQS A;  5JPP A;  3LYG A;  4HM3 B;  3M8C A;  1V74 A;  2BO9 B;  4O2H A;  4STD A;  3KZT A;  2GBW B;  1GY5 A;  1Z1S A;  1ROA A;  3SXX A;  5IG3 A;  5IEP A;  3X3Y A;  3KSP A;  3G4S 3;  1OH0 A;  2P38 A;  3K63 A;  1JV2 B;  3CCJ 3;  1NB3 I;  1K41 A;  4HM6 B;  1W02 A;  3CPO A;  4HZB B;  5D82 A;  1YJN 3;  1FUW A;  4BTY A;  2ML5 A;  3PYJ A;  1JB2 A;  1KQS 2;  2CWU A;  2HMK B;  1ASK A;  1FA3 A;  2YFI B;  3X40 A;  1YJ9 3;  3K0Z A;  3SLU A;  5KP1 A;  2RSX A;  3F8X A;  1OHO A;  7STD A;  5EQL A;  3H51 A;  2CWT A;  2CFL A;  2ZDJ A;  1O7G B;  2XSO B;  4R9L A;  3F8H A;  3SOY A;  5IEN A;  4X2O A;  3WOE B;  1N8R 4;  1IVV A;  4OVM A;  3DGN A;  1WMP A;  1F8N A;  1UI8 A;  2ML6 A;  1M90 4;  1IVW A;  1FGQ A;  5LC6 A;  1E97 A;  1VQL 3;  4QWT A;  1O7W B;  1A90 A;  3SVA A;  3DY5 A;  3DMC A;  1R4C A;  3FKA A;  4XDW A;  1W6G A;  3V92 A;  1Q82 4;  1QVG 2;  1GD3 A;  3MWZ A;  5JPU A;  2CC3 A;  1DMN A;  3JUO A;  3LTD A;  4N6V 0;  1UI7 A;  2RCD A;  2C10 A;  4CCV A;  2P09 A;  2IMJ A;  1CYU A;  2R4I A;  3JUM A;  4H61 A;  1QMA A;  1IVU A;  4HBR A;  3SOA A;  4BTW A;  1D6Z A;  4JRF A;  3X41 A;  4XBT A;  3MYT A;  2Z77 A;  1IU7 A;  1UUV B;  4MJD A;  3EHC A;  3DXO A;  3CCL 3;  3OX9 A;  3NM2 A;  1DYU A;  1IT7 A;  1EKM A;  4KFE A;  4HZ9 B;  4WYK B;  1AVL A;  3Q1C A;  3LXU X;  1Q40 B;  4HM7 B;  3G71 3;  1FGO A;  1JKG A;  1YI2 3;  1ROV A;  1EG9 B;  4FMB A;  3MHE A;  2PNC A;  2MF7 A;  4G1M B;  1N9J A;  3LZA A;  3AMO A;  3S27 A;  4EBG A;  3CNM A;  4XBX A;  4LEH A;  3FLJ A;  1NWW A;  3GWR A;  2WO0 A;  2QIY A;  3EC9 A;  3EBY A;  1VQM 3;  3T8U A;  5AIH A;  3JVC A;  1SII A;  1CEW I;  2P0M A;  3EF8 A;  3WA2 X;  3WOF B;  5IW9 A;  4HYZ A;  4MMY B;  2W03 A;  4IT7 A;  3UL5 A;  1M1X B;  2F99 A;  2W04 A;  4MMX B;  5D83 A;  1W5Z A;  3STD A;  3BB9 A;  5FGO A;  4L8P A;  4KZ1 A;  3S29 A;  2W2C A;  1W7C A;  3CXC 2;  2PZV A;  3H3H A;  5I97 A;  3SED A;  2Z6B A;  4K1V A;  1OGX A;  3EN8 A;  1J2B A;  2Y74 A;  4XM4 A;  3IMA B;  1TUH A;  4FCM A;  3V99 A;  3N9H A;  2STD A;  4J9A A;  3O8Y A;  1GY7 A;  3KFQ C;  3Q90 A;  2XFS A;  5IEO A;  2OOV C;  1LXE A;  1QAK A;  2W9P A;  2XR8 B;  3GZB A;  3S5C A;  3X3Z A;  4FMD A;  3DZL A;  3D9R A;  1M9G A;  2WOH A;  2W56 B;  3CMA 3;  1FGT A;  3OWS A;  2CKF B;  4EC6 A;  1LVN A;  1RRL A;  1VQ4 3;  1YGE A;  5EEO A;  1UUW B;  2OQE C;  3LOY A;  1JB4 A;  4HM8 B;  3HII A;  4O3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...