2GBXB

Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
170
structure length
170
Chain Sequence
b'QIPVTPDVHYDIEAHYRAEVRMFQTGQYREWLQGMVAEDIHYWMPIYEQRLTRDRRPDPTPDDAAIYNDDFGELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAGNGELDVLSNILVYRNRRQTEVTVHTLGREDKLRRDGNGFKVFRRKLILDARVTQDKNLYFFC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biphenyl 2,3-Dioxygenase Alpha Subunit
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
total genus 42
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gbxB00
2HMLB 4R1KA 4CDLA 1O7MB 2UX0A 3DXOA 4HKVB 4WWUC 3GZXB 4XBXA 2Z7AA 5IG5A 3F9SA 1OF5A 1OHSA 1W00A 1A2KA 2GBXB 5G2GA 4HM5B 5DRVA 3T8UA 2RCDA 4HVNA 3B4PA 3MKIA 1O7HB 1ZO2A 3CU3A 4HZBB 1OCVA 4XDVA 1NU3A 3EF8A 2XR8B 1OHOA 2HMNB 5BVBA 3KZTA 3MHEA 1JN5A 1O7WB 1OGXA 3DM8A 3FGYA 3EQQB 1GYBA 3NBRA 4I4KA 4HM1B 4K1UA 3A76A 5JPPA 1GS3A 3NHXA 5D83A 1W6YA 2R4IA 5IF6A 5IG4A 4RZMA 3FF2A 3BB9A 3EN8A 3Q90A 2A15A 5KP1A 5TGNA 4STDA 3FF0A 1STDA 3JUQA 3HX8A 3GZYB 4KVHA 4X2HA 3NUVA 2XSOB 1WQLB 2STDA 8CHOA 4H3UA 5IEOA 3F40A 1O7PB 3E99A 1JKGB 4MJDA 1O7GB 3IPTA 4XBTA 1Q40A 1TP6A 3WMDA 2W2CA 1ULIB 3CNXA 3EHCA 3OWYA 1K41A 1AR0A 3EBYA 3NV0B 2F99A 4N3VA 3EJVA 4HM0B 4XBYA 1CQSA 2F86B 4PEJA 3CNMA 5IEPA 1OPYA 3G0KA 3MG2A 1VZZA 5D81A 4HJLB 3SEDA 3UJMA 3MSOA 1UUWB 2BNGA 2YFLB 4R9LA 1JB2A 3OWSA 1W01A 3K7CA 3EX9A 3F8XA 1U5OA 1JB5A 1QJGA 5D82A 3VSYA 4ORLA 3JUNA 3RGRA 2RGQA 2YFIB 5EVHA 3JUMA 3CPOA 1E3RA 1DMQA 1C7HA 1E97A 3BLZA 5HGRA 2HMKB 4HM8B 3ECFA 4OUQA 4J8TA 3FH1A 4WYKB 1BUQA 2K54A 5IG0A 1ASKA 4LGQA 3KE7A 4X2OA 4XM4A 4GB5A 4XDWA 2GXFA 5CK6A 6STDA 2GBWB 1OUNA 3F14A 1OF5B 3B4OA 3M8CA 3F8HA 1DMNA 3GZBA 1TUHA 3SOYA 3FLJA 4IIAA 3LYGA 3F7SA 1OGZA 4FCMA 3GRDA 2XSHB 3FZWA 3D9RA 4R9KA 3S5CA 5AI1A 1JN5B 2OWPA 3EBTA 2HMMB 2BMRB 3SOAA 1GY6A 5JPUA 1EG9B 1OHPA 3FSDA 3OV4A 1ULJB 1DMMA 5BXQA 5AEUB 5IG3A 4LEHA 1ZX2A 3MYTA 3KSPA 3OX9A 4L8PA 2QGUA 4J9AA 3FKAA 1GY7A 5CLKA 4HM2B 1E3VA 2GEYA 3G16A 2JQ5A 4LMIA 2RFRA 3ER7A 3H51A 3RGAA 5AIHA 2I9WA 3I0YA 4Q53A 2BMQB 3T8NA 4HM7B 1HKXA 3HK4A 1Q40B 4HM3B 5IENA 3JUOA 3MG1A 3GWRA 4FCJA 1EA2A 1IDPA 2GEXA 2F98A 3NXJA 4HZ9B 1JKGA 2BMOB 3LZAA 1ISKA 3HZPA 2XRXB 3GZRA 3EN1B 2HMOB 5CF2A 2CHCA 3UNLA 5CF1A 4OVMA 3NV0A 3B8LA 5FW5A 3MG3A 1OH0A 7STDA 3NM2A 2CKFB 1Z1SA 1GY5A 5AIFA 1W02A 3EC9A 5KP4A 4L8OA 5AIIA 1S5AA 3H3HA 1SJWA 3OWUA 3ROBA 1NDOB 2PZVA 2INXA 5AIGA 5IERA 3OXAA 1Q42A 5KP3A 2QIYA 3STDA 4U13A 3B7CA 3DZLA 3F7XA 1QMAA 2YFJB 4HM4B 2B24B 3JUPA 1UUVB 5CXOA 1JB4A 5AEWB 1O7NB 3DUKA 5DREA 4K1VA 3DMCA 2B1XB 1NWWA 3KKGA 4XB5A 2Z76A 2Z77A 2HMJB 5STDA 2IMJA 4HM6B 3G8ZA 4L7KA 3K0ZA 3VGNA 4WP5A 4WYKA
chains in the Genus database with same CATH superfamily
2HMLB 3HI7A 5M19A 4R1KA 2CFWA 4CDLA 1O7MB 1NO3A 2F56A 2FXTA 2UX0A 1YJN3 3DXOA 1MWRA 4HKVB 1IT8A 2WOFA 1RNTA 5BU4A 6RNTA 4WWUC 1BVIA 3GZXB 3LTDA 3WOEB 4XBXA 3S29A 1FZUA 1VQK3 2CH9A 1RLSA 3PYJA 4CJNA 2CX1A 2Z7AA 4N6TA 3T0UA 3CCR3 4RNTA 3S27A 5IG5A 1GOUA 1G96A 2XF3A 1BSAA 1OF5A 3F9SA 1X1UA 1V57A 4HYZA 3S28A 1OHSA 1W00A 1A2KA 2Y73A 1I0XA 3SVAA 2CG0A 2GBXB 4TX4A 1BSCA 2CC3A 3NBBA 5G2GA 1PFPA 4HM5B 5DRVA 3T8UA 1UI8A 1VQQA 4FCZA 2RCDA 2P0MA 1RGEA 4HVNA 1BOXA 1I2GA 1NNVA 3WHOA 3G4S3 3B4PA 1VQ43 1NB3I 3MKIA 1BNEA 1LOVA 1O7HB 1ZO2A 2ML6A 3CU3A 2CX0A 2XGNA 1OCVA 4FMAA 4H61A 4HZBB 2CK3H 1LOWA 3X40A 4XDVA 1RGFA 3GAXA 4IT7A 1MGWA 5JBSA 1GMRA 1YGEA 3EE1A 1NJI4 1NU3A 3EF8A 2XGLA 3NQZA 1JBSA 2XR8B 3WOFB 1OHOA 2HMNB 3K5TA 5BVBA 3KZTA 3MHEA 1JN5A 1TIJA 1O7WB 3KFQC 3WA2X 3X42A 1OGXA 3LTAA 1FA3A 3DM8A 4MMZB 2ZDJA 4RNYA 3FGYA 5I97A 2IY2A 1RRHA 1GYBA 3EQQB 2QA43 1FGOA 1Q7Y4 3NBRA 4RBNA 4I4KA 4HM1B 2RBIA 4K1UA 1AY7A 1Y4KA 3A76A 2C11A 3DY5A 3CCU3 1LNHA 5FGOA 3EB8A 1BNIA 3U1WA 1R4YA 1BRKA 1A2VA 5JPPA 1YIT3 1K8A4 3DGOA 3CC73 1R4CA 1YJ93 1GS3A 3NHXA 5D83A 2P05A 1W6YA 2R4IA 5IF6A 1S723 1CEWI 1KC84 3FG3A 1LNIA 1TFOA 2F4YA 4ZM8A 6GSPA 1FGQA 1I8VA 5IG4A 4RZMA 1IK3A 3AHWA 3FF2A 2C4BA 1BRNL 3BB9A 3EN8A 3Q90A 1DVDA 1I0VA 4JF8A 2A15A 4LZIA 4R80A 3TDGA 3ZFZA 5KP1A 5TGNA 4STDA 3LMLA 1RGKA 4N6LA 1J2BA 1RRLA 3FF0A 2QEX3 1STDA 1UDII 1BNFA 3DGYA 1DYUA 1RGHA 1GD4A 2CFGA 3JUQA 3HX8A 3GZYB 4KVHA 5G1KA 7RNTA 3CCV3 1MWSA 4FMCA 4X2HA 1LQGC 1U8CB 1QAKA 3L0RA 1SPUA 3J7Yd 3FG1A 3NUVA 1PY3A 1B3SA 1TFKA 2XSOB 2JDIH 1WQLB 2STDA 1RNBA 1JBRA 3PCRA 1AQZA 1BRHA 8CHOA 2K3DA 2LQVA 3MPHA 4H3UA 3F40A 4GSPA 5IEOA 1O7PB 3E99A 2F5MA 2W56A 2OQEA 1JKGB 4MJDA 3NM7A 4EV2A 1O7GB 2HOHA 1FUTA 2L4VA 1FYSA 3IPTA 3PZWA 4KFDA 4XBTA 3V92A 1Q40A 4GL6A 4JRFA 1TP6A 3WMDA 3WR2A 1B2MA 2W2CA 1ULIB 3D5IA 3CNXA 3LH4A 1QVG2 3EHCA 1SIHA 1SQWA 3OWYA 3CCL3 3BU4A 1K41A 1AR0A 2SARA 1W5ZA 1BU4A 3EBYA 2XFSA 4BTXA 3DH2A 7GSPA 3NV0B 2F99A 2CFKA 1IV9A 2E2VA 1IQ8A 3DGLA 4N3VA 4BU4A 1VQ63 1QALA 3EJVA 4HM0B 5BIRA 4XBYA 1A67A 1YIJ3 3D4AA 5EEOA 4EXRA 4BL2A 1CQSA 2F86B 2KRTA 3KN4A 1IT7A 1JZOA 1W6CA 4PEJA 3N54B 4N6OB 3CNMA 3K9MC 5IEPA 3PCSA 4RNZA 3HOHA 4EBGA 1OPYA 3G0KA 3MG2A 3LOYA 1VZZA 4J5GA 5D81A 4HJLB 3SEDA 1T2HA 1UI7A 3UJMA 1JNQA 3LT8A 3MSOA 2W0QA 1UUWB 2BNGA 4BIRA 4KZ1A 4MEIA 1Q824 2O9UX 2YFLB 2AAEA 4R9LA 1JB2A 1X1YA 1W01A 3OWSA 3K7CA 1X1WA 3EX9A 3F8XA 1RMSA 2H0IA 4LSOA 2OOVA 1AV4A 1MNLA 1N5PA 1U5OA 1AVKA 2KCDA 4AKZA 1JB5A 1RGAA 3URPA 1D6ZA 1QJGA 2F5WA 2XFTA 1M1XB 5D82A 3VSYA 1BANA 1HYFA 3KSED 4ORLA 4MMXB 1GD3A 2OQEC 1T3BA 1UGHI 3JUNA 1UCJA 1RJOA 2KAAA 1Q9EA 3RGRA 3I563 1WMNA 1VQ53 1T2IA 2BU4A 2RGQA 4AEQA 1G02A 5ELJA 3FCSB 2YFIB 3DGNA 2KF4A 3QK9A 1W2B2 3NX0A 2WO0A 2W6JH 5EVHA 1C54A 2BHMA 2P0XA 1JZDA 2P38A 3JUMA 1UUGB 3CPOA 4HAAA 1BAOA 1E3RA 4N6NB 5RNTA 1US1A 2MC8A 1DMQA 1I2EA 4WYKA 1TJDA 2IA7A 3HIGA 2KXGA 1BSEA 1C7HA 1E97A 3BLZA 2BO9B 1CYUA 5HGRA 1WTHA 2HMKB 3X41A 1N9JA 3JVCA 3LTBA 4HM8B 1B2UA 2RSXA 3ECFA 4OUQA 1V74A 4J8TA 3FH1A 3LT9A 4WYKB 4WFOA 1QVF2 1BUQA 2K54A 3D5GA 4FR9A 1WMOA 1ZGXA 5IW9A 1IQXA 5IG0A 1ASKA 4LGQA 1TRQA 1YHQ3 1FGMA 1BNSA 2CW9A 2OCTA 3KE7A 2IUKA 1W2ZA 4X2OA 1Q7HA 4XM4A 1DVCA 3CMA3 4GB5A 4XDWA 3AMOA 2GXFA 3BNEA 4WHAA 5CK6A 2XEPA 6STDA 3CD63 2GBWB 3OW22 2W03A 1OUNA 3F14A 1OF5B 1IU7A 3B4OA 3F8HA 1RCLA 3M8CA 1IVUA 3RDEA 1DMNA 3BIRA 3GZBA 1TUHA 3SOYA 3FLJA 2OOVC 4BTYA 1D6YA 3HIIA 4KT3B 4IIAA 1ROAA 1M9GA 1YJW3 3LYGA 4LYLB 3D79A 1JV2B 4MMYB 3CCE3 3F7SA 1M904 2E2TA 4R4KA 2IUJA 1OGZA 1BIRA 3V99A 3X3XA 4FCMA 3GRDA 2D42A 1CYVA 1RN4A 2XSHB 3FZWA 3D9RA 2ZHXB 3X3YA 4R9KA 3S5CA 5AI1A 1M1K4 1JN5B 2OWPA 3EBTA 3G713 3WA3A 2CWVA 2HMMB 2H0HA 1EEJA 1JRQA 3AGOA 1T5YA 1L5GB 3O8YA 1CH0A 4HOHA 1GOYA 2BMRB 2SBLA 2PNCA 1YNVX 3BNDA 3ZG5A 3CXC2 3SOAA 1VQ73 1YI23 1GY6A 2J8XB 3Q2PA 2GSPA 4IPBA 1MWUA 4EC6A 1TRPA 1WMPA 2CFDA 5JPUA 1EG9B 3N8BA 1K28A 1OHPA 2BT3A 3FSDA 1SIIA 3KCHA 3OV4A 4OK0A 3U97A 1RSNA 1FUSA 1ULJB 1V58A 2IYJA 2KF5A 1BRJA 1FUWA 2AADA 3CC23 1BRIA 1DMMA 5BXQA 3DGMA 5AEUB 5IG3A 1UCKA 4KFEA 4LEHA 1JBTA 1IQYA 1RN7A 1ZX2A 3MYTA 3KSPA 3OX9A 4L8PA 2QGUA 1I3FA 4J9AA 1A90A 3FKAA 1GY7A 2YX9A 3AHSA 3NBJA 1PYLA 2W9QA 1F8NA 3ALAA 3BNCA 4J5KA 5CLKA 5AYRB 3K63A 4HM2B 3CCS3 2FNQA 1E3VA 2GEYA 3V98A 3X3ZA 3G16A 2JQ5A 3N9HA 4LMIA 3I553 2D1WA 2WGOA 1YVSA 1BNJA 2RFRA 3ER7A 2O3OA 1I3IA 2ML5A 3H51A 4EV5A 2CG1A 4CPKA 1NB5I 1D6UA 2Y74A 1VQO3 1JJ22 4NREA 4FMDA 3RGAA 1TU5A 5AIHA 1N5HA 3SLUA 2RNTA 3SYUA 1GMPA 2I9WA 1LVNA 3I0YA 4Q53A 2BMQB 3RNTA 4CCVA 2W56B 9RNTA 3T8NA 4HM7B 1HKXA 1EUIC 1B21A 1UW1A 1STFI 5ELUA 1K9M4 1FGTA 1BGSA 2UUGC 3HK4A 1K734 1BNRA 1Q40B 4N6MA 1FGRA 4HM3B 1SARA 5IENA 1EKMA 3JUOA 3UL5A 3MG1A 1B27A 3GWRA 4FCJA 2E2UA 2XH9A 2KF6A 1EA2A 4NPBA 1VQ93 1KWIA 1IDPA 1RGCA 2P09A 1IVWA 3PS8A 3ZG0A 2GEXA 3AGNA 1BSDA 2FGTA 2CWUA 3UB1A 2F98A 1RDSA 5M18A 2LYXA 1HZ1A 1KSIA 3NXJA 1I70A 2K0MA 2L1SA 4HZ9B 3MWZA 3G6E3 1EQKA 4FMBA 3IJEB 4BL3A 1JKGA 1MGRA 3CCQ3 3CME3 2OTJ3 2Q07A 3A5EA 2BMOB 1MWTA 2GU1A 3LZAA 1ISKA 2KF3A 1GOVA 3HZPA 4EW5A 1ZS7A 2XRXB 3GZRA 3CCJ3 3EN1B 2HMOB 5CF2A 1MOLA 1RHLA 3SX1A 4AKYA 2CHCA 3UNLA 4N6V0 1ROVA 2BIRA 2R41A 1B2XA 5CF1A 4OVMA 1KD14 3NV0A 3LTCA 5A0OB 2OTL3 3B8LA 1WNHA 5FW5A 3CPW2 1RCKA 1GMQA 1HU9A 3MG3A 1OH0A 1RN1A 3Q3FA 7STDA 3NM2A 2WGQA 3BNBA 3LXUX 2CKFB 1Z1SA 1UCIA 1DE3A 1GY5A 5AIFA 2Z6BA 4NHFA 4N6UA 1B2SA 1W02A 3EC9A 3VF1A 5KP4A 1VQM3 4L8OA 1VQL3 1N8R4 5AIIA 1S5AA 2V1LA 3H3HA 4O02B 1W7CA 3GSPA 1SJWA 4KFFA 4G1MB 4DKIA 3OWUA 1YVBI 5G1LA 3ROBA 3SXXA 3NQYA 1NDOB 2M7OA 5LC7A 2PZVA 1AVLA 1BSBA 2UGIA 1YGWA 4QWTA 2INXA 8RNTA 3UL6A 1QAFA 2W9PA 5AIGA 5IERA 1VQ83 3OXAA 1A2PA 1Q42A 4K90B 5KP3A 4HBRA 3S67A 2QIYA 1RGGA 1BRSA 3STDA 1BNGA 4U13A 1B20A 1VQP3 1LRAA 3B7CA 3DZLA 4O3VA 1KQS2 1RGLA 2H0GA 1LXEA 3F7XA 5LC6A 3D3LA 3CC43 1QMAA 2W04A 1Q814 4I5QA 1DETA 3PXMA 4BTWA 3KIIA 1FW7A 2YFJB 1IVVA 3FG4A 1BRGA 4HM4B 1Q864 2CFLA 1RTUA 1RKYA 2B24B 2CWTA 2MF7A 1B2ZA 1UUVB 2ZA4A 1JB4A 3JUPA 5CXOA 5AYSC 1VQN3 1TTOA 1I2FA 1IV7A 5AEWB 3WODG 1O7NB 3DUKA 3Q1CA 1G0TA 5DREA 3IMAB 4K1VA 3DMCA 1PU4A 2B1XB 2ZL8A 1BUJA 1LOXA 1NWWA 3WDGB 3KKGA 1LQMB 1IVXA 4XB5A 3AMOB 2GU3A 1N8QA 2Z76A 4O2HA 1UCLA 1UGIA 5HOHA 5M1AA 2CIUA 2Z77A 2HMJB 2WOHA 4O8SA 5STDA 1IYYA 1W4NA 4ILFA 3PGBA 4GHOA 5EQLA 2IMJA 4HM6B 1LOYA 3G8ZA 4L7KA 3K0ZA 2C10A 4EYCA 3CCM3 3QRDA 3VGNA 1W6GA 1N9EA 1GSPA 4WP5A 4K61A 1OACA 5GSPA 1X1XA
chains in the Genus database with same CATH topology
2HMLB 3HI7A 4R1KA 2CFWA 4CDLA 1O7MB 1NO3A 2FXTA 2UX0A 1YJN3 3DXOA 4HKVB 1IT8A 2WOFA 4WWUC 3WOEB 3GZXB 3LTDA 4XBXA 3S29A 1VQK3 2CH9A 3PYJA 2Z7AA 4N6TA 3T0UA 3CCR3 3S27A 5IG5A 1G96A 2XF3A 3F9SA 1OF5A 4HYZA 3S28A 1OHSA 1W00A 1A2KA 2Y73A 3SVAA 2CG0A 2GBXB 4TX4A 2CC3A 3NBBA 5G2GA 1PFPA 4HM5B 5DRVA 3T8UA 1UI8A 4FCZA 2RCDA 2P0MA 4HVNA 3G4S3 1VQ43 3B4PA 1NB3I 3MKIA 1O7HB 1ZO2A 2ML6A 3CU3A 2XGNA 1OCVA 4FMAA 4H61A 4HZBB 2CK3H 3X40A 4XDVA 3GAXA 4IT7A 5JBSA 1YGEA 3EE1A 1NJI4 1NU3A 3EF8A 2XGLA 3NQZA 2XR8B 3WOFB 1OHOA 2HMNB 3K5TA 5BVBA 3KZTA 3MHEA 1JN5A 1TIJA 1O7WB 3KFQC 3WA2X 3X42A 1OGXA 3LTAA 1FA3A 3DM8A 4MMZB 2ZDJA 4RNYA 3FGYA 5I97A 3EQQB 1RRHA 1GYBA 2QA43 1Q7Y4 1FGOA 3NBRA 4RBNA 4I4KA 4HM1B 4K1UA 1Y4KA 3A76A 2C11A 3DY5A 3CCU3 1LNHA 5FGOA 3EB8A 3U1WA 5JPPA 1K8A4 1A2VA 1YIT3 3DGOA 3CC73 1R4CA 1YJ93 1GS3A 3NHXA 5D83A 2P05A 1W6YA 2R4IA 5IF6A 1S723 1CEWI 1KC84 3FG3A 1TFOA 4ZM8A 1FGQA 5IG4A 4RZMA 1IK3A 3FF2A 3BB9A 3EN8A 3Q90A 1DVDA 4JF8A 2A15A 4LZIA 4R80A 3TDGA 5KP1A 5TGNA 4STDA 3LMLA 4N6LA 1J2BA 1RRLA 3FF0A 2QEX3 1STDA 1DYUA 2CFGA 1GD4A 3JUQA 3HX8A 3GZYB 4KVHA 3CCV3 4FMCA 4X2HA 1U8CB 1QAKA 3L0RA 1SPUA 3J7Yd 3FG1A 3NUVA 1TFKA 2XSOB 2JDIH 1WQLB 2STDA 3PCRA 8CHOA 2LQVA 3MPHA 4H3UA 3F40A 5IEOA 1O7PB 3E99A 2W56A 2OQEA 1JKGB 4MJDA 3NM7A 4EV2A 1O7GB 3PZWA 2L4VA 3IPTA 4KFDA 4XBTA 3V92A 1Q40A 4GL6A 4JRFA 1TP6A 3WMDA 2W2CA 1ULIB 3CNXA 3LH4A 1QVG2 3EHCA 1SIHA 1SQWA 3OWYA 3CCL3 1K41A 1AR0A 1W5ZA 3EBYA 2XFSA 4BTXA 3NV0B 2F99A 2CFKA 1IV9A 2E2VA 1IQ8A 3DGLA 4N3VA 1VQ63 1QALA 3EJVA 4HM0B 1A67A 4XBYA 1YIJ3 5EEOA 4EXRA 1CQSA 2F86B 2KRTA 3KN4A 1IT7A 4PEJA 1W6CA 3N54B 4N6OB 3CNMA 3K9MC 5IEPA 3PCSA 4RNZA 4EBGA 1OPYA 3G0KA 3MG2A 3LOYA 1VZZA 5D81A 4HJLB 3SEDA 1UI7A 3UJMA 1JNQA 3LT8A 3MSOA 2W0QA 1UUWB 2BNGA 4KZ1A 4MEIA 1Q824 2O9UX 2YFLB 4R9LA 1JB2A 3OWSA 1W01A 3K7CA 3EX9A 3F8XA 4LSOA 2OOVA 1AV4A 1MNLA 1N5PA 1U5OA 1AVKA 2KCDA 4AKZA 1JB5A 1D6ZA 1QJGA 2XFTA 1M1XB 5D82A 3VSYA 3KSED 4ORLA 4MMXB 1GD3A 2OQEC 3JUNA 1RJOA 3RGRA 3I563 1WMNA 1VQ53 2RGQA 4AEQA 5ELJA 3FCSB 2YFIB 3DGNA 3QK9A 1W2B2 3NX0A 2WO0A 2W6JH 5EVHA 2BHMA 2P0XA 2P38A 3JUMA 4N6NB 3CPOA 1E3RA 1US1A 2MC8A 1DMQA 2IA7A 3HIGA 2KXGA 1C7HA 1E97A 3BLZA 2BO9B 5HGRA 1WTHA 2HMKB 3X41A 1N9JA 3JVCA 3LTBA 4HM8B 3ECFA 2RSXA 4OUQA 1V74A 4J8TA 3FH1A 3LT9A 4WYKB 4WFOA 1QVF2 1BUQA 2K54A 4FR9A 1WMOA 5IW9A 1IQXA 5IG0A 1ASKA 4LGQA 1YHQ3 1FGMA 2CW9A 2OCTA 3KE7A 2IUKA 1W2ZA 4X2OA 4XM4A 1DVCA 3CMA3 4GB5A 4XDWA 3AMOA 2GXFA 3BNEA 4WHAA 5CK6A 2XEPA 6STDA 3CD63 2GBWB 3OW22 2W03A 1OUNA 3F14A 1OF5B 1IU7A 3B4OA 3F8HA 3M8CA 1IVUA 3RDEA 1DMNA 3GZBA 1TUHA 3SOYA 3FLJA 2OOVC 4BTYA 1D6YA 3HIIA 4IIAA 1ROAA 1M9GA 1YJW3 3LYGA 1JV2B 4MMYB 3CCE3 3F7SA 1M904 2E2TA 4R4KA 2IUJA 1OGZA 3V99A 3X3XA 4FCMA 3GRDA 2D42A 1CYVA 2XSHB 3FZWA 3D9RA 3X3YA 4R9KA 3S5CA 5AI1A 1M1K4 1JN5B 2OWPA 3EBTA 3G713 3WA3A 2CWVA 2HMMB 1L5GB 1JRQA 1T5YA 3O8YA 2BMRB 2SBLA 2PNCA 3CXC2 3BNDA 1VQ73 3SOAA 1YI23 1GY6A 3Q2PA 4IPBA 4EC6A 2CFDA 1WMPA 5JPUA 1EG9B 3N8BA 1K28A 1OHPA 2BT3A 3FSDA 1SIIA 3OV4A 4OK0A 3U97A 1ULJB 1FUWA 3CC23 1DMMA 5BXQA 3DGMA 5AEUB 5IG3A 4KFEA 4LEHA 1IQYA 1RN7A 1ZX2A 3MYTA 3KSPA 3OX9A 4L8PA 2QGUA 1A90A 4J9AA 3FKAA 1GY7A 2YX9A 3NBJA 2W9QA 1F8NA 3ALAA 3BNCA 5CLKA 5AYRB 3K63A 4HM2B 3CCS3 2FNQA 1E3VA 2GEYA 3V98A 3X3ZA 3G16A 2JQ5A 3N9HA 4LMIA 3I553 2D1WA 2WGOA 4EV5A 2RFRA 3ER7A 2O3OA 3H51A 2ML5A 2CG1A 1NB5I 1D6UA 2Y74A 1VQO3 1JJ22 4NREA 4FMDA 3RGAA 1TU5A 5AIHA 1N5HA 3SLUA 2I9WA 1LVNA 3I0YA 4Q53A 2BMQB 4CCVA 2W56B 3T8NA 4HM7B 1HKXA 1UW1A 1K9M4 1STFI 5ELUA 1FGTA 3HK4A 1K734 1Q40B 4N6MA 1FGRA 4HM3B 5IENA 1EKMA 3JUOA 3UL5A 3MG1A 3GWRA 4FCJA 2E2UA 2XH9A 1VQ93 1EA2A 1KWIA 1IDPA 2P09A 1IVWA 3PS8A 2GEXA 2FGTA 2CWUA 3UB1A 2F98A 2LYXA 1KSIA 3NXJA 2K0MA 4HZ9B 3MWZA 3G6E3 1EQKA 4FMBA 3IJEB 1JKGA 3CCQ3 3CME3 2OTJ3 2Q07A 2BMOB 3LZAA 2GU1A 1ISKA 3HZPA 2XRXB 3GZRA 3CCJ3 3EN1B 2HMOB 5CF2A 1MOLA 3SX1A 4AKYA 2CHCA 3UNLA 4N6V0 1ROVA 5CF1A 1KD14 4OVMA 3NV0A 3LTCA 5A0OB 2OTL3 3B8LA 1WNHA 5FW5A 3CPW2 3MG3A 1HU9A 1OH0A 7STDA 3NM2A 2WGQA 3BNBA 3LXUX 2CKFB 1Z1SA 1GY5A 5AIFA 2Z6BA 4NHFA 4N6UA 1W02A 3EC9A 3VF1A 5KP4A 1VQM3 4L8OA 1VQL3 1N8R4 5AIIA 1S5AA 2V1LA 3H3HA 4O02B 1W7CA 1SJWA 4KFFA 4G1MB 3OWUA 1YVBI 3ROBA 3SXXA 3NQYA 1NDOB 2M7OA 5LC7A 2PZVA 1AVLA 4QWTA 2INXA 3UL6A 1QAFA 2W9PA 5AIGA 5IERA 1VQ83 3OXAA 1Q42A 4K90B 5KP3A 4HBRA 3S67A 2QIYA 3STDA 4U13A 1VQP3 3B7CA 3DZLA 4O3VA 1KQS2 5LC6A 1LXEA 3F7XA 3D3LA 3CC43 1QMAA 2W04A 1Q814 3PXMA 4BTWA 3KIIA 2YFJB 1IVVA 3FG4A 4HM4B 1Q864 2CFLA 1RKYA 2B24B 2CWTA 2MF7A 3JUPA 1UUVB 5CXOA 1JB4A 1VQN3 5AYSC 1IV7A 5AEWB 3WODG 1O7NB 3DUKA 3Q1CA 5DREA 1CYUA 3IMAB 4K1VA 3DMCA 1PU4A 2B1XB 2ZL8A 1LOXA 1NWWA 3WDGB 3KKGA 1IVXA 4XB5A 3AMOB 2GU3A 1N8QA 2Z76A 4O2HA 2CIUA 2Z77A 2HMJB 2WOHA 4O8SA 5STDA 1W4NA 3PGBA 5EQLA 2IMJA 4HM6B 3G8ZA 4L7KA 3K0ZA 2C10A 4EYCA 3CCM3 3QRDA 3VGNA 1W6GA 1N9EA 4WP5A 4K61A 1OACA 4WYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HML B;  4R1K A;  4CDL A;  1O7M B;  2UX0 A;  3DXO A;  4HKV B;  4WWU C;  3GZX B;  4XBX A;  2Z7A A;  5IG5 A;  3F9S A;  1OF5 A;  1OHS A;  1W00 A;  1A2K A;  2GBX B;  5G2G A;  4HM5 B;  5DRV A;  3T8U A;  2RCD A;  4HVN A;  3B4P A;  3MKI A;  1O7H B;  1ZO2 A;  3CU3 A;  4HZB B;  1OCV A;  4XDV A;  1NU3 A;  3EF8 A;  2XR8 B;  1OHO A;  2HMN B;  5BVB A;  3KZT A;  3MHE A;  1JN5 A;  1O7W B;  1OGX A;  3DM8 A;  3FGY A;  3EQQ B;  1GYB A;  3NBR A;  4I4K A;  4HM1 B;  4K1U A;  3A76 A;  5JPP A;  1GS3 A;  3NHX A;  5D83 A;  1W6Y A;  2R4I A;  5IF6 A;  5IG4 A;  4RZM A;  3FF2 A;  3BB9 A;  3EN8 A;  3Q90 A;  2A15 A;  5KP1 A;  5TGN A;  4STD A;  3FF0 A;  1STD A;  3JUQ A;  3HX8 A;  3GZY B;  4KVH A;  4X2H A;  3NUV A;  2XSO B;  1WQL B;  2STD A;  8CHO A;  4H3U A;  5IEO A;  3F40 A;  1O7P B;  3E99 A;  1JKG B;  4MJD A;  1O7G B;  3IPT A;  4XBT A;  1Q40 A;  1TP6 A;  3WMD A;  2W2C A;  1ULI B;  3CNX A;  3EHC A;  3OWY A;  1K41 A;  1AR0 A;  3EBY A;  3NV0 B;  2F99 A;  4N3V A;  3EJV A;  4HM0 B;  4XBY A;  1CQS A;  2F86 B;  4PEJ A;  3CNM A;  5IEP A;  1OPY A;  3G0K A;  3MG2 A;  1VZZ A;  5D81 A;  4HJL B;  3SED A;  3UJM A;  3MSO A;  1UUW B;  2BNG A;  2YFL B;  4R9L A;  1JB2 A;  3OWS A;  1W01 A;  3K7C A;  3EX9 A;  3F8X A;  1U5O A;  1JB5 A;  1QJG A;  5D82 A;  3VSY A;  4ORL A;  3JUN A;  3RGR A;  2RGQ A;  2YFI B;  5EVH A;  3JUM A;  3CPO A;  1E3R A;  1DMQ A;  1C7H A;  1E97 A;  3BLZ A;  5HGR A;  2HMK B;  4HM8 B;  3ECF A;  4OUQ A;  4J8T A;  3FH1 A;  4WYK B;  1BUQ A;  2K54 A;  5IG0 A;  1ASK A;  4LGQ A;  3KE7 A;  4X2O A;  4XM4 A;  4GB5 A;  4XDW A;  2GXF A;  5CK6 A;  6STD A;  2GBW B;  1OUN A;  3F14 A;  1OF5 B;  3B4O A;  3M8C A;  3F8H A;  1DMN A;  3GZB A;  1TUH A;  3SOY A;  3FLJ A;  4IIA A;  3LYG A;  3F7S A;  1OGZ A;  4FCM A;  3GRD A;  2XSH B;  3FZW A;  3D9R A;  4R9K A;  3S5C A;  5AI1 A;  1JN5 B;  2OWP A;  3EBT A;  2HMM B;  2BMR B;  3SOA A;  1GY6 A;  5JPU A;  1EG9 B;  1OHP A;  3FSD A;  3OV4 A;  1ULJ B;  1DMM A;  5BXQ A;  5AEU B;  5IG3 A;  4LEH A;  1ZX2 A;  3MYT A;  3KSP A;  3OX9 A;  4L8P A;  2QGU A;  4J9A A;  3FKA A;  1GY7 A;  5CLK A;  4HM2 B;  1E3V A;  2GEY A;  3G16 A;  2JQ5 A;  4LMI A;  2RFR A;  3ER7 A;  3H51 A;  3RGA A;  5AIH A;  2I9W A;  3I0Y A;  4Q53 A;  2BMQ B;  3T8N A;  4HM7 B;  1HKX A;  3HK4 A;  1Q40 B;  4HM3 B;  5IEN A;  3JUO A;  3MG1 A;  3GWR A;  4FCJ A;  1EA2 A;  1IDP A;  2GEX A;  2F98 A;  3NXJ A;  4HZ9 B;  1JKG A;  2BMO B;  3LZA A;  1ISK A;  3HZP A;  2XRX B;  3GZR A;  3EN1 B;  2HMO B;  5CF2 A;  2CHC A;  3UNL A;  5CF1 A;  4OVM A;  3NV0 A;  3B8L A;  5FW5 A;  3MG3 A;  1OH0 A;  7STD A;  3NM2 A;  2CKF B;  1Z1S A;  1GY5 A;  5AIF A;  1W02 A;  3EC9 A;  5KP4 A;  4L8O A;  5AII A;  1S5A A;  3H3H A;  1SJW A;  3OWU A;  3ROB A;  1NDO B;  2PZV A;  2INX A;  5AIG A;  5IER A;  3OXA A;  1Q42 A;  5KP3 A;  2QIY A;  3STD A;  4U13 A;  3B7C A;  3DZL A;  3F7X A;  1QMA A;  2YFJ B;  4HM4 B;  2B24 B;  3JUP A;  1UUV B;  5CXO A;  1JB4 A;  5AEW B;  1O7N B;  3DUK A;  5DRE A;  4K1V A;  3DMC A;  2B1X B;  1NWW A;  3KKG A;  4XB5 A;  2Z76 A;  2Z77 A;  2HMJ B;  5STD A;  2IMJ A;  4HM6 B;  3G8Z A;  4L7K A;  3K0Z A;  3VGN A;  4WP5 A;  4WYK A; 
#chains in the Genus database with same CATH topology
 2HML B;  3HI7 A;  5M19 A;  4R1K A;  2CFW A;  4CDL A;  1O7M B;  1NO3 A;  2F56 A;  2FXT A;  2UX0 A;  1YJN 3;  3DXO A;  1MWR A;  4HKV B;  1IT8 A;  2WOF A;  1RNT A;  5BU4 A;  6RNT A;  4WWU C;  1BVI A;  3GZX B;  3LTD A;  3WOE B;  4XBX A;  3S29 A;  1FZU A;  1VQK 3;  2CH9 A;  1RLS A;  3PYJ A;  4CJN A;  2CX1 A;  2Z7A A;  4N6T A;  3T0U A;  3CCR 3;  4RNT A;  3S27 A;  5IG5 A;  1GOU A;  1G96 A;  2XF3 A;  1BSA A;  1OF5 A;  3F9S A;  1X1U A;  1V57 A;  4HYZ A;  3S28 A;  1OHS A;  1W00 A;  1A2K A;  2Y73 A;  1I0X A;  3SVA A;  2CG0 A;  2GBX B;  4TX4 A;  1BSC A;  2CC3 A;  3NBB A;  5G2G A;  1PFP A;  4HM5 B;  5DRV A;  3T8U A;  1UI8 A;  1VQQ A;  4FCZ A;  2RCD A;  2P0M A;  1RGE A;  4HVN A;  1BOX A;  1I2G A;  1NNV A;  3WHO A;  3G4S 3;  3B4P A;  1VQ4 3;  1NB3 I;  3MKI A;  1BNE A;  1LOV A;  1O7H B;  1ZO2 A;  2ML6 A;  3CU3 A;  2CX0 A;  2XGN A;  1OCV A;  4FMA A;  4H61 A;  4HZB B;  2CK3 H;  1LOW A;  3X40 A;  4XDV A;  1RGF A;  3GAX A;  4IT7 A;  1MGW A;  5JBS A;  1GMR A;  1YGE A;  3EE1 A;  1NJI 4;  1NU3 A;  3EF8 A;  2XGL A;  3NQZ A;  1JBS A;  2XR8 B;  3WOF B;  1OHO A;  2HMN B;  3K5T A;  5BVB A;  3KZT A;  3MHE A;  1JN5 A;  1TIJ A;  1O7W B;  3KFQ C;  3WA2 X;  3X42 A;  1OGX A;  3LTA A;  1FA3 A;  3DM8 A;  4MMZ B;  2ZDJ A;  4RNY A;  3FGY A;  5I97 A;  2IY2 A;  1RRH A;  1GYB A;  3EQQ B;  2QA4 3;  1FGO A;  1Q7Y 4;  3NBR A;  4RBN A;  4I4K A;  4HM1 B;  2RBI A;  4K1U A;  1AY7 A;  1Y4K A;  3A76 A;  2C11 A;  3DY5 A;  3CCU 3;  1LNH A;  5FGO A;  3EB8 A;  1BNI A;  3U1W A;  1R4Y A;  1BRK A;  1A2V A;  5JPP A;  1YIT 3;  1K8A 4;  3DGO A;  3CC7 3;  1R4C A;  1YJ9 3;  1GS3 A;  3NHX A;  5D83 A;  2P05 A;  1W6Y A;  2R4I A;  5IF6 A;  1S72 3;  1CEW I;  1KC8 4;  3FG3 A;  1LNI A;  1TFO A;  2F4Y A;  4ZM8 A;  6GSP A;  1FGQ A;  1I8V A;  5IG4 A;  4RZM A;  1IK3 A;  3AHW A;  3FF2 A;  2C4B A;  1BRN L;  3BB9 A;  3EN8 A;  3Q90 A;  1DVD A;  1I0V A;  4JF8 A;  2A15 A;  4LZI A;  4R80 A;  3TDG A;  3ZFZ A;  5KP1 A;  5TGN A;  4STD A;  3LML A;  1RGK A;  4N6L A;  1J2B A;  1RRL A;  3FF0 A;  2QEX 3;  1STD A;  1UDI I;  1BNF A;  3DGY A;  1DYU A;  1RGH A;  1GD4 A;  2CFG A;  3JUQ A;  3HX8 A;  3GZY B;  4KVH A;  5G1K A;  7RNT A;  3CCV 3;  1MWS A;  4FMC A;  4X2H A;  1LQG C;  1U8C B;  1QAK A;  3L0R A;  1SPU A;  3J7Y d;  3FG1 A;  3NUV A;  1PY3 A;  1B3S A;  1TFK A;  2XSO B;  2JDI H;  1WQL B;  2STD A;  1RNB A;  1JBR A;  3PCR A;  1AQZ A;  1BRH A;  8CHO A;  2K3D A;  2LQV A;  3MPH A;  4H3U A;  3F40 A;  4GSP A;  5IEO A;  1O7P B;  3E99 A;  2F5M A;  2W56 A;  2OQE A;  1JKG B;  4MJD A;  3NM7 A;  4EV2 A;  1O7G B;  2HOH A;  1FUT A;  2L4V A;  1FYS A;  3IPT A;  3PZW A;  4KFD A;  4XBT A;  3V92 A;  1Q40 A;  4GL6 A;  4JRF A;  1TP6 A;  3WMD A;  3WR2 A;  1B2M A;  2W2C A;  1ULI B;  3D5I A;  3CNX A;  3LH4 A;  1QVG 2;  3EHC A;  1SIH A;  1SQW A;  3OWY A;  3CCL 3;  3BU4 A;  1K41 A;  1AR0 A;  2SAR A;  1W5Z A;  1BU4 A;  3EBY A;  2XFS A;  4BTX A;  3DH2 A;  7GSP A;  3NV0 B;  2F99 A;  2CFK A;  1IV9 A;  2E2V A;  1IQ8 A;  3DGL A;  4N3V A;  4BU4 A;  1VQ6 3;  1QAL A;  3EJV A;  4HM0 B;  5BIR A;  4XBY A;  1A67 A;  1YIJ 3;  3D4A A;  5EEO A;  4EXR A;  4BL2 A;  1CQS A;  2F86 B;  2KRT A;  3KN4 A;  1IT7 A;  1JZO A;  1W6C A;  4PEJ A;  3N54 B;  4N6O B;  3CNM A;  3K9M C;  5IEP A;  3PCS A;  4RNZ A;  3HOH A;  4EBG A;  1OPY A;  3G0K A;  3MG2 A;  3LOY A;  1VZZ A;  4J5G A;  5D81 A;  4HJL B;  3SED A;  1T2H A;  1UI7 A;  3UJM A;  1JNQ A;  3LT8 A;  3MSO A;  2W0Q A;  1UUW B;  2BNG A;  4BIR A;  4KZ1 A;  4MEI A;  1Q82 4;  2O9U X;  2YFL B;  2AAE A;  4R9L A;  1JB2 A;  1X1Y A;  1W01 A;  3OWS A;  3K7C A;  1X1W A;  3EX9 A;  3F8X A;  1RMS A;  2H0I A;  4LSO A;  2OOV A;  1AV4 A;  1MNL A;  1N5P A;  1U5O A;  1AVK A;  2KCD A;  4AKZ A;  1JB5 A;  1RGA A;  3URP A;  1D6Z A;  1QJG A;  2F5W A;  2XFT A;  1M1X B;  5D82 A;  3VSY A;  1BAN A;  1HYF A;  3KSE D;  4ORL A;  4MMX B;  1GD3 A;  2OQE C;  1T3B A;  1UGH I;  3JUN A;  1UCJ A;  1RJO A;  2KAA A;  1Q9E A;  3RGR A;  3I56 3;  1WMN A;  1VQ5 3;  1T2I A;  2BU4 A;  2RGQ A;  4AEQ A;  1G02 A;  5ELJ A;  3FCS B;  2YFI B;  3DGN A;  2KF4 A;  3QK9 A;  1W2B 2;  3NX0 A;  2WO0 A;  2W6J H;  5EVH A;  1C54 A;  2BHM A;  2P0X A;  1JZD A;  2P38 A;  3JUM A;  1UUG B;  3CPO A;  4HAA A;  1BAO A;  1E3R A;  4N6N B;  5RNT A;  1US1 A;  2MC8 A;  1DMQ A;  1I2E A;  4WYK A;  1TJD A;  2IA7 A;  3HIG A;  2KXG A;  1BSE A;  1C7H A;  1E97 A;  3BLZ A;  2BO9 B;  1CYU A;  5HGR A;  1WTH A;  2HMK B;  3X41 A;  1N9J A;  3JVC A;  3LTB A;  4HM8 B;  1B2U A;  2RSX A;  3ECF A;  4OUQ A;  1V74 A;  4J8T A;  3FH1 A;  3LT9 A;  4WYK B;  4WFO A;  1QVF 2;  1BUQ A;  2K54 A;  3D5G A;  4FR9 A;  1WMO A;  1ZGX A;  5IW9 A;  1IQX A;  5IG0 A;  1ASK A;  4LGQ A;  1TRQ A;  1YHQ 3;  1FGM A;  1BNS A;  2CW9 A;  2OCT A;  3KE7 A;  2IUK A;  1W2Z A;  4X2O A;  1Q7H A;  4XM4 A;  1DVC A;  3CMA 3;  4GB5 A;  4XDW A;  3AMO A;  2GXF A;  3BNE A;  4WHA A;  5CK6 A;  2XEP A;  6STD A;  3CD6 3;  2GBW B;  3OW2 2;  2W03 A;  1OUN A;  3F14 A;  1OF5 B;  1IU7 A;  3B4O A;  3F8H A;  1RCL A;  3M8C A;  1IVU A;  3RDE A;  1DMN A;  3BIR A;  3GZB A;  1TUH A;  3SOY A;  3FLJ A;  2OOV C;  4BTY A;  1D6Y A;  3HII A;  4KT3 B;  4IIA A;  1ROA A;  1M9G A;  1YJW 3;  3LYG A;  4LYL B;  3D79 A;  1JV2 B;  4MMY B;  3CCE 3;  3F7S A;  1M90 4;  2E2T A;  4R4K A;  2IUJ A;  1OGZ A;  1BIR A;  3V99 A;  3X3X A;  4FCM A;  3GRD A;  2D42 A;  1CYV A;  1RN4 A;  2XSH B;  3FZW A;  3D9R A;  2ZHX B;  3X3Y A;  4R9K A;  3S5C A;  5AI1 A;  1M1K 4;  1JN5 B;  2OWP A;  3EBT A;  3G71 3;  3WA3 A;  2CWV A;  2HMM B;  2H0H A;  1EEJ A;  1JRQ A;  3AGO A;  1T5Y A;  1L5G B;  3O8Y A;  1CH0 A;  4HOH A;  1GOY A;  2BMR B;  2SBL A;  2PNC A;  1YNV X;  3BND A;  3ZG5 A;  3CXC 2;  3SOA A;  1VQ7 3;  1YI2 3;  1GY6 A;  2J8X B;  3Q2P A;  2GSP A;  4IPB A;  1MWU A;  4EC6 A;  1TRP A;  1WMP A;  2CFD A;  5JPU A;  1EG9 B;  3N8B A;  1K28 A;  1OHP A;  2BT3 A;  3FSD A;  1SII A;  3KCH A;  3OV4 A;  4OK0 A;  3U97 A;  1RSN A;  1FUS A;  1ULJ B;  1V58 A;  2IYJ A;  2KF5 A;  1BRJ A;  1FUW A;  2AAD A;  3CC2 3;  1BRI A;  1DMM A;  5BXQ A;  3DGM A;  5AEU B;  5IG3 A;  1UCK A;  4KFE A;  4LEH A;  1JBT A;  1IQY A;  1RN7 A;  1ZX2 A;  3MYT A;  3KSP A;  3OX9 A;  4L8P A;  2QGU A;  1I3F A;  4J9A A;  1A90 A;  3FKA A;  1GY7 A;  2YX9 A;  3AHS A;  3NBJ A;  1PYL A;  2W9Q A;  1F8N A;  3ALA A;  3BNC A;  4J5K A;  5CLK A;  5AYR B;  3K63 A;  4HM2 B;  3CCS 3;  2FNQ A;  1E3V A;  2GEY A;  3V98 A;  3X3Z A;  3G16 A;  2JQ5 A;  3N9H A;  4LMI A;  3I55 3;  2D1W A;  2WGO A;  1YVS A;  1BNJ A;  2RFR A;  3ER7 A;  2O3O A;  1I3I A;  2ML5 A;  3H51 A;  4EV5 A;  2CG1 A;  4CPK A;  1NB5 I;  1D6U A;  2Y74 A;  1VQO 3;  1JJ2 2;  4NRE A;  4FMD A;  3RGA A;  1TU5 A;  5AIH A;  1N5H A;  3SLU A;  2RNT A;  3SYU A;  1GMP A;  2I9W A;  1LVN A;  3I0Y A;  4Q53 A;  2BMQ B;  3RNT A;  4CCV A;  2W56 B;  9RNT A;  3T8N A;  4HM7 B;  1HKX A;  1EUI C;  1B21 A;  1UW1 A;  1STF I;  5ELU A;  1K9M 4;  1FGT A;  1BGS A;  2UUG C;  3HK4 A;  1K73 4;  1BNR A;  1Q40 B;  4N6M A;  1FGR A;  4HM3 B;  1SAR A;  5IEN A;  1EKM A;  3JUO A;  3UL5 A;  3MG1 A;  1B27 A;  3GWR A;  4FCJ A;  2E2U A;  2XH9 A;  2KF6 A;  1EA2 A;  4NPB A;  1VQ9 3;  1KWI A;  1IDP A;  1RGC A;  2P09 A;  1IVW A;  3PS8 A;  3ZG0 A;  2GEX A;  3AGN A;  1BSD A;  2FGT A;  2CWU A;  3UB1 A;  2F98 A;  1RDS A;  5M18 A;  2LYX A;  1HZ1 A;  1KSI A;  3NXJ A;  1I70 A;  2K0M A;  2L1S A;  4HZ9 B;  3MWZ A;  3G6E 3;  1EQK A;  4FMB A;  3IJE B;  4BL3 A;  1JKG A;  1MGR A;  3CCQ 3;  3CME 3;  2OTJ 3;  2Q07 A;  3A5E A;  2BMO B;  1MWT A;  2GU1 A;  3LZA A;  1ISK A;  2KF3 A;  1GOV A;  3HZP A;  4EW5 A;  1ZS7 A;  2XRX B;  3GZR A;  3CCJ 3;  3EN1 B;  2HMO B;  5CF2 A;  1MOL A;  1RHL A;  3SX1 A;  4AKY A;  2CHC A;  3UNL A;  4N6V 0;  1ROV A;  2BIR A;  2R41 A;  1B2X A;  5CF1 A;  4OVM A;  1KD1 4;  3NV0 A;  3LTC A;  5A0O B;  2OTL 3;  3B8L A;  1WNH A;  5FW5 A;  3CPW 2;  1RCK A;  1GMQ A;  1HU9 A;  3MG3 A;  1OH0 A;  1RN1 A;  3Q3F A;  7STD A;  3NM2 A;  2WGQ A;  3BNB A;  3LXU X;  2CKF B;  1Z1S A;  1UCI A;  1DE3 A;  1GY5 A;  5AIF A;  2Z6B A;  4NHF A;  4N6U A;  1B2S A;  1W02 A;  3EC9 A;  3VF1 A;  5KP4 A;  1VQM 3;  4L8O A;  1VQL 3;  1N8R 4;  5AII A;  1S5A A;  2V1L A;  3H3H A;  4O02 B;  1W7C A;  3GSP A;  1SJW A;  4KFF A;  4G1M B;  4DKI A;  3OWU A;  1YVB I;  5G1L A;  3ROB A;  3SXX A;  3NQY A;  1NDO B;  2M7O A;  5LC7 A;  2PZV A;  1AVL A;  1BSB A;  2UGI A;  1YGW A;  4QWT A;  2INX A;  8RNT A;  3UL6 A;  1QAF A;  2W9P A;  5AIG A;  5IER A;  1VQ8 3;  3OXA A;  1A2P A;  1Q42 A;  4K90 B;  5KP3 A;  4HBR A;  3S67 A;  2QIY A;  1RGG A;  1BRS A;  3STD A;  1BNG A;  4U13 A;  1B20 A;  1VQP 3;  1LRA A;  3B7C A;  3DZL A;  4O3V A;  1KQS 2;  1RGL A;  2H0G A;  1LXE A;  3F7X A;  5LC6 A;  3D3L A;  3CC4 3;  1QMA A;  2W04 A;  1Q81 4;  4I5Q A;  1DET A;  3PXM A;  4BTW A;  3KII A;  1FW7 A;  2YFJ B;  1IVV A;  3FG4 A;  1BRG A;  4HM4 B;  1Q86 4;  2CFL A;  1RTU A;  1RKY A;  2B24 B;  2CWT A;  2MF7 A;  1B2Z A;  1UUV B;  2ZA4 A;  1JB4 A;  3JUP A;  5CXO A;  5AYS C;  1VQN 3;  1TTO A;  1I2F A;  1IV7 A;  5AEW B;  3WOD G;  1O7N B;  3DUK A;  3Q1C A;  1G0T A;  5DRE A;  3IMA B;  4K1V A;  3DMC A;  1PU4 A;  2B1X B;  2ZL8 A;  1BUJ A;  1LOX A;  1NWW A;  3WDG B;  3KKG A;  1LQM B;  1IVX A;  4XB5 A;  3AMO B;  2GU3 A;  1N8Q A;  2Z76 A;  4O2H A;  1UCL A;  1UGI A;  5HOH A;  5M1A A;  2CIU A;  2Z77 A;  2HMJ B;  2WOH A;  4O8S A;  5STD A;  1IYY A;  1W4N A;  4ILF A;  3PGB A;  4GHO A;  5EQL A;  2IMJ A;  4HM6 B;  1LOY A;  3G8Z A;  4L7K A;  3K0Z A;  2C10 A;  4EYC A;  3CCM 3;  3QRD A;  3VGN A;  1W6G A;  1N9E A;  1GSP A;  4WP5 A;  4K61 A;  1OAC A;  5GSP A;  1X1X A; 
#chains in the Genus database with same CATH homology
 2HML B;  3HI7 A;  4R1K A;  2CFW A;  4CDL A;  1O7M B;  1NO3 A;  2FXT A;  2UX0 A;  1YJN 3;  3DXO A;  4HKV B;  1IT8 A;  2WOF A;  4WWU C;  3WOE B;  3GZX B;  3LTD A;  4XBX A;  3S29 A;  1VQK 3;  2CH9 A;  3PYJ A;  2Z7A A;  4N6T A;  3T0U A;  3CCR 3;  3S27 A;  5IG5 A;  1G96 A;  2XF3 A;  3F9S A;  1OF5 A;  4HYZ A;  3S28 A;  1OHS A;  1W00 A;  1A2K A;  2Y73 A;  3SVA A;  2CG0 A;  2GBX B;  4TX4 A;  2CC3 A;  3NBB A;  5G2G A;  1PFP A;  4HM5 B;  5DRV A;  3T8U A;  1UI8 A;  4FCZ A;  2RCD A;  2P0M A;  4HVN A;  3G4S 3;  1VQ4 3;  3B4P A;  1NB3 I;  3MKI A;  1O7H B;  1ZO2 A;  2ML6 A;  3CU3 A;  2XGN A;  1OCV A;  4FMA A;  4H61 A;  4HZB B;  2CK3 H;  3X40 A;  4XDV A;  3GAX A;  4IT7 A;  5JBS A;  1YGE A;  3EE1 A;  1NJI 4;  1NU3 A;  3EF8 A;  2XGL A;  3NQZ A;  2XR8 B;  3WOF B;  1OHO A;  2HMN B;  3K5T A;  5BVB A;  3KZT A;  3MHE A;  1JN5 A;  1TIJ A;  1O7W B;  3KFQ C;  3WA2 X;  3X42 A;  1OGX A;  3LTA A;  1FA3 A;  3DM8 A;  4MMZ B;  2ZDJ A;  4RNY A;  3FGY A;  5I97 A;  3EQQ B;  1RRH A;  1GYB A;  2QA4 3;  1Q7Y 4;  1FGO A;  3NBR A;  4RBN A;  4I4K A;  4HM1 B;  4K1U A;  1Y4K A;  3A76 A;  2C11 A;  3DY5 A;  3CCU 3;  1LNH A;  5FGO A;  3EB8 A;  3U1W A;  5JPP A;  1K8A 4;  1A2V A;  1YIT 3;  3DGO A;  3CC7 3;  1R4C A;  1YJ9 3;  1GS3 A;  3NHX A;  5D83 A;  2P05 A;  1W6Y A;  2R4I A;  5IF6 A;  1S72 3;  1CEW I;  1KC8 4;  3FG3 A;  1TFO A;  4ZM8 A;  1FGQ A;  5IG4 A;  4RZM A;  1IK3 A;  3FF2 A;  3BB9 A;  3EN8 A;  3Q90 A;  1DVD A;  4JF8 A;  2A15 A;  4LZI A;  4R80 A;  3TDG A;  5KP1 A;  5TGN A;  4STD A;  3LML A;  4N6L A;  1J2B A;  1RRL A;  3FF0 A;  2QEX 3;  1STD A;  1DYU A;  2CFG A;  1GD4 A;  3JUQ A;  3HX8 A;  3GZY B;  4KVH A;  3CCV 3;  4FMC A;  4X2H A;  1U8C B;  1QAK A;  3L0R A;  1SPU A;  3J7Y d;  3FG1 A;  3NUV A;  1TFK A;  2XSO B;  2JDI H;  1WQL B;  2STD A;  3PCR A;  8CHO A;  2LQV A;  3MPH A;  4H3U A;  3F40 A;  5IEO A;  1O7P B;  3E99 A;  2W56 A;  2OQE A;  1JKG B;  4MJD A;  3NM7 A;  4EV2 A;  1O7G B;  3PZW A;  2L4V A;  3IPT A;  4KFD A;  4XBT A;  3V92 A;  1Q40 A;  4GL6 A;  4JRF A;  1TP6 A;  3WMD A;  2W2C A;  1ULI B;  3CNX A;  3LH4 A;  1QVG 2;  3EHC A;  1SIH A;  1SQW A;  3OWY A;  3CCL 3;  1K41 A;  1AR0 A;  1W5Z A;  3EBY A;  2XFS A;  4BTX A;  3NV0 B;  2F99 A;  2CFK A;  1IV9 A;  2E2V A;  1IQ8 A;  3DGL A;  4N3V A;  1VQ6 3;  1QAL A;  3EJV A;  4HM0 B;  1A67 A;  4XBY A;  1YIJ 3;  5EEO A;  4EXR A;  1CQS A;  2F86 B;  2KRT A;  3KN4 A;  1IT7 A;  4PEJ A;  1W6C A;  3N54 B;  4N6O B;  3CNM A;  3K9M C;  5IEP A;  3PCS A;  4RNZ A;  4EBG A;  1OPY A;  3G0K A;  3MG2 A;  3LOY A;  1VZZ A;  5D81 A;  4HJL B;  3SED A;  1UI7 A;  3UJM A;  1JNQ A;  3LT8 A;  3MSO A;  2W0Q A;  1UUW B;  2BNG A;  4KZ1 A;  4MEI A;  1Q82 4;  2O9U X;  2YFL B;  4R9L A;  1JB2 A;  3OWS A;  1W01 A;  3K7C A;  3EX9 A;  3F8X A;  4LSO A;  2OOV A;  1AV4 A;  1MNL A;  1N5P A;  1U5O A;  1AVK A;  2KCD A;  4AKZ A;  1JB5 A;  1D6Z A;  1QJG A;  2XFT A;  1M1X B;  5D82 A;  3VSY A;  3KSE D;  4ORL A;  4MMX B;  1GD3 A;  2OQE C;  3JUN A;  1RJO A;  3RGR A;  3I56 3;  1WMN A;  1VQ5 3;  2RGQ A;  4AEQ A;  5ELJ A;  3FCS B;  2YFI B;  3DGN A;  3QK9 A;  1W2B 2;  3NX0 A;  2WO0 A;  2W6J H;  5EVH A;  2BHM A;  2P0X A;  2P38 A;  3JUM A;  4N6N B;  3CPO A;  1E3R A;  1US1 A;  2MC8 A;  1DMQ A;  2IA7 A;  3HIG A;  2KXG A;  1C7H A;  1E97 A;  3BLZ A;  2BO9 B;  5HGR A;  1WTH A;  2HMK B;  3X41 A;  1N9J A;  3JVC A;  3LTB A;  4HM8 B;  3ECF A;  2RSX A;  4OUQ A;  1V74 A;  4J8T A;  3FH1 A;  3LT9 A;  4WYK B;  4WFO A;  1QVF 2;  1BUQ A;  2K54 A;  4FR9 A;  1WMO A;  5IW9 A;  1IQX A;  5IG0 A;  1ASK A;  4LGQ A;  1YHQ 3;  1FGM A;  2CW9 A;  2OCT A;  3KE7 A;  2IUK A;  1W2Z A;  4X2O A;  4XM4 A;  1DVC A;  3CMA 3;  4GB5 A;  4XDW A;  3AMO A;  2GXF A;  3BNE A;  4WHA A;  5CK6 A;  2XEP A;  6STD A;  3CD6 3;  2GBW B;  3OW2 2;  2W03 A;  1OUN A;  3F14 A;  1OF5 B;  1IU7 A;  3B4O A;  3F8H A;  3M8C A;  1IVU A;  3RDE A;  1DMN A;  3GZB A;  1TUH A;  3SOY A;  3FLJ A;  2OOV C;  4BTY A;  1D6Y A;  3HII A;  4IIA A;  1ROA A;  1M9G A;  1YJW 3;  3LYG A;  1JV2 B;  4MMY B;  3CCE 3;  3F7S A;  1M90 4;  2E2T A;  4R4K A;  2IUJ A;  1OGZ A;  3V99 A;  3X3X A;  4FCM A;  3GRD A;  2D42 A;  1CYV A;  2XSH B;  3FZW A;  3D9R A;  3X3Y A;  4R9K A;  3S5C A;  5AI1 A;  1M1K 4;  1JN5 B;  2OWP A;  3EBT A;  3G71 3;  3WA3 A;  2CWV A;  2HMM B;  1L5G B;  1JRQ A;  1T5Y A;  3O8Y A;  2BMR B;  2SBL A;  2PNC A;  3CXC 2;  3BND A;  1VQ7 3;  3SOA A;  1YI2 3;  1GY6 A;  3Q2P A;  4IPB A;  4EC6 A;  2CFD A;  1WMP A;  5JPU A;  1EG9 B;  3N8B A;  1K28 A;  1OHP A;  2BT3 A;  3FSD A;  1SII A;  3OV4 A;  4OK0 A;  3U97 A;  1ULJ B;  1FUW A;  3CC2 3;  1DMM A;  5BXQ A;  3DGM A;  5AEU B;  5IG3 A;  4KFE A;  4LEH A;  1IQY A;  1RN7 A;  1ZX2 A;  3MYT A;  3KSP A;  3OX9 A;  4L8P A;  2QGU A;  1A90 A;  4J9A A;  3FKA A;  1GY7 A;  2YX9 A;  3NBJ A;  2W9Q A;  1F8N A;  3ALA A;  3BNC A;  5CLK A;  5AYR B;  3K63 A;  4HM2 B;  3CCS 3;  2FNQ A;  1E3V A;  2GEY A;  3V98 A;  3X3Z A;  3G16 A;  2JQ5 A;  3N9H A;  4LMI A;  3I55 3;  2D1W A;  2WGO A;  4EV5 A;  2RFR A;  3ER7 A;  2O3O A;  3H51 A;  2ML5 A;  2CG1 A;  1NB5 I;  1D6U A;  2Y74 A;  1VQO 3;  1JJ2 2;  4NRE A;  4FMD A;  3RGA A;  1TU5 A;  5AIH A;  1N5H A;  3SLU A;  2I9W A;  1LVN A;  3I0Y A;  4Q53 A;  2BMQ B;  4CCV A;  2W56 B;  3T8N A;  4HM7 B;  1HKX A;  1UW1 A;  1K9M 4;  1STF I;  5ELU A;  1FGT A;  3HK4 A;  1K73 4;  1Q40 B;  4N6M A;  1FGR A;  4HM3 B;  5IEN A;  1EKM A;  3JUO A;  3UL5 A;  3MG1 A;  3GWR A;  4FCJ A;  2E2U A;  2XH9 A;  1VQ9 3;  1EA2 A;  1KWI A;  1IDP A;  2P09 A;  1IVW A;  3PS8 A;  2GEX A;  2FGT A;  2CWU A;  3UB1 A;  2F98 A;  2LYX A;  1KSI A;  3NXJ A;  2K0M A;  4HZ9 B;  3MWZ A;  3G6E 3;  1EQK A;  4FMB A;  3IJE B;  1JKG A;  3CCQ 3;  3CME 3;  2OTJ 3;  2Q07 A;  2BMO B;  3LZA A;  2GU1 A;  1ISK A;  3HZP A;  2XRX B;  3GZR A;  3CCJ 3;  3EN1 B;  2HMO B;  5CF2 A;  1MOL A;  3SX1 A;  4AKY A;  2CHC A;  3UNL A;  4N6V 0;  1ROV A;  5CF1 A;  1KD1 4;  4OVM A;  3NV0 A;  3LTC A;  5A0O B;  2OTL 3;  3B8L A;  1WNH A;  5FW5 A;  3CPW 2;  3MG3 A;  1HU9 A;  1OH0 A;  7STD A;  3NM2 A;  2WGQ A;  3BNB A;  3LXU X;  2CKF B;  1Z1S A;  1GY5 A;  5AIF A;  2Z6B A;  4NHF A;  4N6U A;  1W02 A;  3EC9 A;  3VF1 A;  5KP4 A;  1VQM 3;  4L8O A;  1VQL 3;  1N8R 4;  5AII A;  1S5A A;  2V1L A;  3H3H A;  4O02 B;  1W7C A;  1SJW A;  4KFF A;  4G1M B;  3OWU A;  1YVB I;  3ROB A;  3SXX A;  3NQY A;  1NDO B;  2M7O A;  5LC7 A;  2PZV A;  1AVL A;  4QWT A;  2INX A;  3UL6 A;  1QAF A;  2W9P A;  5AIG A;  5IER A;  1VQ8 3;  3OXA A;  1Q42 A;  4K90 B;  5KP3 A;  4HBR A;  3S67 A;  2QIY A;  3STD A;  4U13 A;  1VQP 3;  3B7C A;  3DZL A;  4O3V A;  1KQS 2;  5LC6 A;  1LXE A;  3F7X A;  3D3L A;  3CC4 3;  1QMA A;  2W04 A;  1Q81 4;  3PXM A;  4BTW A;  3KII A;  2YFJ B;  1IVV A;  3FG4 A;  4HM4 B;  1Q86 4;  2CFL A;  1RKY A;  2B24 B;  2CWT A;  2MF7 A;  3JUP A;  1UUV B;  5CXO A;  1JB4 A;  1VQN 3;  5AYS C;  1IV7 A;  5AEW B;  3WOD G;  1O7N B;  3DUK A;  3Q1C A;  5DRE A;  1CYU A;  3IMA B;  4K1V A;  3DMC A;  1PU4 A;  2B1X B;  2ZL8 A;  1LOX A;  1NWW A;  3WDG B;  3KKG A;  1IVX A;  4XB5 A;  3AMO B;  2GU3 A;  1N8Q A;  2Z76 A;  4O2H A;  2CIU A;  2Z77 A;  2HMJ B;  2WOH A;  4O8S A;  5STD A;  1W4N A;  3PGB A;  5EQL A;  2IMJ A;  4HM6 B;  3G8Z A;  4L7K A;  3K0Z A;  2C10 A;  4EYC A;  3CCM 3;  3QRD A;  3VGN A;  1W6G A;  1N9E A;  4WP5 A;  4K61 A;  1OAC A;  4WYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...