2GBXB

Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
170
structure length
170
Chain Sequence
QIPVTPDVHYDIEAHYRAEVRMFQTGQYREWLQGMVAEDIHYWMPIYEQRLTRDRRPDPTPDDAAIYNDDFGELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAGNGELDVLSNILVYRNRRQTEVTVHTLGREDKLRRDGNGFKVFRRKLILDARVTQDKNLYFFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
molecule keywords Biphenyl 2,3-Dioxygenase Alpha Subunit
total genus 42
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gbxB00
4HM7B 4U13A 2GBWB 4HVNA 2PZVA 2RGQA 1AR0A 4HZBB 5IG3A 4HM0B 3GZXB 1OGZA 4STDA 1QJGA 1STDA 5HGRA 3SOYA 4CDLA 5D82A 1UUVB 3HX8A 3FZWA 3LYGA 1TUHA 3UJMA 2R4IA 2GEXA 3F7SA 3F9SA 3I0YA 3SEDA 3STDA 5IEPA 1O7GB 1JN5A 2BMOB 3K0ZA 3OWYA 3MYTA 1O7PB 2HMJB 3KE7A 1DMQA 3G8ZA 3VGNA 2CHCA 1K41A 3EC9A 3EX9A 1OHSA 3B7CA 3MG2A 1HKXA 4J9AA 4X2OA 4XDVA 2F98A 4HKVB 3SOAA 3FH1A 1OGXA 1EG9B 4H3UA 3OWUA 1IDPA 5DRVA 3EN1B 3F14A 3NXJA 4XDWA 1JKGB 4WYKB 1EA2A 2OWPA 3GRDA 3VSYA 4XB5A 3BB9A 1TP6A 3CNMA 4OVMA 1W6YA 4FCMA 1VZZA 2F99A 3FF2A 5KP3A 2UX0A 1ULIB 2QGUA 3MKIA 4L7KA 1UUWB 4LMIA 4R9KA 1OCVA 1C7HA 1JB5A 3CPOA 3FSDA 3KSPA 3S5CA 1GYBA 1O7HB 3MG3A 3A76A 2B1XB 4XBTA 3F40A 3G16A 3KKGA 3F8XA 3EF8A 3HK4A 1W00A 5CXOA 1ZO2A 3NUVA 3Q90A 5CF2A 1W02A 3B8LA 4K1UA 5IERA 3RGAA 3UNLA 1OHOA 1A2KA 3OV4A 4R1KA 3T8UA 1GY5A 3B4PA 5IENA 5IG5A 3F8HA 1ISKA 1DMNA 1E3RA 1E97A 3JUMA 4R9LA 4HM1B 5D83A 5G2GA 5TGNA 3OWSA 2RFRA 1NWWA 5AIHA 3MHEA 2F86B 3DZLA 5D81A 3HZPA 7STDA 1ASKA 1BUQA 2GEYA 3NV0A 1OF5B 4OUQA 2K54A 4IIAA 2W2CA 3T8NA 1NU3A 3FF0A 2XR8B 3BLZA 5CLKA 5AIFA 1OUNA 1QMAA 1OF5A 2HMKB 3EJVA 3F7XA 4LGQA 5AEWB 3ROBA 1S5AA 2B24B 5JPPA 3CNXA 1Q40A 4XBYA 2HMLB 5IG0A 2INXA 3GZBA 3G0KA 4WYKA 3M8CA 1OH0A 5KP1A 2XSOB 4HJLB 3NM2A 4FCJA 2JQ5A 4Q53A 5FW5A 5BVBA 2Z77A 3EBTA 1CQSA 5CF1A 2HMOB 1W01A 1Q42A 4HM5B 5IG4A 3MG1A 1Q40B 3OXAA 4X2HA 1E3VA 6STDA 1DMMA 8CHOA 2STDA 4HM3B 5AI1A 5JPUA 4KVHA 4HZ9B 1JB2A 3FLJA 3NHXA 3NV0B 3IPTA 3FGYA 3JUNA 3DMCA 4WWUC 2IMJA 2I9WA 1O7MB 3EBYA 5STDA 4I4KA 1NDOB 5AIGA 5KP4A 2XRXB 5IF6A 4HM4B 3H51A 2GBXB 3GZYB 5BXQA 4HM6B 4J8TA 4XM4A 2HMNB 3EQQB 2HMMB 3JUPA 3CU3A 3GWRA 3K7CA 2Z7AA 3DM8A 5IEOA 1ZX2A 2CKFB 3E99A 2QIYA 2A15A 3ER7A 3GZRA 4HM2B 5CK6A 1GY7A 3JUOA 3EN8A 3LZAA 5DREA 5AIIA 2YFIB 1JN5B 3RGRA 2GXFA 1O7WB 2XSHB 3JUQA 1GS3A 3OX9A 3ECFA 3EHCA 4L8OA 4LEHA 2BMRB 1U5OA 4N3VA 2RCDA 4WP5A 2YFJB 3KZTA 4XBXA 4MJDA 1SJWA 5EVHA 5AEUB 1JB4A 1OHPA 3B4OA 3D9RA 2YFLB 4GB5A 1OPYA 2Z76A 3FKAA 3H3HA 4RZMA 3WMDA 1O7NB 1Z1SA 1GY6A 4L8PA 4ORLA 3MSOA 1ULJB 2BNGA 3DUKA 3NBRA 4K1VA 1WQLB 3DXOA 2BMQB 4HM8B 1JKGA 4PEJA
chains in the Genus database with same CATH superfamily
4HM7B 2GBWB 4HVNA 1AR0A 2SARA 4HZBB 3GZXB 1ZS7A 1V58A 2BT3A 1YVSA 3HX8A 1QALA 3FZWA 3HIGA 3K9MC 4HOHA 3UJMA 1BUJA 4BTWA 3DGOA 3G6E3 2FXTA 3LTCA 1I3IA 3F7SA 3I0YA 3SLUA 4AKYA 1FUSA 1O7GB 3K0ZA 3MYTA 1B2MA 1WMNA 1SIIA 1FGRA 1STFI 3VGNA 1YGEA 3AHWA 3MG2A 3B7CA 2K0MA 4X2OA 1AQZA 3OWUA 5BU4A 1VQL3 3A5EA 3NXJA 3D3LA 1BRNL 1BANA 1U8CB 1W2ZA 3VSYA 3DY5A 3S29A 3ZG0A 1WMOA 1X1UA 2CK3H 2W04A 4OVMA 4RBNA 2KAAA 3FF2A 4LZIA 1N8QA 1ULIB 4ILFA 5IG5A 1B2UA 1JB5A 3D5IA 1MOLA 3S27A 4NHFA 5IW9A 1M1K4 4XBTA 3G16A 3F8XA 3HK4A 3G4S3 3LMLA 3Q90A 2BO9B 4OK0A 5CF2A 3B8LA 5IERA 1I2GA 3DGLA 1OHOA 4TX4A 3OV4A 1JZOA 3CCR3 1ISKA 1BNRA 4FCZA 5D83A 4R4KA 4EBGA 1TFOA 4O2HA 5G2GA 3CCE3 1SQWA 3OWSA 4K90B 1NWWA 1YI23 1M904 2F86B 3DZLA 3WOEB 1BUQA 2GEYA 3V98A 5LC7A 4BIRA 4OUQA 3SVAA 5A0OB 1BNJA 3FF0A 1KWIA 2J8XB 5CLKA 1FGTA 5AIFA 1OUNA 2QA43 1NB3I 1WNHA 4LGQA 1FA3A 1RGCA 3PGBA 2MC8A 4EV5A 1LOVA 3CNXA 4GSPA 1LQGC 2P09A 5IG0A 4WYKA 3LT9A 1LVNA 2FNQA 2MF7A 2WOHA 4Q53A 4N6TA 3FG4A 1WTHA 3CCU3 2CC3A 5BVBA 2BHMA 2HMOB 5G1LA 1RMSA 4X2HA 1JNQA 3OXAA 6STDA 3J7Yd 2W03A 2O9UX 2STDA 5AI1A 3CXC2 1YJN3 3BNEA 4HZ9B 1MNLA 1ROVA 3NV0B 3HOHA 1BSDA 3U97A 1B3SA 3CCM3 1YNVX 3NQYA 2OCTA 3CCJ3 2XRXB 5IF6A 2CG0A 1BVIA 1QVF2 3H51A 1BSBA 3GZYB 2OTJ3 4KZ1A 2E2TA 1D6UA 2HMNB 3EQQB 4IPBA 1IVUA 1EKMA 3LTBA 4JF8A 4ZM8A 1ROAA 1GY7A 3LZAA 1B21A 2L4VA 2UUGC 3MWZA 3CPW2 2YX9A 1AV4A 2GXFA 4WFOA 1Q9EA 3GAXA 3JUQA 3ECFA 3EHCA 4XBXA 2KRTA 1U5OA 4G1MB 1Q814 1BRKA 1K9M4 1JB4A 1QVG2 3B4OA 3T0UA 4GB5A 4RNTA 4FR9A 4RZMA 4EXRA 1Z1SA 1UCKA 2KF6A 4WHAA 4CPKA 1I8VA 1X1WA 2Q07A 4K1VA 3WR2A 1W6GA 1WQLB 3DXOA 1RGHA 3EBTA 3CC73 4NPBA 1G0TA 3WA3A 3SYUA 1CEWI 3PYJA 1L5GB 1RGFA 3SOYA 1B27A 1FZUA 1NNVA 1UUVB 3NM7A 3CCQ3 1US1A 3LYGA 4MMZB 1FW7A 1VQQA 2W9PA 3PXMA 3STDA 3SEDA 4LSOA 1RSNA 2BMOB 3OWYA 1LRAA 3D4AA 1I0VA 2XH9A 3KE7A 4BL2A 3G8ZA 3CCV3 1K41A 5CF1A 2OOVC 8CHOA 1VQN3 3LH4A 1BNEA 3SOAA 4HKVB 4JRFA 1OGXA 4HBRA 1RRLA 1IDPA 2C10A 3NBJA 2ZL8A 3SX1A 4LYLB 4WYKB 1EA2A 1JBSA 1Q864 1RGKA 3VF1A 1TP6A 2WO0A 3NX0A 1UCIA 1GMPA 1W6YA 4FCMA 4J5KA 1NO3A 1IV7A 2UX0A 4L7KA 1G96A 1VQ53 3AGNA 3FG1A 3KSPA 3S5CA 4EYCA 2W56B 6GSPA 3F40A 2PNCA 3KN4A 2XFTA 1UI7A 4N6UA 1RN4A 2ML5A 1M1XB 1A67A 4R1KA 1LOYA 2KXGA 3FG3A 3T8UA 1IYYA 1KSIA 4FMDA 2W9QA 5ELJA 1IQYA 4BU4A 1OF5B 2CWVA 2P38A 5FGOA 3BLZA 1RCKA 4FMAA 3EJVA 4N6NB 3ROBA 2RSXA 3UL5A 1EQKA 1MWTA 4QWTA 1GMRA 2HMLB 4KFFA 1PU4A 3QK9A 1IK3A 3EB8A 1MGWA 1OH0A 3ZG5A 3AGOA 2XSOB 5KP1A 4HJLB 5ELUA 3NM2A 1HU9A 1A2VA 2H0GA 5FW5A 1Y4KA 1W4NA 3N9HA 1IT8A 1S723 1W01A 1NJI4 1Q42A 1OACA 4HM5B 3X3YA 1JJ22 1Q7HA 1E3VA 1DMMA 2W6JH 5JPUA 3FLJA 3NHXA 1PYLA 4CCVA 3X3XA 4I5QA 5RNTA 1IT7A 3FGYA 3DMCA 2IMJA 1F8NA 4RNZA 3DGYA 2HOHA 5STDA 1NDOB 4KFEA 1BGSA 1TRPA 1RNBA 1VQ43 1UGHI 4HM4B 2ZDJA 1BRIA 1ZGXA 4DKIA 1VQP3 4J8TA 2R41A 1YIJ3 3AHSA 3N54B 2F4YA 3CU3A 3DM8A 4HM2B 2D42A 5IEOA 5CK6A 3JUOA 1GOVA 2YFIB 3RDEA 3WHOA 3X41A 1JN5B 3KIIA 1BNIA 1EEJA 1R4CA 2ZHXB 1IV9A 1RN7A 4K61A 4L8OA 4LEHA 4N3VA 4WP5A 1T5YA 2YFJB 3KZTA 2ML6A 1SJWA 2KCDA 2WGOA 2QEX3 3BU4A 2IA7A 1FYSA 2Z76A 2KF3A 3FKAA 3H3HA 1JBRA 4L8PA 4MEIA 2IUJA 1SARA 3PCRA 4CJNA 3HI7A 2CW9A 2BIRA 4HM8B 4PEJA 2BU4A 3L0RA 4U13A 3I553 1W5ZA 2CFDA 4HM0B 5EQLA 3QRDA 3S28A 1OGZA 1FUWA 1STDA 4N6V0 5HGRA 3Q3FA 4N6MA 5D82A 1Q824 1GSPA 4O8SA 1BRHA 2R4IA 5JBSA 4EV2A 3F9SA 3AMOB 1JN5A 2E2VA 1J2BA 2XGNA 5AYSC 1YJW3 3LXUX 1DMQA 1B20A 2CHCA 3EC9A 1OHSA 1RLSA 4XDVA 1HKXA 2OQEA 1LXEA 3FH1A 1LOWA 1EG9B 3UB1A 1YVBI 5DRVA 1IU7A 1BIRA 3EN1B 3F14A 4XDWA 2K3DA 1IVWA 1JKGB 5GSPA 4O02B 3TDGA 3MPHA 2OWPA 1R4YA 1BSCA 1EUIC 1BU4A 4XB5A 9RNTA 3ALAA 3BB9A 1VQO3 2O3OA 2P0MA 3AMOA 1VQM3 1IQXA 1VZZA 2F99A 2L1SA 1KD14 1UI8A 2QGUA 1T2IA 3MKIA 1RCLA 1UUWB 3DGMA 1CH0A 3CPOA 4LMIA 4R9KA 2H0HA 1B2XA 4KFDA 1GYBA 1O7HB 1GOYA 1RN1A 3A76A 1HZ1A 1W2B2 1D6ZA 1W00A 1ZO2A 2UGIA 1IVXA 1JRQA 4H61A 2KF4A 1I3FA 5IENA 3B4PA 2CG1A 1PY3A 3X40A 1C54A 1E97A 1E3RA 4EC6A 3CC23 2LQVA 1JV2B 4HM1B 3V92A 2D1WA 2SBLA 5AIHA 7STDA 2CFKA 1W6CA 3HZPA 1N9JA 3CME3 2E2UA 3WOFB 1IVVA 5AYRB 3EE1A 1BNGA 2K54A 4IIAA 1UDII 2F5MA 1NU3A 3NBBA 3G713 1QMAA 1RRHA 1OF5A 2HMKB 4FMCA 5AEWB 1S5AA 2B24B 1Q40A 4XBYA 2M7OA 1A2PA 2INXA 2AADA 3SXXA 3ZFZA 2IY2A 2LYXA 1X1XA 3M8CA 4AKZA 3LTDA 3NQZA 4FCJA 2JQ5A 1K8A4 1UW1A 1BRSA 1CQSA 1GD3A 5IG4A 1Q7Y4 1Q40B 1D6YA 1DYUA 3CCL3 1VQ73 1DVDA 3WDGB 3LTAA 4GHOA 3IPTA 3X3ZA 1BSAA 1N5PA 1RJOA 3IMAB 1BNFA 1TRQA 3JUNA 1T2HA 1W7CA 2I9WA 1WMPA 1SIHA 2XGLA 3EBYA 4WWUC 2V1LA 2RNTA 3WODG 3S67A 3O8YA 1BRJA 1UCJA 4HM6B 1VQ83 1VQ93 4XM4A 2CX0A 3GWRA 3UL6A 1FGQA 1GOUA 1GD4A 1ZX2A 1AVLA 2CKFB 3GZRA 3IJEB 5M1AA 7GSPA 2ZA4A 3EN8A 2GSPA 3FCSB 4MMXB 1LNIA 3RGRA 4O3VA 1I70A 3OX9A 1VQ63 2F56A 4BTXA 3I563 1RNTA 2BMRB 1QAKA 1M9GA 2RCDA 1A90A 1TTOA 1QAFA 2H0IA 1OHPA 3D9RA 1BAOA 3DGNA 1OPYA 3OW22 2CWTA 2KF5A 1O7NB 3BIRA 2CIUA 1GY6A 4ORLA 5G1KA 2AAEA 1YGWA 3CD63 1B2SA 3KFQC 3NBRA 7RNTA 3K63A 1JKGA 2OQEC 1RKYA 3N8BA 2PZVA 2RGQA 5IG3A 2C4BA 4STDA 4CDLA 1QJGA 3Q2PA 4FMBA 1AVKA 2Y73A 1TUHA 1DVCA 1FGOA 2GEXA 1TU5A 1YHQ3 1KC84 1V74A 4HAAA 5LC6A 5IEPA 3PZWA 2IUKA 8RNTA 1V57A 1O7PB 1I2EA 2CWUA 2HMJB 3JVCA 4N6OB 4HYZA 3EX9A 1RDSA 4J9AA 4RNYA 2F98A 4H3UA 1TIJA 1IQ8A 5M19A 1RGGA 3GRDA 1UGIA 4KT3B 1G02A 3CNMA 3HIIA 4IT7A 5KP3A 2JDIH 1BOXA 1MWUA 1T3BA 2GU1A 1OCVA 1C7HA 2XEPA 3FSDA 3KSED 5HOHA 3BNDA 1MWSA 1LQMB 2CFGA 3MG3A 2B1XB 3LT8A 1YIT3 1CYUA 3KKGA 3EF8A 5CXOA 3NUVA 1W02A 4K1UA 1MWRA 1LOXA 2F5WA 2W0QA 3V99A 3RGAA 3UNLA 6RNTA 2P05A 1A2KA 1GY5A 3F8HA 1DMNA 3JUMA 1FGMA 4R9LA 1CYVA 2P0XA 4J5GA 5TGNA 4BTYA 2RFRA 2GU3A 1MGRA 1AY7A 1RGLA 1RGAA 2IYJA 3MHEA 5D81A 1ASKA 5M18A 3NV0A 1SPUA 2FGTA 3LOYA 5BIRA 3T8NA 2W2CA 2XR8B 3K5TA 3X42A 4BL3A 1RTUA 4NREA 2OTL3 3F7XA 1DE3A 2CFWA 3D5GA 1KQS2 2RBIA 3URPA 2OOVA 5JPPA 4AEQA 4EW5A 3GZBA 2CFLA 3G0KA 4N6LA 1I2FA 1HYFA 3CCS3 3CMA3 1NB5I 1N5HA 2Z77A 3D79A 1VQK3 3PS8A 3PCSA 1RHLA 3MG1A 1YJ93 1N9EA 1BRGA 3BNBA 3DH2A 3CC43 2CH9A 4HM3B 1UCLA 2Y74A 4KVHA 5EEOA 1JB2A 3GSPA 1TFKA 4R80A 1GMQA 1BSEA 1O7MB 1DETA 4I4KA 1JBTA 5AIGA 5KP4A 2XFSA 4GL6A 2GBXB 2HMMB 3JUPA 3K7CA 5I97A 2Z7AA 3E99A 3ER7A 2QIYA 2A15A 5DREA 1BNSA 3U1WA 5AIIA 2XF3A 2C11A 2W56A 1O7WB 2XSHB 1N8R4 1GS3A 3Q1CA 2Z6BA 5BXQA 5EVHA 3WA2X 1RGEA 1I0XA 4MJDA 4MMYB 5AEUB 1K734 1JZDA 2YFLB 3WMDA 1UUGB 1K28A 1PFPA 2CX1A 1TJDA 1FUTA 1X1YA 3MSOA 2BNGA 1ULJB 3BNCA 3DUKA 3KCHA 3RNTA 1LNHA 2BMQB 1B2ZA 2WOFA 2WGQA
chains in the Genus database with same CATH topology
4HM7B 2GBWB 4HVNA 1AR0A 4HZBB 3GZXB 2BT3A 3HX8A 1QALA 3FZWA 3HIGA 3K9MC 3UJMA 4BTWA 3DGOA 3G6E3 2FXTA 3LTCA 3F7SA 3I0YA 3SLUA 4AKYA 1O7GB 3K0ZA 3MYTA 1WMNA 1SIIA 1FGRA 1STFI 3VGNA 1YGEA 3MG2A 3B7CA 2K0MA 4X2OA 3OWUA 1VQL3 3NXJA 3D3LA 1U8CB 1W2ZA 3VSYA 3DY5A 3S29A 1WMOA 2CK3H 2W04A 4OVMA 4RBNA 3FF2A 4LZIA 1N8QA 1ULIB 5IG5A 1JB5A 1MOLA 3S27A 4NHFA 5IW9A 1M1K4 4XBTA 3G16A 3F8XA 3HK4A 3G4S3 3LMLA 3Q90A 2BO9B 4OK0A 5CF2A 3B8LA 5IERA 3DGLA 1OHOA 4TX4A 3OV4A 3CCR3 1ISKA 4FCZA 5D83A 4R4KA 4EBGA 1TFOA 4O2HA 5G2GA 3CCE3 1SQWA 3OWSA 4K90B 1NWWA 1YI23 1M904 2F86B 3DZLA 3WOEB 1BUQA 2GEYA 3V98A 5LC7A 4OUQA 3SVAA 5A0OB 3FF0A 1KWIA 5CLKA 5AIFA 1FGTA 1OUNA 2QA43 1NB3I 1WNHA 4LGQA 1FA3A 3PGBA 2MC8A 4EV5A 3CNXA 2P09A 5IG0A 4WYKA 3LT9A 1LVNA 2FNQA 2MF7A 2WOHA 4Q53A 4N6TA 3FG4A 1WTHA 3CCU3 2CC3A 5BVBA 2BHMA 2HMOB 4X2HA 1JNQA 3OXAA 6STDA 3J7Yd 2W03A 2O9UX 2STDA 5AI1A 3CXC2 1YJN3 3BNEA 4HZ9B 1MNLA 1ROVA 3NV0B 3U97A 3CCM3 3NQYA 2OCTA 2XRXB 5IF6A 2CG0A 1QVF2 3H51A 2OTJ3 3GZYB 4KZ1A 2E2TA 1D6UA 2HMNB 3EQQB 4IPBA 1IVUA 1EKMA 3LTBA 4JF8A 4ZM8A 1ROAA 1GY7A 3LZAA 2L4VA 3MWZA 3CPW2 2YX9A 1AV4A 2GXFA 4WFOA 3GAXA 3JUQA 3ECFA 3EHCA 4XBXA 2KRTA 1U5OA 4G1MB 1Q814 1K9M4 1JB4A 1QVG2 3B4OA 3T0UA 4GB5A 4FR9A 4RZMA 4EXRA 1Z1SA 4WHAA 2Q07A 4K1VA 1W6GA 1WQLB 3DXOA 3EBTA 3CC73 3WA3A 1CEWI 3PYJA 1L5GB 3SOYA 1UUVB 3NM7A 3CCQ3 1US1A 3LYGA 4MMZB 2W9PA 3PXMA 3STDA 3SEDA 4LSOA 2BMOB 3OWYA 2XH9A 3KE7A 3G8ZA 3CCV3 1K41A 5CF1A 2OOVC 8CHOA 1VQN3 3LH4A 3SOAA 4HKVB 4JRFA 1OGXA 4HBRA 1RRLA 1IDPA 2C10A 3NBJA 2ZL8A 3SX1A 4WYKB 1EA2A 1Q864 3VF1A 1TP6A 2WO0A 3NX0A 1W6YA 4FCMA 1NO3A 1IV7A 2UX0A 4L7KA 1G96A 1VQ53 3FG1A 3KSPA 3S5CA 4EYCA 2W56B 3F40A 2PNCA 3KN4A 2XFTA 1UI7A 4N6UA 2ML5A 1A67A 1M1XB 4R1KA 3T8UA 2KXGA 3FG3A 1KSIA 4FMDA 2W9QA 5ELJA 1IQYA 1OF5B 2CWVA 2P38A 5FGOA 3BLZA 4FMAA 3EJVA 4N6NB 3ROBA 2RSXA 3UL5A 1EQKA 4QWTA 2HMLB 1PU4A 4KFFA 3QK9A 1IK3A 3EB8A 1OH0A 5KP1A 2XSOB 4HJLB 5ELUA 3NM2A 1HU9A 1A2VA 5FW5A 1Y4KA 1W4NA 3N9HA 1IT8A 1S723 1W01A 1NJI4 1Q42A 1OACA 4HM5B 3X3YA 1JJ22 1E3VA 1DMMA 2W6JH 5JPUA 3FLJA 3NHXA 4CCVA 3X3XA 1IT7A 3FGYA 3DMCA 2IMJA 1F8NA 4RNZA 5STDA 1NDOB 4KFEA 1VQ43 4HM4B 2ZDJA 1VQP3 4J8TA 1YIJ3 3N54B 3CU3A 3DM8A 4HM2B 2D42A 5IEOA 5CK6A 3JUOA 2YFIB 3RDEA 3X41A 1JN5B 3KIIA 1R4CA 1IV9A 1RN7A 4K61A 4L8OA 4LEHA 4N3VA 4WP5A 1T5YA 2YFJB 3KZTA 2ML6A 1SJWA 2KCDA 2WGOA 2QEX3 2IA7A 2Z76A 3FKAA 3H3HA 4L8PA 4MEIA 2IUJA 3PCRA 3HI7A 2CW9A 4HM8B 4PEJA 3L0RA 3I553 4U13A 1W5ZA 2CFDA 4HM0B 5EQLA 3QRDA 3S28A 1OGZA 1FUWA 1STDA 4N6V0 5HGRA 1Q824 4N6MA 5D82A 4O8SA 2R4IA 5JBSA 4EV2A 3F9SA 3AMOB 1JN5A 2E2VA 1J2BA 2XGNA 5AYSC 1YJW3 3LXUX 1DMQA 2CHCA 3EC9A 1OHSA 4XDVA 1HKXA 2OQEA 1LXEA 3FH1A 3UB1A 1EG9B 1YVBI 5DRVA 1IU7A 3EN1B 3F14A 4XDWA 1IVWA 1JKGB 4O02B 3TDGA 3MPHA 2OWPA 4XB5A 3ALAA 3BB9A 1VQO3 3AMOA 2O3OA 2P0MA 1VQM3 1IQXA 1VZZA 2F99A 1KD14 1UI8A 2QGUA 3MKIA 4LMIA 3DGMA 1UUWB 4R9KA 3CPOA 4KFDA 1GYBA 1O7HB 3A76A 1W2B2 1D6ZA 1W00A 1ZO2A 1IVXA 1JRQA 4H61A 5IENA 3B4PA 2CG1A 3X40A 1E3RA 1E97A 4EC6A 3CC23 2LQVA 1JV2B 4HM1B 3V92A 2D1WA 2SBLA 5AIHA 7STDA 2CFKA 1W6CA 3HZPA 1N9JA 3CME3 2E2UA 3WOFB 1IVVA 5AYRB 3EE1A 2K54A 4IIAA 1NU3A 3NBBA 3G713 1QMAA 1RRHA 1OF5A 2HMKB 4FMCA 5AEWB 1S5AA 2B24B 1Q40A 4XBYA 2M7OA 2INXA 3SXXA 2LYXA 3M8CA 4AKZA 3LTDA 3NQZA 4FCJA 2JQ5A 1K8A4 1UW1A 1CQSA 1GD3A 5IG4A 1Q7Y4 1Q40B 1D6YA 1DYUA 3CCL3 1VQ73 1DVDA 3WDGB 3LTAA 3X3ZA 3IPTA 1N5PA 1RJOA 3IMAB 3JUNA 4WWUC 3CCJ3 1W7CA 2I9WA 1WMPA 1SIHA 2XGLA 3EBYA 3WODG 2V1LA 3S67A 3O8YA 1VQ93 1VQ83 4HM6B 4XM4A 3GWRA 3UL6A 1FGQA 1GD4A 1ZX2A 1AVLA 2CKFB 3GZRA 3IJEB 3EN8A 3FCSB 4MMXB 3RGRA 4O3VA 3OX9A 1VQ63 4BTXA 3I563 2BMRB 1QAKA 1M9GA 2RCDA 1A90A 1QAFA 1OHPA 3D9RA 3DGNA 1OPYA 3OW22 2CWTA 1O7NB 1GY6A 2CIUA 4ORLA 3CD63 3KFQC 3NBRA 3K63A 1JKGA 2OQEC 1RKYA 3N8BA 2PZVA 2RGQA 5IG3A 4STDA 4CDLA 1QJGA 3Q2PA 4FMBA 1AVKA 2Y73A 1TUHA 1DVCA 1FGOA 2GEXA 1TU5A 1YHQ3 1KC84 1V74A 5LC6A 5IEPA 3PZWA 2IUKA 1O7PB 2CWUA 2HMJB 3JVCA 4N6OB 4HYZA 3EX9A 4J9AA 4RNYA 2F98A 4H3UA 1TIJA 1IQ8A 3GRDA 3CNMA 3HIIA 4IT7A 5KP3A 2JDIH 2GU1A 1OCVA 1C7HA 2XEPA 3FSDA 3KSED 3BNDA 2CFGA 3MG3A 2B1XB 3LT8A 1YIT3 1CYUA 3KKGA 3EF8A 5CXOA 3NUVA 1W02A 4K1UA 1LOXA 2W0QA 3V99A 3RGAA 3UNLA 2P05A 1A2KA 1GY5A 3F8HA 1DMNA 3JUMA 1FGMA 4R9LA 1CYVA 2P0XA 5TGNA 4BTYA 2RFRA 2GU3A 3MHEA 5D81A 1ASKA 3NV0A 1SPUA 2FGTA 3LOYA 3T8NA 2W2CA 2XR8B 3K5TA 3X42A 4NREA 2OTL3 3F7XA 2CFWA 1KQS2 5JPPA 2OOVA 4AEQA 3GZBA 2CFLA 3G0KA 4N6LA 3CCS3 3CMA3 1NB5I 1N5HA 2Z77A 1VQK3 3PS8A 3PCSA 3MG1A 1YJ93 1N9EA 3BNBA 3CC43 2CH9A 4HM3B 2Y74A 4KVHA 5EEOA 1JB2A 1TFKA 4R80A 1O7MB 4I4KA 5AIGA 5KP4A 2XFSA 4GL6A 2GBXB 2HMMB 3JUPA 3K7CA 5I97A 2Z7AA 3E99A 3ER7A 2QIYA 2A15A 5DREA 3U1WA 5AIIA 2XF3A 2C11A 2W56A 1O7WB 2XSHB 1N8R4 1GS3A 3Q1CA 2Z6BA 5BXQA 5EVHA 3WA2X 5AEUB 4MJDA 4MMYB 1K734 2YFLB 3WMDA 1K28A 1PFPA 3MSOA 1ULJB 2BNGA 3BNCA 3DUKA 1LNHA 2BMQB 2WOFA 2WGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM7 B;  4U13 A;  2GBW B;  4HVN A;  2PZV A;  2RGQ A;  1AR0 A;  4HZB B;  5IG3 A;  4HM0 B;  3GZX B;  1OGZ A;  4STD A;  1QJG A;  1STD A;  5HGR A;  3SOY A;  4CDL A;  5D82 A;  1UUV B;  3HX8 A;  3FZW A;  3LYG A;  1TUH A;  3UJM A;  2R4I A;  2GEX A;  3F7S A;  3F9S A;  3I0Y A;  3SED A;  3STD A;  5IEP A;  1O7G B;  1JN5 A;  2BMO B;  3K0Z A;  3OWY A;  3MYT A;  1O7P B;  2HMJ B;  3KE7 A;  1DMQ A;  3G8Z A;  3VGN A;  2CHC A;  1K41 A;  3EC9 A;  3EX9 A;  1OHS A;  3B7C A;  3MG2 A;  1HKX A;  4J9A A;  4X2O A;  4XDV A;  2F98 A;  4HKV B;  3SOA A;  3FH1 A;  1OGX A;  1EG9 B;  4H3U A;  3OWU A;  1IDP A;  5DRV A;  3EN1 B;  3F14 A;  3NXJ A;  4XDW A;  1JKG B;  4WYK B;  1EA2 A;  2OWP A;  3GRD A;  3VSY A;  4XB5 A;  3BB9 A;  1TP6 A;  3CNM A;  4OVM A;  1W6Y A;  4FCM A;  1VZZ A;  2F99 A;  3FF2 A;  5KP3 A;  2UX0 A;  1ULI B;  2QGU A;  3MKI A;  4L7K A;  1UUW B;  4LMI A;  4R9K A;  1OCV A;  1C7H A;  1JB5 A;  3CPO A;  3FSD A;  3KSP A;  3S5C A;  1GYB A;  1O7H B;  3MG3 A;  3A76 A;  2B1X B;  4XBT A;  3F40 A;  3G16 A;  3KKG A;  3F8X A;  3EF8 A;  3HK4 A;  1W00 A;  5CXO A;  1ZO2 A;  3NUV A;  3Q90 A;  5CF2 A;  1W02 A;  3B8L A;  4K1U A;  5IER A;  3RGA A;  3UNL A;  1OHO A;  1A2K A;  3OV4 A;  4R1K A;  3T8U A;  1GY5 A;  3B4P A;  5IEN A;  5IG5 A;  3F8H A;  1ISK A;  1DMN A;  1E3R A;  1E97 A;  3JUM A;  4R9L A;  4HM1 B;  5D83 A;  5G2G A;  5TGN A;  3OWS A;  2RFR A;  1NWW A;  5AIH A;  3MHE A;  2F86 B;  3DZL A;  5D81 A;  3HZP A;  7STD A;  1ASK A;  1BUQ A;  2GEY A;  3NV0 A;  1OF5 B;  4OUQ A;  2K54 A;  4IIA A;  2W2C A;  3T8N A;  1NU3 A;  3FF0 A;  2XR8 B;  3BLZ A;  5CLK A;  5AIF A;  1OUN A;  1QMA A;  1OF5 A;  2HMK B;  3EJV A;  3F7X A;  4LGQ A;  5AEW B;  3ROB A;  1S5A A;  2B24 B;  5JPP A;  3CNX A;  1Q40 A;  4XBY A;  2HML B;  5IG0 A;  2INX A;  3GZB A;  3G0K A;  4WYK A;  3M8C A;  1OH0 A;  5KP1 A;  2XSO B;  4HJL B;  3NM2 A;  4FCJ A;  2JQ5 A;  4Q53 A;  5FW5 A;  5BVB A;  2Z77 A;  3EBT A;  1CQS A;  5CF1 A;  2HMO B;  1W01 A;  1Q42 A;  4HM5 B;  5IG4 A;  3MG1 A;  1Q40 B;  3OXA A;  4X2H A;  1E3V A;  6STD A;  1DMM A;  8CHO A;  2STD A;  4HM3 B;  5AI1 A;  5JPU A;  4KVH A;  4HZ9 B;  1JB2 A;  3FLJ A;  3NHX A;  3NV0 B;  3IPT A;  3FGY A;  3JUN A;  3DMC A;  4WWU C;  2IMJ A;  2I9W A;  1O7M B;  3EBY A;  5STD A;  4I4K A;  1NDO B;  5AIG A;  5KP4 A;  2XRX B;  5IF6 A;  4HM4 B;  3H51 A;  2GBX B;  3GZY B;  5BXQ A;  4HM6 B;  4J8T A;  4XM4 A;  2HMN B;  3EQQ B;  2HMM B;  3JUP A;  3CU3 A;  3GWR A;  3K7C A;  2Z7A A;  3DM8 A;  5IEO A;  1ZX2 A;  2CKF B;  3E99 A;  2QIY A;  2A15 A;  3ER7 A;  3GZR A;  4HM2 B;  5CK6 A;  1GY7 A;  3JUO A;  3EN8 A;  3LZA A;  5DRE A;  5AII A;  2YFI B;  1JN5 B;  3RGR A;  2GXF A;  1O7W B;  2XSH B;  3JUQ A;  1GS3 A;  3OX9 A;  3ECF A;  3EHC A;  4L8O A;  4LEH A;  2BMR B;  1U5O A;  4N3V A;  2RCD A;  4WP5 A;  2YFJ B;  3KZT A;  4XBX A;  4MJD A;  1SJW A;  5EVH A;  5AEU B;  1JB4 A;  1OHP A;  3B4O A;  3D9R A;  2YFL B;  4GB5 A;  1OPY A;  2Z76 A;  3FKA A;  3H3H A;  4RZM A;  3WMD A;  1O7N B;  1Z1S A;  1GY6 A;  4L8P A;  4ORL A;  3MSO A;  1ULJ B;  2BNG A;  3DUK A;  3NBR A;  4K1V A;  1WQL B;  3DXO A;  2BMQ B;  4HM8 B;  1JKG A;  4PEJ A; 
#chains in the Genus database with same CATH topology
 4HM7 B;  2GBW B;  4HVN A;  1AR0 A;  2SAR A;  4HZB B;  3GZX B;  1ZS7 A;  1V58 A;  2BT3 A;  1YVS A;  3HX8 A;  1QAL A;  3FZW A;  3HIG A;  3K9M C;  4HOH A;  3UJM A;  1BUJ A;  4BTW A;  3DGO A;  3G6E 3;  2FXT A;  3LTC A;  1I3I A;  3F7S A;  3I0Y A;  3SLU A;  4AKY A;  1FUS A;  1O7G B;  3K0Z A;  3MYT A;  1B2M A;  1WMN A;  1SII A;  1FGR A;  1STF I;  3VGN A;  1YGE A;  3AHW A;  3MG2 A;  3B7C A;  2K0M A;  4X2O A;  1AQZ A;  3OWU A;  5BU4 A;  1VQL 3;  3A5E A;  3NXJ A;  3D3L A;  1BRN L;  1BAN A;  1U8C B;  1W2Z A;  3VSY A;  3DY5 A;  3S29 A;  3ZG0 A;  1WMO A;  1X1U A;  2CK3 H;  2W04 A;  4OVM A;  4RBN A;  2KAA A;  3FF2 A;  4LZI A;  1N8Q A;  1ULI B;  4ILF A;  5IG5 A;  1B2U A;  1JB5 A;  3D5I A;  1MOL A;  3S27 A;  4NHF A;  5IW9 A;  1M1K 4;  4XBT A;  3G16 A;  3F8X A;  3HK4 A;  3G4S 3;  3LML A;  3Q90 A;  2BO9 B;  4OK0 A;  5CF2 A;  3B8L A;  5IER A;  1I2G A;  3DGL A;  1OHO A;  4TX4 A;  3OV4 A;  1JZO A;  3CCR 3;  1ISK A;  1BNR A;  4FCZ A;  5D83 A;  4R4K A;  4EBG A;  1TFO A;  4O2H A;  5G2G A;  3CCE 3;  1SQW A;  3OWS A;  4K90 B;  1NWW A;  1YI2 3;  1M90 4;  2F86 B;  3DZL A;  3WOE B;  1BUQ A;  2GEY A;  3V98 A;  5LC7 A;  4BIR A;  4OUQ A;  3SVA A;  5A0O B;  1BNJ A;  3FF0 A;  1KWI A;  2J8X B;  5CLK A;  1FGT A;  5AIF A;  1OUN A;  2QA4 3;  1NB3 I;  1WNH A;  4LGQ A;  1FA3 A;  1RGC A;  3PGB A;  2MC8 A;  4EV5 A;  1LOV A;  3CNX A;  4GSP A;  1LQG C;  2P09 A;  5IG0 A;  4WYK A;  3LT9 A;  1LVN A;  2FNQ A;  2MF7 A;  2WOH A;  4Q53 A;  4N6T A;  3FG4 A;  1WTH A;  3CCU 3;  2CC3 A;  5BVB A;  2BHM A;  2HMO B;  5G1L A;  1RMS A;  4X2H A;  1JNQ A;  3OXA A;  6STD A;  3J7Y d;  2W03 A;  2O9U X;  2STD A;  5AI1 A;  3CXC 2;  1YJN 3;  3BNE A;  4HZ9 B;  1MNL A;  1ROV A;  3NV0 B;  3HOH A;  1BSD A;  3U97 A;  1B3S A;  3CCM 3;  1YNV X;  3NQY A;  2OCT A;  3CCJ 3;  2XRX B;  5IF6 A;  2CG0 A;  1BVI A;  1QVF 2;  3H51 A;  1BSB A;  3GZY B;  2OTJ 3;  4KZ1 A;  2E2T A;  1D6U A;  2HMN B;  3EQQ B;  4IPB A;  1IVU A;  1EKM A;  3LTB A;  4JF8 A;  4ZM8 A;  1ROA A;  1GY7 A;  3LZA A;  1B21 A;  2L4V A;  2UUG C;  3MWZ A;  3CPW 2;  2YX9 A;  1AV4 A;  2GXF A;  4WFO A;  1Q9E A;  3GAX A;  3JUQ A;  3ECF A;  3EHC A;  4XBX A;  2KRT A;  1U5O A;  4G1M B;  1Q81 4;  1BRK A;  1K9M 4;  1JB4 A;  1QVG 2;  3B4O A;  3T0U A;  4GB5 A;  4RNT A;  4FR9 A;  4RZM A;  4EXR A;  1Z1S A;  1UCK A;  2KF6 A;  4WHA A;  4CPK A;  1I8V A;  1X1W A;  2Q07 A;  4K1V A;  3WR2 A;  1W6G A;  1WQL B;  3DXO A;  1RGH A;  3EBT A;  3CC7 3;  4NPB A;  1G0T A;  3WA3 A;  3SYU A;  1CEW I;  3PYJ A;  1L5G B;  1RGF A;  3SOY A;  1B27 A;  1FZU A;  1NNV A;  1UUV B;  3NM7 A;  3CCQ 3;  1US1 A;  3LYG A;  4MMZ B;  1FW7 A;  1VQQ A;  2W9P A;  3PXM A;  3STD A;  3SED A;  4LSO A;  1RSN A;  2BMO B;  3OWY A;  1LRA A;  3D4A A;  1I0V A;  2XH9 A;  3KE7 A;  4BL2 A;  3G8Z A;  3CCV 3;  1K41 A;  5CF1 A;  2OOV C;  8CHO A;  1VQN 3;  3LH4 A;  1BNE A;  3SOA A;  4HKV B;  4JRF A;  1OGX A;  4HBR A;  1RRL A;  1IDP A;  2C10 A;  3NBJ A;  2ZL8 A;  3SX1 A;  4LYL B;  4WYK B;  1EA2 A;  1JBS A;  1Q86 4;  1RGK A;  3VF1 A;  1TP6 A;  2WO0 A;  3NX0 A;  1UCI A;  1GMP A;  1W6Y A;  4FCM A;  4J5K A;  1NO3 A;  1IV7 A;  2UX0 A;  4L7K A;  1G96 A;  1VQ5 3;  3AGN A;  3FG1 A;  3KSP A;  3S5C A;  4EYC A;  2W56 B;  6GSP A;  3F40 A;  2PNC A;  3KN4 A;  2XFT A;  1UI7 A;  4N6U A;  1RN4 A;  2ML5 A;  1M1X B;  1A67 A;  4R1K A;  1LOY A;  2KXG A;  3FG3 A;  3T8U A;  1IYY A;  1KSI A;  4FMD A;  2W9Q A;  5ELJ A;  1IQY A;  4BU4 A;  1OF5 B;  2CWV A;  2P38 A;  5FGO A;  3BLZ A;  1RCK A;  4FMA A;  3EJV A;  4N6N B;  3ROB A;  2RSX A;  3UL5 A;  1EQK A;  1MWT A;  4QWT A;  1GMR A;  2HML B;  4KFF A;  1PU4 A;  3QK9 A;  1IK3 A;  3EB8 A;  1MGW A;  1OH0 A;  3ZG5 A;  3AGO A;  2XSO B;  5KP1 A;  4HJL B;  5ELU A;  3NM2 A;  1HU9 A;  1A2V A;  2H0G A;  5FW5 A;  1Y4K A;  1W4N A;  3N9H A;  1IT8 A;  1S72 3;  1W01 A;  1NJI 4;  1Q42 A;  1OAC A;  4HM5 B;  3X3Y A;  1JJ2 2;  1Q7H A;  1E3V A;  1DMM A;  2W6J H;  5JPU A;  3FLJ A;  3NHX A;  1PYL A;  4CCV A;  3X3X A;  4I5Q A;  5RNT A;  1IT7 A;  3FGY A;  3DMC A;  2IMJ A;  1F8N A;  4RNZ A;  3DGY A;  2HOH A;  5STD A;  1NDO B;  4KFE A;  1BGS A;  1TRP A;  1RNB A;  1VQ4 3;  1UGH I;  4HM4 B;  2ZDJ A;  1BRI A;  1ZGX A;  4DKI A;  1VQP 3;  4J8T A;  2R41 A;  1YIJ 3;  3AHS A;  3N54 B;  2F4Y A;  3CU3 A;  3DM8 A;  4HM2 B;  2D42 A;  5IEO A;  5CK6 A;  3JUO A;  1GOV A;  2YFI B;  3RDE A;  3WHO A;  3X41 A;  1JN5 B;  3KII A;  1BNI A;  1EEJ A;  1R4C A;  2ZHX B;  1IV9 A;  1RN7 A;  4K61 A;  4L8O A;  4LEH A;  4N3V A;  4WP5 A;  1T5Y A;  2YFJ B;  3KZT A;  2ML6 A;  1SJW A;  2KCD A;  2WGO A;  2QEX 3;  3BU4 A;  2IA7 A;  1FYS A;  2Z76 A;  2KF3 A;  3FKA A;  3H3H A;  1JBR A;  4L8P A;  4MEI A;  2IUJ A;  1SAR A;  3PCR A;  4CJN A;  3HI7 A;  2CW9 A;  2BIR A;  4HM8 B;  4PEJ A;  2BU4 A;  3L0R A;  4U13 A;  3I55 3;  1W5Z A;  2CFD A;  4HM0 B;  5EQL A;  3QRD A;  3S28 A;  1OGZ A;  1FUW A;  1STD A;  4N6V 0;  5HGR A;  3Q3F A;  4N6M A;  5D82 A;  1Q82 4;  1GSP A;  4O8S A;  1BRH A;  2R4I A;  5JBS A;  4EV2 A;  3F9S A;  3AMO B;  1JN5 A;  2E2V A;  1J2B A;  2XGN A;  5AYS C;  1YJW 3;  3LXU X;  1DMQ A;  1B20 A;  2CHC A;  3EC9 A;  1OHS A;  1RLS A;  4XDV A;  1HKX A;  2OQE A;  1LXE A;  3FH1 A;  1LOW A;  1EG9 B;  3UB1 A;  1YVB I;  5DRV A;  1IU7 A;  1BIR A;  3EN1 B;  3F14 A;  4XDW A;  2K3D A;  1IVW A;  1JKG B;  5GSP A;  4O02 B;  3TDG A;  3MPH A;  2OWP A;  1R4Y A;  1BSC A;  1EUI C;  1BU4 A;  4XB5 A;  9RNT A;  3ALA A;  3BB9 A;  1VQO 3;  2O3O A;  2P0M A;  3AMO A;  1VQM 3;  1IQX A;  1VZZ A;  2F99 A;  2L1S A;  1KD1 4;  1UI8 A;  2QGU A;  1T2I A;  3MKI A;  1RCL A;  1UUW B;  3DGM A;  1CH0 A;  3CPO A;  4LMI A;  4R9K A;  2H0H A;  1B2X A;  4KFD A;  1GYB A;  1O7H B;  1GOY A;  1RN1 A;  3A76 A;  1HZ1 A;  1W2B 2;  1D6Z A;  1W00 A;  1ZO2 A;  2UGI A;  1IVX A;  1JRQ A;  4H61 A;  2KF4 A;  1I3F A;  5IEN A;  3B4P A;  2CG1 A;  1PY3 A;  3X40 A;  1C54 A;  1E97 A;  1E3R A;  4EC6 A;  3CC2 3;  2LQV A;  1JV2 B;  4HM1 B;  3V92 A;  2D1W A;  2SBL A;  5AIH A;  7STD A;  2CFK A;  1W6C A;  3HZP A;  1N9J A;  3CME 3;  2E2U A;  3WOF B;  1IVV A;  5AYR B;  3EE1 A;  1BNG A;  2K54 A;  4IIA A;  1UDI I;  2F5M A;  1NU3 A;  3NBB A;  3G71 3;  1QMA A;  1RRH A;  1OF5 A;  2HMK B;  4FMC A;  5AEW B;  1S5A A;  2B24 B;  1Q40 A;  4XBY A;  2M7O A;  1A2P A;  2INX A;  2AAD A;  3SXX A;  3ZFZ A;  2IY2 A;  2LYX A;  1X1X A;  3M8C A;  4AKZ A;  3LTD A;  3NQZ A;  4FCJ A;  2JQ5 A;  1K8A 4;  1UW1 A;  1BRS A;  1CQS A;  1GD3 A;  5IG4 A;  1Q7Y 4;  1Q40 B;  1D6Y A;  1DYU A;  3CCL 3;  1VQ7 3;  1DVD A;  3WDG B;  3LTA A;  4GHO A;  3IPT A;  3X3Z A;  1BSA A;  1N5P A;  1RJO A;  3IMA B;  1BNF A;  1TRQ A;  3JUN A;  1T2H A;  1W7C A;  2I9W A;  1WMP A;  1SIH A;  2XGL A;  3EBY A;  4WWU C;  2V1L A;  2RNT A;  3WOD G;  3S67 A;  3O8Y A;  1BRJ A;  1UCJ A;  4HM6 B;  1VQ8 3;  1VQ9 3;  4XM4 A;  2CX0 A;  3GWR A;  3UL6 A;  1FGQ A;  1GOU A;  1GD4 A;  1ZX2 A;  1AVL A;  2CKF B;  3GZR A;  3IJE B;  5M1A A;  7GSP A;  2ZA4 A;  3EN8 A;  2GSP A;  3FCS B;  4MMX B;  1LNI A;  3RGR A;  4O3V A;  1I70 A;  3OX9 A;  1VQ6 3;  2F56 A;  4BTX A;  3I56 3;  1RNT A;  2BMR B;  1QAK A;  1M9G A;  2RCD A;  1A90 A;  1TTO A;  1QAF A;  2H0I A;  1OHP A;  3D9R A;  1BAO A;  3DGN A;  1OPY A;  3OW2 2;  2CWT A;  2KF5 A;  1O7N B;  3BIR A;  2CIU A;  1GY6 A;  4ORL A;  5G1K A;  2AAE A;  1YGW A;  3CD6 3;  1B2S A;  3KFQ C;  3NBR A;  7RNT A;  3K63 A;  1JKG A;  2OQE C;  1RKY A;  3N8B A;  2PZV A;  2RGQ A;  5IG3 A;  2C4B A;  4STD A;  4CDL A;  1QJG A;  3Q2P A;  4FMB A;  1AVK A;  2Y73 A;  1TUH A;  1DVC A;  1FGO A;  2GEX A;  1TU5 A;  1YHQ 3;  1KC8 4;  1V74 A;  4HAA A;  5LC6 A;  5IEP A;  3PZW A;  2IUK A;  8RNT A;  1V57 A;  1O7P B;  1I2E A;  2CWU A;  2HMJ B;  3JVC A;  4N6O B;  4HYZ A;  3EX9 A;  1RDS A;  4J9A A;  4RNY A;  2F98 A;  4H3U A;  1TIJ A;  1IQ8 A;  5M19 A;  1RGG A;  3GRD A;  1UGI A;  4KT3 B;  1G02 A;  3CNM A;  3HII A;  4IT7 A;  5KP3 A;  2JDI H;  1BOX A;  1MWU A;  1T3B A;  2GU1 A;  1OCV A;  1C7H A;  2XEP A;  3FSD A;  3KSE D;  5HOH A;  3BND A;  1MWS A;  1LQM B;  2CFG A;  3MG3 A;  2B1X B;  3LT8 A;  1YIT 3;  1CYU A;  3KKG A;  3EF8 A;  5CXO A;  3NUV A;  1W02 A;  4K1U A;  1MWR A;  1LOX A;  2F5W A;  2W0Q A;  3V99 A;  3RGA A;  3UNL A;  6RNT A;  2P05 A;  1A2K A;  1GY5 A;  3F8H A;  1DMN A;  3JUM A;  1FGM A;  4R9L A;  1CYV A;  2P0X A;  4J5G A;  5TGN A;  4BTY A;  2RFR A;  2GU3 A;  1MGR A;  1AY7 A;  1RGL A;  1RGA A;  2IYJ A;  3MHE A;  5D81 A;  1ASK A;  5M18 A;  3NV0 A;  1SPU A;  2FGT A;  3LOY A;  5BIR A;  3T8N A;  2W2C A;  2XR8 B;  3K5T A;  3X42 A;  4BL3 A;  1RTU A;  4NRE A;  2OTL 3;  3F7X A;  1DE3 A;  2CFW A;  3D5G A;  1KQS 2;  2RBI A;  3URP A;  2OOV A;  5JPP A;  4AEQ A;  4EW5 A;  3GZB A;  2CFL A;  3G0K A;  4N6L A;  1I2F A;  1HYF A;  3CCS 3;  3CMA 3;  1NB5 I;  1N5H A;  2Z77 A;  3D79 A;  1VQK 3;  3PS8 A;  3PCS A;  1RHL A;  3MG1 A;  1YJ9 3;  1N9E A;  1BRG A;  3BNB A;  3DH2 A;  3CC4 3;  2CH9 A;  4HM3 B;  1UCL A;  2Y74 A;  4KVH A;  5EEO A;  1JB2 A;  3GSP A;  1TFK A;  4R80 A;  1GMQ A;  1BSE A;  1O7M B;  1DET A;  4I4K A;  1JBT A;  5AIG A;  5KP4 A;  2XFS A;  4GL6 A;  2GBX B;  2HMM B;  3JUP A;  3K7C A;  5I97 A;  2Z7A A;  3E99 A;  3ER7 A;  2QIY A;  2A15 A;  5DRE A;  1BNS A;  3U1W A;  5AII A;  2XF3 A;  2C11 A;  2W56 A;  1O7W B;  2XSH B;  1N8R 4;  1GS3 A;  3Q1C A;  2Z6B A;  5BXQ A;  5EVH A;  3WA2 X;  1RGE A;  1I0X A;  4MJD A;  4MMY B;  5AEU B;  1K73 4;  1JZD A;  2YFL B;  3WMD A;  1UUG B;  1K28 A;  1PFP A;  2CX1 A;  1TJD A;  1FUT A;  1X1Y A;  3MSO A;  2BNG A;  1ULJ B;  3BNC A;  3DUK A;  3KCH A;  3RNT A;  1LNH A;  2BMQ B;  1B2Z A;  2WOF A;  2WGQ A; 
#chains in the Genus database with same CATH homology
 4HM7 B;  2GBW B;  4HVN A;  1AR0 A;  4HZB B;  3GZX B;  2BT3 A;  3HX8 A;  1QAL A;  3FZW A;  3HIG A;  3K9M C;  3UJM A;  4BTW A;  3DGO A;  3G6E 3;  2FXT A;  3LTC A;  3F7S A;  3I0Y A;  3SLU A;  4AKY A;  1O7G B;  3K0Z A;  3MYT A;  1WMN A;  1SII A;  1FGR A;  1STF I;  3VGN A;  1YGE A;  3MG2 A;  3B7C A;  2K0M A;  4X2O A;  3OWU A;  1VQL 3;  3NXJ A;  3D3L A;  1U8C B;  1W2Z A;  3VSY A;  3DY5 A;  3S29 A;  1WMO A;  2CK3 H;  2W04 A;  4OVM A;  4RBN A;  3FF2 A;  4LZI A;  1N8Q A;  1ULI B;  5IG5 A;  1JB5 A;  1MOL A;  3S27 A;  4NHF A;  5IW9 A;  1M1K 4;  4XBT A;  3G16 A;  3F8X A;  3HK4 A;  3G4S 3;  3LML A;  3Q90 A;  2BO9 B;  4OK0 A;  5CF2 A;  3B8L A;  5IER A;  3DGL A;  1OHO A;  4TX4 A;  3OV4 A;  3CCR 3;  1ISK A;  4FCZ A;  5D83 A;  4R4K A;  4EBG A;  1TFO A;  4O2H A;  5G2G A;  3CCE 3;  1SQW A;  3OWS A;  4K90 B;  1NWW A;  1YI2 3;  1M90 4;  2F86 B;  3DZL A;  3WOE B;  1BUQ A;  2GEY A;  3V98 A;  5LC7 A;  4OUQ A;  3SVA A;  5A0O B;  3FF0 A;  1KWI A;  5CLK A;  5AIF A;  1FGT A;  1OUN A;  2QA4 3;  1NB3 I;  1WNH A;  4LGQ A;  1FA3 A;  3PGB A;  2MC8 A;  4EV5 A;  3CNX A;  2P09 A;  5IG0 A;  4WYK A;  3LT9 A;  1LVN A;  2FNQ A;  2MF7 A;  2WOH A;  4Q53 A;  4N6T A;  3FG4 A;  1WTH A;  3CCU 3;  2CC3 A;  5BVB A;  2BHM A;  2HMO B;  4X2H A;  1JNQ A;  3OXA A;  6STD A;  3J7Y d;  2W03 A;  2O9U X;  2STD A;  5AI1 A;  3CXC 2;  1YJN 3;  3BNE A;  4HZ9 B;  1MNL A;  1ROV A;  3NV0 B;  3U97 A;  3CCM 3;  3NQY A;  2OCT A;  2XRX B;  5IF6 A;  2CG0 A;  1QVF 2;  3H51 A;  2OTJ 3;  3GZY B;  4KZ1 A;  2E2T A;  1D6U A;  2HMN B;  3EQQ B;  4IPB A;  1IVU A;  1EKM A;  3LTB A;  4JF8 A;  4ZM8 A;  1ROA A;  1GY7 A;  3LZA A;  2L4V A;  3MWZ A;  3CPW 2;  2YX9 A;  1AV4 A;  2GXF A;  4WFO A;  3GAX A;  3JUQ A;  3ECF A;  3EHC A;  4XBX A;  2KRT A;  1U5O A;  4G1M B;  1Q81 4;  1K9M 4;  1JB4 A;  1QVG 2;  3B4O A;  3T0U A;  4GB5 A;  4FR9 A;  4RZM A;  4EXR A;  1Z1S A;  4WHA A;  2Q07 A;  4K1V A;  1W6G A;  1WQL B;  3DXO A;  3EBT A;  3CC7 3;  3WA3 A;  1CEW I;  3PYJ A;  1L5G B;  3SOY A;  1UUV B;  3NM7 A;  3CCQ 3;  1US1 A;  3LYG A;  4MMZ B;  2W9P A;  3PXM A;  3STD A;  3SED A;  4LSO A;  2BMO B;  3OWY A;  2XH9 A;  3KE7 A;  3G8Z A;  3CCV 3;  1K41 A;  5CF1 A;  2OOV C;  8CHO A;  1VQN 3;  3LH4 A;  3SOA A;  4HKV B;  4JRF A;  1OGX A;  4HBR A;  1RRL A;  1IDP A;  2C10 A;  3NBJ A;  2ZL8 A;  3SX1 A;  4WYK B;  1EA2 A;  1Q86 4;  3VF1 A;  1TP6 A;  2WO0 A;  3NX0 A;  1W6Y A;  4FCM A;  1NO3 A;  1IV7 A;  2UX0 A;  4L7K A;  1G96 A;  1VQ5 3;  3FG1 A;  3KSP A;  3S5C A;  4EYC A;  2W56 B;  3F40 A;  2PNC A;  3KN4 A;  2XFT A;  1UI7 A;  4N6U A;  2ML5 A;  1A67 A;  1M1X B;  4R1K A;  3T8U A;  2KXG A;  3FG3 A;  1KSI A;  4FMD A;  2W9Q A;  5ELJ A;  1IQY A;  1OF5 B;  2CWV A;  2P38 A;  5FGO A;  3BLZ A;  4FMA A;  3EJV A;  4N6N B;  3ROB A;  2RSX A;  3UL5 A;  1EQK A;  4QWT A;  2HML B;  1PU4 A;  4KFF A;  3QK9 A;  1IK3 A;  3EB8 A;  1OH0 A;  5KP1 A;  2XSO B;  4HJL B;  5ELU A;  3NM2 A;  1HU9 A;  1A2V A;  5FW5 A;  1Y4K A;  1W4N A;  3N9H A;  1IT8 A;  1S72 3;  1W01 A;  1NJI 4;  1Q42 A;  1OAC A;  4HM5 B;  3X3Y A;  1JJ2 2;  1E3V A;  1DMM A;  2W6J H;  5JPU A;  3FLJ A;  3NHX A;  4CCV A;  3X3X A;  1IT7 A;  3FGY A;  3DMC A;  2IMJ A;  1F8N A;  4RNZ A;  5STD A;  1NDO B;  4KFE A;  1VQ4 3;  4HM4 B;  2ZDJ A;  1VQP 3;  4J8T A;  1YIJ 3;  3N54 B;  3CU3 A;  3DM8 A;  4HM2 B;  2D42 A;  5IEO A;  5CK6 A;  3JUO A;  2YFI B;  3RDE A;  3X41 A;  1JN5 B;  3KII A;  1R4C A;  1IV9 A;  1RN7 A;  4K61 A;  4L8O A;  4LEH A;  4N3V A;  4WP5 A;  1T5Y A;  2YFJ B;  3KZT A;  2ML6 A;  1SJW A;  2KCD A;  2WGO A;  2QEX 3;  2IA7 A;  2Z76 A;  3FKA A;  3H3H A;  4L8P A;  4MEI A;  2IUJ A;  3PCR A;  3HI7 A;  2CW9 A;  4HM8 B;  4PEJ A;  3L0R A;  3I55 3;  4U13 A;  1W5Z A;  2CFD A;  4HM0 B;  5EQL A;  3QRD A;  3S28 A;  1OGZ A;  1FUW A;  1STD A;  4N6V 0;  5HGR A;  1Q82 4;  4N6M A;  5D82 A;  4O8S A;  2R4I A;  5JBS A;  4EV2 A;  3F9S A;  3AMO B;  1JN5 A;  2E2V A;  1J2B A;  2XGN A;  5AYS C;  1YJW 3;  3LXU X;  1DMQ A;  2CHC A;  3EC9 A;  1OHS A;  4XDV A;  1HKX A;  2OQE A;  1LXE A;  3FH1 A;  3UB1 A;  1EG9 B;  1YVB I;  5DRV A;  1IU7 A;  3EN1 B;  3F14 A;  4XDW A;  1IVW A;  1JKG B;  4O02 B;  3TDG A;  3MPH A;  2OWP A;  4XB5 A;  3ALA A;  3BB9 A;  1VQO 3;  3AMO A;  2O3O A;  2P0M A;  1VQM 3;  1IQX A;  1VZZ A;  2F99 A;  1KD1 4;  1UI8 A;  2QGU A;  3MKI A;  4LMI A;  3DGM A;  1UUW B;  4R9K A;  3CPO A;  4KFD A;  1GYB A;  1O7H B;  3A76 A;  1W2B 2;  1D6Z A;  1W00 A;  1ZO2 A;  1IVX A;  1JRQ A;  4H61 A;  5IEN A;  3B4P A;  2CG1 A;  3X40 A;  1E3R A;  1E97 A;  4EC6 A;  3CC2 3;  2LQV A;  1JV2 B;  4HM1 B;  3V92 A;  2D1W A;  2SBL A;  5AIH A;  7STD A;  2CFK A;  1W6C A;  3HZP A;  1N9J A;  3CME 3;  2E2U A;  3WOF B;  1IVV A;  5AYR B;  3EE1 A;  2K54 A;  4IIA A;  1NU3 A;  3NBB A;  3G71 3;  1QMA A;  1RRH A;  1OF5 A;  2HMK B;  4FMC A;  5AEW B;  1S5A A;  2B24 B;  1Q40 A;  4XBY A;  2M7O A;  2INX A;  3SXX A;  2LYX A;  3M8C A;  4AKZ A;  3LTD A;  3NQZ A;  4FCJ A;  2JQ5 A;  1K8A 4;  1UW1 A;  1CQS A;  1GD3 A;  5IG4 A;  1Q7Y 4;  1Q40 B;  1D6Y A;  1DYU A;  3CCL 3;  1VQ7 3;  1DVD A;  3WDG B;  3LTA A;  3X3Z A;  3IPT A;  1N5P A;  1RJO A;  3IMA B;  3JUN A;  4WWU C;  3CCJ 3;  1W7C A;  2I9W A;  1WMP A;  1SIH A;  2XGL A;  3EBY A;  3WOD G;  2V1L A;  3S67 A;  3O8Y A;  1VQ9 3;  1VQ8 3;  4HM6 B;  4XM4 A;  3GWR A;  3UL6 A;  1FGQ A;  1GD4 A;  1ZX2 A;  1AVL A;  2CKF B;  3GZR A;  3IJE B;  3EN8 A;  3FCS B;  4MMX B;  3RGR A;  4O3V A;  3OX9 A;  1VQ6 3;  4BTX A;  3I56 3;  2BMR B;  1QAK A;  1M9G A;  2RCD A;  1A90 A;  1QAF A;  1OHP A;  3D9R A;  3DGN A;  1OPY A;  3OW2 2;  2CWT A;  1O7N B;  1GY6 A;  2CIU A;  4ORL A;  3CD6 3;  3KFQ C;  3NBR A;  3K63 A;  1JKG A;  2OQE C;  1RKY A;  3N8B A;  2PZV A;  2RGQ A;  5IG3 A;  4STD A;  4CDL A;  1QJG A;  3Q2P A;  4FMB A;  1AVK A;  2Y73 A;  1TUH A;  1DVC A;  1FGO A;  2GEX A;  1TU5 A;  1YHQ 3;  1KC8 4;  1V74 A;  5LC6 A;  5IEP A;  3PZW A;  2IUK A;  1O7P B;  2CWU A;  2HMJ B;  3JVC A;  4N6O B;  4HYZ A;  3EX9 A;  4J9A A;  4RNY A;  2F98 A;  4H3U A;  1TIJ A;  1IQ8 A;  3GRD A;  3CNM A;  3HII A;  4IT7 A;  5KP3 A;  2JDI H;  2GU1 A;  1OCV A;  1C7H A;  2XEP A;  3FSD A;  3KSE D;  3BND A;  2CFG A;  3MG3 A;  2B1X B;  3LT8 A;  1YIT 3;  1CYU A;  3KKG A;  3EF8 A;  5CXO A;  3NUV A;  1W02 A;  4K1U A;  1LOX A;  2W0Q A;  3V99 A;  3RGA A;  3UNL A;  2P05 A;  1A2K A;  1GY5 A;  3F8H A;  1DMN A;  3JUM A;  1FGM A;  4R9L A;  1CYV A;  2P0X A;  5TGN A;  4BTY A;  2RFR A;  2GU3 A;  3MHE A;  5D81 A;  1ASK A;  3NV0 A;  1SPU A;  2FGT A;  3LOY A;  3T8N A;  2W2C A;  2XR8 B;  3K5T A;  3X42 A;  4NRE A;  2OTL 3;  3F7X A;  2CFW A;  1KQS 2;  5JPP A;  2OOV A;  4AEQ A;  3GZB A;  2CFL A;  3G0K A;  4N6L A;  3CCS 3;  3CMA 3;  1NB5 I;  1N5H A;  2Z77 A;  1VQK 3;  3PS8 A;  3PCS A;  3MG1 A;  1YJ9 3;  1N9E A;  3BNB A;  3CC4 3;  2CH9 A;  4HM3 B;  2Y74 A;  4KVH A;  5EEO A;  1JB2 A;  1TFK A;  4R80 A;  1O7M B;  4I4K A;  5AIG A;  5KP4 A;  2XFS A;  4GL6 A;  2GBX B;  2HMM B;  3JUP A;  3K7C A;  5I97 A;  2Z7A A;  3E99 A;  3ER7 A;  2QIY A;  2A15 A;  5DRE A;  3U1W A;  5AII A;  2XF3 A;  2C11 A;  2W56 A;  1O7W B;  2XSH B;  1N8R 4;  1GS3 A;  3Q1C A;  2Z6B A;  5BXQ A;  5EVH A;  3WA2 X;  5AEU B;  4MJD A;  4MMY B;  1K73 4;  2YFL B;  3WMD A;  1K28 A;  1PFP A;  3MSO A;  1ULJ B;  2BNG A;  3BNC A;  3DUK A;  1LNH A;  2BMQ B;  2WOF A;  2WGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...