2GBXB

Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
170
structure length
170
Chain Sequence
QIPVTPDVHYDIEAHYRAEVRMFQTGQYREWLQGMVAEDIHYWMPIYEQRLTRDRRPDPTPDDAAIYNDDFGELKQRVERLYSGQVWMEDPPSKIRYFVSNVEAFEAGNGELDVLSNILVYRNRRQTEVTVHTLGREDKLRRDGNGFKVFRRKLILDARVTQDKNLYFFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Biphenyl 2,3-Dioxygenase Alpha Subunit
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
total genus 42
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gbxB00
1DMQA 3MYTA 4HM7B 3SEDA 2JQ5A 4OUQA 1JKGB 2GEYA 1JN5B 3EJVA 5BVBA 1UUWB 1S5AA 5IG3A 4WYKA 1ULJB 2YFIB 1JB4A 3B7CA 3FGYA 3MG3A 3JUQA 1OHSA 3EN8A 1Q40A 4L7KA 4FCMA 5AIFA 4KVHA 4LEHA 5CLKA 3S5CA 3CNXA 1TP6A 1ASKA 4K1VA 3EBTA 1GS3A 3D9RA 3STDA 3T8UA 3NXJA 4HM4B 5KP4A 2HMMB 3HZPA 3K7CA 3KE7A 3K0ZA 4L8PA 3B4OA 3F9SA 3ECFA 5IG5A 3BLZA 4HM2B 3RGRA 1JKGA 1OGXA 4ORLA 1JN5A 3GZRA 3KSPA 5AI1A 1EA2A 2F86B 3G8ZA 1QMAA 5BXQA 4XM4A 3KZTA 3UJMA 1UUVB 3LZAA 3WMDA 4HM6B 2BMRB 4RZMA 4XDVA 5IEOA 2INXA 2B1XB 2GBWB 1SJWA 2Z77A 3KKGA 5AEUB 1WQLB 3NV0B 1GY6A 1O7MB 2HMOB 3FF0A 3OWSA 1OHPA 4HVNA 2HMNB 1JB5A 3E99A 1OH0A 3EC9A 3CU3A 3OX9A 2GBXB 3MG1A 1E3VA 4HZ9B 5IERA 2Z7AA 4J8TA 2UX0A 2BMQB 4J9AA 1NDOB 3EN1B 2HMLB 4I4KA 5TGNA 4CDLA 3M8CA 5FW5A 4R9KA 4HZBB 3NUVA 4HM5B 3OWYA 1E3RA 3ROBA 4FCJA 3GZXB 4GB5A 1O7PB 3EHCA 3BB9A 1O7HB 5CXOA 3GZBA 1GY5A 4XBYA 5G2GA 4HM3B 2BNGA 2OWPA 2XRXB 2HMKB 5JPPA 4R1KA 4XBXA 2CHCA 3HX8A 3FKAA 3UNLA 3ER7A 3NBRA 3EQQB 3T8NA 3FZWA 3EF8A 3RGAA 3VGNA 4PEJA 3FLJA 3MG2A 2F98A 2PZVA 2BMOB 4X2OA 5D82A 5CF2A 3OWUA 3F40A 1BUQA 3SOAA 3OV4A 4STDA 2QGUA 1CQSA 1E97A 1STDA 1Q42A 1OUNA 3EX9A 2RGQA 3JUPA 3FSDA 2K54A 1W6YA 4WYKB 3MHEA 1ISKA 1DMMA 3Q90A 6STDA 3JUNA 3MKIA 5AIHA 2XSOB 1Q40B 3F14A 2R4IA 1OPYA 1IDPA 2Z76A 1ZX2A 5IG0A 5D83A 5CF1A 2XR8B 2B24B 4HM8B 3EBYA 3H3HA 3F8XA 5AIGA 3CNMA 4H3UA 4HM1B 1NWWA 5IG4A 1OGZA 3A76A 3H51A 3VSYA 2IMJA 1AR0A 1EG9B 5JPUA 2A15A 3DM8A 2CKFB 4WWUC 1C7HA 5AEWB 3NV0A 2QIYA 5EVHA 5D81A 4XB5A 5KP3A 3G0KA 4R9LA 3B8LA 1U5OA 3CPOA 7STDA 3F8HA 2GXFA 3SOYA 3OXAA 4N3VA 4Q53A 1W01A 1W00A 2GEXA 3DUKA 1OF5B 3GZYB 3LYGA 3FF2A 1DMNA 1O7NB 3DZLA 1HKXA 3NM2A 5KP1A 4IIAA 3JUOA 1Z1SA 1OCVA 1JB2A 4OVMA 1K41A 3JUMA 1A2KA 4LGQA 3GRDA 4LMIA 1NU3A 1O7GB 5STDA 3F7XA 2RCDA 3FH1A 3MSOA 5IEPA 4K1UA 2RFRA 2HMJB 2F99A 3G16A 3DXOA 1ZO2A 3I0YA 3NHXA 4L8OA 8CHOA 4HKVB 1VZZA 4MJDA 4HJLB 2I9WA 1OHOA 2STDA 2YFLB 4XDWA 1GYBA 3GWRA 1QJGA 1ULIB 1OF5A 5DREA 4HM0B 5IF6A 1O7WB 1W02A 2W2CA 1TUHA 4XBTA 5AIIA 3F7SA 3B4PA 5HGRA 1GY7A 2XSHB 5DRVA 3IPTA 3HK4A 4U13A 4WP5A 2YFJB 4X2HA 3DMCA 5CK6A 5IENA
chains in the Genus database with same CATH superfamily
1DMQA 1PFPA 2C10A 2CFDA 3MYTA 4HM7B 4KFEA 1MGWA 1YI23 3SEDA 1QALA 4J5KA 2JQ5A 3WOEB 4OUQA 1JKGB 1RMSA 2E2UA 2GEYA 3T0UA 1JN5B 2W56B 3NQYA 3PCRA 1IT7A 3EJVA 1RGFA 3I553 1UGIA 1MWUA 3LXUX 5BVBA 2BHMA 3DGMA 3LH4A 4IPBA 1UUWB 3K5TA 1S5AA 5IG3A 1K8A4 4WYKA 1ULJB 2YFIB 1YIJ3 1JB4A 1LNHA 3G713 3B7CA 2CFWA 3FGYA 3CMA3 4EV5A 3MG3A 1MGRA 3JUQA 2CIUA 1OHSA 3EN8A 3WDGB 3X41A 3CC43 1PYLA 4MMYB 1Q814 1JZOA 1K28A 3CME3 1NJI4 3NM7A 3DY5A 3BU4A 1Q40A 4L7KA 2LQVA 2W6JH 3LTAA 3NBBA 4FCMA 3D5IA 5AIFA 2XH9A 1MWRA 3FG4A 3ZG0A 3X3YA 2SARA 4KVHA 1RHLA 2PNCA 4LEHA 1GMQA 5CLKA 3S5CA 3CNXA 1DE3A 2ZHXB 1RNBA 1TP6A 4KT3B 1VQ73 1R4CA 1ASKA 4K1VA 3EBTA 3DGOA 1BU4A 3KN4A 1GS3A 2HOHA 3D9RA 1BNJA 1LVNA 1RNTA 3SVAA 3STDA 1FGTA 4GSPA 3T8UA 3UL5A 3NXJA 4R4KA 5M19A 4HM4B 1RDSA 1ROVA 2IUKA 3LT9A 4N6UA 5KP4A 3PYJA 2HMMB 5BIRA 3HZPA 3K7CA 3LTCA 1W5ZA 4BTYA 3I563 3KE7A 2W9QA 3K0ZA 1KSIA 4L8PA 4NREA 1IVUA 3B4OA 2CH9A 3F9SA 3ECFA 2WO0A 3KCHA 4R80A 1BRGA 4GL6A 2ML6A 4N6NB 2K3DA 5IG5A 3BLZA 4HM2B 3RGRA 1JKGA 1OGXA 4ORLA 3WODG 1JN5A 2W56A 2XGNA 1BRHA 3GZRA 1VQK3 3KSPA 4O3VA 1EA2A 1F8NA 2GU3A 2F86B 5AI1A 4EC6A 3G8ZA 1LQMB 4N6MA 3Q1CA 1GOVA 3AGOA 3SX1A 4QWTA 1TIJA 2P0XA 5M18A 3GAXA 2CWVA 2IA7A 3VF1A 1QMAA 1B20A 3JVCA 1BRSA 1N5HA 1BSDA 4DKIA 1UUGB 2KRTA 5BXQA 1RGEA 4XM4A 2WGOA 3FCSB 3KZTA 1QAKA 3UJMA 1UUVB 3PXMA 2CX1A 1QVG2 1IT8A 3LZAA 1VQO3 1M1K4 3WMDA 1VQ63 2XFSA 2CW9A 4HM6B 1X1XA 3K63A 4CCVA 2BU4A 1RGGA 2BMRB 4RZMA 4XDVA 5IEOA 3X3ZA 4FMCA 2INXA 2B1XB 2GBWB 5AYSC 1Q864 1SJWA 4KFFA 2Z77A 3KKGA 5AEUB 1WQLB 2C4BA 3NV0B 3AHSA 1GY6A 4TX4A 1O7MB 4HOHA 2HMOB 2WOHA 1EUIC 1BGSA 4EXRA 3FF0A 4WHAA 4WFOA 3OWSA 3QRDA 1OHPA 1LOXA 1GOYA 4BL2A 4HVNA 4N6TA 2XFTA 3CCV3 2HMNB 2OTJ3 1T2IA 1JB5A 1YGWA 2M7OA 2GSPA 4LSOA 1LOWA 3E99A 1OH0A 1EKMA 2KF3A 3RNTA 1D6YA 1RN4A 3EC9A 1IQXA 1TJDA 3CU3A 3V99A 2CC3A 2H0GA 1FUTA 1DETA 3D3LA 1IV9A 3OX9A 2GBXB 3MG1A 1E3VA 3GSPA 5IW9A 4HZ9B 1PU4A 1NB5I 2W03A 4AKYA 1LOYA 1K734 3BNDA 3G6E3 3X40A 1FGQA 5IERA 1SIIA 4AKZA 3BNBA 3CC23 1RJOA 2Z7AA 4J8TA 2UX0A 2BMQB 4G1MB 3KSED 4J9AA 2P05A 1NDOB 3EN1B 1OACA 1Y4KA 2HMLB 4I4KA 5TGNA 4CDLA 3M8CA 3AMOB 3SXXA 2R41A 5FW5A 1I3FA 4R9KA 2OQEA 1SARA 3NBJA 1MWSA 4HZBB 3NUVA 4HM5B 3OWYA 1V57A 1B2UA 1E3RA 1HZ1A 1RGLA 1BVIA 3WHOA 3ROBA 3WA3A 1IV7A 2Y74A 4FCJA 2CFKA 3BNCA 3GZXB 1VQ83 1JV2B 3V92A 4GB5A 3S29A 3N9HA 1L5GB 3K9MC 1O7PB 3EHCA 2KAAA 3BB9A 1O7HB 5CXOA 3D79A 3X3XA 1RN7A 3GZBA 1FUSA 1GY5A 4NPBA 2FNQA 4BL3A 1N9JA 4XBYA 1T3BA 1W6CA 2Y73A 1X1WA 5G2GA 4HM3B 1BRKA 1FYSA 3BIRA 5HOHA 1YJW3 1ROAA 2E2TA 2LYXA 3HIGA 5M1AA 1MNLA 2QEX3 1GMPA 2BNGA 2OWPA 2XRXB 1WMNA 2HMKB 5JPPA 1BNGA 4R1KA 4XBXA 2CG0A 1FGOA 1M904 1IU7A 1U8CB 3CXC2 2CHCA 3HX8A 5LC6A 2AAEA 1A2VA 4J5GA 3FKAA 3UNLA 3D4AA 2CWUA 1UCIA 2BIRA 2XF3A 3ER7A 1N9EA 2OOVC 3NBRA 1VQQA 3QK9A 2KCDA 1UCLA 3EQQB 1JBSA 2OQEC 2RSXA 8RNTA 2JDIH 2P0MA 1IK3A 2IUJA 3T8NA 1FZUA 1B27A 3FZWA 1X1YA 2BO9B 3EF8A 1JNQA 3RGAA 3VGNA 1A90A 1FGMA 2F5WA 2O3OA 4PEJA 1QAFA 4BU4A 2GU1A 3FLJA 5I97A 3MG2A 1RLSA 1T5YA 2F98A 2SBLA 1RSNA 2PZVA 1D6UA 1WMPA 7RNTA 2KF5A 1BSAA 2BMOB 4X2OA 2CX0A 4MMZB 2ML5A 5D82A 4MEIA 5CF2A 4BTXA 1LXEA 4H61A 2WGQA 5ELJA 1UW1A 4FMDA 1B3SA 1YHQ3 6GSPA 3FG1A 3OWUA 4LYLB 2V1LA 1UI7A 3F40A 1TRQA 2CK3H 5RNTA 3CCJ3 1BRNL 1BUQA 3SOAA 1LRAA 3OV4A 1RRLA 2UUGC 4STDA 3CCU3 2MF7A 4NHFA 3G4S3 9RNTA 1CYUA 1KD14 3J7Yd 1CH0A 1VQM3 1RGAA 2KF6A 2QGUA 1CQSA 1NB3I 5EQLA 1DYUA 1BSCA 3DGNA 1E97A 3S27A 1SQWA 1JRQA 2FGTA 2CFLA 1MOLA 1STDA 1BSBA 1T2HA 3NQZA 2F5MA 1Q42A 1OUNA 1I0VA 2H0HA 3EX9A 4HAAA 5ELUA 1W4NA 2L1SA 2RGQA 3U97A 3JUPA 3CCR3 2W9PA 3FSDA 1FGRA 1C54A 1VQN3 1PY3A 2K54A 3LTDA 4RBNA 1W6YA 1I3IA 4WYKB 1M1XB 1VQL3 1D6ZA 3MHEA 1ISKA 1BOXA 3DH2A 5GSPA 1DMMA 3Q90A 1UGHI 1YVSA 4EV2A 6STDA 1HYFA 3JUNA 3MKIA 1G96A 5AIHA 1RCLA 2XSOB 1DVDA 1Q40B 3ZFZA 2W0QA 5BU4A 1JJ22 3RDEA 1SPUA 4FMAA 1AQZA 3F14A 2Q07A 1BNIA 2R4IA 2RNTA 1OPYA 1RCKA 1UCKA 1IDPA 4JF8A 2Z76A 3PCSA 1BANA 4RNYA 1ZX2A 5IG0A 1A67A 1IVXA 5D83A 4IT7A 2F4YA 1N8R4 1IQYA 5CF1A 2FXTA 2XR8B 2B24B 1W7CA 2MC8A 4HM8B 5G1KA 4HYZA 1RGHA 1VQ93 3EBYA 1GSPA 1WNHA 4I5QA 3H3HA 2OOVA 3F8XA 5AIGA 3CNMA 4H3UA 4HM1B 1B2MA 2W04A 1NWWA 1UDII 5IG4A 1OGZA 3A76A 3EE1A 3H51A 1JZDA 3KIIA 4LZIA 3VSYA 2OCTA 2IMJA 1AR0A 1EG9B 1KWIA 2A15A 2O9UX 3FG3A 3O8YA 3NX0A 5JPUA 1BNEA 2XGLA 1ZGXA 3DM8A 2YX9A 1CEWI 1W2ZA 4K90B 2CKFB 1B2XA 4WWUC 1C7HA 1W2B2 5G1LA 4EBGA 5AEWB 3NV0A 2QIYA 4O2HA 4EYCA 5EVHA 5D81A 1JBRA 3IMAB 3CCS3 1LOVA 3CD63 4XB5A 1R4YA 5KP3A 4BTWA 4FR9A 1NNVA 3G0KA 4R9LA 5AYRB 3B8LA 3WOFB 1U5OA 4RNTA 3HI7A 1Q7Y4 1STFI 1RKYA 1RRHA 1YIT3 3BNEA 1I70A 1BIRA 2Z6BA 3CPOA 3UB1A 1BSEA 2AADA 3UL6A 2QA43 1YJN3 1TTOA 7STDA 1VQ43 5LC7A 3F8HA 2GXFA 1ZS7A 3PS8A 3SOYA 3OXAA 4N3VA 4Q53A 5JBSA 3A5EA 1EQKA 1W01A 1W00A 1MWTA 3ALAA 2GEXA 3DUKA 4N6LA 1OF5B 3GZYB 2RBIA 3LYGA 1B21A 3FF2A 1DMNA 1O7NB 1V74A 3CPW2 3DZLA 1HKXA 1I8VA 1RN1A 1UI8A 3NM2A 5EEOA 3URPA 5KP1A 4IIAA 1AVLA 3JUOA 1Z1SA 3AHWA 4GHOA 1FUWA 1RTUA 3AMOA 1YVBI 2ZDJA 3EB8A 1A2PA 1JB2A 1OCVA 3PGBA 4OK0A 4OVMA 3WA2X 1K41A 1TFKA 3JUMA 1A2KA 1W6GA 4LGQA 3GRDA 4LMIA 2OTL3 3S28A 2WOFA 1NU3A 3PZWA 4AEQA 3CCL3 2UGIA 1O7GB 4JRFA 1BRJA 3LTBA 1VQP3 4O02B 4ILFA 4MMXB 5STDA 2CWTA 1N5PA 3F7XA 1X1UA 2RCDA 4EW5A 1TU5A 3FH1A 3CCQ3 3MSOA 1NO3A 3CC73 5IEPA 1VQ53 2E2VA 4K1UA 1BRIA 1I0XA 3LOYA 2RFRA 1K9M4 2HMJB 2F99A 2ZL8A 3AGNA 1SIHA 1B2ZA 1QVF2 1AY7A 2KF4A 1AV4A 1BUJA 1DVCA 2H0IA 1G02A 3KFQC 3G16A 1YNVX 3DXOA 3HIIA 3N54B 4FMBA 1WMOA 1ZO2A 3I0YA 3NHXA 2D42A 4L8OA 4ZM8A 8CHOA 3S67A 4HKVB 1BAOA 4KZ1A 1S723 1HU9A 3HOHA 3LMLA 1YGEA 2P38A 1JBTA 1GD4A 1CYVA 3TDGA 3ZG5A 1KC84 1VZZA 1I2FA 4MJDA 4HJLB 2I9WA 2IYJA 2P09A 1OHOA 2J8XB 3Q2PA 2STDA 2YFLB 1GOUA 1LNIA 4RNZA 4XDWA 1GYBA 3OW22 6RNTA 3WR2A 1TFOA 1Q824 1IYYA 1V58A 1J2BA 3GWRA 4KFDA 1KQS2 4K61A 1QJGA 1Q9EA 4O8SA 2KXGA 1ULIB 1OF5A 2BT3A 3D5GA 3MWZA 4HM0B 5DREA 3X42A 1LQGC 2CFGA 1RGKA 5IF6A 1G0TA 4N6OB 1IVVA 1M9GA 1O7WB 4BIRA 1W02A 3IJEB 3V98A 2W2CA 1BNRA 1AVKA 1EEJA 3SLUA 1N8QA 4HBRA 4N6V0 1TUHA 7GSPA 2D1WA 4XBTA 5AIIA 1WTHA 3N8BA 1RGCA 3LT8A 2L4VA 3B4PA 3F7SA 4FCZA 5HGRA 2K0MA 1I2GA 2XEPA 2ZA4A 1BNSA 1GY7A 2XSHB 3CCM3 5DRVA 1FA3A 4CJNA 1UCJA 3IPTA 1FW7A 3MPHA 3DGLA 3HK4A 1IQ8A 2C11A 1TRPA 4U13A 1BNFA 1IVWA 1GD3A 4WP5A 3U1WA 3CCE3 2IY2A 3L0RA 4CPKA 1B2SA 5A0OB 3SYUA 5FGOA 1Q7HA 2YFJB 4X2HA 1YJ93 3DGYA 3Q3FA 1GMRA 1US1A 3DMCA 2F56A 2CG1A 5CK6A 5IENA 1I2EA
chains in the Genus database with same CATH topology
1DMQA 1PFPA 2C10A 2CFDA 3MYTA 4HM7B 4KFEA 1YI23 3SEDA 1QALA 2JQ5A 3WOEB 4OUQA 1JKGB 2GEYA 2E2UA 3T0UA 1JN5B 2W56B 3NQYA 3PCRA 1IT7A 3EJVA 3I553 3LXUX 5BVBA 2BHMA 3DGMA 3LH4A 4IPBA 1UUWB 3K5TA 1S5AA 5IG3A 1K8A4 4WYKA 1ULJB 2YFIB 1YIJ3 1JB4A 1LNHA 3B7CA 2CFWA 3FGYA 3CMA3 4EV5A 3MG3A 3JUQA 2CIUA 1OHSA 3EN8A 3WDGB 3X41A 3CC43 1Q814 4MMYB 1K28A 3CME3 1NJI4 3NM7A 3DY5A 1Q40A 4L7KA 2LQVA 2W6JH 3LTAA 3NBBA 4FCMA 5AIFA 2XH9A 3FG4A 3X3YA 4KVHA 2PNCA 4LEHA 5CLKA 3S5CA 3CNXA 1TP6A 1VQ73 1R4CA 1ASKA 4K1VA 3EBTA 3DGOA 3KN4A 1GS3A 3D9RA 1LVNA 3SVAA 3STDA 1FGTA 3T8UA 3UL5A 3NXJA 4R4KA 4HM4B 1ROVA 4N6UA 2IUKA 3LT9A 5KP4A 3PYJA 2HMMB 3HZPA 3K7CA 3LTCA 1W5ZA 4BTYA 3I563 3KE7A 2W9QA 3K0ZA 1KSIA 4L8PA 4NREA 1IVUA 3B4OA 2CH9A 3F9SA 3ECFA 2WO0A 4R80A 4GL6A 2ML6A 4N6NB 5IG5A 3BLZA 4HM2B 3RGRA 1JKGA 1OGXA 4ORLA 3WODG 1JN5A 2W56A 2XGNA 3GZRA 1VQK3 3KSPA 4O3VA 1EA2A 1F8NA 2GU3A 2F86B 5AI1A 4EC6A 3G8ZA 4N6MA 3Q1CA 3SX1A 4QWTA 1TIJA 2P0XA 3GAXA 2CWVA 2IA7A 3VF1A 1QMAA 3JVCA 1N5HA 5BXQA 2KRTA 4XM4A 2WGOA 3FCSB 3KZTA 1QAKA 3UJMA 1UUVB 3PXMA 1QVG2 1IT8A 3LZAA 1VQO3 1M1K4 3WMDA 1VQ63 2XFSA 2CW9A 4HM6B 3K63A 4CCVA 2BMRB 4RZMA 4XDVA 5IEOA 3X3ZA 4FMCA 2INXA 2B1XB 2GBWB 5AYSC 1Q864 1SJWA 4KFFA 2Z77A 3KKGA 5AEUB 1WQLB 3NV0B 1GY6A 4TX4A 1O7MB 2HMOB 2WOHA 4EXRA 3FF0A 4WHAA 4WFOA 3OWSA 3QRDA 1OHPA 1LOXA 4HVNA 4N6TA 2XFTA 3CCV3 2HMNB 2OTJ3 1JB5A 2M7OA 4LSOA 3E99A 1OH0A 1EKMA 1D6YA 3EC9A 1IQXA 3CU3A 3V99A 2CC3A 3D3LA 1IV9A 3OX9A 2GBXB 3MG1A 1E3VA 5IW9A 4HZ9B 1PU4A 1NB5I 2W03A 4AKYA 1K734 3BNDA 3G6E3 3X40A 1FGQA 5IERA 1SIIA 4AKZA 3BNBA 3CC23 1RJOA 2Z7AA 4J8TA 2UX0A 2BMQB 4G1MB 3KSED 4J9AA 2P05A 1NDOB 3EN1B 1OACA 1Y4KA 2HMLB 4I4KA 5TGNA 4CDLA 3M8CA 3AMOB 3SXXA 5FW5A 4R9KA 2OQEA 3NBJA 4HZBB 3NUVA 4HM5B 3OWYA 1E3RA 3ROBA 3WA3A 1IV7A 2Y74A 4FCJA 2CFKA 3BNCA 3GZXB 1VQ83 1JV2B 3V92A 4GB5A 3S29A 3N9HA 1L5GB 3K9MC 1O7PB 3EHCA 3BB9A 1O7HB 5CXOA 3X3XA 1RN7A 3GZBA 1GY5A 2FNQA 1N9JA 4XBYA 1W6CA 2Y73A 5G2GA 4HM3B 1YJW3 1ROAA 2E2TA 2LYXA 3HIGA 1MNLA 2QEX3 2OWPA 2BNGA 2XRXB 1WMNA 2HMKB 5JPPA 4R1KA 4XBXA 2CG0A 1FGOA 1M904 1IU7A 1U8CB 3CXC2 2CHCA 3HX8A 5LC6A 1A2VA 3FKAA 3UNLA 2CWUA 2XF3A 3ER7A 1N9EA 2OOVC 3NBRA 3QK9A 2KCDA 3EQQB 2OQEC 2RSXA 2JDIH 2P0MA 1IK3A 2IUJA 3T8NA 3FZWA 2BO9B 3EF8A 1JNQA 3RGAA 3VGNA 1A90A 1FGMA 2O3OA 4PEJA 1QAFA 2GU1A 3FLJA 5I97A 3MG2A 1T5YA 2F98A 2SBLA 2PZVA 1D6UA 1WMPA 2BMOB 4X2OA 4MMZB 2ML5A 5D82A 4MEIA 5CF2A 4BTXA 1LXEA 4H61A 2WGQA 5ELJA 1UW1A 4FMDA 1YHQ3 3FG1A 3OWUA 2V1LA 1UI7A 3F40A 2CK3H 1BUQA 3CCJ3 3SOAA 3OV4A 1RRLA 4STDA 3CCU3 2MF7A 4NHFA 3G4S3 1CYUA 1KD14 3J7Yd 1VQM3 2QGUA 1CQSA 1NB3I 5EQLA 1DYUA 3DGNA 3S27A 1E97A 1SQWA 1JRQA 2FGTA 2CFLA 1MOLA 1STDA 3NQZA 1Q42A 1OUNA 3EX9A 5ELUA 3G713 1J2BA 1W4NA 3U97A 2RGQA 3JUPA 3CCR3 2W9PA 3FSDA 1FGRA 1VQN3 3LTDA 2K54A 4RBNA 1W6YA 4WYKB 1M1XB 1VQL3 1D6ZA 3MHEA 1ISKA 1DMMA 3Q90A 4EV2A 6STDA 3JUNA 3MKIA 1G96A 5AIHA 1DVDA 2XSOB 1Q40B 2W0QA 1JJ22 3RDEA 1SPUA 4FMAA 3F14A 2Q07A 2R4IA 1OPYA 1IDPA 4JF8A 2Z76A 3PCSA 4RNYA 1ZX2A 5IG0A 1A67A 1IVXA 5D83A 4IT7A 1N8R4 1IQYA 5CF1A 2FXTA 2XR8B 2B24B 1W7CA 2MC8A 4HM8B 4HYZA 1VQ93 3EBYA 1WNHA 3H3HA 2OOVA 3F8XA 5AIGA 3CNMA 4H3UA 4HM1B 2W04A 1NWWA 5IG4A 1OGZA 3A76A 3EE1A 3H51A 3KIIA 4LZIA 3VSYA 2OCTA 2IMJA 1AR0A 1EG9B 1KWIA 2A15A 2O9UX 3FG3A 3O8YA 3NX0A 5JPUA 2XGLA 3DM8A 2YX9A 1CEWI 1W2ZA 4K90B 2CKFB 4WWUC 1C7HA 1W2B2 4EBGA 5AEWB 3NV0A 2QIYA 4O2HA 4EYCA 5EVHA 5D81A 3IMAB 3CCS3 3CD63 4XB5A 5KP3A 4BTWA 4FR9A 3G0KA 5AYRB 4R9LA 3WOFB 3B8LA 1U5OA 3HI7A 1Q7Y4 1STFI 1RKYA 1RRHA 1YIT3 3BNEA 2Z6BA 3CPOA 3UL6A 3UB1A 2QA43 1YJN3 7STDA 1VQ43 5LC7A 3F8HA 2GXFA 3PS8A 3SOYA 3OXAA 4N3VA 4Q53A 5JBSA 1EQKA 1W01A 1W00A 3ALAA 2GEXA 3DUKA 4N6LA 1OF5B 3GZYB 3LYGA 3FF2A 1DMNA 1O7NB 1V74A 3CPW2 3DZLA 1HKXA 3NM2A 1UI8A 5EEOA 5KP1A 4IIAA 1AVLA 3JUOA 1Z1SA 1FUWA 3AMOA 1YVBI 2ZDJA 3EB8A 1OCVA 1JB2A 4OK0A 3PGBA 4OVMA 3WA2X 1K41A 1TFKA 3JUMA 1A2KA 1W6GA 4LGQA 3GRDA 4LMIA 2OTL3 3S28A 2WOFA 1NU3A 3PZWA 4AEQA 3CCL3 4JRFA 1O7GB 3LTBA 1VQP3 4O02B 4MMXB 5STDA 2CWTA 1N5PA 3F7XA 2RCDA 1TU5A 3FH1A 3CCQ3 3MSOA 1NO3A 3CC73 5IEPA 1VQ53 2E2VA 4K1UA 3LOYA 1K9M4 2RFRA 2HMJB 2F99A 2ZL8A 1SIHA 1QVF2 1AV4A 1DVCA 3KFQC 3G16A 3DXOA 3HIIA 3N54B 4FMBA 1WMOA 1ZO2A 3I0YA 3NHXA 2D42A 4L8OA 4ZM8A 8CHOA 3S67A 4HKVB 1S723 4KZ1A 1HU9A 3LMLA 1YGEA 2P38A 1GD4A 1CYVA 3TDGA 1KC84 1VZZA 4MJDA 4HJLB 2I9WA 2P09A 1OHOA 3Q2PA 2STDA 2YFLB 4XDWA 4RNZA 1GYBA 3OW22 1Q824 1TFOA 3GWRA 4KFDA 1KQS2 4K61A 1QJGA 4O8SA 2KXGA 1ULIB 1OF5A 2BT3A 3MWZA 5DREA 4HM0B 3X42A 2CFGA 5IF6A 4N6OB 1IVVA 1M9GA 1O7WB 1W02A 3IJEB 3V98A 2W2CA 1AVKA 3SLUA 1N8QA 4HBRA 4N6V0 1TUHA 2D1WA 4XBTA 5AIIA 1WTHA 3N8BA 3LT8A 2L4VA 3B4PA 3F7SA 4FCZA 5HGRA 2K0MA 2XEPA 1GY7A 2XSHB 3CCM3 5DRVA 1FA3A 3IPTA 3MPHA 3DGLA 3HK4A 1IQ8A 2C11A 4U13A 3U1WA 1IVWA 1GD3A 4WP5A 3CCE3 3L0RA 5A0OB 5FGOA 2YFJB 4X2HA 1YJ93 1US1A 3DMCA 2CG1A 5CK6A 5IENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMQ A;  3MYT A;  4HM7 B;  3SED A;  2JQ5 A;  4OUQ A;  1JKG B;  2GEY A;  1JN5 B;  3EJV A;  5BVB A;  1UUW B;  1S5A A;  5IG3 A;  4WYK A;  1ULJ B;  2YFI B;  1JB4 A;  3B7C A;  3FGY A;  3MG3 A;  3JUQ A;  1OHS A;  3EN8 A;  1Q40 A;  4L7K A;  4FCM A;  5AIF A;  4KVH A;  4LEH A;  5CLK A;  3S5C A;  3CNX A;  1TP6 A;  1ASK A;  4K1V A;  3EBT A;  1GS3 A;  3D9R A;  3STD A;  3T8U A;  3NXJ A;  4HM4 B;  5KP4 A;  2HMM B;  3HZP A;  3K7C A;  3KE7 A;  3K0Z A;  4L8P A;  3B4O A;  3F9S A;  3ECF A;  5IG5 A;  3BLZ A;  4HM2 B;  3RGR A;  1JKG A;  1OGX A;  4ORL A;  1JN5 A;  3GZR A;  3KSP A;  5AI1 A;  1EA2 A;  2F86 B;  3G8Z A;  1QMA A;  5BXQ A;  4XM4 A;  3KZT A;  3UJM A;  1UUV B;  3LZA A;  3WMD A;  4HM6 B;  2BMR B;  4RZM A;  4XDV A;  5IEO A;  2INX A;  2B1X B;  2GBW B;  1SJW A;  2Z77 A;  3KKG A;  5AEU B;  1WQL B;  3NV0 B;  1GY6 A;  1O7M B;  2HMO B;  3FF0 A;  3OWS A;  1OHP A;  4HVN A;  2HMN B;  1JB5 A;  3E99 A;  1OH0 A;  3EC9 A;  3CU3 A;  3OX9 A;  2GBX B;  3MG1 A;  1E3V A;  4HZ9 B;  5IER A;  2Z7A A;  4J8T A;  2UX0 A;  2BMQ B;  4J9A A;  1NDO B;  3EN1 B;  2HML B;  4I4K A;  5TGN A;  4CDL A;  3M8C A;  5FW5 A;  4R9K A;  4HZB B;  3NUV A;  4HM5 B;  3OWY A;  1E3R A;  3ROB A;  4FCJ A;  3GZX B;  4GB5 A;  1O7P B;  3EHC A;  3BB9 A;  1O7H B;  5CXO A;  3GZB A;  1GY5 A;  4XBY A;  5G2G A;  4HM3 B;  2BNG A;  2OWP A;  2XRX B;  2HMK B;  5JPP A;  4R1K A;  4XBX A;  2CHC A;  3HX8 A;  3FKA A;  3UNL A;  3ER7 A;  3NBR A;  3EQQ B;  3T8N A;  3FZW A;  3EF8 A;  3RGA A;  3VGN A;  4PEJ A;  3FLJ A;  3MG2 A;  2F98 A;  2PZV A;  2BMO B;  4X2O A;  5D82 A;  5CF2 A;  3OWU A;  3F40 A;  1BUQ A;  3SOA A;  3OV4 A;  4STD A;  2QGU A;  1CQS A;  1E97 A;  1STD A;  1Q42 A;  1OUN A;  3EX9 A;  2RGQ A;  3JUP A;  3FSD A;  2K54 A;  1W6Y A;  4WYK B;  3MHE A;  1ISK A;  1DMM A;  3Q90 A;  6STD A;  3JUN A;  3MKI A;  5AIH A;  2XSO B;  1Q40 B;  3F14 A;  2R4I A;  1OPY A;  1IDP A;  2Z76 A;  1ZX2 A;  5IG0 A;  5D83 A;  5CF1 A;  2XR8 B;  2B24 B;  4HM8 B;  3EBY A;  3H3H A;  3F8X A;  5AIG A;  3CNM A;  4H3U A;  4HM1 B;  1NWW A;  5IG4 A;  1OGZ A;  3A76 A;  3H51 A;  3VSY A;  2IMJ A;  1AR0 A;  1EG9 B;  5JPU A;  2A15 A;  3DM8 A;  2CKF B;  4WWU C;  1C7H A;  5AEW B;  3NV0 A;  2QIY A;  5EVH A;  5D81 A;  4XB5 A;  5KP3 A;  3G0K A;  4R9L A;  3B8L A;  1U5O A;  3CPO A;  7STD A;  3F8H A;  2GXF A;  3SOY A;  3OXA A;  4N3V A;  4Q53 A;  1W01 A;  1W00 A;  2GEX A;  3DUK A;  1OF5 B;  3GZY B;  3LYG A;  3FF2 A;  1DMN A;  1O7N B;  3DZL A;  1HKX A;  3NM2 A;  5KP1 A;  4IIA A;  3JUO A;  1Z1S A;  1OCV A;  1JB2 A;  4OVM A;  1K41 A;  3JUM A;  1A2K A;  4LGQ A;  3GRD A;  4LMI A;  1NU3 A;  1O7G B;  5STD A;  3F7X A;  2RCD A;  3FH1 A;  3MSO A;  5IEP A;  4K1U A;  2RFR A;  2HMJ B;  2F99 A;  3G16 A;  3DXO A;  1ZO2 A;  3I0Y A;  3NHX A;  4L8O A;  8CHO A;  4HKV B;  1VZZ A;  4MJD A;  4HJL B;  2I9W A;  1OHO A;  2STD A;  2YFL B;  4XDW A;  1GYB A;  3GWR A;  1QJG A;  1ULI B;  1OF5 A;  5DRE A;  4HM0 B;  5IF6 A;  1O7W B;  1W02 A;  2W2C A;  1TUH A;  4XBT A;  5AII A;  3F7S A;  3B4P A;  5HGR A;  1GY7 A;  2XSH B;  5DRV A;  3IPT A;  3HK4 A;  4U13 A;  4WP5 A;  2YFJ B;  4X2H A;  3DMC A;  5CK6 A;  5IEN A; 
#chains in the Genus database with same CATH topology
 1DMQ A;  1PFP A;  2C10 A;  2CFD A;  3MYT A;  4HM7 B;  4KFE A;  1MGW A;  1YI2 3;  3SED A;  1QAL A;  4J5K A;  2JQ5 A;  3WOE B;  4OUQ A;  1JKG B;  1RMS A;  2E2U A;  2GEY A;  3T0U A;  1JN5 B;  2W56 B;  3NQY A;  3PCR A;  1IT7 A;  3EJV A;  1RGF A;  3I55 3;  1UGI A;  1MWU A;  3LXU X;  5BVB A;  2BHM A;  3DGM A;  3LH4 A;  4IPB A;  1UUW B;  3K5T A;  1S5A A;  5IG3 A;  1K8A 4;  4WYK A;  1ULJ B;  2YFI B;  1YIJ 3;  1JB4 A;  1LNH A;  3G71 3;  3B7C A;  2CFW A;  3FGY A;  3CMA 3;  4EV5 A;  3MG3 A;  1MGR A;  3JUQ A;  2CIU A;  1OHS A;  3EN8 A;  3WDG B;  3X41 A;  3CC4 3;  1PYL A;  4MMY B;  1Q81 4;  1JZO A;  1K28 A;  3CME 3;  1NJI 4;  3NM7 A;  3DY5 A;  3BU4 A;  1Q40 A;  4L7K A;  2LQV A;  2W6J H;  3LTA A;  3NBB A;  4FCM A;  3D5I A;  5AIF A;  2XH9 A;  1MWR A;  3FG4 A;  3ZG0 A;  3X3Y A;  2SAR A;  4KVH A;  1RHL A;  2PNC A;  4LEH A;  1GMQ A;  5CLK A;  3S5C A;  3CNX A;  1DE3 A;  2ZHX B;  1RNB A;  1TP6 A;  4KT3 B;  1VQ7 3;  1R4C A;  1ASK A;  4K1V A;  3EBT A;  3DGO A;  1BU4 A;  3KN4 A;  1GS3 A;  2HOH A;  3D9R A;  1BNJ A;  1LVN A;  1RNT A;  3SVA A;  3STD A;  1FGT A;  4GSP A;  3T8U A;  3UL5 A;  3NXJ A;  4R4K A;  5M19 A;  4HM4 B;  1RDS A;  1ROV A;  2IUK A;  3LT9 A;  4N6U A;  5KP4 A;  3PYJ A;  2HMM B;  5BIR A;  3HZP A;  3K7C A;  3LTC A;  1W5Z A;  4BTY A;  3I56 3;  3KE7 A;  2W9Q A;  3K0Z A;  1KSI A;  4L8P A;  4NRE A;  1IVU A;  3B4O A;  2CH9 A;  3F9S A;  3ECF A;  2WO0 A;  3KCH A;  4R80 A;  1BRG A;  4GL6 A;  2ML6 A;  4N6N B;  2K3D A;  5IG5 A;  3BLZ A;  4HM2 B;  3RGR A;  1JKG A;  1OGX A;  4ORL A;  3WOD G;  1JN5 A;  2W56 A;  2XGN A;  1BRH A;  3GZR A;  1VQK 3;  3KSP A;  4O3V A;  1EA2 A;  1F8N A;  2GU3 A;  2F86 B;  5AI1 A;  4EC6 A;  3G8Z A;  1LQM B;  4N6M A;  3Q1C A;  1GOV A;  3AGO A;  3SX1 A;  4QWT A;  1TIJ A;  2P0X A;  5M18 A;  3GAX A;  2CWV A;  2IA7 A;  3VF1 A;  1QMA A;  1B20 A;  3JVC A;  1BRS A;  1N5H A;  1BSD A;  4DKI A;  1UUG B;  2KRT A;  5BXQ A;  1RGE A;  4XM4 A;  2WGO A;  3FCS B;  3KZT A;  1QAK A;  3UJM A;  1UUV B;  3PXM A;  2CX1 A;  1QVG 2;  1IT8 A;  3LZA A;  1VQO 3;  1M1K 4;  3WMD A;  1VQ6 3;  2XFS A;  2CW9 A;  4HM6 B;  1X1X A;  3K63 A;  4CCV A;  2BU4 A;  1RGG A;  2BMR B;  4RZM A;  4XDV A;  5IEO A;  3X3Z A;  4FMC A;  2INX A;  2B1X B;  2GBW B;  5AYS C;  1Q86 4;  1SJW A;  4KFF A;  2Z77 A;  3KKG A;  5AEU B;  1WQL B;  2C4B A;  3NV0 B;  3AHS A;  1GY6 A;  4TX4 A;  1O7M B;  4HOH A;  2HMO B;  2WOH A;  1EUI C;  1BGS A;  4EXR A;  3FF0 A;  4WHA A;  4WFO A;  3OWS A;  3QRD A;  1OHP A;  1LOX A;  1GOY A;  4BL2 A;  4HVN A;  4N6T A;  2XFT A;  3CCV 3;  2HMN B;  2OTJ 3;  1T2I A;  1JB5 A;  1YGW A;  2M7O A;  2GSP A;  4LSO A;  1LOW A;  3E99 A;  1OH0 A;  1EKM A;  2KF3 A;  3RNT A;  1D6Y A;  1RN4 A;  3EC9 A;  1IQX A;  1TJD A;  3CU3 A;  3V99 A;  2CC3 A;  2H0G A;  1FUT A;  1DET A;  3D3L A;  1IV9 A;  3OX9 A;  2GBX B;  3MG1 A;  1E3V A;  3GSP A;  5IW9 A;  4HZ9 B;  1PU4 A;  1NB5 I;  2W03 A;  4AKY A;  1LOY A;  1K73 4;  3BND A;  3G6E 3;  3X40 A;  1FGQ A;  5IER A;  1SII A;  4AKZ A;  3BNB A;  3CC2 3;  1RJO A;  2Z7A A;  4J8T A;  2UX0 A;  2BMQ B;  4G1M B;  3KSE D;  4J9A A;  2P05 A;  1NDO B;  3EN1 B;  1OAC A;  1Y4K A;  2HML B;  4I4K A;  5TGN A;  4CDL A;  3M8C A;  3AMO B;  3SXX A;  2R41 A;  5FW5 A;  1I3F A;  4R9K A;  2OQE A;  1SAR A;  3NBJ A;  1MWS A;  4HZB B;  3NUV A;  4HM5 B;  3OWY A;  1V57 A;  1B2U A;  1E3R A;  1HZ1 A;  1RGL A;  1BVI A;  3WHO A;  3ROB A;  3WA3 A;  1IV7 A;  2Y74 A;  4FCJ A;  2CFK A;  3BNC A;  3GZX B;  1VQ8 3;  1JV2 B;  3V92 A;  4GB5 A;  3S29 A;  3N9H A;  1L5G B;  3K9M C;  1O7P B;  3EHC A;  2KAA A;  3BB9 A;  1O7H B;  5CXO A;  3D79 A;  3X3X A;  1RN7 A;  3GZB A;  1FUS A;  1GY5 A;  4NPB A;  2FNQ A;  4BL3 A;  1N9J A;  4XBY A;  1T3B A;  1W6C A;  2Y73 A;  1X1W A;  5G2G A;  4HM3 B;  1BRK A;  1FYS A;  3BIR A;  5HOH A;  1YJW 3;  1ROA A;  2E2T A;  2LYX A;  3HIG A;  5M1A A;  1MNL A;  2QEX 3;  1GMP A;  2BNG A;  2OWP A;  2XRX B;  1WMN A;  2HMK B;  5JPP A;  1BNG A;  4R1K A;  4XBX A;  2CG0 A;  1FGO A;  1M90 4;  1IU7 A;  1U8C B;  3CXC 2;  2CHC A;  3HX8 A;  5LC6 A;  2AAE A;  1A2V A;  4J5G A;  3FKA A;  3UNL A;  3D4A A;  2CWU A;  1UCI A;  2BIR A;  2XF3 A;  3ER7 A;  1N9E A;  2OOV C;  3NBR A;  1VQQ A;  3QK9 A;  2KCD A;  1UCL A;  3EQQ B;  1JBS A;  2OQE C;  2RSX A;  8RNT A;  2JDI H;  2P0M A;  1IK3 A;  2IUJ A;  3T8N A;  1FZU A;  1B27 A;  3FZW A;  1X1Y A;  2BO9 B;  3EF8 A;  1JNQ A;  3RGA A;  3VGN A;  1A90 A;  1FGM A;  2F5W A;  2O3O A;  4PEJ A;  1QAF A;  4BU4 A;  2GU1 A;  3FLJ A;  5I97 A;  3MG2 A;  1RLS A;  1T5Y A;  2F98 A;  2SBL A;  1RSN A;  2PZV A;  1D6U A;  1WMP A;  7RNT A;  2KF5 A;  1BSA A;  2BMO B;  4X2O A;  2CX0 A;  4MMZ B;  2ML5 A;  5D82 A;  4MEI A;  5CF2 A;  4BTX A;  1LXE A;  4H61 A;  2WGQ A;  5ELJ A;  1UW1 A;  4FMD A;  1B3S A;  1YHQ 3;  6GSP A;  3FG1 A;  3OWU A;  4LYL B;  2V1L A;  1UI7 A;  3F40 A;  1TRQ A;  2CK3 H;  5RNT A;  3CCJ 3;  1BRN L;  1BUQ A;  3SOA A;  1LRA A;  3OV4 A;  1RRL A;  2UUG C;  4STD A;  3CCU 3;  2MF7 A;  4NHF A;  3G4S 3;  9RNT A;  1CYU A;  1KD1 4;  3J7Y d;  1CH0 A;  1VQM 3;  1RGA A;  2KF6 A;  2QGU A;  1CQS A;  1NB3 I;  5EQL A;  1DYU A;  1BSC A;  3DGN A;  1E97 A;  3S27 A;  1SQW A;  1JRQ A;  2FGT A;  2CFL A;  1MOL A;  1STD A;  1BSB A;  1T2H A;  3NQZ A;  2F5M A;  1Q42 A;  1OUN A;  1I0V A;  2H0H A;  3EX9 A;  4HAA A;  5ELU A;  1W4N A;  2L1S A;  2RGQ A;  3U97 A;  3JUP A;  3CCR 3;  2W9P A;  3FSD A;  1FGR A;  1C54 A;  1VQN 3;  1PY3 A;  2K54 A;  3LTD A;  4RBN A;  1W6Y A;  1I3I A;  4WYK B;  1M1X B;  1VQL 3;  1D6Z A;  3MHE A;  1ISK A;  1BOX A;  3DH2 A;  5GSP A;  1DMM A;  3Q90 A;  1UGH I;  1YVS A;  4EV2 A;  6STD A;  1HYF A;  3JUN A;  3MKI A;  1G96 A;  5AIH A;  1RCL A;  2XSO B;  1DVD A;  1Q40 B;  3ZFZ A;  2W0Q A;  5BU4 A;  1JJ2 2;  3RDE A;  1SPU A;  4FMA A;  1AQZ A;  3F14 A;  2Q07 A;  1BNI A;  2R4I A;  2RNT A;  1OPY A;  1RCK A;  1UCK A;  1IDP A;  4JF8 A;  2Z76 A;  3PCS A;  1BAN A;  4RNY A;  1ZX2 A;  5IG0 A;  1A67 A;  1IVX A;  5D83 A;  4IT7 A;  2F4Y A;  1N8R 4;  1IQY A;  5CF1 A;  2FXT A;  2XR8 B;  2B24 B;  1W7C A;  2MC8 A;  4HM8 B;  5G1K A;  4HYZ A;  1RGH A;  1VQ9 3;  3EBY A;  1GSP A;  1WNH A;  4I5Q A;  3H3H A;  2OOV A;  3F8X A;  5AIG A;  3CNM A;  4H3U A;  4HM1 B;  1B2M A;  2W04 A;  1NWW A;  1UDI I;  5IG4 A;  1OGZ A;  3A76 A;  3EE1 A;  3H51 A;  1JZD A;  3KII A;  4LZI A;  3VSY A;  2OCT A;  2IMJ A;  1AR0 A;  1EG9 B;  1KWI A;  2A15 A;  2O9U X;  3FG3 A;  3O8Y A;  3NX0 A;  5JPU A;  1BNE A;  2XGL A;  1ZGX A;  3DM8 A;  2YX9 A;  1CEW I;  1W2Z A;  4K90 B;  2CKF B;  1B2X A;  4WWU C;  1C7H A;  1W2B 2;  5G1L A;  4EBG A;  5AEW B;  3NV0 A;  2QIY A;  4O2H A;  4EYC A;  5EVH A;  5D81 A;  1JBR A;  3IMA B;  3CCS 3;  1LOV A;  3CD6 3;  4XB5 A;  1R4Y A;  5KP3 A;  4BTW A;  4FR9 A;  1NNV A;  3G0K A;  4R9L A;  5AYR B;  3B8L A;  3WOF B;  1U5O A;  4RNT A;  3HI7 A;  1Q7Y 4;  1STF I;  1RKY A;  1RRH A;  1YIT 3;  3BNE A;  1I70 A;  1BIR A;  2Z6B A;  3CPO A;  3UB1 A;  1BSE A;  2AAD A;  3UL6 A;  2QA4 3;  1YJN 3;  1TTO A;  7STD A;  1VQ4 3;  5LC7 A;  3F8H A;  2GXF A;  1ZS7 A;  3PS8 A;  3SOY A;  3OXA A;  4N3V A;  4Q53 A;  5JBS A;  3A5E A;  1EQK A;  1W01 A;  1W00 A;  1MWT A;  3ALA A;  2GEX A;  3DUK A;  4N6L A;  1OF5 B;  3GZY B;  2RBI A;  3LYG A;  1B21 A;  3FF2 A;  1DMN A;  1O7N B;  1V74 A;  3CPW 2;  3DZL A;  1HKX A;  1I8V A;  1RN1 A;  1UI8 A;  3NM2 A;  5EEO A;  3URP A;  5KP1 A;  4IIA A;  1AVL A;  3JUO A;  1Z1S A;  3AHW A;  4GHO A;  1FUW A;  1RTU A;  3AMO A;  1YVB I;  2ZDJ A;  3EB8 A;  1A2P A;  1JB2 A;  1OCV A;  3PGB A;  4OK0 A;  4OVM A;  3WA2 X;  1K41 A;  1TFK A;  3JUM A;  1A2K A;  1W6G A;  4LGQ A;  3GRD A;  4LMI A;  2OTL 3;  3S28 A;  2WOF A;  1NU3 A;  3PZW A;  4AEQ A;  3CCL 3;  2UGI A;  1O7G B;  4JRF A;  1BRJ A;  3LTB A;  1VQP 3;  4O02 B;  4ILF A;  4MMX B;  5STD A;  2CWT A;  1N5P A;  3F7X A;  1X1U A;  2RCD A;  4EW5 A;  1TU5 A;  3FH1 A;  3CCQ 3;  3MSO A;  1NO3 A;  3CC7 3;  5IEP A;  1VQ5 3;  2E2V A;  4K1U A;  1BRI A;  1I0X A;  3LOY A;  2RFR A;  1K9M 4;  2HMJ B;  2F99 A;  2ZL8 A;  3AGN A;  1SIH A;  1B2Z A;  1QVF 2;  1AY7 A;  2KF4 A;  1AV4 A;  1BUJ A;  1DVC A;  2H0I A;  1G02 A;  3KFQ C;  3G16 A;  1YNV X;  3DXO A;  3HII A;  3N54 B;  4FMB A;  1WMO A;  1ZO2 A;  3I0Y A;  3NHX A;  2D42 A;  4L8O A;  4ZM8 A;  8CHO A;  3S67 A;  4HKV B;  1BAO A;  4KZ1 A;  1S72 3;  1HU9 A;  3HOH A;  3LML A;  1YGE A;  2P38 A;  1JBT A;  1GD4 A;  1CYV A;  3TDG A;  3ZG5 A;  1KC8 4;  1VZZ A;  1I2F A;  4MJD A;  4HJL B;  2I9W A;  2IYJ A;  2P09 A;  1OHO A;  2J8X B;  3Q2P A;  2STD A;  2YFL B;  1GOU A;  1LNI A;  4RNZ A;  4XDW A;  1GYB A;  3OW2 2;  6RNT A;  3WR2 A;  1TFO A;  1Q82 4;  1IYY A;  1V58 A;  1J2B A;  3GWR A;  4KFD A;  1KQS 2;  4K61 A;  1QJG A;  1Q9E A;  4O8S A;  2KXG A;  1ULI B;  1OF5 A;  2BT3 A;  3D5G A;  3MWZ A;  4HM0 B;  5DRE A;  3X42 A;  1LQG C;  2CFG A;  1RGK A;  5IF6 A;  1G0T A;  4N6O B;  1IVV A;  1M9G A;  1O7W B;  4BIR A;  1W02 A;  3IJE B;  3V98 A;  2W2C A;  1BNR A;  1AVK A;  1EEJ A;  3SLU A;  1N8Q A;  4HBR A;  4N6V 0;  1TUH A;  7GSP A;  2D1W A;  4XBT A;  5AII A;  1WTH A;  3N8B A;  1RGC A;  3LT8 A;  2L4V A;  3B4P A;  3F7S A;  4FCZ A;  5HGR A;  2K0M A;  1I2G A;  2XEP A;  2ZA4 A;  1BNS A;  1GY7 A;  2XSH B;  3CCM 3;  5DRV A;  1FA3 A;  4CJN A;  1UCJ A;  3IPT A;  1FW7 A;  3MPH A;  3DGL A;  3HK4 A;  1IQ8 A;  2C11 A;  1TRP A;  4U13 A;  1BNF A;  1IVW A;  1GD3 A;  4WP5 A;  3U1W A;  3CCE 3;  2IY2 A;  3L0R A;  4CPK A;  1B2S A;  5A0O B;  3SYU A;  5FGO A;  1Q7H A;  2YFJ B;  4X2H A;  1YJ9 3;  3DGY A;  3Q3F A;  1GMR A;  1US1 A;  3DMC A;  2F56 A;  2CG1 A;  5CK6 A;  5IEN A;  1I2E A; 
#chains in the Genus database with same CATH homology
 1DMQ A;  1PFP A;  2C10 A;  2CFD A;  3MYT A;  4HM7 B;  4KFE A;  1YI2 3;  3SED A;  1QAL A;  2JQ5 A;  3WOE B;  4OUQ A;  1JKG B;  2GEY A;  2E2U A;  3T0U A;  1JN5 B;  2W56 B;  3NQY A;  3PCR A;  1IT7 A;  3EJV A;  3I55 3;  3LXU X;  5BVB A;  2BHM A;  3DGM A;  3LH4 A;  4IPB A;  1UUW B;  3K5T A;  1S5A A;  5IG3 A;  1K8A 4;  4WYK A;  1ULJ B;  2YFI B;  1YIJ 3;  1JB4 A;  1LNH A;  3B7C A;  2CFW A;  3FGY A;  3CMA 3;  4EV5 A;  3MG3 A;  3JUQ A;  2CIU A;  1OHS A;  3EN8 A;  3WDG B;  3X41 A;  3CC4 3;  1Q81 4;  4MMY B;  1K28 A;  3CME 3;  1NJI 4;  3NM7 A;  3DY5 A;  1Q40 A;  4L7K A;  2LQV A;  2W6J H;  3LTA A;  3NBB A;  4FCM A;  5AIF A;  2XH9 A;  3FG4 A;  3X3Y A;  4KVH A;  2PNC A;  4LEH A;  5CLK A;  3S5C A;  3CNX A;  1TP6 A;  1VQ7 3;  1R4C A;  1ASK A;  4K1V A;  3EBT A;  3DGO A;  3KN4 A;  1GS3 A;  3D9R A;  1LVN A;  3SVA A;  3STD A;  1FGT A;  3T8U A;  3UL5 A;  3NXJ A;  4R4K A;  4HM4 B;  1ROV A;  4N6U A;  2IUK A;  3LT9 A;  5KP4 A;  3PYJ A;  2HMM B;  3HZP A;  3K7C A;  3LTC A;  1W5Z A;  4BTY A;  3I56 3;  3KE7 A;  2W9Q A;  3K0Z A;  1KSI A;  4L8P A;  4NRE A;  1IVU A;  3B4O A;  2CH9 A;  3F9S A;  3ECF A;  2WO0 A;  4R80 A;  4GL6 A;  2ML6 A;  4N6N B;  5IG5 A;  3BLZ A;  4HM2 B;  3RGR A;  1JKG A;  1OGX A;  4ORL A;  3WOD G;  1JN5 A;  2W56 A;  2XGN A;  3GZR A;  1VQK 3;  3KSP A;  4O3V A;  1EA2 A;  1F8N A;  2GU3 A;  2F86 B;  5AI1 A;  4EC6 A;  3G8Z A;  4N6M A;  3Q1C A;  3SX1 A;  4QWT A;  1TIJ A;  2P0X A;  3GAX A;  2CWV A;  2IA7 A;  3VF1 A;  1QMA A;  3JVC A;  1N5H A;  5BXQ A;  2KRT A;  4XM4 A;  2WGO A;  3FCS B;  3KZT A;  1QAK A;  3UJM A;  1UUV B;  3PXM A;  1QVG 2;  1IT8 A;  3LZA A;  1VQO 3;  1M1K 4;  3WMD A;  1VQ6 3;  2XFS A;  2CW9 A;  4HM6 B;  3K63 A;  4CCV A;  2BMR B;  4RZM A;  4XDV A;  5IEO A;  3X3Z A;  4FMC A;  2INX A;  2B1X B;  2GBW B;  5AYS C;  1Q86 4;  1SJW A;  4KFF A;  2Z77 A;  3KKG A;  5AEU B;  1WQL B;  3NV0 B;  1GY6 A;  4TX4 A;  1O7M B;  2HMO B;  2WOH A;  4EXR A;  3FF0 A;  4WHA A;  4WFO A;  3OWS A;  3QRD A;  1OHP A;  1LOX A;  4HVN A;  4N6T A;  2XFT A;  3CCV 3;  2HMN B;  2OTJ 3;  1JB5 A;  2M7O A;  4LSO A;  3E99 A;  1OH0 A;  1EKM A;  1D6Y A;  3EC9 A;  1IQX A;  3CU3 A;  3V99 A;  2CC3 A;  3D3L A;  1IV9 A;  3OX9 A;  2GBX B;  3MG1 A;  1E3V A;  5IW9 A;  4HZ9 B;  1PU4 A;  1NB5 I;  2W03 A;  4AKY A;  1K73 4;  3BND A;  3G6E 3;  3X40 A;  1FGQ A;  5IER A;  1SII A;  4AKZ A;  3BNB A;  3CC2 3;  1RJO A;  2Z7A A;  4J8T A;  2UX0 A;  2BMQ B;  4G1M B;  3KSE D;  4J9A A;  2P05 A;  1NDO B;  3EN1 B;  1OAC A;  1Y4K A;  2HML B;  4I4K A;  5TGN A;  4CDL A;  3M8C A;  3AMO B;  3SXX A;  5FW5 A;  4R9K A;  2OQE A;  3NBJ A;  4HZB B;  3NUV A;  4HM5 B;  3OWY A;  1E3R A;  3ROB A;  3WA3 A;  1IV7 A;  2Y74 A;  4FCJ A;  2CFK A;  3BNC A;  3GZX B;  1VQ8 3;  1JV2 B;  3V92 A;  4GB5 A;  3S29 A;  3N9H A;  1L5G B;  3K9M C;  1O7P B;  3EHC A;  3BB9 A;  1O7H B;  5CXO A;  3X3X A;  1RN7 A;  3GZB A;  1GY5 A;  2FNQ A;  1N9J A;  4XBY A;  1W6C A;  2Y73 A;  5G2G A;  4HM3 B;  1YJW 3;  1ROA A;  2E2T A;  2LYX A;  3HIG A;  1MNL A;  2QEX 3;  2OWP A;  2BNG A;  2XRX B;  1WMN A;  2HMK B;  5JPP A;  4R1K A;  4XBX A;  2CG0 A;  1FGO A;  1M90 4;  1IU7 A;  1U8C B;  3CXC 2;  2CHC A;  3HX8 A;  5LC6 A;  1A2V A;  3FKA A;  3UNL A;  2CWU A;  2XF3 A;  3ER7 A;  1N9E A;  2OOV C;  3NBR A;  3QK9 A;  2KCD A;  3EQQ B;  2OQE C;  2RSX A;  2JDI H;  2P0M A;  1IK3 A;  2IUJ A;  3T8N A;  3FZW A;  2BO9 B;  3EF8 A;  1JNQ A;  3RGA A;  3VGN A;  1A90 A;  1FGM A;  2O3O A;  4PEJ A;  1QAF A;  2GU1 A;  3FLJ A;  5I97 A;  3MG2 A;  1T5Y A;  2F98 A;  2SBL A;  2PZV A;  1D6U A;  1WMP A;  2BMO B;  4X2O A;  4MMZ B;  2ML5 A;  5D82 A;  4MEI A;  5CF2 A;  4BTX A;  1LXE A;  4H61 A;  2WGQ A;  5ELJ A;  1UW1 A;  4FMD A;  1YHQ 3;  3FG1 A;  3OWU A;  2V1L A;  1UI7 A;  3F40 A;  2CK3 H;  1BUQ A;  3CCJ 3;  3SOA A;  3OV4 A;  1RRL A;  4STD A;  3CCU 3;  2MF7 A;  4NHF A;  3G4S 3;  1CYU A;  1KD1 4;  3J7Y d;  1VQM 3;  2QGU A;  1CQS A;  1NB3 I;  5EQL A;  1DYU A;  3DGN A;  3S27 A;  1E97 A;  1SQW A;  1JRQ A;  2FGT A;  2CFL A;  1MOL A;  1STD A;  3NQZ A;  1Q42 A;  1OUN A;  3EX9 A;  5ELU A;  3G71 3;  1J2B A;  1W4N A;  3U97 A;  2RGQ A;  3JUP A;  3CCR 3;  2W9P A;  3FSD A;  1FGR A;  1VQN 3;  3LTD A;  2K54 A;  4RBN A;  1W6Y A;  4WYK B;  1M1X B;  1VQL 3;  1D6Z A;  3MHE A;  1ISK A;  1DMM A;  3Q90 A;  4EV2 A;  6STD A;  3JUN A;  3MKI A;  1G96 A;  5AIH A;  1DVD A;  2XSO B;  1Q40 B;  2W0Q A;  1JJ2 2;  3RDE A;  1SPU A;  4FMA A;  3F14 A;  2Q07 A;  2R4I A;  1OPY A;  1IDP A;  4JF8 A;  2Z76 A;  3PCS A;  4RNY A;  1ZX2 A;  5IG0 A;  1A67 A;  1IVX A;  5D83 A;  4IT7 A;  1N8R 4;  1IQY A;  5CF1 A;  2FXT A;  2XR8 B;  2B24 B;  1W7C A;  2MC8 A;  4HM8 B;  4HYZ A;  1VQ9 3;  3EBY A;  1WNH A;  3H3H A;  2OOV A;  3F8X A;  5AIG A;  3CNM A;  4H3U A;  4HM1 B;  2W04 A;  1NWW A;  5IG4 A;  1OGZ A;  3A76 A;  3EE1 A;  3H51 A;  3KII A;  4LZI A;  3VSY A;  2OCT A;  2IMJ A;  1AR0 A;  1EG9 B;  1KWI A;  2A15 A;  2O9U X;  3FG3 A;  3O8Y A;  3NX0 A;  5JPU A;  2XGL A;  3DM8 A;  2YX9 A;  1CEW I;  1W2Z A;  4K90 B;  2CKF B;  4WWU C;  1C7H A;  1W2B 2;  4EBG A;  5AEW B;  3NV0 A;  2QIY A;  4O2H A;  4EYC A;  5EVH A;  5D81 A;  3IMA B;  3CCS 3;  3CD6 3;  4XB5 A;  5KP3 A;  4BTW A;  4FR9 A;  3G0K A;  5AYR B;  4R9L A;  3WOF B;  3B8L A;  1U5O A;  3HI7 A;  1Q7Y 4;  1STF I;  1RKY A;  1RRH A;  1YIT 3;  3BNE A;  2Z6B A;  3CPO A;  3UL6 A;  3UB1 A;  2QA4 3;  1YJN 3;  7STD A;  1VQ4 3;  5LC7 A;  3F8H A;  2GXF A;  3PS8 A;  3SOY A;  3OXA A;  4N3V A;  4Q53 A;  5JBS A;  1EQK A;  1W01 A;  1W00 A;  3ALA A;  2GEX A;  3DUK A;  4N6L A;  1OF5 B;  3GZY B;  3LYG A;  3FF2 A;  1DMN A;  1O7N B;  1V74 A;  3CPW 2;  3DZL A;  1HKX A;  3NM2 A;  1UI8 A;  5EEO A;  5KP1 A;  4IIA A;  1AVL A;  3JUO A;  1Z1S A;  1FUW A;  3AMO A;  1YVB I;  2ZDJ A;  3EB8 A;  1OCV A;  1JB2 A;  4OK0 A;  3PGB A;  4OVM A;  3WA2 X;  1K41 A;  1TFK A;  3JUM A;  1A2K A;  1W6G A;  4LGQ A;  3GRD A;  4LMI A;  2OTL 3;  3S28 A;  2WOF A;  1NU3 A;  3PZW A;  4AEQ A;  3CCL 3;  4JRF A;  1O7G B;  3LTB A;  1VQP 3;  4O02 B;  4MMX B;  5STD A;  2CWT A;  1N5P A;  3F7X A;  2RCD A;  1TU5 A;  3FH1 A;  3CCQ 3;  3MSO A;  1NO3 A;  3CC7 3;  5IEP A;  1VQ5 3;  2E2V A;  4K1U A;  3LOY A;  1K9M 4;  2RFR A;  2HMJ B;  2F99 A;  2ZL8 A;  1SIH A;  1QVF 2;  1AV4 A;  1DVC A;  3KFQ C;  3G16 A;  3DXO A;  3HII A;  3N54 B;  4FMB A;  1WMO A;  1ZO2 A;  3I0Y A;  3NHX A;  2D42 A;  4L8O A;  4ZM8 A;  8CHO A;  3S67 A;  4HKV B;  1S72 3;  4KZ1 A;  1HU9 A;  3LML A;  1YGE A;  2P38 A;  1GD4 A;  1CYV A;  3TDG A;  1KC8 4;  1VZZ A;  4MJD A;  4HJL B;  2I9W A;  2P09 A;  1OHO A;  3Q2P A;  2STD A;  2YFL B;  4XDW A;  4RNZ A;  1GYB A;  3OW2 2;  1Q82 4;  1TFO A;  3GWR A;  4KFD A;  1KQS 2;  4K61 A;  1QJG A;  4O8S A;  2KXG A;  1ULI B;  1OF5 A;  2BT3 A;  3MWZ A;  5DRE A;  4HM0 B;  3X42 A;  2CFG A;  5IF6 A;  4N6O B;  1IVV A;  1M9G A;  1O7W B;  1W02 A;  3IJE B;  3V98 A;  2W2C A;  1AVK A;  3SLU A;  1N8Q A;  4HBR A;  4N6V 0;  1TUH A;  2D1W A;  4XBT A;  5AII A;  1WTH A;  3N8B A;  3LT8 A;  2L4V A;  3B4P A;  3F7S A;  4FCZ A;  5HGR A;  2K0M A;  2XEP A;  1GY7 A;  2XSH B;  3CCM 3;  5DRV A;  1FA3 A;  3IPT A;  3MPH A;  3DGL A;  3HK4 A;  1IQ8 A;  2C11 A;  4U13 A;  3U1W A;  1IVW A;  1GD3 A;  4WP5 A;  3CCE 3;  3L0R A;  5A0O B;  5FGO A;  2YFJ B;  4X2H A;  1YJ9 3;  1US1 A;  3DMC A;  2CG1 A;  5CK6 A;  5IEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...