4X2HA

Sac3n peptide bound to mex67:mtr2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
192
structure length
192
Chain Sequence
PTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPRHPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Putative mRNA export protein
publication title Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2.
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
total genus 49
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2014-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4x2hA00
5TGNA 4HM8B 3EN1B 5CK6A 1O7WB 2RFRA 3MYTA 3SOYA 3DMCA 3D9RA 2RCDA 4HJLB 1Z1SA 3STDA 4HZBB 1SJWA 1DMQA 3EBYA 3OWSA 5KP4A 2QGUA 1DMNA 5IEPA 1O7PB 3NHXA 3T8NA 2GEYA 4J8TA 4WYKB 3FLJA 2K54A 3MKIA 1NWWA 1OF5A 2YFLB 1ASKA 5STDA 3HX8A 1UUWB 3LZAA 3DXOA 3E99A 1BUQA 4HM6B 1Q40A 2F86B 1ULIB 4WP5A 1OH0A 3RGAA 4K1UA 2A15A 1A2KA 3DM8A 5KP1A 1W02A 2OWPA 3WMDA 4HKVB 1ZO2A 3EF8A 4HM3B 1OUNA 4ORLA 4CDLA 3EBTA 1JB4A 5BXQA 1E3RA 4HM2B 3FF2A 5AEUB 1UUVB 3MHEA 4J9AA 1JN5A 3G8ZA 1E3VA 3OWUA 4MJDA 1TUHA 5KP3A 1JKGB 2HMMB 3CPOA 3JUMA 4HM4B 4WWUC 3FH1A 3NUVA 3GZXB 4RZMA 1QMAA 4XM4A 4L7KA 3LYGA 3GWRA 3KE7A 3HK4A 4R9LA 5HGRA 3NV0A 4X2OA 2R4IA 2PZVA 1O7MB 2STDA 1CQSA 1E97A 4K1VA 3F14A 3JUOA 1GY6A 5CF2A 2GBWB 2YFJB 4FCMA 1OGZA 4HVNA 4PEJA 1C7HA 1Q42A 5DRVA 3NXJA 3KSPA 2Z77A 3GZYB 5IENA 3FGYA 1GS3A 2IMJA 4KVHA 2YFIB 3OX9A 3FKAA 1U5OA 5G2GA 4I4KA 1EA2A 3SOAA 5IG3A 3FZWA 3F8XA 3VGNA 4HM0B 1K41A 4N3VA 5AIGA 1W00A 3K7CA 1OF5B 4X2HA 2BMRB 4HZ9B 5CXOA 4XB5A 3OWYA 1NDOB 2HMKB 2UX0A 3S5CA 2JQ5A 1OHOA 3OV4A 3B7CA 5D83A 3UJMA 5JPUA 2XSOB 4L8OA 4R1KA 4XBTA 2HMJB 1S5AA 3EJVA 1EG9B 1HKXA 3HZPA 2INXA 2BMQB 2HMNB 1JKGA 1GY5A 1OHSA 3F40A 3CNXA 2GXFA 3UNLA 7STDA 4R9KA 5AIIA 8CHOA 3NBRA 4HM5B 3DUKA 5IG5A 3IPTA 1JN5B 2XRXB 3EHCA 1OPYA 4STDA 2B24B 3G16A 4XBXA 5EVHA 1TP6A 5D82A 3B4PA 3B4OA 5FW5A 1STDA 3F7SA 1JB2A 4L8PA 3RGRA 3MG2A 4LGQA 5AEWB 5CLKA 3JUQA 5JPPA 1JB5A 5D81A 4HM1B 2CKFB 5AIFA 5IERA 3GRDA 3JUNA 3G0KA 3NV0B 1IDPA 3VSYA 4XBYA 3H51A 2Z76A 2Z7AA 3H3HA 3KZTA 4HM7B 4WYKA 2F98A 2XSHB 1GY7A 1OGXA 1VZZA 3SEDA 2B1XB 4Q53A 2F99A 3EX9A 2BMOB 1NU3A 1W01A 3FF0A 4GB5A 3GZBA 2QIYA 4OVMA 4LEHA 6STDA 2HMLB 1WQLB 3BB9A 1DMMA 5AI1A 2XR8B 3DZLA 3EQQB 3ROBA 4FCJA 3F7XA 1O7NB 3F9SA 2CHCA 3F8HA 3MG3A 3M8CA 3EN8A 3Q90A 1ULJB 3GZRA 1OHPA 3T8UA 4XDVA 2RGQA 3BLZA 1Q40B 3CNMA 3JUPA 3A76A 3OXAA 2BNGA 3NM2A 3ECFA 4H3UA 5AIHA 5DREA 5BVBA 1ZX2A 1O7GB 2W2CA 1ISKA 2GBXB 4IIAA 3FSDA 5IG0A 4OUQA 4LMIA 1OCVA 5IEOA 3ER7A 3I0YA 1QJGA 5IF6A 3KKGA 1AR0A 1O7HB 4XDWA 3MSOA 3B8LA 3EC9A 5IG4A 3MG1A 2I9WA 2GEXA 5CF1A 4U13A 1GYBA 1W6YA 3K0ZA 3CU3A 2HMOB
chains in the Genus database with same CATH superfamily
4FMBA 3S29A 1B2XA 3NQYA 2CIUA 1DETA 1RN1A 4WHAA 5TGNA 4HM8B 1QAKA 1IV9A 5AYRB 3EN1B 5CK6A 1O7WB 2RFRA 1HZ1A 1RN7A 3MYTA 2OTL3 2E2TA 3SOYA 3HI7A 1BNGA 1IV7A 3DMCA 1X1XA 3D9RA 4BTXA 1BGSA 2RCDA 5HOHA 5M1AA 4HJLB 1Z1SA 2AADA 2CW9A 2CX0A 2ZDJA 2W6JH 3LT8A 3STDA 3VF1A 4HZBB 1I3IA 4EV5A 1SJWA 1BOXA 5BIRA 3D5IA 1DMQA 5GSPA 1FYSA 1IQ8A 3EBYA 1EEJA 1VQ73 4CPKA 5G1LA 1FGQA 1VQ43 1MWTA 1N5HA 1RGCA 1STFI 3OWSA 5KP4A 1QALA 2QGUA 1DMNA 3DGOA 3X41A 5IEPA 1O7PB 1N9JA 3NHXA 1ZS7A 1RTUA 2WOFA 1BSAA 4NPBA 3T8NA 4JRFA 1TRQA 3AHWA 2XF3A 3KN4A 3CCQ3 2BT3A 1L5GB 2GEYA 1BUJA 1NNVA 4J8TA 1AY7A 4WYKB 3OW22 4RNTA 1YHQ3 9RNTA 4KFDA 1N8QA 3FLJA 3BNEA 2FXTA 2K54A 6GSPA 3SX1A 1DVDA 3FG4A 3MKIA 4BTWA 2QA43 1BU4A 1NWWA 4KFEA 1OF5A 1UCIA 2IUKA 2YFLB 1ASKA 5STDA 1WNHA 3HX8A 1UUWB 1VQQA 4IT7A 3LZAA 3DXOA 2D42A 1X1WA 1RHLA 4H61A 4EBGA 1SPUA 3WOEB 1A2VA 1K734 2BIRA 1RJOA 3LXUX 3X3XA 3E99A 1BUQA 1IQXA 2SARA 4HOHA 3HOHA 1SIHA 2JDIH 4HM6B 1MGWA 1Q40A 2RNTA 2F86B 3V98A 3LTBA 1RGGA 1ULIB 3PCSA 4WP5A 1OH0A 3LTDA 3RGAA 4K1UA 5AYSC 3QK9A 3Q2PA 2L1SA 2J8XB 1PY3A 2OQEA 2A15A 1GOUA 1A2KA 1CYVA 1YJ93 1I2FA 1BVIA 1X1YA 3DM8A 1JZDA 4N6UA 3ALAA 5KP1A 2W04A 3JVCA 4N6TA 1YJW3 3KIIA 1W02A 1VQK3 4O8SA 2OWPA 2PNCA 2W0QA 3LOYA 3WMDA 3PZWA 7RNTA 3CMA3 4HKVB 1ZO2A 3EF8A 4HM3B 1I8VA 1OUNA 3GSPA 1B2UA 4ORLA 3EE1A 4CDLA 1RGKA 1B2SA 3V92A 3EBTA 1JB4A 5BXQA 3MPHA 1FGTA 1E3RA 2C10A 2CWVA 4HM2B 3FF2A 1LOVA 3ZG5A 5AEUB 3J7Yd 2OCTA 1UUVB 3MHEA 1JN5A 2FNQA 4J9AA 3G8ZA 1IU7A 4EC6A 2WGQA 1E3VA 3OWUA 4J5GA 4MJDA 1U8CB 4I5QA 1BSBA 1TUHA 3CPW2 5KP3A 1BRNL 1JKGB 2HMMB 2O9UX 3CPOA 3K63A 2OTJ3 1PFPA 3X40A 3JUMA 2XEPA 3CCE3 1I2EA 4N6OB 3WHOA 3K5TA 4HM4B 1FUWA 4QWTA 4WWUC 3D5GA 1VQ83 3FH1A 4BTYA 1RRHA 1LNIA 1JV2B 3NUVA 3GZXB 2Y73A 1N9EA 4EW5A 3WOFB 1EQKA 4RZMA 2XGNA 1RGLA 2O3OA 3Q1CA 4GHOA 2Y74A 1CH0A 1BIRA 3CME3 2OOVA 1BNSA 1TRPA 1LRAA 1GOVA 2XH9A 4GSPA 1QMAA 4XM4A 3CCM3 4L7KA 1ZGXA 3LYGA 3PGBA 1X1UA 3AMOA 1NO3A 3WR2A 3DGLA 1YVSA 1RRLA 3GWRA 3KE7A 4HAAA 3HK4A 4R9LA 5HGRA 1CEWI 3DGMA 3NV0A 4K61A 3SXXA 1W4NA 2D1WA 7GSPA 1IT7A 1W2ZA 2Z6BA 2OQEC 4X2OA 1TJDA 2R41A 2R4IA 1ROVA 3CD63 3MWZA 2KF4A 5IW9A 2PZVA 1O7MB 1IK3A 1BRHA 1K8A4 2CFGA 2STDA 1TIJA 1T2IA 3LTAA 4TX4A 1CQSA 1E97A 3WA2X 4K90B 4K1VA 1JJ22 1LOXA 3F14A 4FMDA 1MOLA 1LOWA 1RN4A 2H0GA 5LC7A 1JBTA 3JUOA 4N6V0 1GY6A 2KRTA 1A67A 1UCKA 5CF2A 2GBWB 1VQP3 4AKYA 3DH2A 1NJI4 2YFJB 2E2VA 1JRQA 4FCMA 1OGZA 2MC8A 4CJNA 4EXRA 3X3ZA 3Q3FA 4HVNA 3BU4A 1PYLA 4PEJA 1C7HA 4LSOA 4GL6A 1Q814 5BU4A 1Q42A 5DRVA 3NXJA 3KSPA 3NBJA 4FR9A 1BSDA 1FGMA 2LYXA 1YGEA 1FA3A 2W56B 2Z77A 3NX0A 3GZYB 5IENA 4O3VA 3FGYA 2K3DA 1I0VA 2QEX3 1IVXA 3PS8A 3I553 3KSED 1RMSA 1GS3A 2IMJA 4KVHA 2BHMA 2XFSA 1BSCA 2YFIB 2RSXA 3OX9A 3FKAA 1U5OA 5G2GA 4I4KA 2BU4A 1BRIA 1BNEA 1EA2A 3SOAA 5IG3A 1QVF2 1GMQA 2CX1A 3FZWA 1BNFA 1BRSA 4BL3A 1DYUA 3F8XA 1JNQA 3FG3A 1QVG2 1N8R4 2KF6A 2IY2A 3D3LA 3VGNA 5RNTA 1VQO3 4HM0B 1T5YA 4JF8A 1VQ93 4AKZA 1GSPA 1B2MA 1K41A 1YVBI 3URPA 5EQLA 2CFLA 4R4KA 2KF3A 2RBIA 1DVCA 1Y4KA 1MWSA 2HMOB 2KAAA 2ML6A 1UI8A 3HIIA 4N3VA 5AIGA 1W00A 1VQ63 2CC3A 1W6CA 1OF5B 3K7CA 3LMLA 3N9HA 1LQMB 1LNHA 2KF5A 3LH4A 4N6MA 1WTHA 1YIJ3 1RGAA 1AV4A 2CWUA 4X2HA 1T2HA 2BMRB 4HZ9B 4XB5A 4MMZB 3BNBA 1MWRA 5CXOA 3OWYA 4O2HA 1NDOB 2HMKB 2UX0A 2UUGC 4G1MB 3S5CA 1ROAA 1OHOA 2JQ5A 2KCDA 3OV4A 1RGFA 3AGOA 3B7CA 5D83A 3AGNA 1GD4A 1VQN3 1AVLA 1JZOA 3UJMA 5JPUA 2XSOB 4KT3B 2F5WA 3D79A 4RBNA 3S67A 4L8OA 1IVUA 4R80A 3N8BA 4R1KA 2E2UA 4XBTA 2C11A 1S5AA 2HMJB 1SIIA 3UB1A 3U97A 4ZM8A 4HBRA 3EJVA 4N6NB 1G02A 1EG9B 1HKXA 1RNTA 3HZPA 2WGOA 2INXA 4BU4A 3X3YA 1RNBA 5G1KA 2BMQB 1V74A 3UL6A 1GD3A 2HMNB 2GU1A 1JKGA 2KXGA 5FGOA 3WA3A 1YI23 1KQS2 3DY5A 2CG0A 3PXMA 1F8NA 1GY5A 1OHSA 3AHSA 3F40A 6RNTA 3CNXA 1Q864 1FZUA 3BNDA 3PCRA 4BL2A 3UL5A 2GXFA 3UNLA 1VQ53 3LT9A 1BAOA 2C4BA 1W6GA 2P38A 1IQYA 2IYJA 4RNYA 3S28A 1FGOA 4R9KA 3NQZA 5AIIA 7STDA 3CCU3 2ZL8A 8CHOA 3NBRA 2M7OA 2F56A 3KCHA 4HM5B 3DUKA 3CC73 2Q07A 1KSIA 1RCKA 3PYJA 2LQVA 4AEQA 4FMCA 5IG5A 3IPTA 1FUSA 1JN5B 4O02B 2XRXB 4KFFA 2V1LA 2W9PA 1UGIA 1J2BA 3EHCA 1A90A 1M904 5ELJA 8RNTA 1OPYA 4STDA 1FW7A 2B24B 3G16A 4XBXA 5EVHA 2UGIA 1TP6A 1R4YA 3N54B 5D82A 2P0MA 3B4PA 1EKMA 3B4OA 5FW5A 1STDA 2F4YA 3F7SA 1JB2A 4L8PA 3RGRA 3SVAA 3TDGA 5M19A 3ZG0A 2CK3H 3MG2A 4LGQA 1G0TA 2GSPA 4EV2A 5A0OB 1KD14 1R4CA 1TFKA 3NM7A 5CLKA 1QAFA 5AEWB 1Q9EA 3GAXA 3CC23 1Q824 3JUQA 5JPPA 1K28A 1B27A 1JB5A 2SBLA 1RSNA 1VQL3 1EUIC 5D81A 4HM1B 1W5ZA 1BRGA 3SLUA 1TTOA 1I3FA 1Q7Y4 2CKFB 5AIFA 3AMOB 1BRJA 5IERA 2YX9A 3GRDA 3I563 3WODG 3DGNA 3JUNA 3G0KA 1UUGB 1MNLA 2MF7A 1HU9A 3NV0B 4KZ1A 1IDPA 2WO0A 3VSYA 1T3BA 3RNTA 4XBYA 2ZHXB 2FGTA 3H51A 4FMAA 4LYLB 1JBSA 2GU3A 2Z76A 3NBBA 2Z7AA 3H3HA 1I70A 3KZTA 3BIRA 4HM7B 4WYKA 4MEIA 2F98A 3CCS3 2XSHB 1GY7A 1OGXA 2L4VA 1LQGC 1VZZA 2W56A 3HIGA 3SEDA 1FUTA 2B1XB 4Q53A 1GOYA 2F99A 3X42A 1US1A 3EX9A 1VQM3 1BNRA 1RCLA 2BMOB 1WMOA 3FCSB 1I0XA 1NU3A 2P0XA 3V99A 1W01A 3FF0A 4IPBA 4N6LA 2P09A 2CFWA 4ILFA 4GB5A 3GZBA 4WFOA 5LC6A 1BNIA 1RDSA 2QIYA 2XGLA 1V57A 1SARA 2ML5A 3A5EA 4OVMA 1OACA 1Q7HA 1MGRA 1MWUA 1M1K4 4LEHA 6STDA 2HMLB 1IVVA 1UCLA 1WQLB 3BB9A 1NB5I 2OOVC 3O8YA 4BIRA 1DMMA 2CFDA 5AI1A 1CYUA 2F5MA 2XR8B 4J5KA 4FCZA 3DZLA 1NB3I 2CH9A 3EB8A 3EQQB 3L0RA 4CCVA 3G713 2W03A 2W9QA 2H0HA 2ZA4A 1YJN3 2WOHA 1G96A 3QRDA 1D6YA 1TFOA 4FCJA 1IT8A 3ROBA 1B3SA 1UW1A 1W2B2 1HYFA 1O7NB 3F7XA 3F9SA 5M18A 1PU4A 2P05A 1M1XB 1RGHA 2CHCA 2CWTA 3F8HA 3MG3A 1I2GA 4HYZA 3CCJ3 1RKYA 3M8CA 2AAEA 4RNZA 3BNCA 3EN8A 3Q90A 1ULJB 1B21A 1DE3A 3GZRA 1OHPA 3T8UA 3G4S3 4XDVA 1AVKA 1BNJA 3U1WA 4MMYB 2RGQA 1V58A 3BLZA 1GMPA 1Q40B 3CNMA 3JUPA 5ELUA 1LOYA 3A76A 3OXAA 3CCL3 2CG1A 5EEOA 1YNVX 3D4AA 3K9MC 1D6UA 1WMPA 2BNGA 2XFTA 1IVWA 1M9GA 3NM2A 3ECFA 4H3UA 2CFKA 2H0IA 1KC84 5AIHA 4DKIA 5DREA 5BVBA 1ZX2A 1O7GB 1UDII 2W2CA 3IMAB 3FG1A 1ISKA 2GBXB 4IIAA 3FSDA 1GMRA 1B20A 4OUQA 5IG0A 1C54A 2IA7A 3S27A 4LMIA 4EYCA 1A2PA 3SYUA 5JBSA 4MMXB 2BO9B 1OCVA 3WDGB 5IEOA 4NREA 1SQWA 1K9M4 3RDEA 3ER7A 1B2ZA 1BSEA 1BANA 3I0YA 1QJGA 1RLSA 1BRKA 1FGRA 5IF6A 3KKGA 3KFQC 3G6E3 1WMNA 1AR0A 3CXC2 3CCV3 3LTCA 2IUJA 5I97A 1O7HB 4XDWA 1LVNA 1D6ZA 3IJEB 1UCJA 1KWIA 1TU5A 3MSOA 2K0MA 1LXEA 1YIT3 1YGWA 4LZIA 3B8LA 3EC9A 5IG4A 3MG1A 3ZFZA 2I9WA 2GEXA 5CF1A 1UI7A 3T0UA 4U13A 4NHFA 1N5PA 4OK0A 2HOHA 1IYYA 1GYBA 1RGEA 1W6YA 3K0ZA 1S723 3DGYA 1JBRA 1UGHI 3CC43 1AQZA 3CU3A 3CCR3 1W7CA
chains in the Genus database with same CATH topology
4FMBA 3S29A 3NQYA 2CIUA 4WHAA 5TGNA 4HM8B 1QAKA 1IV9A 5AYRB 3EN1B 5CK6A 1O7WB 2RFRA 1RN7A 3MYTA 2OTL3 2E2TA 3SOYA 3HI7A 1IV7A 3DMCA 3D9RA 4BTXA 2RCDA 4HJLB 1Z1SA 3STDA 2CW9A 2ZDJA 3VF1A 2W6JH 3LT8A 4HZBB 4EV5A 1SJWA 1DMQA 1IQ8A 3EBYA 1VQ73 1FGQA 1VQ43 1N5HA 1STFI 3OWSA 5KP4A 1QALA 2QGUA 1DMNA 3DGOA 3X41A 5IEPA 1O7PB 1N9JA 3NHXA 2WOFA 3T8NA 4JRFA 2XF3A 3KN4A 3CCQ3 2BT3A 1L5GB 2GEYA 4J8TA 4WYKB 3OW22 1YHQ3 4KFDA 1N8QA 3FLJA 3BNEA 2FXTA 2K54A 3SX1A 1DVDA 3FG4A 3MKIA 1W7CA 4BTWA 2QA43 1NWWA 4KFEA 1OF5A 2IUKA 2YFLB 1ASKA 5STDA 1WNHA 3HX8A 1UUWB 4IT7A 3LZAA 3DXOA 2D42A 4H61A 4EBGA 1SPUA 3WOEB 1A2VA 1K734 1RJOA 3LXUX 3X3XA 3E99A 1BUQA 1IQXA 1SIHA 2JDIH 4HM6B 1Q40A 2F86B 3V98A 3LTBA 1ULIB 3PCSA 4WP5A 1OH0A 3LTDA 3RGAA 4K1UA 5AYSC 3QK9A 3Q2PA 2OQEA 2A15A 1A2KA 1CYVA 1YJ93 3DM8A 4N6UA 3ALAA 5KP1A 2W04A 3JVCA 4N6TA 1YJW3 3KIIA 1W02A 1VQK3 4O8SA 2OWPA 2PNCA 2W0QA 3LOYA 3WMDA 3PZWA 3CMA3 4HKVB 1ZO2A 3EF8A 4HM3B 1OUNA 4ORLA 3EE1A 4CDLA 3V92A 3EBTA 1JB4A 5BXQA 3MPHA 1FGTA 1E3RA 2C10A 2CWVA 4HM2B 3FF2A 5AEUB 3J7Yd 2OCTA 1UUVB 3MHEA 1JN5A 2FNQA 4J9AA 3G8ZA 1IU7A 4EC6A 2WGQA 1E3VA 3OWUA 4MJDA 1U8CB 1TUHA 3CPW2 5KP3A 1JKGB 2HMMB 2O9UX 3CPOA 3K63A 2OTJ3 1PFPA 3X40A 3JUMA 2XEPA 3CCE3 4N6OB 3K5TA 4HM4B 1FUWA 4QWTA 4WWUC 1VQ83 3FH1A 4BTYA 1RRHA 1JV2B 3NUVA 3GZXB 2Y73A 1N9EA 1EQKA 3WOFB 4RZMA 2XGNA 2O3OA 3Q1CA 2Y74A 3CME3 2OOVA 2XH9A 1QMAA 4XM4A 3CCM3 4L7KA 3LYGA 3PGBA 3AMOA 1NO3A 3DGLA 1RRLA 3GWRA 3KE7A 3HK4A 4R9LA 5HGRA 1CEWI 3DGMA 3NV0A 4K61A 3SXXA 1W4NA 2D1WA 1IT7A 1W2ZA 2Z6BA 2OQEC 4X2OA 2R4IA 1ROVA 3CD63 3MWZA 5IW9A 2PZVA 1O7MB 1IK3A 1K8A4 2CFGA 2STDA 1TIJA 3LTAA 4TX4A 1CQSA 1E97A 3WA2X 4K90B 4K1VA 1JJ22 1LOXA 3F14A 4FMDA 1MOLA 5LC7A 3JUOA 4N6V0 1GY6A 2KRTA 1A67A 5CF2A 2GBWB 1VQP3 4AKYA 1NJI4 2YFJB 2E2VA 1JRQA 4FCMA 1OGZA 2MC8A 4EXRA 3X3ZA 4HVNA 4PEJA 1C7HA 4LSOA 4GL6A 1Q814 1Q42A 5DRVA 3NXJA 3KSPA 3NBJA 4FR9A 1FGMA 2LYXA 1YGEA 1FA3A 2W56B 2Z77A 3NX0A 3GZYB 5IENA 4O3VA 3FGYA 2QEX3 1IVXA 3PS8A 3I553 3KSED 1GS3A 2IMJA 4KVHA 2BHMA 2XFSA 2YFIB 2RSXA 3OX9A 3FKAA 1U5OA 5G2GA 4I4KA 1EA2A 3SOAA 5IG3A 1QVF2 3FZWA 1DYUA 3F8XA 1JNQA 3FG3A 1QVG2 1N8R4 3VGNA 3D3LA 1VQO3 4HM0B 1T5YA 4JF8A 1VQ93 4AKZA 1K41A 1YVBI 5EQLA 2CFLA 4R4KA 1DVCA 1Y4KA 2ML6A 3HIIA 4N3VA 1UI8A 5AIGA 1W00A 1VQ63 2CC3A 1W6CA 1OF5B 3K7CA 3LMLA 3N9HA 1LNHA 3LH4A 4N6MA 1WTHA 1YIJ3 1AV4A 2CWUA 4X2HA 2BMRB 4HZ9B 4XB5A 4MMZB 3BNBA 5CXOA 3OWYA 4O2HA 1NDOB 2HMKB 2UX0A 4G1MB 3S5CA 1S723 1ROAA 1OHOA 2JQ5A 2KCDA 3OV4A 3B7CA 5D83A 1GD4A 1VQN3 1AVLA 3UJMA 5JPUA 2XSOB 3S67A 4RBNA 4L8OA 1IVUA 4R80A 3N8BA 4R1KA 2E2UA 4XBTA 2C11A 1S5AA 2HMJB 1SIIA 3UB1A 3U97A 4ZM8A 4HBRA 3EJVA 4N6NB 1EG9B 1HKXA 3HZPA 2WGOA 2INXA 3X3YA 3UL6A 2BMQB 1V74A 1GD3A 2HMNB 2GU1A 1JKGA 2KXGA 5FGOA 3WA3A 1YI23 1KQS2 3DY5A 2CG0A 3PXMA 1F8NA 1GY5A 1OHSA 3F40A 3CNXA 1Q864 3BNDA 3PCRA 3UL5A 2GXFA 3UNLA 1VQ53 3LT9A 1W6GA 2P38A 1IQYA 4RNYA 3S28A 7STDA 1FGOA 4R9KA 3NQZA 5AIIA 3CCU3 2ZL8A 8CHOA 3NBRA 2M7OA 4HM5B 3CC73 3DUKA 2Q07A 1KSIA 3PYJA 2LQVA 4AEQA 4FMCA 5IG5A 3IPTA 1JN5B 4O02B 2XRXB 4KFFA 2V1LA 2W9PA 1J2BA 3EHCA 1A90A 1M904 5ELJA 1OPYA 4STDA 2B24B 3G16A 4XBXA 5EVHA 1TP6A 3N54B 5D82A 2P0MA 3B4PA 1EKMA 3B4OA 5FW5A 1STDA 3F7SA 1JB2A 4L8PA 3RGRA 3SVAA 3TDGA 2CK3H 3MG2A 4LGQA 4EV2A 5A0OB 1KD14 1R4CA 1TFKA 3NM7A 5CLKA 1QAFA 5AEWB 3GAXA 3CC23 1Q824 3JUQA 5JPPA 1K28A 1JB5A 2SBLA 1VQL3 5D81A 4HM1B 1W5ZA 3SLUA 1Q7Y4 2CKFB 5AIFA 3AMOB 5IERA 2YX9A 3GRDA 3I563 3WODG 3DGNA 3JUNA 3G0KA 1MNLA 2MF7A 1HU9A 3NV0B 4KZ1A 1IDPA 2WO0A 3VSYA 4XBYA 2FGTA 3H51A 4FMAA 2GU3A 2Z76A 3NBBA 2Z7AA 3H3HA 3KZTA 4HM7B 4WYKA 4MEIA 2F98A 3CCS3 2XSHB 1GY7A 1OGXA 2L4VA 1VZZA 3HIGA 2W56A 3SEDA 2B1XB 4Q53A 2F99A 3X42A 1US1A 3EX9A 1VQM3 2BMOB 1WMOA 3FCSB 1NU3A 2P0XA 3V99A 1W01A 3FF0A 4IPBA 4N6LA 2P09A 2CFWA 4GB5A 3GZBA 4WFOA 5LC6A 2QIYA 2XGLA 2ML5A 4OVMA 1OACA 1M1K4 4LEHA 6STDA 2HMLB 1IVVA 1WQLB 3BB9A 1NB5I 2OOVC 3O8YA 1DMMA 2CFDA 5AI1A 1CYUA 2XR8B 4FCZA 3DZLA 1NB3I 2CH9A 3EB8A 3EQQB 3L0RA 4CCVA 3G713 2W03A 2W9QA 1YJN3 2WOHA 1G96A 3QRDA 1D6YA 1TFOA 4FCJA 1IT8A 3ROBA 1UW1A 1W2B2 3F7XA 1O7NB 3F9SA 1PU4A 2P05A 1M1XB 2CHCA 2CWTA 3CCJ3 3F8HA 3MG3A 4HYZA 1RKYA 3M8CA 4RNZA 3BNCA 3EN8A 3Q90A 1ULJB 3GZRA 1OHPA 3T8UA 3G4S3 4XDVA 1AVKA 3U1WA 4MMYB 2RGQA 3BLZA 1Q40B 3CNMA 3JUPA 5ELUA 3A76A 3OXAA 3CCL3 2CG1A 5EEOA 3K9MC 1D6UA 1WMPA 2BNGA 2XFTA 1IVWA 1M9GA 3NM2A 3ECFA 4H3UA 2CFKA 1KC84 5AIHA 5DREA 5BVBA 1ZX2A 1O7GB 2W2CA 3IMAB 3FG1A 1ISKA 2GBXB 4IIAA 3FSDA 5IG0A 4OUQA 2IA7A 3S27A 4LMIA 4EYCA 5JBSA 4MMXB 2BO9B 1OCVA 3WDGB 5IEOA 4NREA 1SQWA 1K9M4 3RDEA 3ER7A 3I0YA 1QJGA 1FGRA 5IF6A 3KKGA 3KFQC 3G6E3 1WMNA 1AR0A 3CXC2 3CCV3 3LTCA 2IUJA 5I97A 1O7HB 4XDWA 1LVNA 1D6ZA 3IJEB 1TU5A 1KWIA 3MSOA 2K0MA 1LXEA 1YIT3 4LZIA 3B8LA 3EC9A 5IG4A 3MG1A 2I9WA 2GEXA 5CF1A 1UI7A 3T0UA 4U13A 4NHFA 1N5PA 4OK0A 1GYBA 1W6YA 3K0ZA 3CC43 3CU3A 3CCR3 2HMOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TGN A;  4HM8 B;  3EN1 B;  5CK6 A;  1O7W B;  2RFR A;  3MYT A;  3SOY A;  3DMC A;  3D9R A;  2RCD A;  4HJL B;  1Z1S A;  3STD A;  4HZB B;  1SJW A;  1DMQ A;  3EBY A;  3OWS A;  5KP4 A;  2QGU A;  1DMN A;  5IEP A;  1O7P B;  3NHX A;  3T8N A;  2GEY A;  4J8T A;  4WYK B;  3FLJ A;  2K54 A;  3MKI A;  1NWW A;  1OF5 A;  2YFL B;  1ASK A;  5STD A;  3HX8 A;  1UUW B;  3LZA A;  3DXO A;  3E99 A;  1BUQ A;  4HM6 B;  1Q40 A;  2F86 B;  1ULI B;  4WP5 A;  1OH0 A;  3RGA A;  4K1U A;  2A15 A;  1A2K A;  3DM8 A;  5KP1 A;  1W02 A;  2OWP A;  3WMD A;  4HKV B;  1ZO2 A;  3EF8 A;  4HM3 B;  1OUN A;  4ORL A;  4CDL A;  3EBT A;  1JB4 A;  5BXQ A;  1E3R A;  4HM2 B;  3FF2 A;  5AEU B;  1UUV B;  3MHE A;  4J9A A;  1JN5 A;  3G8Z A;  1E3V A;  3OWU A;  4MJD A;  1TUH A;  5KP3 A;  1JKG B;  2HMM B;  3CPO A;  3JUM A;  4HM4 B;  4WWU C;  3FH1 A;  3NUV A;  3GZX B;  4RZM A;  1QMA A;  4XM4 A;  4L7K A;  3LYG A;  3GWR A;  3KE7 A;  3HK4 A;  4R9L A;  5HGR A;  3NV0 A;  4X2O A;  2R4I A;  2PZV A;  1O7M B;  2STD A;  1CQS A;  1E97 A;  4K1V A;  3F14 A;  3JUO A;  1GY6 A;  5CF2 A;  2GBW B;  2YFJ B;  4FCM A;  1OGZ A;  4HVN A;  4PEJ A;  1C7H A;  1Q42 A;  5DRV A;  3NXJ A;  3KSP A;  2Z77 A;  3GZY B;  5IEN A;  3FGY A;  1GS3 A;  2IMJ A;  4KVH A;  2YFI B;  3OX9 A;  3FKA A;  1U5O A;  5G2G A;  4I4K A;  1EA2 A;  3SOA A;  5IG3 A;  3FZW A;  3F8X A;  3VGN A;  4HM0 B;  1K41 A;  4N3V A;  5AIG A;  1W00 A;  3K7C A;  1OF5 B;  4X2H A;  2BMR B;  4HZ9 B;  5CXO A;  4XB5 A;  3OWY A;  1NDO B;  2HMK B;  2UX0 A;  3S5C A;  2JQ5 A;  1OHO A;  3OV4 A;  3B7C A;  5D83 A;  3UJM A;  5JPU A;  2XSO B;  4L8O A;  4R1K A;  4XBT A;  2HMJ B;  1S5A A;  3EJV A;  1EG9 B;  1HKX A;  3HZP A;  2INX A;  2BMQ B;  2HMN B;  1JKG A;  1GY5 A;  1OHS A;  3F40 A;  3CNX A;  2GXF A;  3UNL A;  7STD A;  4R9K A;  5AII A;  8CHO A;  3NBR A;  4HM5 B;  3DUK A;  5IG5 A;  3IPT A;  1JN5 B;  2XRX B;  3EHC A;  1OPY A;  4STD A;  2B24 B;  3G16 A;  4XBX A;  5EVH A;  1TP6 A;  5D82 A;  3B4P A;  3B4O A;  5FW5 A;  1STD A;  3F7S A;  1JB2 A;  4L8P A;  3RGR A;  3MG2 A;  4LGQ A;  5AEW B;  5CLK A;  3JUQ A;  5JPP A;  1JB5 A;  5D81 A;  4HM1 B;  2CKF B;  5AIF A;  5IER A;  3GRD A;  3JUN A;  3G0K A;  3NV0 B;  1IDP A;  3VSY A;  4XBY A;  3H51 A;  2Z76 A;  2Z7A A;  3H3H A;  3KZT A;  4HM7 B;  4WYK A;  2F98 A;  2XSH B;  1GY7 A;  1OGX A;  1VZZ A;  3SED A;  2B1X B;  4Q53 A;  2F99 A;  3EX9 A;  2BMO B;  1NU3 A;  1W01 A;  3FF0 A;  4GB5 A;  3GZB A;  2QIY A;  4OVM A;  4LEH A;  6STD A;  2HML B;  1WQL B;  3BB9 A;  1DMM A;  5AI1 A;  2XR8 B;  3DZL A;  3EQQ B;  3ROB A;  4FCJ A;  3F7X A;  1O7N B;  3F9S A;  2CHC A;  3F8H A;  3MG3 A;  3M8C A;  3EN8 A;  3Q90 A;  1ULJ B;  3GZR A;  1OHP A;  3T8U A;  4XDV A;  2RGQ A;  3BLZ A;  1Q40 B;  3CNM A;  3JUP A;  3A76 A;  3OXA A;  2BNG A;  3NM2 A;  3ECF A;  4H3U A;  5AIH A;  5DRE A;  5BVB A;  1ZX2 A;  1O7G B;  2W2C A;  1ISK A;  2GBX B;  4IIA A;  3FSD A;  5IG0 A;  4OUQ A;  4LMI A;  1OCV A;  5IEO A;  3ER7 A;  3I0Y A;  1QJG A;  5IF6 A;  3KKG A;  1AR0 A;  1O7H B;  4XDW A;  3MSO A;  3B8L A;  3EC9 A;  5IG4 A;  3MG1 A;  2I9W A;  2GEX A;  5CF1 A;  4U13 A;  1GYB A;  1W6Y A;  3K0Z A;  3CU3 A;  2HMO B; 
#chains in the Genus database with same CATH topology
 4FMB A;  3S29 A;  1B2X A;  3NQY A;  2CIU A;  1DET A;  1RN1 A;  4WHA A;  5TGN A;  4HM8 B;  1QAK A;  1IV9 A;  5AYR B;  3EN1 B;  5CK6 A;  1O7W B;  2RFR A;  1HZ1 A;  1RN7 A;  3MYT A;  2OTL 3;  2E2T A;  3SOY A;  3HI7 A;  1BNG A;  1IV7 A;  3DMC A;  1X1X A;  3D9R A;  4BTX A;  1BGS A;  2RCD A;  5HOH A;  5M1A A;  4HJL B;  1Z1S A;  2AAD A;  2CW9 A;  2CX0 A;  2ZDJ A;  2W6J H;  3LT8 A;  3STD A;  3VF1 A;  4HZB B;  1I3I A;  4EV5 A;  1SJW A;  1BOX A;  5BIR A;  3D5I A;  1DMQ A;  5GSP A;  1FYS A;  1IQ8 A;  3EBY A;  1EEJ A;  1VQ7 3;  4CPK A;  5G1L A;  1FGQ A;  1VQ4 3;  1MWT A;  1N5H A;  1RGC A;  1STF I;  3OWS A;  5KP4 A;  1QAL A;  2QGU A;  1DMN A;  3DGO A;  3X41 A;  5IEP A;  1O7P B;  1N9J A;  3NHX A;  1ZS7 A;  1RTU A;  2WOF A;  1BSA A;  4NPB A;  3T8N A;  4JRF A;  1TRQ A;  3AHW A;  2XF3 A;  3KN4 A;  3CCQ 3;  2BT3 A;  1L5G B;  2GEY A;  1BUJ A;  1NNV A;  4J8T A;  1AY7 A;  4WYK B;  3OW2 2;  4RNT A;  1YHQ 3;  9RNT A;  4KFD A;  1N8Q A;  3FLJ A;  3BNE A;  2FXT A;  2K54 A;  6GSP A;  3SX1 A;  1DVD A;  3FG4 A;  3MKI A;  4BTW A;  2QA4 3;  1BU4 A;  1NWW A;  4KFE A;  1OF5 A;  1UCI A;  2IUK A;  2YFL B;  1ASK A;  5STD A;  1WNH A;  3HX8 A;  1UUW B;  1VQQ A;  4IT7 A;  3LZA A;  3DXO A;  2D42 A;  1X1W A;  1RHL A;  4H61 A;  4EBG A;  1SPU A;  3WOE B;  1A2V A;  1K73 4;  2BIR A;  1RJO A;  3LXU X;  3X3X A;  3E99 A;  1BUQ A;  1IQX A;  2SAR A;  4HOH A;  3HOH A;  1SIH A;  2JDI H;  4HM6 B;  1MGW A;  1Q40 A;  2RNT A;  2F86 B;  3V98 A;  3LTB A;  1RGG A;  1ULI B;  3PCS A;  4WP5 A;  1OH0 A;  3LTD A;  3RGA A;  4K1U A;  5AYS C;  3QK9 A;  3Q2P A;  2L1S A;  2J8X B;  1PY3 A;  2OQE A;  2A15 A;  1GOU A;  1A2K A;  1CYV A;  1YJ9 3;  1I2F A;  1BVI A;  1X1Y A;  3DM8 A;  1JZD A;  4N6U A;  3ALA A;  5KP1 A;  2W04 A;  3JVC A;  4N6T A;  1YJW 3;  3KII A;  1W02 A;  1VQK 3;  4O8S A;  2OWP A;  2PNC A;  2W0Q A;  3LOY A;  3WMD A;  3PZW A;  7RNT A;  3CMA 3;  4HKV B;  1ZO2 A;  3EF8 A;  4HM3 B;  1I8V A;  1OUN A;  3GSP A;  1B2U A;  4ORL A;  3EE1 A;  4CDL A;  1RGK A;  1B2S A;  3V92 A;  3EBT A;  1JB4 A;  5BXQ A;  3MPH A;  1FGT A;  1E3R A;  2C10 A;  2CWV A;  4HM2 B;  3FF2 A;  1LOV A;  3ZG5 A;  5AEU B;  3J7Y d;  2OCT A;  1UUV B;  3MHE A;  1JN5 A;  2FNQ A;  4J9A A;  3G8Z A;  1IU7 A;  4EC6 A;  2WGQ A;  1E3V A;  3OWU A;  4J5G A;  4MJD A;  1U8C B;  4I5Q A;  1BSB A;  1TUH A;  3CPW 2;  5KP3 A;  1BRN L;  1JKG B;  2HMM B;  2O9U X;  3CPO A;  3K63 A;  2OTJ 3;  1PFP A;  3X40 A;  3JUM A;  2XEP A;  3CCE 3;  1I2E A;  4N6O B;  3WHO A;  3K5T A;  4HM4 B;  1FUW A;  4QWT A;  4WWU C;  3D5G A;  1VQ8 3;  3FH1 A;  4BTY A;  1RRH A;  1LNI A;  1JV2 B;  3NUV A;  3GZX B;  2Y73 A;  1N9E A;  4EW5 A;  3WOF B;  1EQK A;  4RZM A;  2XGN A;  1RGL A;  2O3O A;  3Q1C A;  4GHO A;  2Y74 A;  1CH0 A;  1BIR A;  3CME 3;  2OOV A;  1BNS A;  1TRP A;  1LRA A;  1GOV A;  2XH9 A;  4GSP A;  1QMA A;  4XM4 A;  3CCM 3;  4L7K A;  1ZGX A;  3LYG A;  3PGB A;  1X1U A;  3AMO A;  1NO3 A;  3WR2 A;  3DGL A;  1YVS A;  1RRL A;  3GWR A;  3KE7 A;  4HAA A;  3HK4 A;  4R9L A;  5HGR A;  1CEW I;  3DGM A;  3NV0 A;  4K61 A;  3SXX A;  1W4N A;  2D1W A;  7GSP A;  1IT7 A;  1W2Z A;  2Z6B A;  2OQE C;  4X2O A;  1TJD A;  2R41 A;  2R4I A;  1ROV A;  3CD6 3;  3MWZ A;  2KF4 A;  5IW9 A;  2PZV A;  1O7M B;  1IK3 A;  1BRH A;  1K8A 4;  2CFG A;  2STD A;  1TIJ A;  1T2I A;  3LTA A;  4TX4 A;  1CQS A;  1E97 A;  3WA2 X;  4K90 B;  4K1V A;  1JJ2 2;  1LOX A;  3F14 A;  4FMD A;  1MOL A;  1LOW A;  1RN4 A;  2H0G A;  5LC7 A;  1JBT A;  3JUO A;  4N6V 0;  1GY6 A;  2KRT A;  1A67 A;  1UCK A;  5CF2 A;  2GBW B;  1VQP 3;  4AKY A;  3DH2 A;  1NJI 4;  2YFJ B;  2E2V A;  1JRQ A;  4FCM A;  1OGZ A;  2MC8 A;  4CJN A;  4EXR A;  3X3Z A;  3Q3F A;  4HVN A;  3BU4 A;  1PYL A;  4PEJ A;  1C7H A;  4LSO A;  4GL6 A;  1Q81 4;  5BU4 A;  1Q42 A;  5DRV A;  3NXJ A;  3KSP A;  3NBJ A;  4FR9 A;  1BSD A;  1FGM A;  2LYX A;  1YGE A;  1FA3 A;  2W56 B;  2Z77 A;  3NX0 A;  3GZY B;  5IEN A;  4O3V A;  3FGY A;  2K3D A;  1I0V A;  2QEX 3;  1IVX A;  3PS8 A;  3I55 3;  3KSE D;  1RMS A;  1GS3 A;  2IMJ A;  4KVH A;  2BHM A;  2XFS A;  1BSC A;  2YFI B;  2RSX A;  3OX9 A;  3FKA A;  1U5O A;  5G2G A;  4I4K A;  2BU4 A;  1BRI A;  1BNE A;  1EA2 A;  3SOA A;  5IG3 A;  1QVF 2;  1GMQ A;  2CX1 A;  3FZW A;  1BNF A;  1BRS A;  4BL3 A;  1DYU A;  3F8X A;  1JNQ A;  3FG3 A;  1QVG 2;  1N8R 4;  2KF6 A;  2IY2 A;  3D3L A;  3VGN A;  5RNT A;  1VQO 3;  4HM0 B;  1T5Y A;  4JF8 A;  1VQ9 3;  4AKZ A;  1GSP A;  1B2M A;  1K41 A;  1YVB I;  3URP A;  5EQL A;  2CFL A;  4R4K A;  2KF3 A;  2RBI A;  1DVC A;  1Y4K A;  1MWS A;  2HMO B;  2KAA A;  2ML6 A;  1UI8 A;  3HII A;  4N3V A;  5AIG A;  1W00 A;  1VQ6 3;  2CC3 A;  1W6C A;  1OF5 B;  3K7C A;  3LML A;  3N9H A;  1LQM B;  1LNH A;  2KF5 A;  3LH4 A;  4N6M A;  1WTH A;  1YIJ 3;  1RGA A;  1AV4 A;  2CWU A;  4X2H A;  1T2H A;  2BMR B;  4HZ9 B;  4XB5 A;  4MMZ B;  3BNB A;  1MWR A;  5CXO A;  3OWY A;  4O2H A;  1NDO B;  2HMK B;  2UX0 A;  2UUG C;  4G1M B;  3S5C A;  1ROA A;  1OHO A;  2JQ5 A;  2KCD A;  3OV4 A;  1RGF A;  3AGO A;  3B7C A;  5D83 A;  3AGN A;  1GD4 A;  1VQN 3;  1AVL A;  1JZO A;  3UJM A;  5JPU A;  2XSO B;  4KT3 B;  2F5W A;  3D79 A;  4RBN A;  3S67 A;  4L8O A;  1IVU A;  4R80 A;  3N8B A;  4R1K A;  2E2U A;  4XBT A;  2C11 A;  1S5A A;  2HMJ B;  1SII A;  3UB1 A;  3U97 A;  4ZM8 A;  4HBR A;  3EJV A;  4N6N B;  1G02 A;  1EG9 B;  1HKX A;  1RNT A;  3HZP A;  2WGO A;  2INX A;  4BU4 A;  3X3Y A;  1RNB A;  5G1K A;  2BMQ B;  1V74 A;  3UL6 A;  1GD3 A;  2HMN B;  2GU1 A;  1JKG A;  2KXG A;  5FGO A;  3WA3 A;  1YI2 3;  1KQS 2;  3DY5 A;  2CG0 A;  3PXM A;  1F8N A;  1GY5 A;  1OHS A;  3AHS A;  3F40 A;  6RNT A;  3CNX A;  1Q86 4;  1FZU A;  3BND A;  3PCR A;  4BL2 A;  3UL5 A;  2GXF A;  3UNL A;  1VQ5 3;  3LT9 A;  1BAO A;  2C4B A;  1W6G A;  2P38 A;  1IQY A;  2IYJ A;  4RNY A;  3S28 A;  1FGO A;  4R9K A;  3NQZ A;  5AII A;  7STD A;  3CCU 3;  2ZL8 A;  8CHO A;  3NBR A;  2M7O A;  2F56 A;  3KCH A;  4HM5 B;  3DUK A;  3CC7 3;  2Q07 A;  1KSI A;  1RCK A;  3PYJ A;  2LQV A;  4AEQ A;  4FMC A;  5IG5 A;  3IPT A;  1FUS A;  1JN5 B;  4O02 B;  2XRX B;  4KFF A;  2V1L A;  2W9P A;  1UGI A;  1J2B A;  3EHC A;  1A90 A;  1M90 4;  5ELJ A;  8RNT A;  1OPY A;  4STD A;  1FW7 A;  2B24 B;  3G16 A;  4XBX A;  5EVH A;  2UGI A;  1TP6 A;  1R4Y A;  3N54 B;  5D82 A;  2P0M A;  3B4P A;  1EKM A;  3B4O A;  5FW5 A;  1STD A;  2F4Y A;  3F7S A;  1JB2 A;  4L8P A;  3RGR A;  3SVA A;  3TDG A;  5M19 A;  3ZG0 A;  2CK3 H;  3MG2 A;  4LGQ A;  1G0T A;  2GSP A;  4EV2 A;  5A0O B;  1KD1 4;  1R4C A;  1TFK A;  3NM7 A;  5CLK A;  1QAF A;  5AEW B;  1Q9E A;  3GAX A;  3CC2 3;  1Q82 4;  3JUQ A;  5JPP A;  1K28 A;  1B27 A;  1JB5 A;  2SBL A;  1RSN A;  1VQL 3;  1EUI C;  5D81 A;  4HM1 B;  1W5Z A;  1BRG A;  3SLU A;  1TTO A;  1I3F A;  1Q7Y 4;  2CKF B;  5AIF A;  3AMO B;  1BRJ A;  5IER A;  2YX9 A;  3GRD A;  3I56 3;  3WOD G;  3DGN A;  3JUN A;  3G0K A;  1UUG B;  1MNL A;  2MF7 A;  1HU9 A;  3NV0 B;  4KZ1 A;  1IDP A;  2WO0 A;  3VSY A;  1T3B A;  3RNT A;  4XBY A;  2ZHX B;  2FGT A;  3H51 A;  4FMA A;  4LYL B;  1JBS A;  2GU3 A;  2Z76 A;  3NBB A;  2Z7A A;  3H3H A;  1I70 A;  3KZT A;  3BIR A;  4HM7 B;  4WYK A;  4MEI A;  2F98 A;  3CCS 3;  2XSH B;  1GY7 A;  1OGX A;  2L4V A;  1LQG C;  1VZZ A;  2W56 A;  3HIG A;  3SED A;  1FUT A;  2B1X B;  4Q53 A;  1GOY A;  2F99 A;  3X42 A;  1US1 A;  3EX9 A;  1VQM 3;  1BNR A;  1RCL A;  2BMO B;  1WMO A;  3FCS B;  1I0X A;  1NU3 A;  2P0X A;  3V99 A;  1W01 A;  3FF0 A;  4IPB A;  4N6L A;  2P09 A;  2CFW A;  4ILF A;  4GB5 A;  3GZB A;  4WFO A;  5LC6 A;  1BNI A;  1RDS A;  2QIY A;  2XGL A;  1V57 A;  1SAR A;  2ML5 A;  3A5E A;  4OVM A;  1OAC A;  1Q7H A;  1MGR A;  1MWU A;  1M1K 4;  4LEH A;  6STD A;  2HML B;  1IVV A;  1UCL A;  1WQL B;  3BB9 A;  1NB5 I;  2OOV C;  3O8Y A;  4BIR A;  1DMM A;  2CFD A;  5AI1 A;  1CYU A;  2F5M A;  2XR8 B;  4J5K A;  4FCZ A;  3DZL A;  1NB3 I;  2CH9 A;  3EB8 A;  3EQQ B;  3L0R A;  4CCV A;  3G71 3;  2W03 A;  2W9Q A;  2H0H A;  2ZA4 A;  1YJN 3;  2WOH A;  1G96 A;  3QRD A;  1D6Y A;  1TFO A;  4FCJ A;  1IT8 A;  3ROB A;  1B3S A;  1UW1 A;  1W2B 2;  1HYF A;  1O7N B;  3F7X A;  3F9S A;  5M18 A;  1PU4 A;  2P05 A;  1M1X B;  1RGH A;  2CHC A;  2CWT A;  3F8H A;  3MG3 A;  1I2G A;  4HYZ A;  3CCJ 3;  1RKY A;  3M8C A;  2AAE A;  4RNZ A;  3BNC A;  3EN8 A;  3Q90 A;  1ULJ B;  1B21 A;  1DE3 A;  3GZR A;  1OHP A;  3T8U A;  3G4S 3;  4XDV A;  1AVK A;  1BNJ A;  3U1W A;  4MMY B;  2RGQ A;  1V58 A;  3BLZ A;  1GMP A;  1Q40 B;  3CNM A;  3JUP A;  5ELU A;  1LOY A;  3A76 A;  3OXA A;  3CCL 3;  2CG1 A;  5EEO A;  1YNV X;  3D4A A;  3K9M C;  1D6U A;  1WMP A;  2BNG A;  2XFT A;  1IVW A;  1M9G A;  3NM2 A;  3ECF A;  4H3U A;  2CFK A;  2H0I A;  1KC8 4;  5AIH A;  4DKI A;  5DRE A;  5BVB A;  1ZX2 A;  1O7G B;  1UDI I;  2W2C A;  3IMA B;  3FG1 A;  1ISK A;  2GBX B;  4IIA A;  3FSD A;  1GMR A;  1B20 A;  4OUQ A;  5IG0 A;  1C54 A;  2IA7 A;  3S27 A;  4LMI A;  4EYC A;  1A2P A;  3SYU A;  5JBS A;  4MMX B;  2BO9 B;  1OCV A;  3WDG B;  5IEO A;  4NRE A;  1SQW A;  1K9M 4;  3RDE A;  3ER7 A;  1B2Z A;  1BSE A;  1BAN A;  3I0Y A;  1QJG A;  1RLS A;  1BRK A;  1FGR A;  5IF6 A;  3KKG A;  3KFQ C;  3G6E 3;  1WMN A;  1AR0 A;  3CXC 2;  3CCV 3;  3LTC A;  2IUJ A;  5I97 A;  1O7H B;  4XDW A;  1LVN A;  1D6Z A;  3IJE B;  1UCJ A;  1KWI A;  1TU5 A;  3MSO A;  2K0M A;  1LXE A;  1YIT 3;  1YGW A;  4LZI A;  3B8L A;  3EC9 A;  5IG4 A;  3MG1 A;  3ZFZ A;  2I9W A;  2GEX A;  5CF1 A;  1UI7 A;  3T0U A;  4U13 A;  4NHF A;  1N5P A;  4OK0 A;  2HOH A;  1IYY A;  1GYB A;  1RGE A;  1W6Y A;  3K0Z A;  1S72 3;  3DGY A;  1JBR A;  1UGH I;  3CC4 3;  1AQZ A;  3CU3 A;  3CCR 3;  1W7C A; 
#chains in the Genus database with same CATH homology
 4FMB A;  3S29 A;  3NQY A;  2CIU A;  4WHA A;  5TGN A;  4HM8 B;  1QAK A;  1IV9 A;  5AYR B;  3EN1 B;  5CK6 A;  1O7W B;  2RFR A;  1RN7 A;  3MYT A;  2OTL 3;  2E2T A;  3SOY A;  3HI7 A;  1IV7 A;  3DMC A;  3D9R A;  4BTX A;  2RCD A;  4HJL B;  1Z1S A;  3STD A;  2CW9 A;  2ZDJ A;  3VF1 A;  2W6J H;  3LT8 A;  4HZB B;  4EV5 A;  1SJW A;  1DMQ A;  1IQ8 A;  3EBY A;  1VQ7 3;  1FGQ A;  1VQ4 3;  1N5H A;  1STF I;  3OWS A;  5KP4 A;  1QAL A;  2QGU A;  1DMN A;  3DGO A;  3X41 A;  5IEP A;  1O7P B;  1N9J A;  3NHX A;  2WOF A;  3T8N A;  4JRF A;  2XF3 A;  3KN4 A;  3CCQ 3;  2BT3 A;  1L5G B;  2GEY A;  4J8T A;  4WYK B;  3OW2 2;  1YHQ 3;  4KFD A;  1N8Q A;  3FLJ A;  3BNE A;  2FXT A;  2K54 A;  3SX1 A;  1DVD A;  3FG4 A;  3MKI A;  1W7C A;  4BTW A;  2QA4 3;  1NWW A;  4KFE A;  1OF5 A;  2IUK A;  2YFL B;  1ASK A;  5STD A;  1WNH A;  3HX8 A;  1UUW B;  4IT7 A;  3LZA A;  3DXO A;  2D42 A;  4H61 A;  4EBG A;  1SPU A;  3WOE B;  1A2V A;  1K73 4;  1RJO A;  3LXU X;  3X3X A;  3E99 A;  1BUQ A;  1IQX A;  1SIH A;  2JDI H;  4HM6 B;  1Q40 A;  2F86 B;  3V98 A;  3LTB A;  1ULI B;  3PCS A;  4WP5 A;  1OH0 A;  3LTD A;  3RGA A;  4K1U A;  5AYS C;  3QK9 A;  3Q2P A;  2OQE A;  2A15 A;  1A2K A;  1CYV A;  1YJ9 3;  3DM8 A;  4N6U A;  3ALA A;  5KP1 A;  2W04 A;  3JVC A;  4N6T A;  1YJW 3;  3KII A;  1W02 A;  1VQK 3;  4O8S A;  2OWP A;  2PNC A;  2W0Q A;  3LOY A;  3WMD A;  3PZW A;  3CMA 3;  4HKV B;  1ZO2 A;  3EF8 A;  4HM3 B;  1OUN A;  4ORL A;  3EE1 A;  4CDL A;  3V92 A;  3EBT A;  1JB4 A;  5BXQ A;  3MPH A;  1FGT A;  1E3R A;  2C10 A;  2CWV A;  4HM2 B;  3FF2 A;  5AEU B;  3J7Y d;  2OCT A;  1UUV B;  3MHE A;  1JN5 A;  2FNQ A;  4J9A A;  3G8Z A;  1IU7 A;  4EC6 A;  2WGQ A;  1E3V A;  3OWU A;  4MJD A;  1U8C B;  1TUH A;  3CPW 2;  5KP3 A;  1JKG B;  2HMM B;  2O9U X;  3CPO A;  3K63 A;  2OTJ 3;  1PFP A;  3X40 A;  3JUM A;  2XEP A;  3CCE 3;  4N6O B;  3K5T A;  4HM4 B;  1FUW A;  4QWT A;  4WWU C;  1VQ8 3;  3FH1 A;  4BTY A;  1RRH A;  1JV2 B;  3NUV A;  3GZX B;  2Y73 A;  1N9E A;  1EQK A;  3WOF B;  4RZM A;  2XGN A;  2O3O A;  3Q1C A;  2Y74 A;  3CME 3;  2OOV A;  2XH9 A;  1QMA A;  4XM4 A;  3CCM 3;  4L7K A;  3LYG A;  3PGB A;  3AMO A;  1NO3 A;  3DGL A;  1RRL A;  3GWR A;  3KE7 A;  3HK4 A;  4R9L A;  5HGR A;  1CEW I;  3DGM A;  3NV0 A;  4K61 A;  3SXX A;  1W4N A;  2D1W A;  1IT7 A;  1W2Z A;  2Z6B A;  2OQE C;  4X2O A;  2R4I A;  1ROV A;  3CD6 3;  3MWZ A;  5IW9 A;  2PZV A;  1O7M B;  1IK3 A;  1K8A 4;  2CFG A;  2STD A;  1TIJ A;  3LTA A;  4TX4 A;  1CQS A;  1E97 A;  3WA2 X;  4K90 B;  4K1V A;  1JJ2 2;  1LOX A;  3F14 A;  4FMD A;  1MOL A;  5LC7 A;  3JUO A;  4N6V 0;  1GY6 A;  2KRT A;  1A67 A;  5CF2 A;  2GBW B;  1VQP 3;  4AKY A;  1NJI 4;  2YFJ B;  2E2V A;  1JRQ A;  4FCM A;  1OGZ A;  2MC8 A;  4EXR A;  3X3Z A;  4HVN A;  4PEJ A;  1C7H A;  4LSO A;  4GL6 A;  1Q81 4;  1Q42 A;  5DRV A;  3NXJ A;  3KSP A;  3NBJ A;  4FR9 A;  1FGM A;  2LYX A;  1YGE A;  1FA3 A;  2W56 B;  2Z77 A;  3NX0 A;  3GZY B;  5IEN A;  4O3V A;  3FGY A;  2QEX 3;  1IVX A;  3PS8 A;  3I55 3;  3KSE D;  1GS3 A;  2IMJ A;  4KVH A;  2BHM A;  2XFS A;  2YFI B;  2RSX A;  3OX9 A;  3FKA A;  1U5O A;  5G2G A;  4I4K A;  1EA2 A;  3SOA A;  5IG3 A;  1QVF 2;  3FZW A;  1DYU A;  3F8X A;  1JNQ A;  3FG3 A;  1QVG 2;  1N8R 4;  3VGN A;  3D3L A;  1VQO 3;  4HM0 B;  1T5Y A;  4JF8 A;  1VQ9 3;  4AKZ A;  1K41 A;  1YVB I;  5EQL A;  2CFL A;  4R4K A;  1DVC A;  1Y4K A;  2ML6 A;  3HII A;  4N3V A;  1UI8 A;  5AIG A;  1W00 A;  1VQ6 3;  2CC3 A;  1W6C A;  1OF5 B;  3K7C A;  3LML A;  3N9H A;  1LNH A;  3LH4 A;  4N6M A;  1WTH A;  1YIJ 3;  1AV4 A;  2CWU A;  4X2H A;  2BMR B;  4HZ9 B;  4XB5 A;  4MMZ B;  3BNB A;  5CXO A;  3OWY A;  4O2H A;  1NDO B;  2HMK B;  2UX0 A;  4G1M B;  3S5C A;  1S72 3;  1ROA A;  1OHO A;  2JQ5 A;  2KCD A;  3OV4 A;  3B7C A;  5D83 A;  1GD4 A;  1VQN 3;  1AVL A;  3UJM A;  5JPU A;  2XSO B;  3S67 A;  4RBN A;  4L8O A;  1IVU A;  4R80 A;  3N8B A;  4R1K A;  2E2U A;  4XBT A;  2C11 A;  1S5A A;  2HMJ B;  1SII A;  3UB1 A;  3U97 A;  4ZM8 A;  4HBR A;  3EJV A;  4N6N B;  1EG9 B;  1HKX A;  3HZP A;  2WGO A;  2INX A;  3X3Y A;  3UL6 A;  2BMQ B;  1V74 A;  1GD3 A;  2HMN B;  2GU1 A;  1JKG A;  2KXG A;  5FGO A;  3WA3 A;  1YI2 3;  1KQS 2;  3DY5 A;  2CG0 A;  3PXM A;  1F8N A;  1GY5 A;  1OHS A;  3F40 A;  3CNX A;  1Q86 4;  3BND A;  3PCR A;  3UL5 A;  2GXF A;  3UNL A;  1VQ5 3;  3LT9 A;  1W6G A;  2P38 A;  1IQY A;  4RNY A;  3S28 A;  7STD A;  1FGO A;  4R9K A;  3NQZ A;  5AII A;  3CCU 3;  2ZL8 A;  8CHO A;  3NBR A;  2M7O A;  4HM5 B;  3CC7 3;  3DUK A;  2Q07 A;  1KSI A;  3PYJ A;  2LQV A;  4AEQ A;  4FMC A;  5IG5 A;  3IPT A;  1JN5 B;  4O02 B;  2XRX B;  4KFF A;  2V1L A;  2W9P A;  1J2B A;  3EHC A;  1A90 A;  1M90 4;  5ELJ A;  1OPY A;  4STD A;  2B24 B;  3G16 A;  4XBX A;  5EVH A;  1TP6 A;  3N54 B;  5D82 A;  2P0M A;  3B4P A;  1EKM A;  3B4O A;  5FW5 A;  1STD A;  3F7S A;  1JB2 A;  4L8P A;  3RGR A;  3SVA A;  3TDG A;  2CK3 H;  3MG2 A;  4LGQ A;  4EV2 A;  5A0O B;  1KD1 4;  1R4C A;  1TFK A;  3NM7 A;  5CLK A;  1QAF A;  5AEW B;  3GAX A;  3CC2 3;  1Q82 4;  3JUQ A;  5JPP A;  1K28 A;  1JB5 A;  2SBL A;  1VQL 3;  5D81 A;  4HM1 B;  1W5Z A;  3SLU A;  1Q7Y 4;  2CKF B;  5AIF A;  3AMO B;  5IER A;  2YX9 A;  3GRD A;  3I56 3;  3WOD G;  3DGN A;  3JUN A;  3G0K A;  1MNL A;  2MF7 A;  1HU9 A;  3NV0 B;  4KZ1 A;  1IDP A;  2WO0 A;  3VSY A;  4XBY A;  2FGT A;  3H51 A;  4FMA A;  2GU3 A;  2Z76 A;  3NBB A;  2Z7A A;  3H3H A;  3KZT A;  4HM7 B;  4WYK A;  4MEI A;  2F98 A;  3CCS 3;  2XSH B;  1GY7 A;  1OGX A;  2L4V A;  1VZZ A;  3HIG A;  2W56 A;  3SED A;  2B1X B;  4Q53 A;  2F99 A;  3X42 A;  1US1 A;  3EX9 A;  1VQM 3;  2BMO B;  1WMO A;  3FCS B;  1NU3 A;  2P0X A;  3V99 A;  1W01 A;  3FF0 A;  4IPB A;  4N6L A;  2P09 A;  2CFW A;  4GB5 A;  3GZB A;  4WFO A;  5LC6 A;  2QIY A;  2XGL A;  2ML5 A;  4OVM A;  1OAC A;  1M1K 4;  4LEH A;  6STD A;  2HML B;  1IVV A;  1WQL B;  3BB9 A;  1NB5 I;  2OOV C;  3O8Y A;  1DMM A;  2CFD A;  5AI1 A;  1CYU A;  2XR8 B;  4FCZ A;  3DZL A;  1NB3 I;  2CH9 A;  3EB8 A;  3EQQ B;  3L0R A;  4CCV A;  3G71 3;  2W03 A;  2W9Q A;  1YJN 3;  2WOH A;  1G96 A;  3QRD A;  1D6Y A;  1TFO A;  4FCJ A;  1IT8 A;  3ROB A;  1UW1 A;  1W2B 2;  3F7X A;  1O7N B;  3F9S A;  1PU4 A;  2P05 A;  1M1X B;  2CHC A;  2CWT A;  3CCJ 3;  3F8H A;  3MG3 A;  4HYZ A;  1RKY A;  3M8C A;  4RNZ A;  3BNC A;  3EN8 A;  3Q90 A;  1ULJ B;  3GZR A;  1OHP A;  3T8U A;  3G4S 3;  4XDV A;  1AVK A;  3U1W A;  4MMY B;  2RGQ A;  3BLZ A;  1Q40 B;  3CNM A;  3JUP A;  5ELU A;  3A76 A;  3OXA A;  3CCL 3;  2CG1 A;  5EEO A;  3K9M C;  1D6U A;  1WMP A;  2BNG A;  2XFT A;  1IVW A;  1M9G A;  3NM2 A;  3ECF A;  4H3U A;  2CFK A;  1KC8 4;  5AIH A;  5DRE A;  5BVB A;  1ZX2 A;  1O7G B;  2W2C A;  3IMA B;  3FG1 A;  1ISK A;  2GBX B;  4IIA A;  3FSD A;  5IG0 A;  4OUQ A;  2IA7 A;  3S27 A;  4LMI A;  4EYC A;  5JBS A;  4MMX B;  2BO9 B;  1OCV A;  3WDG B;  5IEO A;  4NRE A;  1SQW A;  1K9M 4;  3RDE A;  3ER7 A;  3I0Y A;  1QJG A;  1FGR A;  5IF6 A;  3KKG A;  3KFQ C;  3G6E 3;  1WMN A;  1AR0 A;  3CXC 2;  3CCV 3;  3LTC A;  2IUJ A;  5I97 A;  1O7H B;  4XDW A;  1LVN A;  1D6Z A;  3IJE B;  1TU5 A;  1KWI A;  3MSO A;  2K0M A;  1LXE A;  1YIT 3;  4LZI A;  3B8L A;  3EC9 A;  5IG4 A;  3MG1 A;  2I9W A;  2GEX A;  5CF1 A;  1UI7 A;  3T0U A;  4U13 A;  4NHF A;  1N5P A;  4OK0 A;  1GYB A;  1W6Y A;  3K0Z A;  3CC4 3;  3CU3 A;  3CCR 3;  2HMO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...