4X2HA

Sac3n peptide bound to mex67:mtr2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
192
structure length
192
Chain Sequence
PTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPRHPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative mRNA export protein
publication title Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2.
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
molecule tags Transcription
total genus 49
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2014-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4x2hA00
4HVNA 4K1UA 3B4OA 1ASKA 1GY6A 1OHSA 2YFJB 4WP5A 1NDOB 4WYKA 3F7SA 4ORLA 3G16A 3DUKA 2JQ5A 4LGQA 2A15A 4XDVA 2B24B 4J9AA 4R1KA 3KZTA 3BLZA 3I0YA 1TUHA 3MHEA 4CDLA 4HKVB 1JKGA 3EC9A 3EQQB 3F8XA 1E3RA 1Q40A 1JB4A 1E3VA 1UUWB 2STDA 4I4KA 4HM8B 4R9KA 4HM0B 1EG9B 5AIFA 2HMOB 1OPYA 1GYBA 5AIHA 1TP6A 3OWSA 3T8NA 5CF2A 5CLKA 3NHXA 3MG3A 1JB5A 2RFRA 5FW5A 1ULJB 4HM5B 5BXQA 4Q53A 3F8HA 2GXFA 4HM2B 3EBTA 3JUOA 3B8LA 1DMQA 4L8OA 3HK4A 1STDA 4FCJA 4HM4B 3FH1A 2HMMB 4WWUC 3GRDA 5BVBA 4HM3B 4XM4A 3EN1B 3WMDA 2R4IA 3OWUA 1EA2A 1GY5A 4XB5A 2CKFB 4HM7B 3EF8A 4PEJA 1JN5B 1QJGA 2QIYA 1GS3A 3MG1A 1OGZA 3EX9A 1IDPA 3SOYA 4STDA 3OWYA 1OH0A 3IPTA 1GY7A 3KKGA 3SOAA 3RGRA 4HZBB 3KSPA 3VGNA 3JUNA 3CNXA 3S5CA 3FF2A 4RZMA 3OV4A 4GB5A 3G0KA 4XDWA 3GZBA 1W6YA 2QGUA 1O7HB 2UX0A 3GZXB 3F7XA 4OVMA 5JPUA 3E99A 5EVHA 3RGAA 3KE7A 3JUMA 3DZLA 5D83A 3H51A 8CHOA 5KP3A 4XBXA 3FZWA 1ISKA 1ZX2A 2BMQB 3SEDA 1U5OA 3F9SA 4X2OA 5DREA 1JN5A 5AEUB 3MKIA 2GEYA 1OHPA 2RCDA 1O7MB 4LMIA 3BB9A 4HM6B 3OX9A 5IERA 4N3VA 5STDA 4K1VA 5CF1A 1S5AA 4U13A 1AR0A 3DM8A 3EHCA 2XSHB 1O7NB 3G8ZA 3ROBA 3M8CA 3JUPA 1Z1SA 4HM1B 3K0ZA 1BUQA 4X2HA 5G2GA 1C7HA 3FSDA 1DMMA 2B1XB 2HMKB 1O7PB 5IEPA 2W2CA 2Z7AA 5D82A 3VSYA 3EBYA 2YFLB 5IG3A 3HZPA 2I9WA 1Q42A 5KP4A 1OF5B 3NUVA 4OUQA 2YFIB 4IIAA 5AIGA 2Z77A 3CU3A 2BMRB 3FKAA 3D9RA 3ECFA 4J8TA 4LEHA 1QMAA 2XRXB 1WQLB 5CXOA 1JB2A 1O7WB 5KP1A 1ZO2A 3FF0A 3LYGA 4XBYA 3NXJA 5AI1A 5IENA 2GEXA 3LZAA 1HKXA 3CNMA 4KVHA 2BNGA 3NV0B 3MG2A 3HX8A 5TGNA 2HMJB 4HJLB 1OGXA 3DMCA 3F40A 4FCMA 3ER7A 2Z76A 3T8UA 3NBRA 3MYTA 3UNLA 1CQSA 2GBWB 1OF5A 4MJDA 3GZRA 5IG5A 3B7CA 2F86B 1OUNA 2F98A 5IG4A 2OWPA 3EN8A 3H3HA 1OHOA 1ULIB 7STDA 1NWWA 5CK6A 4L8PA 4R9LA 4H3UA 5JPPA 5HGRA 2HMLB 5D81A 3B4PA 2RGQA 3NV0A 3NM2A 3K7CA 3FGYA 3JUQA 1VZZA 1OCVA 3F14A 6STDA 1O7GB 1W01A 3A76A 2INXA 2PZVA 5IEOA 1W02A 3MSOA 3DXOA 1DMNA 4WYKB 3EJVA 3FLJA 2IMJA 2XR8B 3Q90A 3CPOA 1K41A 3UJMA 3GZYB 5IG0A 2BMOB 1W00A 2GBXB 3OXAA 3GWRA 3STDA 2K54A 1JKGB 1Q40B 1NU3A 1UUVB 4HZ9B 1A2KA 5AIIA 1SJWA 4L7KA 4XBTA 2CHCA 2XSOB 5IF6A 5DRVA 5AEWB 1E97A 2F99A 2HMNB
chains in the Genus database with same CATH superfamily
1N9EA 4HVNA 1FGMA 1UDII 2WOFA 4K1UA 1TRPA 3B4OA 4MMYB 1KWIA 4GSPA 4R80A 7RNTA 1RGFA 1ASKA 1GY6A 4O2HA 3CCE3 3DGLA 1OHSA 3CCQ3 4LZIA 2YFJB 4WP5A 1NDOB 4WYKA 3F7SA 5LC6A 1IQXA 4BTWA 3LTDA 4ORLA 1T2IA 1I3IA 3DUKA 1UGHI 3G16A 5BU4A 1VQ53 3WA2X 2JQ5A 4LGQA 2A15A 4XDVA 2B24B 4QWTA 2W9PA 4J9AA 1BRNL 3S27A 4R1KA 3KZTA 2XH9A 1CYVA 2W04A 3X3ZA 2BU4A 1RHLA 4DKIA 3N54B 3K5TA 3WOFB 3BLZA 4GHOA 2MC8A 5I97A 3CCV3 1VQ73 3I0YA 1Q824 5GSPA 1GD4A 1TUHA 3MHEA 3WODG 1BNIA 4HKVB 5FGOA 3LXUX 4CDLA 3PXMA 1GOVA 1JKGA 2SBLA 3EC9A 3EQQB 1FYSA 3F8XA 3PZWA 1YI23 1FGRA 2ZHXB 1BVIA 1TFOA 2RBIA 3RDEA 1T5YA 3J7Yd 1RJOA 3IJEB 3T0UA 1E3RA 1UUWB 1IQYA 1JB4A 1E3VA 1Q40A 2STDA 2IUJA 1ZGXA 4I4KA 1UUGB 3RNTA 1X1WA 2R41A 4HM8B 4R9KA 1YHQ3 4HM0B 1BNSA 1EG9B 3KN4A 1A67A 5AIFA 2L1SA 2HMOB 1OPYA 1GYBA 1Q9EA 3AMOA 5AIHA 5G1KA 1TP6A 4KFDA 2E2UA 2CFWA 3KIIA 3OWSA 1BRHA 1GMQA 3CCU3 2KF5A 1Q814 1RTUA 3T8NA 5CF2A 5CLKA 1Q864 4H61A 3NHXA 1PYLA 3MG3A 1JB5A 2RFRA 2W0QA 3TDGA 1RCLA 5FW5A 2OTJ3 3FCSB 1G02A 3CCJ3 2F5WA 1ULJB 3EB8A 1LNIA 2OCTA 4HM5B 1ROVA 4Q53A 4BTXA 5BXQA 3F8HA 3ZFZA 2GXFA 1US1A 2W03A 2CFLA 2JDIH 4HM2B 3Q3FA 3EBTA 3JUOA 1NNVA 2P05A 5G1LA 1I2GA 3B8LA 1DMQA 4JRFA 2H0IA 2XGNA 3HK4A 1STDA 3LH4A 4JF8A 4FCJA 4L8OA 4HM4B 1YIJ3 1RSNA 1DVDA 1JNQA 3FH1A 1Y4KA 2HMMB 1BSCA 2P09A 2IYJA 4HAAA 3ZG5A 1TIJA 4EC6A 1SIHA 1RGGA 1JZDA 4KFEA 3DH2A 4WWUC 5EEOA 1IK3A 3GRDA 1YGEA 5BVBA 4HM3B 1FUTA 4XM4A 3BNDA 3SXXA 3NM7A 2WOHA 3EN1B 3WMDA 3PYJA 1RN1A 4O02B 3V99A 2R4IA 2OOVC 1I2FA 2KF4A 3OWUA 2IY2A 1VQ63 1EA2A 1GY5A 5BIRA 4XB5A 2CKFB 1B3SA 1B2XA 3Q1CA 1LOXA 2BIRA 4HM7B 3EF8A 4PEJA 4WFOA 1UW1A 1JN5B 3DGOA 1RGEA 3AGOA 1QJGA 2QIYA 3BNEA 1GS3A 1W4NA 1IV9A 3MG1A 2LYXA 1ZS7A 4AEQA 3BIRA 1OGZA 4O8SA 4G1MB 3FG1A 4N6MA 3EX9A 1IV7A 1IDPA 1LOWA 1RKYA 1JBRA 7GSPA 1WMPA 2CWTA 3SOYA 4STDA 3OWYA 2KXGA 3V92A 1OH0A 4J5KA 3IPTA 1GY7A 3KKGA 2CK3H 2KAAA 5JBSA 3SOAA 1JV2B 1KD14 1RN7A 3NQZA 1NB5I 3RGRA 1IVUA 5EQLA 4HZBB 1MWUA 3AHWA 3KSPA 4KFFA 3VGNA 1RGAA 3X3YA 2WGOA 4O3VA 1JRQA 1MGRA 1IT8A 3JUNA 3QK9A 3CNXA 4EV5A 1CEWI 3S5CA 1NO3A 4N6V0 5AYSC 1F8NA 3FF2A 2OTL3 4RZMA 2KRTA 1HYFA 3BNBA 3OV4A 3G0KA 1LXEA 1RCKA 4GB5A 4XDWA 3CCM3 3GZBA 1W6YA 1BRSA 2BO9B 1LVNA 1VQQA 2CX1A 3LT9A 2QGUA 1O7HB 1MWSA 2UX0A 3D3LA 3GZXB 1AVKA 1I8VA 3F7XA 3HIGA 4OVMA 5JPUA 3E99A 5EVHA 3S67A 3RGAA 3KE7A 3SVAA 5RNTA 3JUMA 1VQ43 1B2UA 1BNJA 3DZLA 3OW22 1IYYA 1TJDA 5D83A 2CIUA 1QAFA 3H51A 4EBGA 8CHOA 5KP3A 4XBXA 3FZWA 1ISKA 4AKZA 1ZX2A 1YIT3 2BMQB 3SEDA 1U5OA 3F9SA 2Z6BA 4OK0A 4X2OA 5DREA 1V58A 1JBSA 1JN5A 1FW7A 5AEUB 4R4KA 1PY3A 1SIIA 2L4VA 4N6NB 3MKIA 3UL5A 2GEYA 1Q7Y4 1IVXA 1OHPA 3S28A 2RCDA 1O7MB 3GSPA 4LMIA 1CYUA 1GMRA 1MOLA 1EUIC 3BB9A 4HM6B 4HBRA 4RBNA 2CWUA 3OX9A 1ROAA 3GAXA 4J5GA 5IERA 1IQ8A 2QA43 3ZG0A 1IVVA 1YVSA 1FUWA 4GL6A 4N3VA 2CG0A 1YVBI 5STDA 2GU3A 2IUKA 3LOYA 1G96A 4K1VA 4BU4A 1B2MA 3PCRA 1IVWA 1S5AA 2GU1A 3D4AA 2CG1A 4U13A 1AR0A 5CF1A 3DM8A 1BRIA 3EHCA 3KFQC 2XSHB 1L5GB 1O7NB 3K63A 1DVCA 1RRHA 3G8ZA 4RNYA 1CH0A 1BSEA 1A90A 1FUSA 3ROBA 2K0MA 2AAEA 5A0OB 1BRGA 2C11A 3M8CA 3JUPA 1Z1SA 1V74A 4HM1B 1BSDA 1BOXA 2C10A 1W7CA 1BNEA 2CFGA 3K0ZA 3LTBA 3DGNA 2CFKA 1BUQA 4MEIA 2P0XA 1BAOA 1BUJA 3WOEB 5HOHA 1WMOA 1V57A 4X2HA 5G2GA 4BTYA 1BU4A 1DE3A 3G4S3 1AY7A 3KCHA 3UB1A 1C7HA 4CPKA 1LOYA 3LTAA 1YNVX 2Y73A 1RGHA 1I0XA 3FSDA 3VF1A 1DMMA 4LYLB 2B1XB 1MWRA 1WNHA 2HMKB 1UI7A 1O7PB 1VQL3 1K9M4 1U8CB 5IEPA 3G713 1WMNA 4BIRA 1EEJA 3N8BA 1M904 4FMBA 2W2CA 2Z7AA 2FGTA 2V1LA 1YGWA 5D82A 1QAKA 1UCKA 4IPBA 3VSYA 3CC43 1W6CA 1DETA 3EBYA 6GSPA 3CCS3 2YFLB 1UCJA 4KZ1A 5IG3A 3CXC2 2C4BA 1K734 3BU4A 3HZPA 3MWZA 2I9WA 1YJN3 1Q42A 5AYRB 1OF5B 3NUVA 4OUQA 3A5EA 5KP4A 2YFIB 2AADA 1LQGC 1WTHA 4IIAA 4BL3A 3HIIA 3CMA3 1VQ83 3PCSA 1BANA 1HZ1A 2W9QA 5AIGA 1VQP3 2RSXA 2Z77A 3CU3A 2BMRB 3FKAA 5M1AA 3D9RA 3ECFA 4K90B 4J8TA 4LEHA 4MMZB 9RNTA 1EKMA 1QMAA 2D1WA 2M7OA 2D42A 2XRXB 1FGTA 1WQLB 4N6LA 3WDGB 5CXOA 1EQKA 1GOYA 1LNHA 1JB2A 4AKYA 3AGNA 4N6TA 1O7WB 3DGYA 1KC84 1UI8A 5KP1A 1I2EA 1ZO2A 2Y74A 2CX0A 2ML6A 3FF0A 3O8YA 2LQVA 3LYGA 4ZM8A 4XBYA 1AQZA 3NXJA 5AI1A 5IENA 2CW9A 1Q7HA 1STFI 1RLSA 1GMPA 1IU7A 4EYCA 1RN4A 2GEXA 2XEPA 3LZAA 1HKXA 1QVG2 1K28A 2KCDA 3CNMA 2OQEA 1BRJA 2XFTA 1B27A 2IA7A 4KVHA 2BNGA 3I553 3NV0B 3MG2A 3DY5A 3MPHA 3ALAA 1N5PA 1S723 3HX8A 1RGKA 1TTOA 1YJ93 3CCR3 5TGNA 3HOHA 5ELUA 1X1UA 1T2HA 2WGQA 1K8A4 1BRKA 2XGLA 5M18A 2HMJB 3WHOA 1BNRA 2W6JH 3BNCA 2XFSA 3NBJA 4HJLB 1OGXA 1R4CA 3FG4A 1SARA 4RNZA 1PU4A 1BIRA 3DMCA 3JVCA 4FMCA 3F40A 4NPBA 2KF3A 3NBBA 2CH9A 1R4YA 4FCMA 3ER7A 1GD3A 1JJ22 2Z76A 3T8UA 3NBRA 1LOVA 3MYTA 2O9UX 2W56B 3SLUA 4WHAA 3UNLA 1W2ZA 1BSBA 4FR9A 1KQS2 1CQSA 2E2TA 1IT7A 2GBWB 1OF5A 3KSED 4MJDA 3GZRA 5IG5A 1DYUA 3B7CA 1NJI4 1AVLA 3CD63 2YX9A 1VQK3 1X1YA 2F86B 3WA3A 1A2VA 1OUNA 2F98A 2CWVA 1FZUA 1N5HA 2WO0A 5IG4A 1SPUA 5LC7A 3U1WA 5IW9A 4KT3B 2ML5A 2BHMA 2OWPA 3EN8A 3H3HA 3SX1A 1OACA 2F56A 1LRAA 1A2PA 3X40A 4HYZA 1OHOA 3UL6A 1ULIB 7STDA 4K61A 1UGIA 1VQN3 1NWWA 2MF7A 1M9GA 2P0MA 2RNTA 4HOHA 4RNTA 5CK6A 4TX4A 4L8PA 3IMAB 3LT8A 4R9LA 3SYUA 3G6E3 4H3UA 5JPPA 2FNQA 1RRLA 1FGOA 1AV4A 4LSOA 5HGRA 2P38A 2HMLB 1B2SA 2HOHA 3NQYA 5D81A 1QVF2 1BNGA 4EXRA 3CME3 4BL2A 1UCLA 1VQ93 3B4PA 4ILFA 2RGQA 3NV0A 2KF6A 3I563 1PFPA 3NM2A 2J8XB 3K7CA 1RGCA 1N8QA 1RDSA 3FGYA 2XF3A 1NB3I 4NREA 1I0VA 1JBTA 2ZA4A 1D6YA 3JUQA 1D6UA 1VZZA 1LQMB 3X3XA 1W6GA 3CCL3 1OCVA 1QALA 1BSAA 3F14A 3HI7A 6STDA 1O7GB 3LTCA 3QRDA 3D5IA 4EW5A 1B20A 1KSIA 4MMXB 2FXTA 1BNFA 1RGLA 2K3DA 2ZL8A 1W01A 3N9HA 3A76A 2INXA 2E2VA 1BGSA 3NX0A 2PZVA 1SQWA 1W02A 2W56A 5IEOA 1W2B2 3MSOA 3EE1A 2O3OA 1X1XA 3DXOA 1DMNA 3PS8A 4WYKB 3EJVA 1FGQA 1M1K4 4N6UA 1MGWA 2ZDJA 1J2BA 1MNLA 1MWTA 1W5ZA 3D79A 2Q07A 8RNTA 1JZOA 3FLJA 4FMAA 2IMJA 4EV2A 2XR8B 1M1XB 3Q90A 1D6ZA 1VQO3 3CPOA 4I5QA 1TU5A 3L0RA 3LMLA 1K41A 1N8R4 3UJMA 4FMDA 2CFDA 3GZYB 4NHFA 5IG0A 2SARA 1I3FA 2BMOB 2OQEC 1YJW3 4FCZA 1W00A 2GBXB 3OXAA 4N6OB 4CCVA 2F5MA 3GWRA 1RNTA 2BT3A 1HU9A 4CJNA 1TRQA 2QEX3 3STDA 2K54A 1JKGB 1UCIA 2H0GA 1GSPA 3D5GA 2H0HA 3DGMA 3PGBA 1C54A 1TFKA 1B21A 2F4YA 1N9JA 2UUGC 1RNBA 3U97A 3S29A 3AHSA 1Q40B 1NU3A 1UUVB 4HZ9B 3CPW2 3V98A 3K9MC 1B2ZA 1A2KA 3CC73 1T3BA 1FA3A 5AIIA 1SJWA 2OOVA 5M19A 1G0TA 1GOUA 3WR2A 3X41A 4L7KA 4XBTA 2CHCA 1VQM3 6RNTA 1I70A 2UGIA 2XSOB 2PNCA 3AMOB 3Q2PA 3CC23 5IF6A 3X42A 4IT7A 5DRVA 5ELJA 2GSPA 3URPA 3FG3A 1RMSA 5AEWB 1E97A 2F99A 2CC3A 2HMNB
chains in the Genus database with same CATH topology
1N9EA 4HVNA 1FGMA 2WOFA 4K1UA 3B4OA 4MMYB 1KWIA 4R80A 1ASKA 1GY6A 4O2HA 3CCE3 3DGLA 1OHSA 3CCQ3 4LZIA 2YFJB 4WP5A 1NDOB 4WYKA 3F7SA 5LC6A 1IQXA 4BTWA 3LTDA 4ORLA 3G16A 3DUKA 1VQ53 3WA2X 2JQ5A 4LGQA 2A15A 4XDVA 2B24B 4QWTA 2W9PA 4J9AA 3S27A 4R1KA 3KZTA 2XH9A 1CYVA 2W04A 3X3ZA 3N54B 3K5TA 3WOFB 3BLZA 5I97A 2MC8A 3CCV3 1VQ73 3I0YA 1Q824 1GD4A 1TUHA 3MHEA 3WODG 4HKVB 5FGOA 4CDLA 3LXUX 3PXMA 1JKGA 2SBLA 3EC9A 3EQQB 3F8XA 3PZWA 1YI23 1FGRA 1TFOA 3RDEA 1T5YA 3J7Yd 1RJOA 3IJEB 3T0UA 1E3RA 1IQYA 1JB4A 1E3VA 1Q40A 1UUWB 2STDA 2IUJA 4I4KA 1YHQ3 4HM8B 4R9KA 4HM0B 1EG9B 3KN4A 1A67A 5AIFA 2HMOB 1OPYA 1GYBA 3AMOA 5AIHA 1TP6A 4KFDA 2E2UA 2CFWA 3KIIA 3OWSA 3CCU3 1Q814 1Q864 3T8NA 5CF2A 5CLKA 4H61A 3NHXA 3MG3A 1JB5A 2RFRA 2W0QA 3TDGA 5FW5A 2OTJ3 3FCSB 3CCJ3 1ULJB 3EB8A 2OCTA 4HM5B 5BXQA 1ROVA 4Q53A 4BTXA 3F8HA 2GXFA 1US1A 2W03A 2CFLA 2JDIH 4HM2B 3EBTA 3JUOA 2P05A 3B8LA 1DMQA 4JRFA 2XGNA 3HK4A 1STDA 3LH4A 4JF8A 4FCJA 4L8OA 4HM4B 1YIJ3 1DVDA 1JNQA 3FH1A 1Y4KA 2HMMB 2P09A 1TIJA 4EC6A 1SIHA 4KFEA 5EEOA 4WWUC 1IK3A 3GRDA 1YGEA 5BVBA 4HM3B 4XM4A 3BNDA 3SXXA 3NM7A 2WOHA 3EN1B 3WMDA 3PYJA 4O02B 3V99A 2R4IA 2OOVC 3OWUA 1VQ63 1EA2A 1GY5A 4XB5A 2CKFB 3Q1CA 1LOXA 4HM7B 3EF8A 4PEJA 4WFOA 1UW1A 1JN5B 3DGOA 1QJGA 2QIYA 3BNEA 1GS3A 1W4NA 1IV9A 3MG1A 2LYXA 4AEQA 1OGZA 4O8SA 4G1MB 3FG1A 4N6MA 3EX9A 1IV7A 1IDPA 1RKYA 1WMPA 2CWTA 3SOYA 4STDA 3OWYA 2KXGA 3V92A 1OH0A 5JBSA 3IPTA 1GY7A 3KKGA 2CK3H 3SOAA 1JV2B 1KD14 1RN7A 3NQZA 1NB5I 3RGRA 1IVUA 5EQLA 4HZBB 4KFFA 3KSPA 3VGNA 3X3YA 2WGOA 4O3VA 1JRQA 1IT8A 3JUNA 3QK9A 3CNXA 4EV5A 1CEWI 3S5CA 1NO3A 4N6V0 5AYSC 1F8NA 3FF2A 2OTL3 4RZMA 2KRTA 3BNBA 3OV4A 4GB5A 3G0KA 1LXEA 3CCM3 4XDWA 3GZBA 1W6YA 2BO9B 1LVNA 3LT9A 2QGUA 1O7HB 2UX0A 3D3LA 3GZXB 1AVKA 3F7XA 3HIGA 4OVMA 5JPUA 3E99A 5EVHA 3S67A 3RGAA 3KE7A 3SVAA 1VQ43 3JUMA 3DZLA 3OW22 5D83A 2CIUA 1QAFA 3H51A 4EBGA 8CHOA 5KP3A 4XBXA 3FZWA 1ISKA 4AKZA 1ZX2A 1YIT3 2BMQB 3SEDA 1U5OA 3F9SA 2Z6BA 4OK0A 4X2OA 5DREA 1JN5A 5AEUB 4R4KA 1SIIA 2L4VA 4N6NB 3MKIA 3UL5A 2GEYA 1Q7Y4 1IVXA 1OHPA 3S28A 2RCDA 1O7MB 4LMIA 1CYUA 1MOLA 3BB9A 4HM6B 4HBRA 4RBNA 2CWUA 3OX9A 1ROAA 3GAXA 5IERA 1IQ8A 2QA43 1FUWA 1IVVA 4GL6A 4N3VA 2CG0A 1YVBI 5STDA 2GU3A 2IUKA 3LOYA 1G96A 4K1VA 3PCRA 1IVWA 1S5AA 2GU1A 2CG1A 5CF1A 4U13A 1AR0A 3DM8A 3EHCA 3KFQC 2XSHB 1L5GB 1O7NB 3K63A 1DVCA 1RRHA 3G8ZA 4RNYA 1A90A 3ROBA 2K0MA 5A0OB 2C11A 3M8CA 3JUPA 1Z1SA 1V74A 4HM1B 2C10A 2CFGA 1W7CA 3LTBA 3K0ZA 1BUQA 3DGNA 2CFKA 4MEIA 2P0XA 3WOEB 1WMOA 4X2HA 4BTYA 5G2GA 3G4S3 3UB1A 1C7HA 3LTAA 2Y73A 3FSDA 3VF1A 1DMMA 2B1XB 1WNHA 2HMKB 1UI7A 1O7PB 1VQL3 1K9M4 1U8CB 5IEPA 3G713 1WMNA 1M904 3N8BA 4FMBA 2W2CA 2Z7AA 2FGTA 2V1LA 5D82A 1QAKA 4IPBA 3VSYA 3CC43 1W6CA 3EBYA 3CCS3 2YFLB 3CXC2 4KZ1A 5IG3A 1K734 3HZPA 3MWZA 2I9WA 1YJN3 1Q42A 5AYRB 1OF5B 3NUVA 4OUQA 5KP4A 2YFIB 1WTHA 4IIAA 3CMA3 3HIIA 1VQ83 3PCSA 2W9QA 5AIGA 1VQP3 2RSXA 2Z77A 3CU3A 2BMRB 3FKAA 3D9RA 3ECFA 4K90B 4J8TA 4LEHA 4MMZB 1EKMA 1QMAA 2D1WA 2M7OA 2D42A 2XRXB 1FGTA 1WQLB 4N6LA 3WDGB 5CXOA 1EQKA 4AKYA 1LNHA 1JB2A 4N6TA 1O7WB 1KC84 1UI8A 5KP1A 1ZO2A 2Y74A 2ML6A 3FF0A 3O8YA 2LQVA 3LYGA 4ZM8A 4XBYA 3NXJA 5AI1A 5IENA 2CW9A 1STFI 1IU7A 4EYCA 2GEXA 2XEPA 3LZAA 1HKXA 1QVG2 1K28A 2KCDA 3CNMA 2OQEA 2XFTA 4KVHA 2IA7A 2BNGA 3I553 3NV0B 3MG2A 3DY5A 3MPHA 3ALAA 1N5PA 3HX8A 1YJ93 3CCR3 5TGNA 5ELUA 2WGQA 1K8A4 2XGLA 2HMJB 2W6JH 3BNCA 2XFSA 3NBJA 4HJLB 1OGXA 1R4CA 3FG4A 4RNZA 1PU4A 3DMCA 3JVCA 4FMCA 3F40A 3NBBA 2CH9A 4FCMA 3ER7A 1GD3A 1JJ22 2Z76A 3T8UA 3NBRA 3MYTA 2O9UX 2W56B 3SLUA 4WHAA 3UNLA 1W2ZA 4FR9A 1KQS2 1CQSA 2E2TA 1IT7A 2GBWB 1OF5A 3KSED 4MJDA 3GZRA 5IG5A 1DYUA 3B7CA 1NJI4 1AVLA 3CD63 2YX9A 1VQK3 2F86B 3WA3A 1A2VA 1OUNA 2F98A 2CWVA 1N5HA 2WO0A 5IG4A 1SPUA 5LC7A 3U1WA 5IW9A 2ML5A 2BHMA 2OWPA 3EN8A 3H3HA 3SX1A 1OACA 3X40A 4HYZA 1OHOA 3UL6A 1ULIB 7STDA 4K61A 1VQN3 1NWWA 2MF7A 1M9GA 2P0MA 5CK6A 4TX4A 4L8PA 3IMAB 3LT8A 4R9LA 3G6E3 4H3UA 5JPPA 2FNQA 1RRLA 1FGOA 1AV4A 4LSOA 5HGRA 2P38A 2HMLB 3NQYA 5D81A 1QVF2 4EXRA 3CME3 1VQ93 3B4PA 2RGQA 3NV0A 3I563 1PFPA 3NM2A 3K7CA 1N8QA 3FGYA 2XF3A 1NB3I 4NREA 1D6YA 3JUQA 1D6UA 1VZZA 3X3XA 1W6GA 3CCL3 1OCVA 1QALA 3F14A 3HI7A 6STDA 1O7GB 3LTCA 3QRDA 1KSIA 4MMXB 2FXTA 2ZL8A 1W01A 3N9HA 3A76A 2INXA 2E2VA 3NX0A 2PZVA 1SQWA 1W02A 2W56A 5IEOA 1W2B2 3MSOA 3EE1A 2O3OA 3DXOA 1DMNA 3PS8A 4WYKB 3EJVA 1FGQA 1M1K4 4N6UA 2ZDJA 1J2BA 1MNLA 1W5ZA 2Q07A 3FLJA 4FMAA 2IMJA 4EV2A 2XR8B 1M1XB 3Q90A 1D6ZA 1VQO3 3CPOA 1TU5A 3L0RA 3LMLA 1K41A 1N8R4 3UJMA 4FMDA 2CFDA 3GZYB 4NHFA 5IG0A 2BMOB 2OQEC 1YJW3 4FCZA 1W00A 2GBXB 3OXAA 4N6OB 4CCVA 3GWRA 2BT3A 1HU9A 2QEX3 3STDA 2K54A 1JKGB 3DGMA 1S723 3PGBA 1TFKA 1N9JA 3U97A 3S29A 1Q40B 1NU3A 1UUVB 4HZ9B 3CPW2 3V98A 3K9MC 3CC73 1A2KA 1FA3A 5AIIA 1SJWA 2OOVA 3X41A 4L7KA 4XBTA 2CHCA 1VQM3 2XSOB 2PNCA 3AMOB 3Q2PA 3CC23 5IF6A 3X42A 4IT7A 5DRVA 5ELJA 3FG3A 5AEWB 1E97A 2F99A 2CC3A 2HMNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVN A;  4K1U A;  3B4O A;  1ASK A;  1GY6 A;  1OHS A;  2YFJ B;  4WP5 A;  1NDO B;  4WYK A;  3F7S A;  4ORL A;  3G16 A;  3DUK A;  2JQ5 A;  4LGQ A;  2A15 A;  4XDV A;  2B24 B;  4J9A A;  4R1K A;  3KZT A;  3BLZ A;  3I0Y A;  1TUH A;  3MHE A;  4CDL A;  4HKV B;  1JKG A;  3EC9 A;  3EQQ B;  3F8X A;  1E3R A;  1Q40 A;  1JB4 A;  1E3V A;  1UUW B;  2STD A;  4I4K A;  4HM8 B;  4R9K A;  4HM0 B;  1EG9 B;  5AIF A;  2HMO B;  1OPY A;  1GYB A;  5AIH A;  1TP6 A;  3OWS A;  3T8N A;  5CF2 A;  5CLK A;  3NHX A;  3MG3 A;  1JB5 A;  2RFR A;  5FW5 A;  1ULJ B;  4HM5 B;  5BXQ A;  4Q53 A;  3F8H A;  2GXF A;  4HM2 B;  3EBT A;  3JUO A;  3B8L A;  1DMQ A;  4L8O A;  3HK4 A;  1STD A;  4FCJ A;  4HM4 B;  3FH1 A;  2HMM B;  4WWU C;  3GRD A;  5BVB A;  4HM3 B;  4XM4 A;  3EN1 B;  3WMD A;  2R4I A;  3OWU A;  1EA2 A;  1GY5 A;  4XB5 A;  2CKF B;  4HM7 B;  3EF8 A;  4PEJ A;  1JN5 B;  1QJG A;  2QIY A;  1GS3 A;  3MG1 A;  1OGZ A;  3EX9 A;  1IDP A;  3SOY A;  4STD A;  3OWY A;  1OH0 A;  3IPT A;  1GY7 A;  3KKG A;  3SOA A;  3RGR A;  4HZB B;  3KSP A;  3VGN A;  3JUN A;  3CNX A;  3S5C A;  3FF2 A;  4RZM A;  3OV4 A;  4GB5 A;  3G0K A;  4XDW A;  3GZB A;  1W6Y A;  2QGU A;  1O7H B;  2UX0 A;  3GZX B;  3F7X A;  4OVM A;  5JPU A;  3E99 A;  5EVH A;  3RGA A;  3KE7 A;  3JUM A;  3DZL A;  5D83 A;  3H51 A;  8CHO A;  5KP3 A;  4XBX A;  3FZW A;  1ISK A;  1ZX2 A;  2BMQ B;  3SED A;  1U5O A;  3F9S A;  4X2O A;  5DRE A;  1JN5 A;  5AEU B;  3MKI A;  2GEY A;  1OHP A;  2RCD A;  1O7M B;  4LMI A;  3BB9 A;  4HM6 B;  3OX9 A;  5IER A;  4N3V A;  5STD A;  4K1V A;  5CF1 A;  1S5A A;  4U13 A;  1AR0 A;  3DM8 A;  3EHC A;  2XSH B;  1O7N B;  3G8Z A;  3ROB A;  3M8C A;  3JUP A;  1Z1S A;  4HM1 B;  3K0Z A;  1BUQ A;  4X2H A;  5G2G A;  1C7H A;  3FSD A;  1DMM A;  2B1X B;  2HMK B;  1O7P B;  5IEP A;  2W2C A;  2Z7A A;  5D82 A;  3VSY A;  3EBY A;  2YFL B;  5IG3 A;  3HZP A;  2I9W A;  1Q42 A;  5KP4 A;  1OF5 B;  3NUV A;  4OUQ A;  2YFI B;  4IIA A;  5AIG A;  2Z77 A;  3CU3 A;  2BMR B;  3FKA A;  3D9R A;  3ECF A;  4J8T A;  4LEH A;  1QMA A;  2XRX B;  1WQL B;  5CXO A;  1JB2 A;  1O7W B;  5KP1 A;  1ZO2 A;  3FF0 A;  3LYG A;  4XBY A;  3NXJ A;  5AI1 A;  5IEN A;  2GEX A;  3LZA A;  1HKX A;  3CNM A;  4KVH A;  2BNG A;  3NV0 B;  3MG2 A;  3HX8 A;  5TGN A;  2HMJ B;  4HJL B;  1OGX A;  3DMC A;  3F40 A;  4FCM A;  3ER7 A;  2Z76 A;  3T8U A;  3NBR A;  3MYT A;  3UNL A;  1CQS A;  2GBW B;  1OF5 A;  4MJD A;  3GZR A;  5IG5 A;  3B7C A;  2F86 B;  1OUN A;  2F98 A;  5IG4 A;  2OWP A;  3EN8 A;  3H3H A;  1OHO A;  1ULI B;  7STD A;  1NWW A;  5CK6 A;  4L8P A;  4R9L A;  4H3U A;  5JPP A;  5HGR A;  2HML B;  5D81 A;  3B4P A;  2RGQ A;  3NV0 A;  3NM2 A;  3K7C A;  3FGY A;  3JUQ A;  1VZZ A;  1OCV A;  3F14 A;  6STD A;  1O7G B;  1W01 A;  3A76 A;  2INX A;  2PZV A;  5IEO A;  1W02 A;  3MSO A;  3DXO A;  1DMN A;  4WYK B;  3EJV A;  3FLJ A;  2IMJ A;  2XR8 B;  3Q90 A;  3CPO A;  1K41 A;  3UJM A;  3GZY B;  5IG0 A;  2BMO B;  1W00 A;  2GBX B;  3OXA A;  3GWR A;  3STD A;  2K54 A;  1JKG B;  1Q40 B;  1NU3 A;  1UUV B;  4HZ9 B;  1A2K A;  5AII A;  1SJW A;  4L7K A;  4XBT A;  2CHC A;  2XSO B;  5IF6 A;  5DRV A;  5AEW B;  1E97 A;  2F99 A;  2HMN B; 
#chains in the Genus database with same CATH topology
 1N9E A;  4HVN A;  1FGM A;  1UDI I;  2WOF A;  4K1U A;  1TRP A;  3B4O A;  4MMY B;  1KWI A;  4GSP A;  4R80 A;  7RNT A;  1RGF A;  1ASK A;  1GY6 A;  4O2H A;  3CCE 3;  3DGL A;  1OHS A;  3CCQ 3;  4LZI A;  2YFJ B;  4WP5 A;  1NDO B;  4WYK A;  3F7S A;  5LC6 A;  1IQX A;  4BTW A;  3LTD A;  4ORL A;  1T2I A;  1I3I A;  3DUK A;  1UGH I;  3G16 A;  5BU4 A;  1VQ5 3;  3WA2 X;  2JQ5 A;  4LGQ A;  2A15 A;  4XDV A;  2B24 B;  4QWT A;  2W9P A;  4J9A A;  1BRN L;  3S27 A;  4R1K A;  3KZT A;  2XH9 A;  1CYV A;  2W04 A;  3X3Z A;  2BU4 A;  1RHL A;  4DKI A;  3N54 B;  3K5T A;  3WOF B;  3BLZ A;  4GHO A;  2MC8 A;  5I97 A;  3CCV 3;  1VQ7 3;  3I0Y A;  1Q82 4;  5GSP A;  1GD4 A;  1TUH A;  3MHE A;  3WOD G;  1BNI A;  4HKV B;  5FGO A;  3LXU X;  4CDL A;  3PXM A;  1GOV A;  1JKG A;  2SBL A;  3EC9 A;  3EQQ B;  1FYS A;  3F8X A;  3PZW A;  1YI2 3;  1FGR A;  2ZHX B;  1BVI A;  1TFO A;  2RBI A;  3RDE A;  1T5Y A;  3J7Y d;  1RJO A;  3IJE B;  3T0U A;  1E3R A;  1UUW B;  1IQY A;  1JB4 A;  1E3V A;  1Q40 A;  2STD A;  2IUJ A;  1ZGX A;  4I4K A;  1UUG B;  3RNT A;  1X1W A;  2R41 A;  4HM8 B;  4R9K A;  1YHQ 3;  4HM0 B;  1BNS A;  1EG9 B;  3KN4 A;  1A67 A;  5AIF A;  2L1S A;  2HMO B;  1OPY A;  1GYB A;  1Q9E A;  3AMO A;  5AIH A;  5G1K A;  1TP6 A;  4KFD A;  2E2U A;  2CFW A;  3KII A;  3OWS A;  1BRH A;  1GMQ A;  3CCU 3;  2KF5 A;  1Q81 4;  1RTU A;  3T8N A;  5CF2 A;  5CLK A;  1Q86 4;  4H61 A;  3NHX A;  1PYL A;  3MG3 A;  1JB5 A;  2RFR A;  2W0Q A;  3TDG A;  1RCL A;  5FW5 A;  2OTJ 3;  3FCS B;  1G02 A;  3CCJ 3;  2F5W A;  1ULJ B;  3EB8 A;  1LNI A;  2OCT A;  4HM5 B;  1ROV A;  4Q53 A;  4BTX A;  5BXQ A;  3F8H A;  3ZFZ A;  2GXF A;  1US1 A;  2W03 A;  2CFL A;  2JDI H;  4HM2 B;  3Q3F A;  3EBT A;  3JUO A;  1NNV A;  2P05 A;  5G1L A;  1I2G A;  3B8L A;  1DMQ A;  4JRF A;  2H0I A;  2XGN A;  3HK4 A;  1STD A;  3LH4 A;  4JF8 A;  4FCJ A;  4L8O A;  4HM4 B;  1YIJ 3;  1RSN A;  1DVD A;  1JNQ A;  3FH1 A;  1Y4K A;  2HMM B;  1BSC A;  2P09 A;  2IYJ A;  4HAA A;  3ZG5 A;  1TIJ A;  4EC6 A;  1SIH A;  1RGG A;  1JZD A;  4KFE A;  3DH2 A;  4WWU C;  5EEO A;  1IK3 A;  3GRD A;  1YGE A;  5BVB A;  4HM3 B;  1FUT A;  4XM4 A;  3BND A;  3SXX A;  3NM7 A;  2WOH A;  3EN1 B;  3WMD A;  3PYJ A;  1RN1 A;  4O02 B;  3V99 A;  2R4I A;  2OOV C;  1I2F A;  2KF4 A;  3OWU A;  2IY2 A;  1VQ6 3;  1EA2 A;  1GY5 A;  5BIR A;  4XB5 A;  2CKF B;  1B3S A;  1B2X A;  3Q1C A;  1LOX A;  2BIR A;  4HM7 B;  3EF8 A;  4PEJ A;  4WFO A;  1UW1 A;  1JN5 B;  3DGO A;  1RGE A;  3AGO A;  1QJG A;  2QIY A;  3BNE A;  1GS3 A;  1W4N A;  1IV9 A;  3MG1 A;  2LYX A;  1ZS7 A;  4AEQ A;  3BIR A;  1OGZ A;  4O8S A;  4G1M B;  3FG1 A;  4N6M A;  3EX9 A;  1IV7 A;  1IDP A;  1LOW A;  1RKY A;  1JBR A;  7GSP A;  1WMP A;  2CWT A;  3SOY A;  4STD A;  3OWY A;  2KXG A;  3V92 A;  1OH0 A;  4J5K A;  3IPT A;  1GY7 A;  3KKG A;  2CK3 H;  2KAA A;  5JBS A;  3SOA A;  1JV2 B;  1KD1 4;  1RN7 A;  3NQZ A;  1NB5 I;  3RGR A;  1IVU A;  5EQL A;  4HZB B;  1MWU A;  3AHW A;  3KSP A;  4KFF A;  3VGN A;  1RGA A;  3X3Y A;  2WGO A;  4O3V A;  1JRQ A;  1MGR A;  1IT8 A;  3JUN A;  3QK9 A;  3CNX A;  4EV5 A;  1CEW I;  3S5C A;  1NO3 A;  4N6V 0;  5AYS C;  1F8N A;  3FF2 A;  2OTL 3;  4RZM A;  2KRT A;  1HYF A;  3BNB A;  3OV4 A;  3G0K A;  1LXE A;  1RCK A;  4GB5 A;  4XDW A;  3CCM 3;  3GZB A;  1W6Y A;  1BRS A;  2BO9 B;  1LVN A;  1VQQ A;  2CX1 A;  3LT9 A;  2QGU A;  1O7H B;  1MWS A;  2UX0 A;  3D3L A;  3GZX B;  1AVK A;  1I8V A;  3F7X A;  3HIG A;  4OVM A;  5JPU A;  3E99 A;  5EVH A;  3S67 A;  3RGA A;  3KE7 A;  3SVA A;  5RNT A;  3JUM A;  1VQ4 3;  1B2U A;  1BNJ A;  3DZL A;  3OW2 2;  1IYY A;  1TJD A;  5D83 A;  2CIU A;  1QAF A;  3H51 A;  4EBG A;  8CHO A;  5KP3 A;  4XBX A;  3FZW A;  1ISK A;  4AKZ A;  1ZX2 A;  1YIT 3;  2BMQ B;  3SED A;  1U5O A;  3F9S A;  2Z6B A;  4OK0 A;  4X2O A;  5DRE A;  1V58 A;  1JBS A;  1JN5 A;  1FW7 A;  5AEU B;  4R4K A;  1PY3 A;  1SII A;  2L4V A;  4N6N B;  3MKI A;  3UL5 A;  2GEY A;  1Q7Y 4;  1IVX A;  1OHP A;  3S28 A;  2RCD A;  1O7M B;  3GSP A;  4LMI A;  1CYU A;  1GMR A;  1MOL A;  1EUI C;  3BB9 A;  4HM6 B;  4HBR A;  4RBN A;  2CWU A;  3OX9 A;  1ROA A;  3GAX A;  4J5G A;  5IER A;  1IQ8 A;  2QA4 3;  3ZG0 A;  1IVV A;  1YVS A;  1FUW A;  4GL6 A;  4N3V A;  2CG0 A;  1YVB I;  5STD A;  2GU3 A;  2IUK A;  3LOY A;  1G96 A;  4K1V A;  4BU4 A;  1B2M A;  3PCR A;  1IVW A;  1S5A A;  2GU1 A;  3D4A A;  2CG1 A;  4U13 A;  1AR0 A;  5CF1 A;  3DM8 A;  1BRI A;  3EHC A;  3KFQ C;  2XSH B;  1L5G B;  1O7N B;  3K63 A;  1DVC A;  1RRH A;  3G8Z A;  4RNY A;  1CH0 A;  1BSE A;  1A90 A;  1FUS A;  3ROB A;  2K0M A;  2AAE A;  5A0O B;  1BRG A;  2C11 A;  3M8C A;  3JUP A;  1Z1S A;  1V74 A;  4HM1 B;  1BSD A;  1BOX A;  2C10 A;  1W7C A;  1BNE A;  2CFG A;  3K0Z A;  3LTB A;  3DGN A;  2CFK A;  1BUQ A;  4MEI A;  2P0X A;  1BAO A;  1BUJ A;  3WOE B;  5HOH A;  1WMO A;  1V57 A;  4X2H A;  5G2G A;  4BTY A;  1BU4 A;  1DE3 A;  3G4S 3;  1AY7 A;  3KCH A;  3UB1 A;  1C7H A;  4CPK A;  1LOY A;  3LTA A;  1YNV X;  2Y73 A;  1RGH A;  1I0X A;  3FSD A;  3VF1 A;  1DMM A;  4LYL B;  2B1X B;  1MWR A;  1WNH A;  2HMK B;  1UI7 A;  1O7P B;  1VQL 3;  1K9M 4;  1U8C B;  5IEP A;  3G71 3;  1WMN A;  4BIR A;  1EEJ A;  3N8B A;  1M90 4;  4FMB A;  2W2C A;  2Z7A A;  2FGT A;  2V1L A;  1YGW A;  5D82 A;  1QAK A;  1UCK A;  4IPB A;  3VSY A;  3CC4 3;  1W6C A;  1DET A;  3EBY A;  6GSP A;  3CCS 3;  2YFL B;  1UCJ A;  4KZ1 A;  5IG3 A;  3CXC 2;  2C4B A;  1K73 4;  3BU4 A;  3HZP A;  3MWZ A;  2I9W A;  1YJN 3;  1Q42 A;  5AYR B;  1OF5 B;  3NUV A;  4OUQ A;  3A5E A;  5KP4 A;  2YFI B;  2AAD A;  1LQG C;  1WTH A;  4IIA A;  4BL3 A;  3HII A;  3CMA 3;  1VQ8 3;  3PCS A;  1BAN A;  1HZ1 A;  2W9Q A;  5AIG A;  1VQP 3;  2RSX A;  2Z77 A;  3CU3 A;  2BMR B;  3FKA A;  5M1A A;  3D9R A;  3ECF A;  4K90 B;  4J8T A;  4LEH A;  4MMZ B;  9RNT A;  1EKM A;  1QMA A;  2D1W A;  2M7O A;  2D42 A;  2XRX B;  1FGT A;  1WQL B;  4N6L A;  3WDG B;  5CXO A;  1EQK A;  1GOY A;  1LNH A;  1JB2 A;  4AKY A;  3AGN A;  4N6T A;  1O7W B;  3DGY A;  1KC8 4;  1UI8 A;  5KP1 A;  1I2E A;  1ZO2 A;  2Y74 A;  2CX0 A;  2ML6 A;  3FF0 A;  3O8Y A;  2LQV A;  3LYG A;  4ZM8 A;  4XBY A;  1AQZ A;  3NXJ A;  5AI1 A;  5IEN A;  2CW9 A;  1Q7H A;  1STF I;  1RLS A;  1GMP A;  1IU7 A;  4EYC A;  1RN4 A;  2GEX A;  2XEP A;  3LZA A;  1HKX A;  1QVG 2;  1K28 A;  2KCD A;  3CNM A;  2OQE A;  1BRJ A;  2XFT A;  1B27 A;  2IA7 A;  4KVH A;  2BNG A;  3I55 3;  3NV0 B;  3MG2 A;  3DY5 A;  3MPH A;  3ALA A;  1N5P A;  1S72 3;  3HX8 A;  1RGK A;  1TTO A;  1YJ9 3;  3CCR 3;  5TGN A;  3HOH A;  5ELU A;  1X1U A;  1T2H A;  2WGQ A;  1K8A 4;  1BRK A;  2XGL A;  5M18 A;  2HMJ B;  3WHO A;  1BNR A;  2W6J H;  3BNC A;  2XFS A;  3NBJ A;  4HJL B;  1OGX A;  1R4C A;  3FG4 A;  1SAR A;  4RNZ A;  1PU4 A;  1BIR A;  3DMC A;  3JVC A;  4FMC A;  3F40 A;  4NPB A;  2KF3 A;  3NBB A;  2CH9 A;  1R4Y A;  4FCM A;  3ER7 A;  1GD3 A;  1JJ2 2;  2Z76 A;  3T8U A;  3NBR A;  1LOV A;  3MYT A;  2O9U X;  2W56 B;  3SLU A;  4WHA A;  3UNL A;  1W2Z A;  1BSB A;  4FR9 A;  1KQS 2;  1CQS A;  2E2T A;  1IT7 A;  2GBW B;  1OF5 A;  3KSE D;  4MJD A;  3GZR A;  5IG5 A;  1DYU A;  3B7C A;  1NJI 4;  1AVL A;  3CD6 3;  2YX9 A;  1VQK 3;  1X1Y A;  2F86 B;  3WA3 A;  1A2V A;  1OUN A;  2F98 A;  2CWV A;  1FZU A;  1N5H A;  2WO0 A;  5IG4 A;  1SPU A;  5LC7 A;  3U1W A;  5IW9 A;  4KT3 B;  2ML5 A;  2BHM A;  2OWP A;  3EN8 A;  3H3H A;  3SX1 A;  1OAC A;  2F56 A;  1LRA A;  1A2P A;  3X40 A;  4HYZ A;  1OHO A;  3UL6 A;  1ULI B;  7STD A;  4K61 A;  1UGI A;  1VQN 3;  1NWW A;  2MF7 A;  1M9G A;  2P0M A;  2RNT A;  4HOH A;  4RNT A;  5CK6 A;  4TX4 A;  4L8P A;  3IMA B;  3LT8 A;  4R9L A;  3SYU A;  3G6E 3;  4H3U A;  5JPP A;  2FNQ A;  1RRL A;  1FGO A;  1AV4 A;  4LSO A;  5HGR A;  2P38 A;  2HML B;  1B2S A;  2HOH A;  3NQY A;  5D81 A;  1QVF 2;  1BNG A;  4EXR A;  3CME 3;  4BL2 A;  1UCL A;  1VQ9 3;  3B4P A;  4ILF A;  2RGQ A;  3NV0 A;  2KF6 A;  3I56 3;  1PFP A;  3NM2 A;  2J8X B;  3K7C A;  1RGC A;  1N8Q A;  1RDS A;  3FGY A;  2XF3 A;  1NB3 I;  4NRE A;  1I0V A;  1JBT A;  2ZA4 A;  1D6Y A;  3JUQ A;  1D6U A;  1VZZ A;  1LQM B;  3X3X A;  1W6G A;  3CCL 3;  1OCV A;  1QAL A;  1BSA A;  3F14 A;  3HI7 A;  6STD A;  1O7G B;  3LTC A;  3QRD A;  3D5I A;  4EW5 A;  1B20 A;  1KSI A;  4MMX B;  2FXT A;  1BNF A;  1RGL A;  2K3D A;  2ZL8 A;  1W01 A;  3N9H A;  3A76 A;  2INX A;  2E2V A;  1BGS A;  3NX0 A;  2PZV A;  1SQW A;  1W02 A;  2W56 A;  5IEO A;  1W2B 2;  3MSO A;  3EE1 A;  2O3O A;  1X1X A;  3DXO A;  1DMN A;  3PS8 A;  4WYK B;  3EJV A;  1FGQ A;  1M1K 4;  4N6U A;  1MGW A;  2ZDJ A;  1J2B A;  1MNL A;  1MWT A;  1W5Z A;  3D79 A;  2Q07 A;  8RNT A;  1JZO A;  3FLJ A;  4FMA A;  2IMJ A;  4EV2 A;  2XR8 B;  1M1X B;  3Q90 A;  1D6Z A;  1VQO 3;  3CPO A;  4I5Q A;  1TU5 A;  3L0R A;  3LML A;  1K41 A;  1N8R 4;  3UJM A;  4FMD A;  2CFD A;  3GZY B;  4NHF A;  5IG0 A;  2SAR A;  1I3F A;  2BMO B;  2OQE C;  1YJW 3;  4FCZ A;  1W00 A;  2GBX B;  3OXA A;  4N6O B;  4CCV A;  2F5M A;  3GWR A;  1RNT A;  2BT3 A;  1HU9 A;  4CJN A;  1TRQ A;  2QEX 3;  3STD A;  2K54 A;  1JKG B;  1UCI A;  2H0G A;  1GSP A;  3D5G A;  2H0H A;  3DGM A;  3PGB A;  1C54 A;  1TFK A;  1B21 A;  2F4Y A;  1N9J A;  2UUG C;  1RNB A;  3U97 A;  3S29 A;  3AHS A;  1Q40 B;  1NU3 A;  1UUV B;  4HZ9 B;  3CPW 2;  3V98 A;  3K9M C;  1B2Z A;  1A2K A;  3CC7 3;  1T3B A;  1FA3 A;  5AII A;  1SJW A;  2OOV A;  5M19 A;  1G0T A;  1GOU A;  3WR2 A;  3X41 A;  4L7K A;  4XBT A;  2CHC A;  1VQM 3;  6RNT A;  1I70 A;  2UGI A;  2XSO B;  2PNC A;  3AMO B;  3Q2P A;  3CC2 3;  5IF6 A;  3X42 A;  4IT7 A;  5DRV A;  5ELJ A;  2GSP A;  3URP A;  3FG3 A;  1RMS A;  5AEW B;  1E97 A;  2F99 A;  2CC3 A;  2HMN B; 
#chains in the Genus database with same CATH homology
 1N9E A;  4HVN A;  1FGM A;  2WOF A;  4K1U A;  3B4O A;  4MMY B;  1KWI A;  4R80 A;  1ASK A;  1GY6 A;  4O2H A;  3CCE 3;  3DGL A;  1OHS A;  3CCQ 3;  4LZI A;  2YFJ B;  4WP5 A;  1NDO B;  4WYK A;  3F7S A;  5LC6 A;  1IQX A;  4BTW A;  3LTD A;  4ORL A;  3G16 A;  3DUK A;  1VQ5 3;  3WA2 X;  2JQ5 A;  4LGQ A;  2A15 A;  4XDV A;  2B24 B;  4QWT A;  2W9P A;  4J9A A;  3S27 A;  4R1K A;  3KZT A;  2XH9 A;  1CYV A;  2W04 A;  3X3Z A;  3N54 B;  3K5T A;  3WOF B;  3BLZ A;  5I97 A;  2MC8 A;  3CCV 3;  1VQ7 3;  3I0Y A;  1Q82 4;  1GD4 A;  1TUH A;  3MHE A;  3WOD G;  4HKV B;  5FGO A;  4CDL A;  3LXU X;  3PXM A;  1JKG A;  2SBL A;  3EC9 A;  3EQQ B;  3F8X A;  3PZW A;  1YI2 3;  1FGR A;  1TFO A;  3RDE A;  1T5Y A;  3J7Y d;  1RJO A;  3IJE B;  3T0U A;  1E3R A;  1IQY A;  1JB4 A;  1E3V A;  1Q40 A;  1UUW B;  2STD A;  2IUJ A;  4I4K A;  1YHQ 3;  4HM8 B;  4R9K A;  4HM0 B;  1EG9 B;  3KN4 A;  1A67 A;  5AIF A;  2HMO B;  1OPY A;  1GYB A;  3AMO A;  5AIH A;  1TP6 A;  4KFD A;  2E2U A;  2CFW A;  3KII A;  3OWS A;  3CCU 3;  1Q81 4;  1Q86 4;  3T8N A;  5CF2 A;  5CLK A;  4H61 A;  3NHX A;  3MG3 A;  1JB5 A;  2RFR A;  2W0Q A;  3TDG A;  5FW5 A;  2OTJ 3;  3FCS B;  3CCJ 3;  1ULJ B;  3EB8 A;  2OCT A;  4HM5 B;  5BXQ A;  1ROV A;  4Q53 A;  4BTX A;  3F8H A;  2GXF A;  1US1 A;  2W03 A;  2CFL A;  2JDI H;  4HM2 B;  3EBT A;  3JUO A;  2P05 A;  3B8L A;  1DMQ A;  4JRF A;  2XGN A;  3HK4 A;  1STD A;  3LH4 A;  4JF8 A;  4FCJ A;  4L8O A;  4HM4 B;  1YIJ 3;  1DVD A;  1JNQ A;  3FH1 A;  1Y4K A;  2HMM B;  2P09 A;  1TIJ A;  4EC6 A;  1SIH A;  4KFE A;  5EEO A;  4WWU C;  1IK3 A;  3GRD A;  1YGE A;  5BVB A;  4HM3 B;  4XM4 A;  3BND A;  3SXX A;  3NM7 A;  2WOH A;  3EN1 B;  3WMD A;  3PYJ A;  4O02 B;  3V99 A;  2R4I A;  2OOV C;  3OWU A;  1VQ6 3;  1EA2 A;  1GY5 A;  4XB5 A;  2CKF B;  3Q1C A;  1LOX A;  4HM7 B;  3EF8 A;  4PEJ A;  4WFO A;  1UW1 A;  1JN5 B;  3DGO A;  1QJG A;  2QIY A;  3BNE A;  1GS3 A;  1W4N A;  1IV9 A;  3MG1 A;  2LYX A;  4AEQ A;  1OGZ A;  4O8S A;  4G1M B;  3FG1 A;  4N6M A;  3EX9 A;  1IV7 A;  1IDP A;  1RKY A;  1WMP A;  2CWT A;  3SOY A;  4STD A;  3OWY A;  2KXG A;  3V92 A;  1OH0 A;  5JBS A;  3IPT A;  1GY7 A;  3KKG A;  2CK3 H;  3SOA A;  1JV2 B;  1KD1 4;  1RN7 A;  3NQZ A;  1NB5 I;  3RGR A;  1IVU A;  5EQL A;  4HZB B;  4KFF A;  3KSP A;  3VGN A;  3X3Y A;  2WGO A;  4O3V A;  1JRQ A;  1IT8 A;  3JUN A;  3QK9 A;  3CNX A;  4EV5 A;  1CEW I;  3S5C A;  1NO3 A;  4N6V 0;  5AYS C;  1F8N A;  3FF2 A;  2OTL 3;  4RZM A;  2KRT A;  3BNB A;  3OV4 A;  4GB5 A;  3G0K A;  1LXE A;  3CCM 3;  4XDW A;  3GZB A;  1W6Y A;  2BO9 B;  1LVN A;  3LT9 A;  2QGU A;  1O7H B;  2UX0 A;  3D3L A;  3GZX B;  1AVK A;  3F7X A;  3HIG A;  4OVM A;  5JPU A;  3E99 A;  5EVH A;  3S67 A;  3RGA A;  3KE7 A;  3SVA A;  1VQ4 3;  3JUM A;  3DZL A;  3OW2 2;  5D83 A;  2CIU A;  1QAF A;  3H51 A;  4EBG A;  8CHO A;  5KP3 A;  4XBX A;  3FZW A;  1ISK A;  4AKZ A;  1ZX2 A;  1YIT 3;  2BMQ B;  3SED A;  1U5O A;  3F9S A;  2Z6B A;  4OK0 A;  4X2O A;  5DRE A;  1JN5 A;  5AEU B;  4R4K A;  1SII A;  2L4V A;  4N6N B;  3MKI A;  3UL5 A;  2GEY A;  1Q7Y 4;  1IVX A;  1OHP A;  3S28 A;  2RCD A;  1O7M B;  4LMI A;  1CYU A;  1MOL A;  3BB9 A;  4HM6 B;  4HBR A;  4RBN A;  2CWU A;  3OX9 A;  1ROA A;  3GAX A;  5IER A;  1IQ8 A;  2QA4 3;  1FUW A;  1IVV A;  4GL6 A;  4N3V A;  2CG0 A;  1YVB I;  5STD A;  2GU3 A;  2IUK A;  3LOY A;  1G96 A;  4K1V A;  3PCR A;  1IVW A;  1S5A A;  2GU1 A;  2CG1 A;  5CF1 A;  4U13 A;  1AR0 A;  3DM8 A;  3EHC A;  3KFQ C;  2XSH B;  1L5G B;  1O7N B;  3K63 A;  1DVC A;  1RRH A;  3G8Z A;  4RNY A;  1A90 A;  3ROB A;  2K0M A;  5A0O B;  2C11 A;  3M8C A;  3JUP A;  1Z1S A;  1V74 A;  4HM1 B;  2C10 A;  2CFG A;  1W7C A;  3LTB A;  3K0Z A;  1BUQ A;  3DGN A;  2CFK A;  4MEI A;  2P0X A;  3WOE B;  1WMO A;  4X2H A;  4BTY A;  5G2G A;  3G4S 3;  3UB1 A;  1C7H A;  3LTA A;  2Y73 A;  3FSD A;  3VF1 A;  1DMM A;  2B1X B;  1WNH A;  2HMK B;  1UI7 A;  1O7P B;  1VQL 3;  1K9M 4;  1U8C B;  5IEP A;  3G71 3;  1WMN A;  1M90 4;  3N8B A;  4FMB A;  2W2C A;  2Z7A A;  2FGT A;  2V1L A;  5D82 A;  1QAK A;  4IPB A;  3VSY A;  3CC4 3;  1W6C A;  3EBY A;  3CCS 3;  2YFL B;  3CXC 2;  4KZ1 A;  5IG3 A;  1K73 4;  3HZP A;  3MWZ A;  2I9W A;  1YJN 3;  1Q42 A;  5AYR B;  1OF5 B;  3NUV A;  4OUQ A;  5KP4 A;  2YFI B;  1WTH A;  4IIA A;  3CMA 3;  3HII A;  1VQ8 3;  3PCS A;  2W9Q A;  5AIG A;  1VQP 3;  2RSX A;  2Z77 A;  3CU3 A;  2BMR B;  3FKA A;  3D9R A;  3ECF A;  4K90 B;  4J8T A;  4LEH A;  4MMZ B;  1EKM A;  1QMA A;  2D1W A;  2M7O A;  2D42 A;  2XRX B;  1FGT A;  1WQL B;  4N6L A;  3WDG B;  5CXO A;  1EQK A;  4AKY A;  1LNH A;  1JB2 A;  4N6T A;  1O7W B;  1KC8 4;  1UI8 A;  5KP1 A;  1ZO2 A;  2Y74 A;  2ML6 A;  3FF0 A;  3O8Y A;  2LQV A;  3LYG A;  4ZM8 A;  4XBY A;  3NXJ A;  5AI1 A;  5IEN A;  2CW9 A;  1STF I;  1IU7 A;  4EYC A;  2GEX A;  2XEP A;  3LZA A;  1HKX A;  1QVG 2;  1K28 A;  2KCD A;  3CNM A;  2OQE A;  2XFT A;  4KVH A;  2IA7 A;  2BNG A;  3I55 3;  3NV0 B;  3MG2 A;  3DY5 A;  3MPH A;  3ALA A;  1N5P A;  3HX8 A;  1YJ9 3;  3CCR 3;  5TGN A;  5ELU A;  2WGQ A;  1K8A 4;  2XGL A;  2HMJ B;  2W6J H;  3BNC A;  2XFS A;  3NBJ A;  4HJL B;  1OGX A;  1R4C A;  3FG4 A;  4RNZ A;  1PU4 A;  3DMC A;  3JVC A;  4FMC A;  3F40 A;  3NBB A;  2CH9 A;  4FCM A;  3ER7 A;  1GD3 A;  1JJ2 2;  2Z76 A;  3T8U A;  3NBR A;  3MYT A;  2O9U X;  2W56 B;  3SLU A;  4WHA A;  3UNL A;  1W2Z A;  4FR9 A;  1KQS 2;  1CQS A;  2E2T A;  1IT7 A;  2GBW B;  1OF5 A;  3KSE D;  4MJD A;  3GZR A;  5IG5 A;  1DYU A;  3B7C A;  1NJI 4;  1AVL A;  3CD6 3;  2YX9 A;  1VQK 3;  2F86 B;  3WA3 A;  1A2V A;  1OUN A;  2F98 A;  2CWV A;  1N5H A;  2WO0 A;  5IG4 A;  1SPU A;  5LC7 A;  3U1W A;  5IW9 A;  2ML5 A;  2BHM A;  2OWP A;  3EN8 A;  3H3H A;  3SX1 A;  1OAC A;  3X40 A;  4HYZ A;  1OHO A;  3UL6 A;  1ULI B;  7STD A;  4K61 A;  1VQN 3;  1NWW A;  2MF7 A;  1M9G A;  2P0M A;  5CK6 A;  4TX4 A;  4L8P A;  3IMA B;  3LT8 A;  4R9L A;  3G6E 3;  4H3U A;  5JPP A;  2FNQ A;  1RRL A;  1FGO A;  1AV4 A;  4LSO A;  5HGR A;  2P38 A;  2HML B;  3NQY A;  5D81 A;  1QVF 2;  4EXR A;  3CME 3;  1VQ9 3;  3B4P A;  2RGQ A;  3NV0 A;  3I56 3;  1PFP A;  3NM2 A;  3K7C A;  1N8Q A;  3FGY A;  2XF3 A;  1NB3 I;  4NRE A;  1D6Y A;  3JUQ A;  1D6U A;  1VZZ A;  3X3X A;  1W6G A;  3CCL 3;  1OCV A;  1QAL A;  3F14 A;  3HI7 A;  6STD A;  1O7G B;  3LTC A;  3QRD A;  1KSI A;  4MMX B;  2FXT A;  2ZL8 A;  1W01 A;  3N9H A;  3A76 A;  2INX A;  2E2V A;  3NX0 A;  2PZV A;  1SQW A;  1W02 A;  2W56 A;  5IEO A;  1W2B 2;  3MSO A;  3EE1 A;  2O3O A;  3DXO A;  1DMN A;  3PS8 A;  4WYK B;  3EJV A;  1FGQ A;  1M1K 4;  4N6U A;  2ZDJ A;  1J2B A;  1MNL A;  1W5Z A;  2Q07 A;  3FLJ A;  4FMA A;  2IMJ A;  4EV2 A;  2XR8 B;  1M1X B;  3Q90 A;  1D6Z A;  1VQO 3;  3CPO A;  1TU5 A;  3L0R A;  3LML A;  1K41 A;  1N8R 4;  3UJM A;  4FMD A;  2CFD A;  3GZY B;  4NHF A;  5IG0 A;  2BMO B;  2OQE C;  1YJW 3;  4FCZ A;  1W00 A;  2GBX B;  3OXA A;  4N6O B;  4CCV A;  3GWR A;  2BT3 A;  1HU9 A;  2QEX 3;  3STD A;  2K54 A;  1JKG B;  3DGM A;  1S72 3;  3PGB A;  1TFK A;  1N9J A;  3U97 A;  3S29 A;  1Q40 B;  1NU3 A;  1UUV B;  4HZ9 B;  3CPW 2;  3V98 A;  3K9M C;  3CC7 3;  1A2K A;  1FA3 A;  5AII A;  1SJW A;  2OOV A;  3X41 A;  4L7K A;  4XBT A;  2CHC A;  1VQM 3;  2XSO B;  2PNC A;  3AMO B;  3Q2P A;  3CC2 3;  5IF6 A;  3X42 A;  4IT7 A;  5DRV A;  5ELJ A;  3FG3 A;  5AEW B;  1E97 A;  2F99 A;  2CC3 A;  2HMN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...