1LNIA

Crystal structure analysis of a ribonuclease from streptomyces aureofaciens at atomic resolution (1.0 a)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
molecule tags Hydrolase
source organism Streptomyces aureofaciens
publication title Atomic resolution data reveal flexibility in the structure of RNase Sa.
pubmed doi rcsb
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1lniA00
1X1WA 1BRIA 1RGAA 1AY7A 1B27A 1BNRA 2RNTA 1RNBA 1RCLA 3AGOA 3RNTA 3D5IA 1I2FA 1UCLA 2GSPA 1BRSA 1I2EA 1BGSA 1B2ZA 1I3IA 1YVSA 1BRJA 1CH0A 1X1XA 1FYSA 1LNIA 1UCKA 6GSPA 2F4YA 1C54A 1FUTA 2SARA 1I70A 1TRQA 2KAAA 1BSAA 2ZA4A 1DETA 1BSEA 1TRPA 4HAAA 1RMSA 1B20A 3AHSA 1B2SA 1YNVX 1BNFA 1RHLA 1RNTA 1RGHA 1PY3A 1GMRA 3A5EA 1UCIA 1BRHA 1IYYA 1BUJA 1GOUA 1BSDA 1RGKA 1RDSA 1ZGXA 3WHOA 1BNEA 4BU4A 1RLSA 1GMPA 1RSNA 1BSBA 1FZUA 1RGFA 1BNSA 5GSPA 1BNIA 1JBRA 1I0VA 1BIRA 1BVIA 2BU4A 2HOHA 3SYUA 1HYFA 3BU4A 1LOWA 5BIRA 1JBTA 1RN1A 1I8VA 1LOVA 3D5GA 1R4YA 1RGLA 2F5WA 1PYLA 2KF5A 1UCJA 5BU4A 1TTOA 3BIRA 4RNTA 1MGWA 4BIRA 3GSPA 1I0XA 1BU4A 1G02A 7RNTA 1I2GA 1YGWA 1RGEA 8RNTA 1BNGA 1RGGA 1B21A 1LOYA 2KF4A 4GHOA 1LRAA 1RN4A 2C4BA 1GMQA 1Q9EA 1MGRA 1BNJA 1BOXA 1B3SA 1HZ1A 1SARA 5HOHA 1RCKA 3WR2A 2RBIA 4GSPA 1BRKA 1BRNL 1AQZA 1BSCA 7GSPA 2BIRA 1X1UA 4J5GA 1BANA 3KCHA 1GOYA 2AADA 1B2MA 1X1YA 5RNTA 2KF6A 1FUSA 1I3FA 2KF3A 3D4AA 1RGCA 1GSPA 1B2XA 1GOVA 1T2IA 3DGYA 1B2UA 4HOHA 3AHWA 1BRGA 3Q3FA 3AGNA 2AAEA 1RTUA 9RNTA 1BAOA 3URPA 6RNTA 3DH2A 1DE3A 1T2HA 1FW7A 1JBSA 1A2PA 4J5KA 3HOHA 2F5MA 2F56A
chains in the Genus database with same CATH superfamily
1X1WA 1AY7A 3F14A 2ZL8A 2Z7AA 1TU5A 1RNBA 2IA7A 3RNTA 2ML6A 3EHCA 3NX0A 3X42A 1FA3A 3HIGA 1AV4A 3MG1A 1I3IA 1YVSA 4AKZA 3EN1B 1IK3A 1IVWA 3G16A 1X1XA 2D1WA 2OCTA 3FG4A 4JF8A 4RBNA 1C54A 1EG9B 2SARA 1TRQA 1WMPA 4MMYB 3RGAA 1BSAA 4CPKA 1KQS2 4HAAA 1TRPA 3X3ZA 5CLKA 1B20A 4ILFA 4RZMA 3ZG0A 3BNCA 3F8XA 2CWVA 4HZ9B 4HM3B 1CEWI 1GMRA 3A5EA 4FR9A 1UCIA 1RN7A 1BUQA 2L1SA 5JPUA 4KZ1A 1SQWA 1BUJA 1GOUA 3STDA 4N6UA 4FCMA 1IT7A 4K1VA 1CQSA 2WOHA 2XEPA 5G1LA 4EW5A 3EBTA 1NWWA 1SJWA 5HGRA 4LEHA 5IG5A 1N8R4 1FZUA 1RGFA 4QWTA 3NUVA 1KC84 1DVDA 1JBRA 4I4KA 2BU4A 2QGUA 3SYUA 3OV4A 1LQGC 3BU4A 1LOWA 3KZTA 1JBTA 1W00A 1I8VA 1Q864 3D5GA 3MKIA 1OUNA 3N8BA 4KT3B 1R4YA 2IUJA 3DGMA 1STFI 1U8CB 1RGLA 3EJVA 5FW5A 2OQEA 2IY2A 2KCDA 2KF5A 2JDIH 2RGQA 3OW22 1K9M4 3B4OA 1WMOA 1LNHA 1EKMA 1JKGB 5BVBA 1JKGA 1JN5A 2R41A 4RNTA 2CHCA 3EF8A 1TJDA 4LZIA 3CCJ3 2XF3A 1VQ73 1RRLA 2XR8B 3OWSA 1I2GA 4FCJA 3S29A 3SEDA 3AMOA 1J2BA 3GZBA 4BL2A 5D83A 3CU3A 1RJOA 4LSOA 4N6MA 1LOYA 1VQ63 1ASKA 2W6JH 1LOXA 1O7MB 2R4IA 1OPYA 1Q42A 2HMJB 1Q9EA 4N6NB 3NHXA 1BNJA 2XH9A 1PU4A 3CCL3 4O2HA 1OCVA 2CW9A 3PCSA 1F8NA 5I97A 3KN4A 1K28A 4NPBA 3M8CA 5IG0A 2RBIA 4GSPA 3PGBA 4KFFA 1N9JA 5AIIA 3ROBA 1K8A4 1X1UA 3JUNA 3DY5A 3CC23 2XSHB 1IT8A 1OACA 1JN5B 1D6ZA 3N9HA 3KCHA 3VSYA 3CME3 1GOYA 1N5HA 1NB3I 2GEXA 1S723 3HZPA 1FUSA 1OHPA 1NB5I 2XFTA 1RGCA 5AIFA 1GSPA 1B2XA 4HM1B 1G96A 3DGYA 4OUQA 4EV2A 3V99A 1SPUA 1W6YA 3BNBA 3AHWA 4HOHA 4HZBB 4AKYA 1JV2B 1W6CA 1DMMA 5IERA 3IPTA 3B4PA 4RNYA 2CFKA 3UJMA 4CDLA 9RNTA 5AEWB 4BTWA 1ROVA 2RFRA 6RNTA 4PEJA 1T2HA 4N6OB 3EBYA 1YGEA 2K0MA 3HOHA 1MWRA 4BTXA 3OX9A 4FMCA 1RGAA 1B27A 4LGQA 2HMNB 3LT9A 3QRDA 2YX9A 4EC6A 3ZFZA 4FMDA 2O9UX 2BO9B 2OQEC 1I2EA 3FZWA 3K7CA 2O3OA 2IMJA 1BRJA 1CH0A 3NM2A 5JPPA 1DMNA 1LNIA 2XGLA 1UCKA 3PZWA 4KFEA 2F4YA 3F7XA 2F99A 3MPHA 3FG1A 1IQXA 1Q824 4J8TA 2BNGA 1BSEA 2GBXB 1Q40A 2UGIA 1B2SA 3DZLA 1YNVX 5LC7A 1M1XB 4MMXB 1OGXA 5AEUB 3BNEA 1PY3A 1ROAA 1V74A 4WFOA 1JB2A 2UUGC 4EXRA 1IQYA 1BSDA 5AIHA 2OTL3 1RDSA 3ECFA 1YJW3 1Y4KA 4R4KA 1BNEA 2HMOB 1RLSA 1ZX2A 4MMZB 1SIIA 1GMPA 2CK3H 2E2TA 3LTBA 3G8ZA 5D81A 7STDA 3D3LA 3S5CA 1Z1SA 1W2B2 4G1MB 4X2OA 3FGYA 2CFLA 4EV5A 2Y73A 2XSOB 8RNTA 1R4CA 3F7SA 5EQLA 3KSPA 3LTCA 1M9GA 1QJGA 5KP1A 1LXEA 3CXC2 1JB4A 2ML5A 5AIGA 2J8XB 2RSXA 5BU4A 1NO3A 3JUOA 1I0XA 1BU4A 3ZG5A 1UUGB 3EN8A 3EQQB 3K5TA 4RNZA 3JUQA 4EYCA 3MWZA 3DGNA 5M18A 2P0XA 1UUVB 3K63A 3V98A 3F40A 1UGIA 2QEX3 2KRTA 1JB5A 3FSDA 2C11A 2KF4A 3DM8A 5G1KA 1EQKA 1JRQA 3EX9A 4U13A 1KD14 1JZOA 1MGRA 1TUHA 2BHMA 1BOXA 1HU9A 2M7OA 2OOVC 2GU3A 5IG3A 1LQMB 1RCKA 2Z6BA 3BLZA 2GU1A 2CFDA 1Q7Y4 4XBXA 5AI1A 2F86B 2BMQB 3DGOA 3G713 1E97A 1YIT3 3T8NA 1OF5B 1ISKA 1YVBI 2UX0A 2GEYA 4JRFA 1N9EA 3KE7A 1LVNA 3GZYB 4K90B 3GRDA 1B2MA 1A2VA 5RNTA 1VQ93 2KF6A 3CCM3 2OTJ3 2C10A 1FGTA 5IG4A 1IVXA 3CPW2 2CX0A 3NM7A 1T2IA 2CC3A 1VZZA 2FGTA 4IT7A 1B2UA 3NBRA 4R9LA 3WODG 3CCU3 4I5QA 3I563 1W6GA 1BRGA 3EB8A 1G0TA 3CMA3 2AAEA 1W4NA 2RCDA 2XFSA 4WYKA 3SOAA 3HI7A 2HMLB 3NQYA 4MEIA 2I9WA 3D9RA 1C7HA 1ULJB 3AMOB 5G2GA 3WOFB 2K3DA 4J5KA 2L4VA 3WOEB 2F5MA 1BRIA 1AVKA 4K1UA 2RNTA 2FXTA 1E3RA 2H0GA 4KFDA 3AGOA 4HM4B 4LMIA 3D5IA 1UCLA 3DXOA 1NU3A 1BRSA 4XB5A 4R9KA 5M19A 3FF0A 2W9QA 4XDWA 3X3YA 1IV9A 3HX8A 1FYSA 2XRXB 1V57A 1I70A 1GY7A 3PS8A 4O3VA 1IU7A 1RMSA 2CWUA 3Q90A 5JBSA 1BNFA 2E2VA 1RNTA 1RGHA 3H51A 3VF1A 1BRHA 1TP6A 3LXUX 1S5AA 4KVHA 1AR0A 3B7CA 5AYSC 3S27A 4L8PA 1T5YA 4XBYA 4STDA 4XM4A 4AEQA 2BMRB 4IIAA 4R1KA 4WP5A 1YJN3 3I0YA 2BMOB 1RSNA 3NBJA 1BSBA 2YFLB 3MG2A 1BNIA 1I0VA 1RRHA 1O7NB 2HOHA 4FMAA 3GWRA 5DRVA 1HYFA 5D82A 2MF7A 1O7HB 5STDA 1RN1A 2IYJA 2Z77A 3MHEA 2WGOA 1QALA 3NXJA 4TX4A 2F5WA 1GY6A 1PYLA 1T3BA 4HM2B 1VQ83 3CC43 3CPOA 4DKIA 1TFKA 3UL5A 2WO0A 5IW9A 2GXFA 3BIRA 1MGWA 2CFWA 3GSPA 4NREA 5DREA 4BIRA 2XGNA 1VQK3 5ELJA 1G02A 1DYUA 2KXGA 3S28A 7RNTA 3WA3A 1WMNA 3FKAA 3N54B 2B1XB 1VQ53 1UUWB 1RGEA 1RGGA 4CJNA 1IDPA 4BL3A 2ZDJA 4HM6B 4N6LA 5CXOA 3X3XA 3QK9A 4GHOA 1RN4A 2C4BA 3HK4A 1GMQA 3OWYA 1WQLB 1MWTA 3RGRA 1E3VA 5TGNA 3U1WA 3CCQ3 1ZS7A 1HZ1A 1SARA 2P05A 3WR2A 5ELUA 1MOLA 3MSOA 1BRKA 4HM7B 1AQZA 3OXAA 1BRNL 1IV7A 1SIHA 2CX1A 1MWSA 2BIRA 3FG3A 4HM5B 4J5GA 2W2CA 5AYRB 1BANA 2F98A 1OHOA 3UL6A 4HKVB 2E2UA 5KP4A 4HVNA 1KWIA 1W7CA 2HMKB 4CCVA 3SLUA 3ALAA 2AADA 1X1YA 2PNCA 2CFGA 2HMMB 2P0MA 3KIIA 4N3VA 1ULIB 2CG0A 2WGQA 4XDVA 3WDGB 1JZDA 1W01A 5IF6A 3SVAA 3GAXA 2W04A 1VQQA 1IQ8A 2CKFB 5EEOA 5BXQA 3B8LA 4WWUC 3CCV3 3NV0B 2CWTA 3Q3FA 3S67A 1MNLA 1RTUA 3T8UA 3ER7A 3VGNA 1GS3A 3URPA 3V92A 4K61A 3X41A 3LZAA 3DH2A 1MWUA 3KFQC 3SX1A 1RKYA 1QVG2 1JBSA 3BB9A 1JNQA 2INXA 3BNDA 1FW7A 1A2PA 1OGZA 3JUPA 1PFPA 3GZRA 1N8QA 2P09A 3RDEA 1EA2A 3FF2A 2F56A 4HBRA 3CCS3 3PCRA 3NBBA 3CD63 1CYUA 4GL6A 3NV0A 3DMCA 5CF1A 1BNRA 1EUIC 4ORLA 3E99A 1RCLA 1K41A 2K54A 3CCE3 1GD4A 1FGQA 4H3UA 1I2FA 4HM8B 2GSPA 4WYKB 1YIJ3 1UI8A 1BGSA 1GY5A 3CNMA 1B2ZA 1NJI4 4NHFA 5M1AA 1OH0A 1L5GB 2CH9A 2Y74A 4N6V0 4O8SA 1VQL3 2LYXA 3JUMA 2MC8A 1AVLA 4OK0A 2W56A 3U97A 6GSPA 1FUTA 2ZHXB 4BTYA 3SOYA 2KAAA 1STDA 2CIUA 2ZA4A 3MYTA 1DETA 1K734 2CG1A 3I553 3AHSA 3F8HA 3KKGA 1RHLA 4GB5A 1Q7HA 3T0UA 3J7Yd 3EE1A 3WMDA 4IPBA 1CYVA 2P38A 1OF5A 3LH4A 1IYYA 3UNLA 1W5ZA 4L7KA 3EC9A 3LOYA 1RGKA 3FLJA 1ZGXA 5IEOA 5CF2A 3WHOA 1V58A 4BU4A 1TFOA 1N5PA 2FNQA 3LYGA 4MJDA 3G4S3 1UW1A 4Q53A 5GSPA 1BNSA 1GYBA 2A15A 1NNVA 2IUKA 1BIRA 1BVIA 2QIYA 1WNHA 2W03A 1QAKA 2YFJB 3G0KA 3K9MC 4EBGA 6STDA 3G6E3 5LC6A 1FUWA 3DUKA 2W56B 3X40A 5BIRA 1LOVA 2W0QA 1QVF2 3NQZA 4WHAA 2B24B 3FH1A 3H3HA 5IEPA 2PZVA 3SXXA 2V1LA 2H0IA 1EEJA 1US1A 3LMLA 1QAFA 1Q814 1UCJA 1VQN3 1TTOA 1UGHI 2JQ5A 3OWUA 2Q07A 3CNXA 4R80A 1NDOB 3WA2X 1FGOA 3FCSB 1YHQ3 1YGWA 1JJ22 4LYLB 3A76A 1GD3A 1IVVA 1BNGA 2LQVA 3LT8A 4J9AA 4N6TA 1UDII 1KSIA 1B21A 3F9SA 1ZO2A 1D6UA 1QMAA 1DVCA 1LRAA 1OHSA 3L0RA 3D79A 3PYJA 1M1K4 4H61A 1B3SA 1O7GB 5HOHA 1DMQA 1TIJA 2W9PA 4HYZA 3HIIA 3K0ZA 2YFIB 1BSCA 7GSPA 4O02B 3UB1A 1YJ93 2GBWB 1A2KA 3TDGA 4FCZA 1YI23 2D42A 1A67A 3GZXB 1W2ZA 1VQM3 5EVHA 5CK6A 5A0OB 1D6YA 3CC73 3IJEB 4X2HA 1I3FA 1Q40B 2KF3A 2Z76A 3JVCA 3MG3A 3D4AA 3PXMA 4FMBA 4HM0B 1VQP3 4OVMA 2OWPA 3DGLA 1GOVA 1O7PB 1VQ43 8CHOA 3Q1CA 1HKXA 3IMAB 3CCR3 2BT3A 4L8OA 3LTDA 1W02A 2OOVA 4XBTA 2STDA 3Q2PA 3AGNA 1UI7A 2H0HA 1O7WB 5IENA 1M904 1BAOA 3KSED 2WOFA 1DE3A 1FGMA 3O8YA 1WTHA 4HJLB 2SBLA 3LTAA 5KP3A 1FGRA 1U5OA 1IVUA 1A90A 5FGOA 2QA43 4ZM8A 1VQO3
chains in the Genus database with same CATH topology
1X1WA 1BRIA 1RGAA 1AY7A 1B27A 1BNRA 2RNTA 1RNBA 1RCLA 3AGOA 3RNTA 3D5IA 1I2FA 1UCLA 2GSPA 1BRSA 1I2EA 1BGSA 1B2ZA 1I3IA 1YVSA 1BRJA 1CH0A 1X1XA 1FYSA 1LNIA 1UCKA 6GSPA 2F4YA 1C54A 1FUTA 2SARA 1I70A 1TRQA 2KAAA 1BSAA 2ZA4A 1DETA 1BSEA 1TRPA 4HAAA 1RMSA 1B20A 3AHSA 1B2SA 1YNVX 1BNFA 1RHLA 1RNTA 1RGHA 1PY3A 1GMRA 3A5EA 1UCIA 1BRHA 1IYYA 1BUJA 1GOUA 1BSDA 1RGKA 1RDSA 1ZGXA 3WHOA 1BNEA 4BU4A 1RLSA 1GMPA 1RSNA 1BSBA 1FZUA 1RGFA 1BNSA 5GSPA 1BNIA 1JBRA 1I0VA 1BIRA 1BVIA 2BU4A 2HOHA 3SYUA 1HYFA 3BU4A 1LOWA 5BIRA 1JBTA 1RN1A 1I8VA 1LOVA 3D5GA 1R4YA 1RGLA 2F5WA 1PYLA 2KF5A 1UCJA 5BU4A 1TTOA 3BIRA 4RNTA 1MGWA 4BIRA 3GSPA 1I0XA 1BU4A 1G02A 7RNTA 1I2GA 1YGWA 1RGEA 8RNTA 1BNGA 1RGGA 1B21A 1LOYA 2KF4A 4GHOA 1LRAA 1RN4A 2C4BA 1GMQA 1Q9EA 1MGRA 1BNJA 1BOXA 1B3SA 1HZ1A 1SARA 5HOHA 1RCKA 3WR2A 2RBIA 4GSPA 1BRKA 1BRNL 1AQZA 1BSCA 7GSPA 2BIRA 1X1UA 4J5GA 1BANA 3KCHA 1GOYA 2AADA 1B2MA 1X1YA 5RNTA 2KF6A 1FUSA 1I3FA 2KF3A 3D4AA 1RGCA 1GSPA 1B2XA 1GOVA 1T2IA 3DGYA 1B2UA 4HOHA 3AHWA 1BRGA 3Q3FA 3AGNA 2AAEA 1RTUA 9RNTA 1BAOA 3URPA 6RNTA 3DH2A 1DE3A 1T2HA 1FW7A 1JBSA 1A2PA 4J5KA 3HOHA 2F5MA 2F56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1W A;  1BRI A;  1RGA A;  1AY7 A;  1B27 A;  1BNR A;  2RNT A;  1RNB A;  1RCL A;  3AGO A;  3RNT A;  3D5I A;  1I2F A;  1UCL A;  2GSP A;  1BRS A;  1I2E A;  1BGS A;  1B2Z A;  1I3I A;  1YVS A;  1BRJ A;  1CH0 A;  1X1X A;  1FYS A;  1LNI A;  1UCK A;  6GSP A;  2F4Y A;  1C54 A;  1FUT A;  2SAR A;  1I70 A;  1TRQ A;  2KAA A;  1BSA A;  2ZA4 A;  1DET A;  1BSE A;  1TRP A;  4HAA A;  1RMS A;  1B20 A;  3AHS A;  1B2S A;  1YNV X;  1BNF A;  1RHL A;  1RNT A;  1RGH A;  1PY3 A;  1GMR A;  3A5E A;  1UCI A;  1BRH A;  1IYY A;  1BUJ A;  1GOU A;  1BSD A;  1RGK A;  1RDS A;  1ZGX A;  3WHO A;  1BNE A;  4BU4 A;  1RLS A;  1GMP A;  1RSN A;  1BSB A;  1FZU A;  1RGF A;  1BNS A;  5GSP A;  1BNI A;  1JBR A;  1I0V A;  1BIR A;  1BVI A;  2BU4 A;  2HOH A;  3SYU A;  1HYF A;  3BU4 A;  1LOW A;  5BIR A;  1JBT A;  1RN1 A;  1I8V A;  1LOV A;  3D5G A;  1R4Y A;  1RGL A;  2F5W A;  1PYL A;  2KF5 A;  1UCJ A;  5BU4 A;  1TTO A;  3BIR A;  4RNT A;  1MGW A;  4BIR A;  3GSP A;  1I0X A;  1BU4 A;  1G02 A;  7RNT A;  1I2G A;  1YGW A;  1RGE A;  8RNT A;  1BNG A;  1RGG A;  1B21 A;  1LOY A;  2KF4 A;  4GHO A;  1LRA A;  1RN4 A;  2C4B A;  1GMQ A;  1Q9E A;  1MGR A;  1BNJ A;  1BOX A;  1B3S A;  1HZ1 A;  1SAR A;  5HOH A;  1RCK A;  3WR2 A;  2RBI A;  4GSP A;  1BRK A;  1BRN L;  1AQZ A;  1BSC A;  7GSP A;  2BIR A;  1X1U A;  4J5G A;  1BAN A;  3KCH A;  1GOY A;  2AAD A;  1B2M A;  1X1Y A;  5RNT A;  2KF6 A;  1FUS A;  1I3F A;  2KF3 A;  3D4A A;  1RGC A;  1GSP A;  1B2X A;  1GOV A;  1T2I A;  3DGY A;  1B2U A;  4HOH A;  3AHW A;  1BRG A;  3Q3F A;  3AGN A;  2AAE A;  1RTU A;  9RNT A;  1BAO A;  3URP A;  6RNT A;  3DH2 A;  1DE3 A;  1T2H A;  1FW7 A;  1JBS A;  1A2P A;  4J5K A;  3HOH A;  2F5M A;  2F56 A; 
#chains in the Genus database with same CATH topology
 1X1W A;  1AY7 A;  3F14 A;  2ZL8 A;  2Z7A A;  1TU5 A;  1RNB A;  2IA7 A;  3RNT A;  2ML6 A;  3EHC A;  3NX0 A;  3X42 A;  1FA3 A;  3HIG A;  1AV4 A;  3MG1 A;  1I3I A;  1YVS A;  4AKZ A;  3EN1 B;  1IK3 A;  1IVW A;  3G16 A;  1X1X A;  2D1W A;  2OCT A;  3FG4 A;  4JF8 A;  4RBN A;  1C54 A;  1EG9 B;  2SAR A;  1TRQ A;  1WMP A;  4MMY B;  3RGA A;  1BSA A;  4CPK A;  1KQS 2;  4HAA A;  1TRP A;  3X3Z A;  5CLK A;  1B20 A;  4ILF A;  4RZM A;  3ZG0 A;  3BNC A;  3F8X A;  2CWV A;  4HZ9 B;  4HM3 B;  1CEW I;  1GMR A;  3A5E A;  4FR9 A;  1UCI A;  1RN7 A;  1BUQ A;  2L1S A;  5JPU A;  4KZ1 A;  1SQW A;  1BUJ A;  1GOU A;  3STD A;  4N6U A;  4FCM A;  1IT7 A;  4K1V A;  1CQS A;  2WOH A;  2XEP A;  5G1L A;  4EW5 A;  3EBT A;  1NWW A;  1SJW A;  5HGR A;  4LEH A;  5IG5 A;  1N8R 4;  1FZU A;  1RGF A;  4QWT A;  3NUV A;  1KC8 4;  1DVD A;  1JBR A;  4I4K A;  2BU4 A;  2QGU A;  3SYU A;  3OV4 A;  1LQG C;  3BU4 A;  1LOW A;  3KZT A;  1JBT A;  1W00 A;  1I8V A;  1Q86 4;  3D5G A;  3MKI A;  1OUN A;  3N8B A;  4KT3 B;  1R4Y A;  2IUJ A;  3DGM A;  1STF I;  1U8C B;  1RGL A;  3EJV A;  5FW5 A;  2OQE A;  2IY2 A;  2KCD A;  2KF5 A;  2JDI H;  2RGQ A;  3OW2 2;  1K9M 4;  3B4O A;  1WMO A;  1LNH A;  1EKM A;  1JKG B;  5BVB A;  1JKG A;  1JN5 A;  2R41 A;  4RNT A;  2CHC A;  3EF8 A;  1TJD A;  4LZI A;  3CCJ 3;  2XF3 A;  1VQ7 3;  1RRL A;  2XR8 B;  3OWS A;  1I2G A;  4FCJ A;  3S29 A;  3SED A;  3AMO A;  1J2B A;  3GZB A;  4BL2 A;  5D83 A;  3CU3 A;  1RJO A;  4LSO A;  4N6M A;  1LOY A;  1VQ6 3;  1ASK A;  2W6J H;  1LOX A;  1O7M B;  2R4I A;  1OPY A;  1Q42 A;  2HMJ B;  1Q9E A;  4N6N B;  3NHX A;  1BNJ A;  2XH9 A;  1PU4 A;  3CCL 3;  4O2H A;  1OCV A;  2CW9 A;  3PCS A;  1F8N A;  5I97 A;  3KN4 A;  1K28 A;  4NPB A;  3M8C A;  5IG0 A;  2RBI A;  4GSP A;  3PGB A;  4KFF A;  1N9J A;  5AII A;  3ROB A;  1K8A 4;  1X1U A;  3JUN A;  3DY5 A;  3CC2 3;  2XSH B;  1IT8 A;  1OAC A;  1JN5 B;  1D6Z A;  3N9H A;  3KCH A;  3VSY A;  3CME 3;  1GOY A;  1N5H A;  1NB3 I;  2GEX A;  1S72 3;  3HZP A;  1FUS A;  1OHP A;  1NB5 I;  2XFT A;  1RGC A;  5AIF A;  1GSP A;  1B2X A;  4HM1 B;  1G96 A;  3DGY A;  4OUQ A;  4EV2 A;  3V99 A;  1SPU A;  1W6Y A;  3BNB A;  3AHW A;  4HOH A;  4HZB B;  4AKY A;  1JV2 B;  1W6C A;  1DMM A;  5IER A;  3IPT A;  3B4P A;  4RNY A;  2CFK A;  3UJM A;  4CDL A;  9RNT A;  5AEW B;  4BTW A;  1ROV A;  2RFR A;  6RNT A;  4PEJ A;  1T2H A;  4N6O B;  3EBY A;  1YGE A;  2K0M A;  3HOH A;  1MWR A;  4BTX A;  3OX9 A;  4FMC A;  1RGA A;  1B27 A;  4LGQ A;  2HMN B;  3LT9 A;  3QRD A;  2YX9 A;  4EC6 A;  3ZFZ A;  4FMD A;  2O9U X;  2BO9 B;  2OQE C;  1I2E A;  3FZW A;  3K7C A;  2O3O A;  2IMJ A;  1BRJ A;  1CH0 A;  3NM2 A;  5JPP A;  1DMN A;  1LNI A;  2XGL A;  1UCK A;  3PZW A;  4KFE A;  2F4Y A;  3F7X A;  2F99 A;  3MPH A;  3FG1 A;  1IQX A;  1Q82 4;  4J8T A;  2BNG A;  1BSE A;  2GBX B;  1Q40 A;  2UGI A;  1B2S A;  3DZL A;  1YNV X;  5LC7 A;  1M1X B;  4MMX B;  1OGX A;  5AEU B;  3BNE A;  1PY3 A;  1ROA A;  1V74 A;  4WFO A;  1JB2 A;  2UUG C;  4EXR A;  1IQY A;  1BSD A;  5AIH A;  2OTL 3;  1RDS A;  3ECF A;  1YJW 3;  1Y4K A;  4R4K A;  1BNE A;  2HMO B;  1RLS A;  1ZX2 A;  4MMZ B;  1SII A;  1GMP A;  2CK3 H;  2E2T A;  3LTB A;  3G8Z A;  5D81 A;  7STD A;  3D3L A;  3S5C A;  1Z1S A;  1W2B 2;  4G1M B;  4X2O A;  3FGY A;  2CFL A;  4EV5 A;  2Y73 A;  2XSO B;  8RNT A;  1R4C A;  3F7S A;  5EQL A;  3KSP A;  3LTC A;  1M9G A;  1QJG A;  5KP1 A;  1LXE A;  3CXC 2;  1JB4 A;  2ML5 A;  5AIG A;  2J8X B;  2RSX A;  5BU4 A;  1NO3 A;  3JUO A;  1I0X A;  1BU4 A;  3ZG5 A;  1UUG B;  3EN8 A;  3EQQ B;  3K5T A;  4RNZ A;  3JUQ A;  4EYC A;  3MWZ A;  3DGN A;  5M18 A;  2P0X A;  1UUV B;  3K63 A;  3V98 A;  3F40 A;  1UGI A;  2QEX 3;  2KRT A;  1JB5 A;  3FSD A;  2C11 A;  2KF4 A;  3DM8 A;  5G1K A;  1EQK A;  1JRQ A;  3EX9 A;  4U13 A;  1KD1 4;  1JZO A;  1MGR A;  1TUH A;  2BHM A;  1BOX A;  1HU9 A;  2M7O A;  2OOV C;  2GU3 A;  5IG3 A;  1LQM B;  1RCK A;  2Z6B A;  3BLZ A;  2GU1 A;  2CFD A;  1Q7Y 4;  4XBX A;  5AI1 A;  2F86 B;  2BMQ B;  3DGO A;  3G71 3;  1E97 A;  1YIT 3;  3T8N A;  1OF5 B;  1ISK A;  1YVB I;  2UX0 A;  2GEY A;  4JRF A;  1N9E A;  3KE7 A;  1LVN A;  3GZY B;  4K90 B;  3GRD A;  1B2M A;  1A2V A;  5RNT A;  1VQ9 3;  2KF6 A;  3CCM 3;  2OTJ 3;  2C10 A;  1FGT A;  5IG4 A;  1IVX A;  3CPW 2;  2CX0 A;  3NM7 A;  1T2I A;  2CC3 A;  1VZZ A;  2FGT A;  4IT7 A;  1B2U A;  3NBR A;  4R9L A;  3WOD G;  3CCU 3;  4I5Q A;  3I56 3;  1W6G A;  1BRG A;  3EB8 A;  1G0T A;  3CMA 3;  2AAE A;  1W4N A;  2RCD A;  2XFS A;  4WYK A;  3SOA A;  3HI7 A;  2HML B;  3NQY A;  4MEI A;  2I9W A;  3D9R A;  1C7H A;  1ULJ B;  3AMO B;  5G2G A;  3WOF B;  2K3D A;  4J5K A;  2L4V A;  3WOE B;  2F5M A;  1BRI A;  1AVK A;  4K1U A;  2RNT A;  2FXT A;  1E3R A;  2H0G A;  4KFD A;  3AGO A;  4HM4 B;  4LMI A;  3D5I A;  1UCL A;  3DXO A;  1NU3 A;  1BRS A;  4XB5 A;  4R9K A;  5M19 A;  3FF0 A;  2W9Q A;  4XDW A;  3X3Y A;  1IV9 A;  3HX8 A;  1FYS A;  2XRX B;  1V57 A;  1I70 A;  1GY7 A;  3PS8 A;  4O3V A;  1IU7 A;  1RMS A;  2CWU A;  3Q90 A;  5JBS A;  1BNF A;  2E2V A;  1RNT A;  1RGH A;  3H51 A;  3VF1 A;  1BRH A;  1TP6 A;  3LXU X;  1S5A A;  4KVH A;  1AR0 A;  3B7C A;  5AYS C;  3S27 A;  4L8P A;  1T5Y A;  4XBY A;  4STD A;  4XM4 A;  4AEQ A;  2BMR B;  4IIA A;  4R1K A;  4WP5 A;  1YJN 3;  3I0Y A;  2BMO B;  1RSN A;  3NBJ A;  1BSB A;  2YFL B;  3MG2 A;  1BNI A;  1I0V A;  1RRH A;  1O7N B;  2HOH A;  4FMA A;  3GWR A;  5DRV A;  1HYF A;  5D82 A;  2MF7 A;  1O7H B;  5STD A;  1RN1 A;  2IYJ A;  2Z77 A;  3MHE A;  2WGO A;  1QAL A;  3NXJ A;  4TX4 A;  2F5W A;  1GY6 A;  1PYL A;  1T3B A;  4HM2 B;  1VQ8 3;  3CC4 3;  3CPO A;  4DKI A;  1TFK A;  3UL5 A;  2WO0 A;  5IW9 A;  2GXF A;  3BIR A;  1MGW A;  2CFW A;  3GSP A;  4NRE A;  5DRE A;  4BIR A;  2XGN A;  1VQK 3;  5ELJ A;  1G02 A;  1DYU A;  2KXG A;  3S28 A;  7RNT A;  3WA3 A;  1WMN A;  3FKA A;  3N54 B;  2B1X B;  1VQ5 3;  1UUW B;  1RGE A;  1RGG A;  4CJN A;  1IDP A;  4BL3 A;  2ZDJ A;  4HM6 B;  4N6L A;  5CXO A;  3X3X A;  3QK9 A;  4GHO A;  1RN4 A;  2C4B A;  3HK4 A;  1GMQ A;  3OWY A;  1WQL B;  1MWT A;  3RGR A;  1E3V A;  5TGN A;  3U1W A;  3CCQ 3;  1ZS7 A;  1HZ1 A;  1SAR A;  2P05 A;  3WR2 A;  5ELU A;  1MOL A;  3MSO A;  1BRK A;  4HM7 B;  1AQZ A;  3OXA A;  1BRN L;  1IV7 A;  1SIH A;  2CX1 A;  1MWS A;  2BIR A;  3FG3 A;  4HM5 B;  4J5G A;  2W2C A;  5AYR B;  1BAN A;  2F98 A;  1OHO A;  3UL6 A;  4HKV B;  2E2U A;  5KP4 A;  4HVN A;  1KWI A;  1W7C A;  2HMK B;  4CCV A;  3SLU A;  3ALA A;  2AAD A;  1X1Y A;  2PNC A;  2CFG A;  2HMM B;  2P0M A;  3KII A;  4N3V A;  1ULI B;  2CG0 A;  2WGQ A;  4XDV A;  3WDG B;  1JZD A;  1W01 A;  5IF6 A;  3SVA A;  3GAX A;  2W04 A;  1VQQ A;  1IQ8 A;  2CKF B;  5EEO A;  5BXQ A;  3B8L A;  4WWU C;  3CCV 3;  3NV0 B;  2CWT A;  3Q3F A;  3S67 A;  1MNL A;  1RTU A;  3T8U A;  3ER7 A;  3VGN A;  1GS3 A;  3URP A;  3V92 A;  4K61 A;  3X41 A;  3LZA A;  3DH2 A;  1MWU A;  3KFQ C;  3SX1 A;  1RKY A;  1QVG 2;  1JBS A;  3BB9 A;  1JNQ A;  2INX A;  3BND A;  1FW7 A;  1A2P A;  1OGZ A;  3JUP A;  1PFP A;  3GZR A;  1N8Q A;  2P09 A;  3RDE A;  1EA2 A;  3FF2 A;  2F56 A;  4HBR A;  3CCS 3;  3PCR A;  3NBB A;  3CD6 3;  1CYU A;  4GL6 A;  3NV0 A;  3DMC A;  5CF1 A;  1BNR A;  1EUI C;  4ORL A;  3E99 A;  1RCL A;  1K41 A;  2K54 A;  3CCE 3;  1GD4 A;  1FGQ A;  4H3U A;  1I2F A;  4HM8 B;  2GSP A;  4WYK B;  1YIJ 3;  1UI8 A;  1BGS A;  1GY5 A;  3CNM A;  1B2Z A;  1NJI 4;  4NHF A;  5M1A A;  1OH0 A;  1L5G B;  2CH9 A;  2Y74 A;  4N6V 0;  4O8S A;  1VQL 3;  2LYX A;  3JUM A;  2MC8 A;  1AVL A;  4OK0 A;  2W56 A;  3U97 A;  6GSP A;  1FUT A;  2ZHX B;  4BTY A;  3SOY A;  2KAA A;  1STD A;  2CIU A;  2ZA4 A;  3MYT A;  1DET A;  1K73 4;  2CG1 A;  3I55 3;  3AHS A;  3F8H A;  3KKG A;  1RHL A;  4GB5 A;  1Q7H A;  3T0U A;  3J7Y d;  3EE1 A;  3WMD A;  4IPB A;  1CYV A;  2P38 A;  1OF5 A;  3LH4 A;  1IYY A;  3UNL A;  1W5Z A;  4L7K A;  3EC9 A;  3LOY A;  1RGK A;  3FLJ A;  1ZGX A;  5IEO A;  5CF2 A;  3WHO A;  1V58 A;  4BU4 A;  1TFO A;  1N5P A;  2FNQ A;  3LYG A;  4MJD A;  3G4S 3;  1UW1 A;  4Q53 A;  5GSP A;  1BNS A;  1GYB A;  2A15 A;  1NNV A;  2IUK A;  1BIR A;  1BVI A;  2QIY A;  1WNH A;  2W03 A;  1QAK A;  2YFJ B;  3G0K A;  3K9M C;  4EBG A;  6STD A;  3G6E 3;  5LC6 A;  1FUW A;  3DUK A;  2W56 B;  3X40 A;  5BIR A;  1LOV A;  2W0Q A;  1QVF 2;  3NQZ A;  4WHA A;  2B24 B;  3FH1 A;  3H3H A;  5IEP A;  2PZV A;  3SXX A;  2V1L A;  2H0I A;  1EEJ A;  1US1 A;  3LML A;  1QAF A;  1Q81 4;  1UCJ A;  1VQN 3;  1TTO A;  1UGH I;  2JQ5 A;  3OWU A;  2Q07 A;  3CNX A;  4R80 A;  1NDO B;  3WA2 X;  1FGO A;  3FCS B;  1YHQ 3;  1YGW A;  1JJ2 2;  4LYL B;  3A76 A;  1GD3 A;  1IVV A;  1BNG A;  2LQV A;  3LT8 A;  4J9A A;  4N6T A;  1UDI I;  1KSI A;  1B21 A;  3F9S A;  1ZO2 A;  1D6U A;  1QMA A;  1DVC A;  1LRA A;  1OHS A;  3L0R A;  3D79 A;  3PYJ A;  1M1K 4;  4H61 A;  1B3S A;  1O7G B;  5HOH A;  1DMQ A;  1TIJ A;  2W9P A;  4HYZ A;  3HII A;  3K0Z A;  2YFI B;  1BSC A;  7GSP A;  4O02 B;  3UB1 A;  1YJ9 3;  2GBW B;  1A2K A;  3TDG A;  4FCZ A;  1YI2 3;  2D42 A;  1A67 A;  3GZX B;  1W2Z A;  1VQM 3;  5EVH A;  5CK6 A;  5A0O B;  1D6Y A;  3CC7 3;  3IJE B;  4X2H A;  1I3F A;  1Q40 B;  2KF3 A;  2Z76 A;  3JVC A;  3MG3 A;  3D4A A;  3PXM A;  4FMB A;  4HM0 B;  1VQP 3;  4OVM A;  2OWP A;  3DGL A;  1GOV A;  1O7P B;  1VQ4 3;  8CHO A;  3Q1C A;  1HKX A;  3IMA B;  3CCR 3;  2BT3 A;  4L8O A;  3LTD A;  1W02 A;  2OOV A;  4XBT A;  2STD A;  3Q2P A;  3AGN A;  1UI7 A;  2H0H A;  1O7W B;  5IEN A;  1M90 4;  1BAO A;  3KSE D;  2WOF A;  1DE3 A;  1FGM A;  3O8Y A;  1WTH A;  4HJL B;  2SBL A;  3LTA A;  5KP3 A;  1FGR A;  1U5O A;  1IVU A;  1A90 A;  5FGO A;  2QA4 3;  4ZM8 A;  1VQO 3; 
#chains in the Genus database with same CATH homology
 1X1W A;  1BRI A;  1RGA A;  1AY7 A;  1B27 A;  1BNR A;  2RNT A;  1RNB A;  1RCL A;  3AGO A;  3RNT A;  3D5I A;  1I2F A;  1UCL A;  2GSP A;  1BRS A;  1I2E A;  1BGS A;  1B2Z A;  1I3I A;  1YVS A;  1BRJ A;  1CH0 A;  1X1X A;  1FYS A;  1LNI A;  1UCK A;  6GSP A;  2F4Y A;  1C54 A;  1FUT A;  2SAR A;  1I70 A;  1TRQ A;  2KAA A;  1BSA A;  2ZA4 A;  1DET A;  1BSE A;  1TRP A;  4HAA A;  1RMS A;  1B20 A;  3AHS A;  1B2S A;  1YNV X;  1BNF A;  1RHL A;  1RNT A;  1RGH A;  1PY3 A;  1GMR A;  3A5E A;  1UCI A;  1BRH A;  1IYY A;  1BUJ A;  1GOU A;  1BSD A;  1RGK A;  1RDS A;  1ZGX A;  3WHO A;  1BNE A;  4BU4 A;  1RLS A;  1GMP A;  1RSN A;  1BSB A;  1FZU A;  1RGF A;  1BNS A;  5GSP A;  1BNI A;  1JBR A;  1I0V A;  1BIR A;  1BVI A;  2BU4 A;  2HOH A;  3SYU A;  1HYF A;  3BU4 A;  1LOW A;  5BIR A;  1JBT A;  1RN1 A;  1I8V A;  1LOV A;  3D5G A;  1R4Y A;  1RGL A;  2F5W A;  1PYL A;  2KF5 A;  1UCJ A;  5BU4 A;  1TTO A;  3BIR A;  4RNT A;  1MGW A;  4BIR A;  3GSP A;  1I0X A;  1BU4 A;  1G02 A;  7RNT A;  1I2G A;  1YGW A;  1RGE A;  8RNT A;  1BNG A;  1RGG A;  1B21 A;  1LOY A;  2KF4 A;  4GHO A;  1LRA A;  1RN4 A;  2C4B A;  1GMQ A;  1Q9E A;  1MGR A;  1BNJ A;  1BOX A;  1B3S A;  1HZ1 A;  1SAR A;  5HOH A;  1RCK A;  3WR2 A;  2RBI A;  4GSP A;  1BRK A;  1BRN L;  1AQZ A;  1BSC A;  7GSP A;  2BIR A;  1X1U A;  4J5G A;  1BAN A;  3KCH A;  1GOY A;  2AAD A;  1B2M A;  1X1Y A;  5RNT A;  2KF6 A;  1FUS A;  1I3F A;  2KF3 A;  3D4A A;  1RGC A;  1GSP A;  1B2X A;  1GOV A;  1T2I A;  3DGY A;  1B2U A;  4HOH A;  3AHW A;  1BRG A;  3Q3F A;  3AGN A;  2AAE A;  1RTU A;  9RNT A;  1BAO A;  3URP A;  6RNT A;  3DH2 A;  1DE3 A;  1T2H A;  1FW7 A;  1JBS A;  1A2P A;  4J5K A;  3HOH A;  2F5M A;  2F56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...