1LNIA

Crystal structure analysis of a ribonuclease from streptomyces aureofaciens at atomic resolution (1.0 a)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Atomic resolution data reveal flexibility in the structure of RNase Sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1lniA00
1LRAA 1BSCA 1BU4A 4HOHA 1JBTA 1PYLA 3KCHA 2SARA 3HOHA 7GSPA 1BNRA 1RGLA 1BRJA 3GSPA 1BANA 1RCLA 1X1YA 3WHOA 4GSPA 1BRGA 1HYFA 2KF5A 5GSPA 2GSPA 1TRQA 1B2MA 1RGHA 2AADA 1BUJA 1RGGA 2RNTA 2F56A 2KF4A 1BRHA 1UCLA 1DE3A 2KF3A 4BU4A 4J5GA 1BNGA 2AAEA 2KF6A 4J5KA 1RGFA 1B27A 1BNEA 1B2XA 5HOHA 1I70A 6GSPA 3A5EA 2ZA4A 1IYYA 1PY3A 3AHWA 3DH2A 3D4AA 1GSPA 7RNTA 1RLSA 1B20A 1B21A 1LOVA 1BNFA 3URPA 3D5IA 2F4YA 1B3SA 1T2HA 1FW7A 3AHSA 4BIRA 1BSBA 1GOUA 2C4BA 1I0VA 1BGSA 3BIRA 1AY7A 1RMSA 1BVIA 1Q9EA 1ZGXA 2F5WA 1X1XA 3WR2A 1UCIA 1A2PA 3BU4A 1BIRA 1BRSA 5BU4A 1BNSA 1X1UA 1I2EA 1CH0A 1LOWA 3AGOA 1G02A 1BAOA 2BU4A 1SARA 1RGKA 1I0XA 3AGNA 1FUSA 4RNTA 1GOVA 1JBRA 1B2SA 1RTUA 2RBIA 1RGAA 8RNTA 1YVSA 2HOHA 4HAAA 1MGRA 1RDSA 1UCKA 6RNTA 1UCJA 1YGWA 1RCKA 1BNJA 1RGEA 1BSDA 1BRKA 1R4YA 1B2UA 1I3IA 2BIRA 1RSNA 1RNTA 3RNTA 1BNIA 5RNTA 1GMPA 1I2GA 1LOYA 1AQZA 1MGWA 1FUTA 1RN1A 1YNVX 1I2FA 1GOYA 1RHLA 1BRIA 1RNBA 1RGCA 1BSAA 1GMRA 1I3FA 5BIRA 1BRNL 1T2IA 1JBSA 1I8VA 1FZUA 1TTOA 1RN4A 1B2ZA 1FYSA 2KAAA 2F5MA 3Q3FA 1GMQA 4GHOA 1HZ1A 9RNTA 1LNIA 1X1WA 1BSEA 1DETA 3D5GA 3SYUA 1TRPA 1C54A 1BOXA 3DGYA
chains in the Genus database with same CATH superfamily
1LRAA 1V57A 3K5TA 1JBTA 3KCHA 2F99A 2SARA 4ZM8A 2W9PA 3S27A 3LXUX 1QMAA 3DGOA 5BVBA 2JDIH 2BO9B 1HYFA 1A90A 3K7CA 1TFKA 1WNHA 2AADA 3B4PA 2MF7A 1JB2A 4EBGA 1BUJA 1T5YA 3X3YA 1SIIA 3G4S3 1BRHA 2WO0A 5CXOA 1DMMA 2LYXA 4XBTA 3Q90A 4FMCA 1C7HA 5CK6A 3PXMA 4EV5A 2KF6A 2P0MA 2Z7AA 1BUQA 2E2TA 3HIGA 3N8BA 3WDGB 5HOHA 2XH9A 3CCJ3 2Z77A 3DM8A 4WYKB 2CH9A 2GU1A 1N9JA 1Z1SA 4X2OA 1NO3A 1US1A 1LNHA 1B21A 3L0RA 4WWUC 3SX1A 4R9LA 3KN4A 4OVMA 3URPA 5KP4A 1TJDA 5BXQA 4WYKA 4PEJA 1T2HA 1OPYA 4O2HA 3EBTA 2OOVC 1BSBA 3BNCA 1IVXA 1O7WB 3FGYA 2WGQA 1RRHA 4J9AA 1QVG2 1CYUA 1JRQA 4HKVB 3E99A 3DGNA 4L7KA 1IT7A 1A2PA 1A2KA 1EA2A 5JPPA 4STDA 5ELJA 2K3DA 4FCMA 5AIHA 4JRFA 1X1UA 1I2EA 5IEPA 3NUVA 1M904 4U13A 4HBRA 2KRTA 2OWPA 1LOWA 2SBLA 3AGOA 1M1XB 2GEXA 3WOFB 1VQP3 1FGRA 2GBXB 1OF5B 5HGRA 3PCRA 2H0IA 1GOVA 1JBRA 1B2SA 2RBIA 1RGAA 2CWUA 8RNTA 1VQO3 2L4VA 2V1LA 1OF5A 1YVSA 3CCQ3 3T8NA 1KC84 4NHFA 2GXFA 5IG0A 3QRDA 1Q42A 6RNTA 3F8XA 1WTHA 1MWUA 2Q07A 3O8YA 1GY7A 4HZBB 1RCKA 1BNJA 3CU3A 1IV9A 2W0QA 1NU3A 1D6YA 2CC3A 3F14A 3BLZA 5EQLA 4HM1B 1B2UA 3LTAA 1IK3A 2RSXA 3LTBA 3T0UA 1IVWA 3BNDA 3H51A 5D82A 3NHXA 1GMPA 3CCR3 1I2GA 3NX0A 3LH4A 1LOYA 2PZVA 4R4KA 1M9GA 3I0YA 1OUNA 1MGWA 5DRVA 3KIIA 1FUTA 3FG1A 4CCVA 1UGHI 1CEWI 4IPBA 5AEWB 2WOFA 6STDA 3S29A 1YNVX 1I2FA 2STDA 5FW5A 3EX9A 2I9WA 1BSAA 3D79A 3WA3A 5AIGA 4LSOA 4CDLA 1I3FA 1BRNL 3MPHA 2O3OA 1MNLA 2P38A 1GS3A 3G713 1U5OA 4EXRA 2RCDA 3EJVA 1WMPA 4FMAA 1B2ZA 2KAAA 2GU3A 2ZHXB 3MYTA 3EQQB 1VQN3 3OV4A 1LQGC 2CHCA 3Q1CA 4XDVA 1BSEA 2CW9A 2P05A 1W00A 4J8TA 2BMRB 4RBNA 1TFOA 4XM4A 4X2HA 2W03A 7GSPA 3HOHA 1EQKA 1RGLA 1JN5B 3CCV3 5AIIA 1ZX2A 3HIIA 2YFLB 1X1YA 3WHOA 4BTXA 1ASKA 2RGQA 7STDA 1BRGA 2XR8B 4MMYB 4KZ1A 2Y74A 1AVKA 4RZMA 3TDGA 1TRQA 1MWTA 1HKXA 1RGHA 2XEPA 1JN5A 2UUGC 2RNTA 4N6UA 1CQSA 3Q2PA 2F56A 2XSOB 2ZL8A 1G96A 5LC7A 4HM0B 5FGOA 1Q40A 4BU4A 1WMNA 1DMQA 1NJI4 4XB5A 2AAEA 4J5KA 3F7SA 3NBRA 1RGFA 4O3VA 1E97A 1N8R4 1PY3A 3NM2A 2CG1A 1ROVA 2CX0A 3GZYB 2Z6BA 1FGQA 3LZAA 5KP3A 7RNTA 2OTJ3 3M8CA 1B20A 2CK3H 1IU7A 3LTCA 3LMLA 1A67A 3FZWA 3BB9A 3AHSA 1ZO2A 3DXOA 1O7GB 1F8NA 1IV7A 2W56B 4WHAA 3S5CA 3OWYA 1JZOA 1W02A 1TIJA 3PYJA 1PU4A 2CIUA 2ML6A 1UUWB 2WOHA 1BVIA 1O7PB 3ER7A 3IJEB 4K90B 2W56A 5STDA 1X1XA 3WR2A 4GB5A 2E2UA 1OACA 5M1AA 3ALAA 2M7OA 3BU4A 1BIRA 3GZBA 4HJLB 1JKGA 3U1WA 4Q53A 1QVF2 1JV2B 2W9QA 4FMDA 3RGAA 2QA43 3FCSB 1W5ZA 1GY5A 1BAOA 2BU4A 3BNBA 3EBYA 3JVCA 4HM8B 3AGNA 1IDPA 1SJWA 1W6CA 3HK4A 1EKMA 3PCSA 4NPBA 1N5PA 3EN1B 5CF2A 1M1K4 2F98A 1RTUA 3UL6A 1O7HB 1W01A 1A2VA 5IF6A 3CCE3 1RN7A 1VQ53 5IG3A 1FGOA 1VZZA 5LC6A 4FMBA 2HOHA 2QGUA 2ML5A 1MGRA 1VQ73 1RDSA 4EYCA 3CCM3 3LOYA 2L1SA 4JF8A 3B7CA 3LTDA 3QK9A 1EUIC 3HZPA 3X3ZA 1YHQ3 2BIRA 2CWTA 1IQ8A 1RNTA 1RSNA 3V98A 1EEJA 1BNIA 2KXGA 3PGBA 1N8QA 3DGMA 4EW5A 1JB4A 1OGZA 1JB5A 1VQL3 4RNZA 3CPOA 3B4OA 1K41A 5D83A 1VQK3 4N3VA 1AQZA 2IYJA 3WODG 3FF2A 5EVHA 3CC23 4XBXA 2YFJB 3LT9A 3UL5A 1N5HA 3EB8A 1QAFA 1BRIA 3JUQA 3ZG0A 1TU5A 3FG4A 4LMIA 1RJOA 4K1VA 5AEUB 3S28A 1W6GA 3JUNA 1NDOB 1T2IA 3ECFA 1UUGB 3D3LA 3MSOA 3VSYA 2Z76A 1AV4A 1NWWA 4EC6A 1YJ93 1JBSA 1PFPA 1OCVA 4MMZB 3BNEA 2UGIA 2F5MA 5ELUA 3WOEB 5M18A 1UW1A 2ZDJA 3MWZA 3CPW2 1K734 1AR0A 3GAXA 1EG9B 9RNTA 2IMJA 3V99A 1OHPA 3D5GA 3SYUA 1GYBA 3DGYA 2MC8A 3CNXA 5AYRB 4HOHA 4R9KA 2OQEA 3MG3A 1VQ63 4BTWA 5AI1A 3I563 1BRJA 1SQWA 1BANA 1RCLA 2BMQB 3GSPA 4K61A 5G1LA 2W04A 4HM5B 1N9EA 5GSPA 1B2MA 3SOAA 4KFEA 2XFSA 3G6E3 1LXEA 3G16A 1VQM3 2KF4A 2CFLA 2D42A 4XDWA 1DE3A 1VQ93 3MHEA 4J5GA 5AIFA 3RGRA 4ILFA 3UNLA 2YX9A 3FF0A 4HM4B 2P0XA 4HM7B 3X40A 1S723 1UI7A 4LZIA 1W6YA 3WMDA 6GSPA 3A5EA 3T8UA 1IYYA 2C10A 1R4CA 2HMLB 3EN8A 5CLKA 3H3HA 3I553 2HMKB 3D4AA 1GSPA 1GY6A 2CFGA 4N6OB 2B1XB 5M19A 1RLSA 1UGIA 4R1KA 5IG4A 2IA7A 5KP1A 2J8XB 3K9MC 1LVNA 1B3SA 2F4YA 3JUPA 1VQ43 3OXAA 3ZFZA 3NXJA 3RDEA 3A76A 1Q40B 4OK0A 4ORLA 4N6NB 1GOUA 1CYVA 2C4BA 4GL6A 1I0VA 2P09A 4HYZA 3DUKA 1LOXA 4N6LA 5CF1A 1UDII 1Q9EA 1D6ZA 2HMNB 3K0ZA 1GD3A 2QIYA 3LYGA 1ZGXA 2XGNA 4MMXB 3V92A 1OHSA 3U97A 3DZLA 1UCIA 2OOVA 5D81A 2A15A 2BT3A 1MWRA 5IENA 1O7MB 1BNSA 2XRXB 5BU4A 1YJN3 4FCZA 1CH0A 2JQ5A 2O9UX 2PNCA 3NBJA 1O7NB 1KQS2 4LGQA 3DGLA 3KZTA 4KFDA 3WA2X 3UB1A 1SARA 1DVDA 1KWIA 1I0XA 1FUSA 2K0MA 2UX0A 3HX8A 5IEOA 4AKZA 3GZXB 3DY5A 4CJNA 3FSDA 1RRLA 1ULIB 1VQQA 1FGTA 1STDA 5JPUA 3EE1A 1MWSA 4O02B 1UCJA 5IERA 3JUOA 3OX9A 1Y4KA 2XFTA 3G8ZA 1JKGB 1GD4A 4H61A 1R4YA 1Q7Y4 1I3IA 1Q864 3KSPA 3RNTA 3CC43 3K63A 1STFI 3JUMA 3PZWA 3F40A 1IVUA 3J7Yd 1IT8A 1WQLB 3F7XA 5DREA 1DYUA 1FA3A 1D6UA 2BHMA 3N9HA 1W2ZA 4BTYA 5A0OB 3VGNA 3SXXA 2YFIB 5EEOA 1YJW3 1RNBA 1G0TA 1S5AA 3FH1A 3NQYA 4CPKA 2BMOB 1BOXA 4MEIA 5BIRA 2IUJA 3KE7A 3CNMA 3CMA3 1I8VA 3IMAB 2H0HA 2OCTA 2W2CA 3N54B 4BL3A 3CCS3 1FYSA 4N6MA 3Q3FA 4KFFA 3X3XA 1GMQA 4GHOA 4HM2B 1V74A 3OWSA 3CME3 2E2VA 2Y73A 3FG3A 2XF3A 4IIAA 1TRPA 2D1WA 1ROAA 3PS8A 4OUQA 1C54A 1RGCA 2QEX3 3SVAA 1HU9A 1BSCA 1BU4A 1PYLA 2CFWA 1YVBI 3AMOB 2K54A 1BNRA 3KFQC 1U8CB 5IW9A 1VQ83 4HVNA 2F86B 2WGOA 4MJDA 2C11A 4GSPA 1SPUA 4FR9A 4WP5A 3UJMA 5IG5A 2KF5A 2XSHB 2GSPA 1FGMA 3AMOA 1OH0A 4K1UA 2CX1A 4LEHA 1UCLA 4QWTA 2KF3A 2RFRA 3GRDA 4IT7A 1DVCA 4DKIA 1BNGA 4BL2A 1E3VA 2GEYA 4FCJA 1B27A 1BNEA 1Q7HA 1B2XA 2H0GA 4XBYA 1IQXA 1I70A 1NNVA 4H3UA 4AKYA 3S67A 2ZA4A 3AHWA 3SOYA 3DH2A 3ZG5A 1L5GB 1IVVA 2R41A 1LOVA 4G1MB 4N6V0 1TUHA 1BNFA 3ROBA 3D5IA 3FLJA 1DMNA 4TX4A 4I5QA 1FW7A 4BIRA 1Q814 4HM6B 3F9SA 2CG0A 3STDA 1KSIA 1K28A 4R80A 1BGSA 3BIRA 4L8OA 3OW22 2R4IA 1ISKA 1UUVB 1AY7A 1RMSA 1T3BA 2CKFB 1E3RA 1TP6A 3KKGA 1K8A4 4WFOA 3EF8A 2IUKA 1YIJ3 3G0KA 3SEDA 2F5WA 3IPTA 5TGNA 2IY2A 4KVHA 3GWRA 1BRSA 2FNQA 1AVLA 3FKAA 4N6TA 3EC9A 2W6JH 4I4KA 3X42A 1G02A 1W2B2 3MG2A 2CFKA 1RGKA 4LYLB 1QALA 3D9RA 1NB3I 1LQMB 4AEQA 4EV2A 1YI23 4HM3B 1QJGA 1KD14 3EHCA 4RNTA 3SLUA 3CCL3 3X41A 1MOLA 3HI7A 3MKIA 1WMOA 1FUWA 2BNGA 1W7CA 3KSED 2CWVA 1J2BA 4HAAA 1JNQA 1UCKA 3NBBA 1YGWA 1YIT3 2B24B 4RNYA 3OWUA 1RGEA 1Q824 1BSDA 1JJ22 1BRKA 4KT3B 1UI8A 3CCU3 2INXA 1YGEA 5RNTA 1JZDA 3NV0B 3GZRA 5I97A 5JBSA 4HZ9B 3B8LA 1OHOA 3VF1A 3CXC2 3CD63 2LQVA 1IQYA 5G2GA 3NV0A 1V58A 1SIHA 2FXTA 2KCDA 1RN1A 1ULJB 4L8PA 4NREA 1GOYA 2FGTA 1RHLA 3NM7A 1QAKA 1GMRA 5G1KA 2HMMB 8CHOA 3F8HA 1RKYA 1K9M4 2HMOB 1FZUA 3LT8A 3CC73 1TTOA 1W4NA 1RN4A 2OTL3 1ZS7A 2HMJB 3DMCA 3MG1A 2OQEC 4O8SA 2CFDA 1HZ1A 1LNIA 1X1WA 3NQZA 1NB5I 5AYSC 1DETA 1OGXA 2GBWB 2XGLA 1RGGA
chains in the Genus database with same CATH topology
1LRAA 1BSCA 1BU4A 4HOHA 1JBTA 1PYLA 3KCHA 2SARA 3HOHA 7GSPA 1BNRA 1RGLA 1BRJA 3GSPA 1BANA 1RCLA 1X1YA 3WHOA 4GSPA 1BRGA 1HYFA 2KF5A 5GSPA 2GSPA 1TRQA 1B2MA 1RGHA 2AADA 1BUJA 1RGGA 2RNTA 2F56A 2KF4A 1BRHA 1UCLA 1DE3A 2KF3A 4BU4A 4J5GA 1BNGA 2AAEA 2KF6A 4J5KA 1RGFA 1B27A 1BNEA 1B2XA 5HOHA 1I70A 6GSPA 3A5EA 2ZA4A 1IYYA 1PY3A 3AHWA 3DH2A 3D4AA 1GSPA 7RNTA 1RLSA 1B20A 1B21A 1LOVA 1BNFA 3URPA 3D5IA 2F4YA 1B3SA 1T2HA 1FW7A 3AHSA 4BIRA 1BSBA 1GOUA 2C4BA 1I0VA 1BGSA 3BIRA 1AY7A 1RMSA 1BVIA 1Q9EA 1ZGXA 2F5WA 1X1XA 3WR2A 1UCIA 1A2PA 3BU4A 1BIRA 1BRSA 5BU4A 1BNSA 1X1UA 1I2EA 1CH0A 1LOWA 3AGOA 1G02A 1BAOA 2BU4A 1SARA 1RGKA 1I0XA 3AGNA 1FUSA 4RNTA 1GOVA 1JBRA 1B2SA 1RTUA 2RBIA 1RGAA 8RNTA 1YVSA 2HOHA 4HAAA 1MGRA 1RDSA 1UCKA 6RNTA 1UCJA 1YGWA 1RCKA 1BNJA 1RGEA 1BSDA 1BRKA 1R4YA 1B2UA 1I3IA 2BIRA 1RSNA 1RNTA 3RNTA 1BNIA 5RNTA 1GMPA 1I2GA 1LOYA 1AQZA 1MGWA 1FUTA 1RN1A 1YNVX 1I2FA 1GOYA 1RHLA 1BRIA 1RNBA 1RGCA 1BSAA 1GMRA 1I3FA 5BIRA 1BRNL 1T2IA 1JBSA 1I8VA 1FZUA 1TTOA 1RN4A 1B2ZA 1FYSA 2KAAA 2F5MA 3Q3FA 1GMQA 4GHOA 1HZ1A 9RNTA 1LNIA 1X1WA 1BSEA 1DETA 3D5GA 3SYUA 1TRPA 1C54A 1BOXA 3DGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LRA A;  1BSC A;  1BU4 A;  4HOH A;  1JBT A;  1PYL A;  3KCH A;  2SAR A;  3HOH A;  7GSP A;  1BNR A;  1RGL A;  1BRJ A;  3GSP A;  1BAN A;  1RCL A;  1X1Y A;  3WHO A;  4GSP A;  1BRG A;  1HYF A;  2KF5 A;  5GSP A;  2GSP A;  1TRQ A;  1B2M A;  1RGH A;  2AAD A;  1BUJ A;  1RGG A;  2RNT A;  2F56 A;  2KF4 A;  1BRH A;  1UCL A;  1DE3 A;  2KF3 A;  4BU4 A;  4J5G A;  1BNG A;  2AAE A;  2KF6 A;  4J5K A;  1RGF A;  1B27 A;  1BNE A;  1B2X A;  5HOH A;  1I70 A;  6GSP A;  3A5E A;  2ZA4 A;  1IYY A;  1PY3 A;  3AHW A;  3DH2 A;  3D4A A;  1GSP A;  7RNT A;  1RLS A;  1B20 A;  1B21 A;  1LOV A;  1BNF A;  3URP A;  3D5I A;  2F4Y A;  1B3S A;  1T2H A;  1FW7 A;  3AHS A;  4BIR A;  1BSB A;  1GOU A;  2C4B A;  1I0V A;  1BGS A;  3BIR A;  1AY7 A;  1RMS A;  1BVI A;  1Q9E A;  1ZGX A;  2F5W A;  1X1X A;  3WR2 A;  1UCI A;  1A2P A;  3BU4 A;  1BIR A;  1BRS A;  5BU4 A;  1BNS A;  1X1U A;  1I2E A;  1CH0 A;  1LOW A;  3AGO A;  1G02 A;  1BAO A;  2BU4 A;  1SAR A;  1RGK A;  1I0X A;  3AGN A;  1FUS A;  4RNT A;  1GOV A;  1JBR A;  1B2S A;  1RTU A;  2RBI A;  1RGA A;  8RNT A;  1YVS A;  2HOH A;  4HAA A;  1MGR A;  1RDS A;  1UCK A;  6RNT A;  1UCJ A;  1YGW A;  1RCK A;  1BNJ A;  1RGE A;  1BSD A;  1BRK A;  1R4Y A;  1B2U A;  1I3I A;  2BIR A;  1RSN A;  1RNT A;  3RNT A;  1BNI A;  5RNT A;  1GMP A;  1I2G A;  1LOY A;  1AQZ A;  1MGW A;  1FUT A;  1RN1 A;  1YNV X;  1I2F A;  1GOY A;  1RHL A;  1BRI A;  1RNB A;  1RGC A;  1BSA A;  1GMR A;  1I3F A;  5BIR A;  1BRN L;  1T2I A;  1JBS A;  1I8V A;  1FZU A;  1TTO A;  1RN4 A;  1B2Z A;  1FYS A;  2KAA A;  2F5M A;  3Q3F A;  1GMQ A;  4GHO A;  1HZ1 A;  9RNT A;  1LNI A;  1X1W A;  1BSE A;  1DET A;  3D5G A;  3SYU A;  1TRP A;  1C54 A;  1BOX A;  3DGY A; 
#chains in the Genus database with same CATH topology
 1LRA A;  1V57 A;  3K5T A;  1JBT A;  3KCH A;  2F99 A;  2SAR A;  4ZM8 A;  2W9P A;  3S27 A;  3LXU X;  1QMA A;  3DGO A;  5BVB A;  2JDI H;  2BO9 B;  1HYF A;  1A90 A;  3K7C A;  1TFK A;  1WNH A;  2AAD A;  3B4P A;  2MF7 A;  1JB2 A;  4EBG A;  1BUJ A;  1T5Y A;  3X3Y A;  1SII A;  3G4S 3;  1BRH A;  2WO0 A;  5CXO A;  1DMM A;  2LYX A;  4XBT A;  3Q90 A;  4FMC A;  1C7H A;  5CK6 A;  3PXM A;  4EV5 A;  2KF6 A;  2P0M A;  2Z7A A;  1BUQ A;  2E2T A;  3HIG A;  3N8B A;  3WDG B;  5HOH A;  2XH9 A;  3CCJ 3;  2Z77 A;  3DM8 A;  4WYK B;  2CH9 A;  2GU1 A;  1N9J A;  1Z1S A;  4X2O A;  1NO3 A;  1US1 A;  1LNH A;  1B21 A;  3L0R A;  4WWU C;  3SX1 A;  4R9L A;  3KN4 A;  4OVM A;  3URP A;  5KP4 A;  1TJD A;  5BXQ A;  4WYK A;  4PEJ A;  1T2H A;  1OPY A;  4O2H A;  3EBT A;  2OOV C;  1BSB A;  3BNC A;  1IVX A;  1O7W B;  3FGY A;  2WGQ A;  1RRH A;  4J9A A;  1QVG 2;  1CYU A;  1JRQ A;  4HKV B;  3E99 A;  3DGN A;  4L7K A;  1IT7 A;  1A2P A;  1A2K A;  1EA2 A;  5JPP A;  4STD A;  5ELJ A;  2K3D A;  4FCM A;  5AIH A;  4JRF A;  1X1U A;  1I2E A;  5IEP A;  3NUV A;  1M90 4;  4U13 A;  4HBR A;  2KRT A;  2OWP A;  1LOW A;  2SBL A;  3AGO A;  1M1X B;  2GEX A;  3WOF B;  1VQP 3;  1FGR A;  2GBX B;  1OF5 B;  5HGR A;  3PCR A;  2H0I A;  1GOV A;  1JBR A;  1B2S A;  2RBI A;  1RGA A;  2CWU A;  8RNT A;  1VQO 3;  2L4V A;  2V1L A;  1OF5 A;  1YVS A;  3CCQ 3;  3T8N A;  1KC8 4;  4NHF A;  2GXF A;  5IG0 A;  3QRD A;  1Q42 A;  6RNT A;  3F8X A;  1WTH A;  1MWU A;  2Q07 A;  3O8Y A;  1GY7 A;  4HZB B;  1RCK A;  1BNJ A;  3CU3 A;  1IV9 A;  2W0Q A;  1NU3 A;  1D6Y A;  2CC3 A;  3F14 A;  3BLZ A;  5EQL A;  4HM1 B;  1B2U A;  3LTA A;  1IK3 A;  2RSX A;  3LTB A;  3T0U A;  1IVW A;  3BND A;  3H51 A;  5D82 A;  3NHX A;  1GMP A;  3CCR 3;  1I2G A;  3NX0 A;  3LH4 A;  1LOY A;  2PZV A;  4R4K A;  1M9G A;  3I0Y A;  1OUN A;  1MGW A;  5DRV A;  3KII A;  1FUT A;  3FG1 A;  4CCV A;  1UGH I;  1CEW I;  4IPB A;  5AEW B;  2WOF A;  6STD A;  3S29 A;  1YNV X;  1I2F A;  2STD A;  5FW5 A;  3EX9 A;  2I9W A;  1BSA A;  3D79 A;  3WA3 A;  5AIG A;  4LSO A;  4CDL A;  1I3F A;  1BRN L;  3MPH A;  2O3O A;  1MNL A;  2P38 A;  1GS3 A;  3G71 3;  1U5O A;  4EXR A;  2RCD A;  3EJV A;  1WMP A;  4FMA A;  1B2Z A;  2KAA A;  2GU3 A;  2ZHX B;  3MYT A;  3EQQ B;  1VQN 3;  3OV4 A;  1LQG C;  2CHC A;  3Q1C A;  4XDV A;  1BSE A;  2CW9 A;  2P05 A;  1W00 A;  4J8T A;  2BMR B;  4RBN A;  1TFO A;  4XM4 A;  4X2H A;  2W03 A;  7GSP A;  3HOH A;  1EQK A;  1RGL A;  1JN5 B;  3CCV 3;  5AII A;  1ZX2 A;  3HII A;  2YFL B;  1X1Y A;  3WHO A;  4BTX A;  1ASK A;  2RGQ A;  7STD A;  1BRG A;  2XR8 B;  4MMY B;  4KZ1 A;  2Y74 A;  1AVK A;  4RZM A;  3TDG A;  1TRQ A;  1MWT A;  1HKX A;  1RGH A;  2XEP A;  1JN5 A;  2UUG C;  2RNT A;  4N6U A;  1CQS A;  3Q2P A;  2F56 A;  2XSO B;  2ZL8 A;  1G96 A;  5LC7 A;  4HM0 B;  5FGO A;  1Q40 A;  4BU4 A;  1WMN A;  1DMQ A;  1NJI 4;  4XB5 A;  2AAE A;  4J5K A;  3F7S A;  3NBR A;  1RGF A;  4O3V A;  1E97 A;  1N8R 4;  1PY3 A;  3NM2 A;  2CG1 A;  1ROV A;  2CX0 A;  3GZY B;  2Z6B A;  1FGQ A;  3LZA A;  5KP3 A;  7RNT A;  2OTJ 3;  3M8C A;  1B20 A;  2CK3 H;  1IU7 A;  3LTC A;  3LML A;  1A67 A;  3FZW A;  3BB9 A;  3AHS A;  1ZO2 A;  3DXO A;  1O7G B;  1F8N A;  1IV7 A;  2W56 B;  4WHA A;  3S5C A;  3OWY A;  1JZO A;  1W02 A;  1TIJ A;  3PYJ A;  1PU4 A;  2CIU A;  2ML6 A;  1UUW B;  2WOH A;  1BVI A;  1O7P B;  3ER7 A;  3IJE B;  4K90 B;  2W56 A;  5STD A;  1X1X A;  3WR2 A;  4GB5 A;  2E2U A;  1OAC A;  5M1A A;  3ALA A;  2M7O A;  3BU4 A;  1BIR A;  3GZB A;  4HJL B;  1JKG A;  3U1W A;  4Q53 A;  1QVF 2;  1JV2 B;  2W9Q A;  4FMD A;  3RGA A;  2QA4 3;  3FCS B;  1W5Z A;  1GY5 A;  1BAO A;  2BU4 A;  3BNB A;  3EBY A;  3JVC A;  4HM8 B;  3AGN A;  1IDP A;  1SJW A;  1W6C A;  3HK4 A;  1EKM A;  3PCS A;  4NPB A;  1N5P A;  3EN1 B;  5CF2 A;  1M1K 4;  2F98 A;  1RTU A;  3UL6 A;  1O7H B;  1W01 A;  1A2V A;  5IF6 A;  3CCE 3;  1RN7 A;  1VQ5 3;  5IG3 A;  1FGO A;  1VZZ A;  5LC6 A;  4FMB A;  2HOH A;  2QGU A;  2ML5 A;  1MGR A;  1VQ7 3;  1RDS A;  4EYC A;  3CCM 3;  3LOY A;  2L1S A;  4JF8 A;  3B7C A;  3LTD A;  3QK9 A;  1EUI C;  3HZP A;  3X3Z A;  1YHQ 3;  2BIR A;  2CWT A;  1IQ8 A;  1RNT A;  1RSN A;  3V98 A;  1EEJ A;  1BNI A;  2KXG A;  3PGB A;  1N8Q A;  3DGM A;  4EW5 A;  1JB4 A;  1OGZ A;  1JB5 A;  1VQL 3;  4RNZ A;  3CPO A;  3B4O A;  1K41 A;  5D83 A;  1VQK 3;  4N3V A;  1AQZ A;  2IYJ A;  3WOD G;  3FF2 A;  5EVH A;  3CC2 3;  4XBX A;  2YFJ B;  3LT9 A;  3UL5 A;  1N5H A;  3EB8 A;  1QAF A;  1BRI A;  3JUQ A;  3ZG0 A;  1TU5 A;  3FG4 A;  4LMI A;  1RJO A;  4K1V A;  5AEU B;  3S28 A;  1W6G A;  3JUN A;  1NDO B;  1T2I A;  3ECF A;  1UUG B;  3D3L A;  3MSO A;  3VSY A;  2Z76 A;  1AV4 A;  1NWW A;  4EC6 A;  1YJ9 3;  1JBS A;  1PFP A;  1OCV A;  4MMZ B;  3BNE A;  2UGI A;  2F5M A;  5ELU A;  3WOE B;  5M18 A;  1UW1 A;  2ZDJ A;  3MWZ A;  3CPW 2;  1K73 4;  1AR0 A;  3GAX A;  1EG9 B;  9RNT A;  2IMJ A;  3V99 A;  1OHP A;  3D5G A;  3SYU A;  1GYB A;  3DGY A;  2MC8 A;  3CNX A;  5AYR B;  4HOH A;  4R9K A;  2OQE A;  3MG3 A;  1VQ6 3;  4BTW A;  5AI1 A;  3I56 3;  1BRJ A;  1SQW A;  1BAN A;  1RCL A;  2BMQ B;  3GSP A;  4K61 A;  5G1L A;  2W04 A;  4HM5 B;  1N9E A;  5GSP A;  1B2M A;  3SOA A;  4KFE A;  2XFS A;  3G6E 3;  1LXE A;  3G16 A;  1VQM 3;  2KF4 A;  2CFL A;  2D42 A;  4XDW A;  1DE3 A;  1VQ9 3;  3MHE A;  4J5G A;  5AIF A;  3RGR A;  4ILF A;  3UNL A;  2YX9 A;  3FF0 A;  4HM4 B;  2P0X A;  4HM7 B;  3X40 A;  1S72 3;  1UI7 A;  4LZI A;  1W6Y A;  3WMD A;  6GSP A;  3A5E A;  3T8U A;  1IYY A;  2C10 A;  1R4C A;  2HML B;  3EN8 A;  5CLK A;  3H3H A;  3I55 3;  2HMK B;  3D4A A;  1GSP A;  1GY6 A;  2CFG A;  4N6O B;  2B1X B;  5M19 A;  1RLS A;  1UGI A;  4R1K A;  5IG4 A;  2IA7 A;  5KP1 A;  2J8X B;  3K9M C;  1LVN A;  1B3S A;  2F4Y A;  3JUP A;  1VQ4 3;  3OXA A;  3ZFZ A;  3NXJ A;  3RDE A;  3A76 A;  1Q40 B;  4OK0 A;  4ORL A;  4N6N B;  1GOU A;  1CYV A;  2C4B A;  4GL6 A;  1I0V A;  2P09 A;  4HYZ A;  3DUK A;  1LOX A;  4N6L A;  5CF1 A;  1UDI I;  1Q9E A;  1D6Z A;  2HMN B;  3K0Z A;  1GD3 A;  2QIY A;  3LYG A;  1ZGX A;  2XGN A;  4MMX B;  3V92 A;  1OHS A;  3U97 A;  3DZL A;  1UCI A;  2OOV A;  5D81 A;  2A15 A;  2BT3 A;  1MWR A;  5IEN A;  1O7M B;  1BNS A;  2XRX B;  5BU4 A;  1YJN 3;  4FCZ A;  1CH0 A;  2JQ5 A;  2O9U X;  2PNC A;  3NBJ A;  1O7N B;  1KQS 2;  4LGQ A;  3DGL A;  3KZT A;  4KFD A;  3WA2 X;  3UB1 A;  1SAR A;  1DVD A;  1KWI A;  1I0X A;  1FUS A;  2K0M A;  2UX0 A;  3HX8 A;  5IEO A;  4AKZ A;  3GZX B;  3DY5 A;  4CJN A;  3FSD A;  1RRL A;  1ULI B;  1VQQ A;  1FGT A;  1STD A;  5JPU A;  3EE1 A;  1MWS A;  4O02 B;  1UCJ A;  5IER A;  3JUO A;  3OX9 A;  1Y4K A;  2XFT A;  3G8Z A;  1JKG B;  1GD4 A;  4H61 A;  1R4Y A;  1Q7Y 4;  1I3I A;  1Q86 4;  3KSP A;  3RNT A;  3CC4 3;  3K63 A;  1STF I;  3JUM A;  3PZW A;  3F40 A;  1IVU A;  3J7Y d;  1IT8 A;  1WQL B;  3F7X A;  5DRE A;  1DYU A;  1FA3 A;  1D6U A;  2BHM A;  3N9H A;  1W2Z A;  4BTY A;  5A0O B;  3VGN A;  3SXX A;  2YFI B;  5EEO A;  1YJW 3;  1RNB A;  1G0T A;  1S5A A;  3FH1 A;  3NQY A;  4CPK A;  2BMO B;  1BOX A;  4MEI A;  5BIR A;  2IUJ A;  3KE7 A;  3CNM A;  3CMA 3;  1I8V A;  3IMA B;  2H0H A;  2OCT A;  2W2C A;  3N54 B;  4BL3 A;  3CCS 3;  1FYS A;  4N6M A;  3Q3F A;  4KFF A;  3X3X A;  1GMQ A;  4GHO A;  4HM2 B;  1V74 A;  3OWS A;  3CME 3;  2E2V A;  2Y73 A;  3FG3 A;  2XF3 A;  4IIA A;  1TRP A;  2D1W A;  1ROA A;  3PS8 A;  4OUQ A;  1C54 A;  1RGC A;  2QEX 3;  3SVA A;  1HU9 A;  1BSC A;  1BU4 A;  1PYL A;  2CFW A;  1YVB I;  3AMO B;  2K54 A;  1BNR A;  3KFQ C;  1U8C B;  5IW9 A;  1VQ8 3;  4HVN A;  2F86 B;  2WGO A;  4MJD A;  2C11 A;  4GSP A;  1SPU A;  4FR9 A;  4WP5 A;  3UJM A;  5IG5 A;  2KF5 A;  2XSH B;  2GSP A;  1FGM A;  3AMO A;  1OH0 A;  4K1U A;  2CX1 A;  4LEH A;  1UCL A;  4QWT A;  2KF3 A;  2RFR A;  3GRD A;  4IT7 A;  1DVC A;  4DKI A;  1BNG A;  4BL2 A;  1E3V A;  2GEY A;  4FCJ A;  1B27 A;  1BNE A;  1Q7H A;  1B2X A;  2H0G A;  4XBY A;  1IQX A;  1I70 A;  1NNV A;  4H3U A;  4AKY A;  3S67 A;  2ZA4 A;  3AHW A;  3SOY A;  3DH2 A;  3ZG5 A;  1L5G B;  1IVV A;  2R41 A;  1LOV A;  4G1M B;  4N6V 0;  1TUH A;  1BNF A;  3ROB A;  3D5I A;  3FLJ A;  1DMN A;  4TX4 A;  4I5Q A;  1FW7 A;  4BIR A;  1Q81 4;  4HM6 B;  3F9S A;  2CG0 A;  3STD A;  1KSI A;  1K28 A;  4R80 A;  1BGS A;  3BIR A;  4L8O A;  3OW2 2;  2R4I A;  1ISK A;  1UUV B;  1AY7 A;  1RMS A;  1T3B A;  2CKF B;  1E3R A;  1TP6 A;  3KKG A;  1K8A 4;  4WFO A;  3EF8 A;  2IUK A;  1YIJ 3;  3G0K A;  3SED A;  2F5W A;  3IPT A;  5TGN A;  2IY2 A;  4KVH A;  3GWR A;  1BRS A;  2FNQ A;  1AVL A;  3FKA A;  4N6T A;  3EC9 A;  2W6J H;  4I4K A;  3X42 A;  1G02 A;  1W2B 2;  3MG2 A;  2CFK A;  1RGK A;  4LYL B;  1QAL A;  3D9R A;  1NB3 I;  1LQM B;  4AEQ A;  4EV2 A;  1YI2 3;  4HM3 B;  1QJG A;  1KD1 4;  3EHC A;  4RNT A;  3SLU A;  3CCL 3;  3X41 A;  1MOL A;  3HI7 A;  3MKI A;  1WMO A;  1FUW A;  2BNG A;  1W7C A;  3KSE D;  2CWV A;  1J2B A;  4HAA A;  1JNQ A;  1UCK A;  3NBB A;  1YGW A;  1YIT 3;  2B24 B;  4RNY A;  3OWU A;  1RGE A;  1Q82 4;  1BSD A;  1JJ2 2;  1BRK A;  4KT3 B;  1UI8 A;  3CCU 3;  2INX A;  1YGE A;  5RNT A;  1JZD A;  3NV0 B;  3GZR A;  5I97 A;  5JBS A;  4HZ9 B;  3B8L A;  1OHO A;  3VF1 A;  3CXC 2;  3CD6 3;  2LQV A;  1IQY A;  5G2G A;  3NV0 A;  1V58 A;  1SIH A;  2FXT A;  2KCD A;  1RN1 A;  1ULJ B;  4L8P A;  4NRE A;  1GOY A;  2FGT A;  1RHL A;  3NM7 A;  1QAK A;  1GMR A;  5G1K A;  2HMM B;  8CHO A;  3F8H A;  1RKY A;  1K9M 4;  2HMO B;  1FZU A;  3LT8 A;  3CC7 3;  1TTO A;  1W4N A;  1RN4 A;  2OTL 3;  1ZS7 A;  2HMJ B;  3DMC A;  3MG1 A;  2OQE C;  4O8S A;  2CFD A;  1HZ1 A;  1LNI A;  1X1W A;  3NQZ A;  1NB5 I;  5AYS C;  1DET A;  1OGX A;  2GBW B;  2XGL A;  1RGG A; 
#chains in the Genus database with same CATH homology
 1LRA A;  1BSC A;  1BU4 A;  4HOH A;  1JBT A;  1PYL A;  3KCH A;  2SAR A;  3HOH A;  7GSP A;  1BNR A;  1RGL A;  1BRJ A;  3GSP A;  1BAN A;  1RCL A;  1X1Y A;  3WHO A;  4GSP A;  1BRG A;  1HYF A;  2KF5 A;  5GSP A;  2GSP A;  1TRQ A;  1B2M A;  1RGH A;  2AAD A;  1BUJ A;  1RGG A;  2RNT A;  2F56 A;  2KF4 A;  1BRH A;  1UCL A;  1DE3 A;  2KF3 A;  4BU4 A;  4J5G A;  1BNG A;  2AAE A;  2KF6 A;  4J5K A;  1RGF A;  1B27 A;  1BNE A;  1B2X A;  5HOH A;  1I70 A;  6GSP A;  3A5E A;  2ZA4 A;  1IYY A;  1PY3 A;  3AHW A;  3DH2 A;  3D4A A;  1GSP A;  7RNT A;  1RLS A;  1B20 A;  1B21 A;  1LOV A;  1BNF A;  3URP A;  3D5I A;  2F4Y A;  1B3S A;  1T2H A;  1FW7 A;  3AHS A;  4BIR A;  1BSB A;  1GOU A;  2C4B A;  1I0V A;  1BGS A;  3BIR A;  1AY7 A;  1RMS A;  1BVI A;  1Q9E A;  1ZGX A;  2F5W A;  1X1X A;  3WR2 A;  1UCI A;  1A2P A;  3BU4 A;  1BIR A;  1BRS A;  5BU4 A;  1BNS A;  1X1U A;  1I2E A;  1CH0 A;  1LOW A;  3AGO A;  1G02 A;  1BAO A;  2BU4 A;  1SAR A;  1RGK A;  1I0X A;  3AGN A;  1FUS A;  4RNT A;  1GOV A;  1JBR A;  1B2S A;  1RTU A;  2RBI A;  1RGA A;  8RNT A;  1YVS A;  2HOH A;  4HAA A;  1MGR A;  1RDS A;  1UCK A;  6RNT A;  1UCJ A;  1YGW A;  1RCK A;  1BNJ A;  1RGE A;  1BSD A;  1BRK A;  1R4Y A;  1B2U A;  1I3I A;  2BIR A;  1RSN A;  1RNT A;  3RNT A;  1BNI A;  5RNT A;  1GMP A;  1I2G A;  1LOY A;  1AQZ A;  1MGW A;  1FUT A;  1RN1 A;  1YNV X;  1I2F A;  1GOY A;  1RHL A;  1BRI A;  1RNB A;  1RGC A;  1BSA A;  1GMR A;  1I3F A;  5BIR A;  1BRN L;  1T2I A;  1JBS A;  1I8V A;  1FZU A;  1TTO A;  1RN4 A;  1B2Z A;  1FYS A;  2KAA A;  2F5M A;  3Q3F A;  1GMQ A;  4GHO A;  1HZ1 A;  9RNT A;  1LNI A;  1X1W A;  1BSE A;  1DET A;  3D5G A;  3SYU A;  1TRP A;  1C54 A;  1BOX A;  3DGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...