1W6YA

Crystal structure of a mutant w92a in ketosteroid isomerase (ksi) from pseudomonas putida biotype b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
125
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGKVRACLTGPVRASHNGCGAMPFRVEMVANGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Small Exterior Hydrophobic Cluster Contributes to Conformational Stability and Steroid Binding in Ketosteroid Isomerase from Pseudomonas Putida Biotype B
pubmed doi rcsb
source organism Pseudomonas putida
total genus 35
structure length 125
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1w6yA00
5TGNA 2HMJB 5BVBA 3JUPA 5KP1A 2RGQA 1QMAA 1EA2A 5DRVA 3EJVA 4ORLA 3NHXA 2GEYA 2OWPA 4GB5A 3MG2A 4U13A 1VZZA 1NU3A 3K7CA 2QGUA 2B1XB 3F7SA 3EX9A 4X2HA 2IMJA 4I4KA 5IF6A 4J8TA 5AIFA 4N3VA 1C7HA 2BMQB 4WYKB 3EF8A 5CF2A 1ISKA 3CPOA 3FKAA 3EBYA 4FCMA 2GBXB 3F40A 3DUKA 4HM1B 4WWUC 1UUWB 3F14A 4HZ9B 3K0ZA 3OXAA 1DMMA 3FLJA 2YFJB 4HM4B 4HM0B 1W01A 3I0YA 1OHSA 4HVNA 3T8UA 3G16A 3RGAA 3F7XA 1DMQA 3JUNA 4L8PA 4XBTA 3GZBA 3KSPA 3SEDA 3EBTA 1BUQA 6STDA 4WYKA 1DMNA 3DZLA 5AEWB 1JKGB 5IENA 2GXFA 1STDA 3JUQA 2CKFB 1O7HB 4K1VA 4RZMA 3MG3A 4XB5A 4PEJA 1W00A 3GZXB 5D82A 3G8ZA 3FF0A 3G0KA 5AI1A 3EC9A 3B8LA 3H51A 1ZO2A 2Z77A 3LZAA 3GZRA 5KP4A 4H3UA 5IERA 1E3RA 3GZYB 1O7PB 1S5AA 3IPTA 5AIHA 1ULJB 1GY5A 3KE7A 1EG9B 5G2GA 3B7CA 3CU3A 3FGYA 1NDOB 1JB4A 1JKGA 1TUHA 2HMKB 2INXA 5IEPA 4XDVA 5FW5A 2YFLB 4HM7B 1OH0A 5CK6A 3FH1A 4K1UA 4OUQA 1ZX2A 1A2KA 1OGXA 5IG5A 3OWSA 1OHPA 5AEUB 4Q53A 3OV4A 1GS3A 1AR0A 1JB5A 4STDA 1WQLB 3EQQB 3KKGA 4R9LA 2W2CA 1O7MB 2JQ5A 3DMCA 3E99A 1SJWA 2BNGA 1OUNA 3ER7A 3M8CA 3S5CA 2STDA 1O7WB 5IG0A 2K54A 4HJLB 1Q42A 3CNMA 1U5OA 3CNXA 2CHCA 5IG3A 3OWUA 2A15A 3MSOA 5JPUA 1W02A 1UUVB 1O7GB 4LGQA 3JUMA 1OPYA 3OX9A 3NBRA 5AIIA 1GY7A 3F8HA 1Q40A 3VGNA 2UX0A 3T8NA 5CLKA 3MYTA 3BB9A 3F9SA 1GY6A 3VSYA 5D83A 2HMMB 1JB2A 2R4IA 2XR8B 3FZWA 2XSHB 3DM8A 3SOAA 4OVMA 4LEHA 3JUOA 2HMLB 3B4PA 4XBXA 2RFRA 4L8OA 1HKXA 5IEOA 3RGRA 2YFIB 3FF2A 4FCJA 5CF1A 4HKVB 5STDA 3HZPA 1OHOA 3UJMA 7STDA 3GWRA 3MKIA 1K41A 5D81A 3ECFA 4HM3B 3BLZA 3NM2A 2Z7AA 3ROBA 1OF5A 3STDA 4HM2B 3NV0A 3OWYA 1Q40B 1TP6A 2RCDA 5JPPA 3MHEA 4R9KA 2QIYA 2GEXA 2BMOB 4X2OA 2PZVA 3MG1A 4XDWA 4LMIA 3DXOA 3FSDA 3EHCA 1Z1SA 4HM6B 3WMDA 3EN1B 5AIGA 4R1KA 4L7KA 3LYGA 4WP5A 2BMRB 5KP3A 2F86B 2F98A 1GYBA 1ASKA 3H3HA 3EN8A 2Z76A 3B4OA 1JN5B 1IDPA 2XRXB 3D9RA 3HX8A 5DREA 3Q90A 4MJDA 3A76A 3UNLA 3F8XA 5BXQA 4HM5B 3NXJA 5EVHA 2HMOB 4KVHA 4IIAA 4HM8B 4J9AA 5CXOA 2GBWB 3SOYA 3HK4A 1ULIB 1CQSA 2F99A 2B24B 1OF5B 3KZTA 4XBYA 1QJGA 3NV0B 5IG4A 3NUVA 1OCVA 1E97A 4HZBB 2XSOB 1W6YA 4CDLA 1E3VA 2HMNB 1NWWA 1O7NB 8CHOA 1OGZA 2I9WA 5HGRA 3GRDA 1JN5A 4XM4A
chains in the Genus database with same CATH superfamily
1GSPA 5TGNA 3DGNA 1N9EA 2HMJB 3ZFZA 1US1A 2R41A 4LZIA 3JUPA 5BVBA 5KP1A 1RHLA 1I2EA 2RGQA 1QMAA 3D79A 6GSPA 1EA2A 5DRVA 2M7OA 3EJVA 1ZGXA 5G1LA 3WODG 4ORLA 4EV5A 3NHXA 2GEYA 1UCJA 4QWTA 2OWPA 2XFTA 1FGQA 1I0XA 4GB5A 3MG2A 4U13A 1VZZA 5RNTA 4KZ1A 3CXC2 1NU3A 3VF1A 5LC7A 1RDSA 3K7CA 3PS8A 1TJDA 2QGUA 1VQK3 2GSPA 2F56A 2B1XB 3F7SA 1RCLA 3EX9A 1BNRA 1LNHA 4X2HA 1SQWA 1R4CA 1T3BA 2IMJA 3UL5A 1LOVA 4I4KA 5IF6A 3CCM3 4J8TA 2LYXA 5AIFA 1I70A 4N3VA 2LQVA 1C7HA 2BMQB 3CCJ3 4WYKB 4HBRA 8RNTA 3EF8A 2W04A 2XGNA 1A2PA 2E2UA 2CFDA 2XFSA 3NM7A 3LOYA 4MEIA 5CF2A 3G4S3 3LTCA 1ISKA 1RN4A 3CPOA 1BGSA 1W7CA 3FKAA 2P05A 1LNIA 3EBYA 4FCMA 1Q7Y4 4N6LA 2H0GA 2GBXB 3F40A 3DUKA 2Y74A 3LTDA 4HM1B 3BIRA 4WWUC 3SX1A 1B2UA 2D42A 3G6E3 1JBRA 1VQM3 1UUWB 2E2VA 2GU3A 4MMZB 1VQ63 3F14A 2AAEA 3PXMA 1CH0A 3BNDA 1VQO3 4HZ9B 2IYJA 3K0ZA 3LXUX 5BU4A 2Q07A 3OXAA 1L5GB 3K5TA 1DMMA 1JZOA 3FLJA 2YFJB 3AHWA 3SLUA 4AKYA 2UUGC 4HM4B 4HM0B 1EKMA 1MWTA 1W01A 1BVIA 3I0YA 1LOYA 1OHSA 4HVNA 3WDGB 3DH2A 3IMAB 3T8UA 3G16A 1VQP3 2RBIA 3EB8A 3SVAA 4EW5A 3RGAA 1YJN3 1DVDA 1M904 3KSED 1UCKA 3PCRA 3D3LA 1DYUA 3F7XA 3WA3A 2WGQA 1VQ93 1I8VA 1BSCA 2F5WA 3SXXA 1ROAA 3UB1A 3CCQ3 1RGFA 1DMQA 3I553 3JUNA 1FW7A 1B2ZA 3FG1A 4L8PA 1W6CA 4XBTA 3LT8A 1NJI4 2CIUA 1B21A 2Z6BA 1JRQA 2HOHA 3GZBA 1BOXA 1SARA 1TFKA 3KSPA 3RNTA 3SEDA 3EBTA 1BUQA 6STDA 2F5MA 4WYKA 1DMNA 1MWSA 3DZLA 2XEPA 2KF5A 1JBTA 1IU7A 3AHSA 3GSPA 1Q7HA 2O9UX 1WMOA 5AEWB 1JKGB 1BNGA 2W03A 5IENA 2GXFA 4EXRA 3T0UA 1STDA 3JUQA 2CKFB 3V92A 2O3OA 4I5QA 1O7HB 2KAAA 1UI7A 4K1VA 1AVLA 4RZMA 3X3XA 1FGRA 1RGLA 3MG3A 3S28A 4XB5A 1GD4A 4PEJA 2BT3A 3UL6A 1W00A 3BNCA 1I0VA 3GZXB 1MWRA 5D82A 1Y4KA 1FUSA 1RNTA 3G8ZA 2QA43 1QVG2 1BRIA 1LVNA 3FF0A 1M1K4 1V57A 3G0KA 1VQ43 1JZDA 5AI1A 3X41A 3EC9A 2C10A 3B8LA 3Q2PA 4WFOA 2ML5A 3H51A 4EV2A 3J7Yd 4DKIA 3CCS3 1N5PA 4FMBA 3TDGA 1IQYA 1ZO2A 3U1WA 2Z77A 3FCSB 3LZAA 4KT3B 3NX0A 2W6JH 3PCSA 3GZRA 3WR2A 5KP4A 3LMLA 4H3UA 2RNTA 4HYZA 5IERA 2W9QA 3LTAA 3FG4A 2OCTA 4KFDA 1E3RA 1A90A 3GZYB 4RNTA 1YVSA 4IPBA 4FR9A 1O7PB 1BNEA 1OACA 1QVF2 1S5AA 1FGTA 1IVXA 3IPTA 5AIHA 2JDIH 7RNTA 1ULJB 2CH9A 2KRTA 3CCV3 3GAXA 1GY5A 3KE7A 4BU4A 1EG9B 2IA7A 1IK3A 5G2GA 4EBGA 3B7CA 2P09A 5GSPA 2K0MA 1D6ZA 2C4BA 2AADA 3CU3A 3FGYA 1NDOB 1JB4A 2KCDA 3CCL3 1JKGA 1QAKA 2D1WA 1FGOA 1CYUA 1BANA 1BNJA 3WHOA 1RN7A 1EQKA 1TUHA 2HMKB 1UW1A 1A2VA 2INXA 2W9PA 3IJEB 4NHFA 5IEPA 4XDVA 1G02A 1DE3A 1I2GA 2GU1A 5FW5A 1LRAA 2YFLB 4NREA 2J8XB 2P0MA 4HM7B 1W4NA 2WOHA 1GD3A 1BRJA 3SYUA 1QAFA 1U8CB 3Q3FA 1OH0A 5CK6A 3L0RA 1LXEA 3FH1A 1A67A 3DY5A 4K1UA 2CWTA 4OUQA 1ZX2A 1K8A4 1BRHA 1ZS7A 4O2HA 1A2KA 1HU9A 1OGXA 3D5GA 3AMOA 5IG5A 1YIJ3 3OWSA 1OHPA 3CCU3 2YX9A 3ZG0A 5AEUB 1RRLA 1RNBA 3OW22 4Q53A 3KFQC 4OK0A 3K63A 2WGOA 4N6MA 3OV4A 2BIRA 1GS3A 3KIIA 5LC6A 9RNTA 1WMNA 1T2IA 2MF7A 3DGLA 1AR0A 3X42A 1R4YA 1F8NA 1JB5A 4STDA 1QALA 1RJOA 1WQLB 3EQQB 1BRSA 3BU4A 3KKGA 4R9LA 2W2CA 1S723 1PU4A 1GMQA 1IVUA 1O7MB 5M1AA 2JQ5A 1DETA 3DMCA 1X1YA 3CD63 3E99A 1FZUA 1SJWA 2CG1A 2BNGA 3O8YA 4MMYB 4CPKA 1YGWA 1N8QA 1OUNA 3ER7A 3M8CA 3S5CA 3D4AA 2K3DA 2STDA 1FGMA 4AKZA 1CEWI 1O7WB 1Q824 3CCR3 1RGKA 2K54A 5IG0A 4GL6A 1Q42A 4HJLB 1AQZA 1NB3I 1K28A 3CNMA 4MMXB 5ELJA 2FXTA 3I563 1SIIA 3AGNA 1U5OA 3ALAA 3CNXA 2CHCA 5IG3A 1B3SA 2V1LA 4LYLB 3OWUA 2A15A 3LH4A 3MSOA 1GOVA 1RGHA 3HI7A 2CFWA 1W02A 5JPUA 4WHAA 1UUVB 1O7GB 4LGQA 3JUMA 1LQGC 3D5IA 1OPYA 1DVCA 3OX9A 3NBRA 3FG3A 5AIIA 1RRHA 1GY7A 3F8HA 2SARA 1Q40A 3VGNA 2UX0A 1NNVA 5EQLA 1BSEA 3S27A 3T8NA 4FCZA 2ZA4A 5CLKA 3MYTA 3K9MC 5ELUA 1KQS2 2KF6A 3NBBA 1TIJA 1TRQA 3BB9A 3DGMA 3F9SA 4O8SA 5IW9A 4N6OB 1GY6A 1IYYA 1UUGB 3VSYA 2IY2A 1M1XB 7GSPA 1TRPA 1FUTA 4RNZA 5D83A 1IVWA 1BSAA 5A0OB 4TX4A 3Q1CA 1MGWA 2CX0A 2HMMB 1JB2A 2R4IA 1VQ53 3CPW2 2UGIA 2CFLA 2XR8B 3AMOB 4BTYA 1D6YA 3LT9A 4FMDA 1N5HA 3FZWA 2XSHB 3U97A 2IUKA 2SBLA 3DM8A 1G96A 1N9JA 4H61A 4N6TA 1EUIC 3SOAA 2OTL3 1YNVX 1FA3A 4OVMA 1KWIA 2W56A 4LEHA 1T2HA 1YJ93 1KC84 3WOFB 1VQL3 3N8BA 3PGBA 3N9HA 5EEOA 1X1WA 2WOFA 5BIRA 1C54A 4JF8A 3JUOA 4RNYA 2HMLB 2XH9A 3B4PA 1RN1A 4KFEA 4XBXA 2RFRA 1GMRA 4L8OA 2MC8A 2KF4A 4JRFA 1HKXA 3CC43 5IEOA 2CWUA 3RGRA 1IV7A 2IUJA 3NQYA 4FMCA 1LQMB 4GHOA 2OQEA 1STFI 1PYLA 1WMPA 2CC3A 1W5ZA 2YFIB 1WTHA 3QK9A 1LOXA 2ZL8A 5I97A 1B20A 1BU4A 3NQZA 3BNEA 2CX1A 1YGEA 3FF2A 4FCJA 1UCLA 1IT7A 4BTXA 1MGRA 3MWZA 5AYSC 2P38A 2WO0A 1B27A 5CF1A 4HKVB 2BHMA 5STDA 1YJW3 2H0HA 3HZPA 3N54B 4IT7A 1OHOA 3UJMA 3CME3 1RMSA 2KF3A 7STDA 3GWRA 3MKIA 3PZWA 6RNTA 2PNCA 1K41A 5D81A 2OOVC 3ECFA 4HM3B 5AYRB 3BLZA 1X1UA 2E2TA 1RGAA 2OQEC 1GOYA 5M19A 2FNQA 2L1SA 4N6NB 1ROVA 3NM2A 1FYSA 3JVCA 2Z7AA 1IV9A 2H0IA 1UCIA 1OF5A 1D6UA 1BNFA 2CG0A 3KCHA 3ROBA 3STDA 4BL3A 1BNIA 4CCVA 1V74A 1TFOA 1GMPA 1AV4A 3QRDA 3NV0A 4HM2B 3URPA 3OWYA 1GOUA 1Q40B 4O3VA 1BAOA 1BSBA 4KFFA 1VQN3 1RGEA 1TP6A 2RCDA 5JBSA 5JPPA 3KN4A 2P0XA 3MHEA 1TTOA 4R9KA 2QIYA 3S67A 2CFGA 1BNSA 2GEXA 1Q9EA 2L4VA 1VQQA 2BMOB 1YI23 4X2OA 1NO3A 1IVVA 4ILFA 2PZVA 2ML6A 3MG1A 4GSPA 4XDWA 3CCE3 3AGOA 1RGGA 3HIGA 4LMIA 1AY7A 3G713 3DXOA 2RSXA 1TU5A 3FSDA 1RCKA 1UGIA 2CK3H 3EHCA 3WOEB 4BIRA 1Z1SA 3EE1A 4NPBA 4N6UA 1LOWA 2ZHXB 4HM6B 3WMDA 2W56B 4BTWA 3EN1B 5AIGA 3V98A 4EC6A 3PYJA 4HOHA 4R1KA 4L7KA 3LYGA 1SPUA 1IQ8A 1W2ZA 4R4KA 1BRKA 4WP5A 2BMRB 5KP3A 2F86B 3RDEA 1RKYA 1Q864 2F98A 1N8R4 1GYBA 4ZM8A 1ASKA 3H3HA 1JNQA 1MWUA 3EN8A 3X40A 4FMAA 5M18A 1JBSA 1J2BA 2OTJ3 2Z76A 3B4OA 1JN5B 1UDII 1IDPA 2XRXB 1BUJA 3D9RA 1K734 1YVBI 3HX8A 3WA2X 1V58A 3NBJA 3MPHA 1KD14 1RLSA 1VQ83 5DREA 2FGTA 3Q90A 1M9GA 1AVKA 1JJ22 4K61A 1IT8A 1RTUA 3DGOA 1BRGA 4MJDA 3A76A 3UNLA 1X1XA 3F8XA 1WNHA 2CWVA 4HM5B 5BXQA 1FUWA 3NXJA 4G1MB 1IQXA 1B2SA 1MOLA 3LTBA 1W6GA 4RBNA 4CJNA 1BRNL 2KXGA 2HMOB 2CW9A 4KVHA 5EVHA 5G1KA 4AEQA 2F4YA 1Q814 1B2MA 1UGHI 1UI8A 4IIAA 4HAAA 4K90B 2C11A 1KSIA 4HM8B 4J9AA 5CXOA 2XGLA 4J5KA 2GBWB 1YIT3 3SOYA 3HK4A 1ULIB 1VQ73 1CQSA 2CFKA 3HIIA 5FGOA 2BO9B 2B24B 2F99A 1OF5B 3KZTA 3S29A 4EYCA 3CC73 1W2B2 4XBYA 3ZG5A 1NB5I 1QJGA 1BIRA 3CMA3 1HYFA 3NV0B 5IG4A 1I3FA 3CC23 2ZDJA 4LSOA 3NUVA 1SIHA 1OCVA 3X3YA 2QEX3 1EEJA 1E97A 4HZBB 1HZ1A 2XSOB 1G0TA 1W6YA 3BNBA 4J5GA 5HOHA 1YHQ3 1I3IA 4R80A 1RSNA 3X3ZA 3HOHA 1I2FA 4CDLA 1PY3A 4N6V0 1E3VA 1CYVA 2HMNB 1NWWA 1O7NB 1K9M4 2W0QA 3V99A 2XF3A 8CHOA 1T5YA 3A5EA 2OOVA 1MNLA 4BL2A 4O02B 1OGZA 2BU4A 1PFPA 2I9WA 2Y73A 5HGRA 1B2XA 3DGYA 1JV2B 3GRDA 1BSDA 1JN5A 1RGCA 4XM4A
chains in the Genus database with same CATH topology
5TGNA 3DGNA 1N9EA 2HMJB 1US1A 4LZIA 5BVBA 3JUPA 5KP1A 2RGQA 1QMAA 1EA2A 5DRVA 2M7OA 3EJVA 3WODG 4EV5A 4ORLA 3NHXA 2GEYA 4QWTA 2OWPA 2XFTA 1FGQA 4GB5A 3MG2A 4U13A 1VZZA 4KZ1A 3CXC2 1NU3A 3VF1A 5LC7A 3K7CA 3PS8A 1VQK3 2QGUA 2B1XB 3F7SA 3EX9A 1LNHA 4X2HA 1SQWA 1R4CA 2IMJA 3UL5A 4I4KA 5IF6A 3CCM3 4J8TA 2LYXA 5AIFA 4N3VA 2LQVA 1C7HA 2BMQB 3CCJ3 4WYKB 4HBRA 3EF8A 2W04A 2XGNA 2E2UA 2CFDA 2XFSA 3NM7A 3LOYA 4MEIA 5CF2A 3G4S3 3LTCA 1ISKA 3CPOA 1W7CA 3FKAA 2P05A 3EBYA 4FCMA 1Q7Y4 4N6LA 2GBXB 3F40A 3DUKA 2Y74A 3LTDA 4HM1B 4WWUC 3SX1A 2D42A 3G6E3 1VQM3 1UUWB 2E2VA 2GU3A 4MMZB 1VQ63 3F14A 3PXMA 3BNDA 1VQO3 4HZ9B 3K0ZA 3LXUX 2Q07A 3OXAA 1L5GB 3K5TA 1DMMA 3FLJA 2YFJB 3SLUA 4AKYA 4HM4B 4HM0B 1EKMA 1W01A 3I0YA 1OHSA 4HVNA 3WDGB 3IMAB 3T8UA 3G16A 1VQP3 3EB8A 3SVAA 1YJN3 3RGAA 1DVDA 1M904 3KSED 3PCRA 3D3LA 1DYUA 3F7XA 3WA3A 2WGQA 1VQ93 3SXXA 3UB1A 1ROAA 3CCQ3 1DMQA 3I553 3JUNA 3FG1A 4L8PA 1W6CA 4XBTA 3LT8A 1NJI4 2CIUA 2Z6BA 1JRQA 3GZBA 1TFKA 3KSPA 3SEDA 3EBTA 1BUQA 6STDA 4WYKA 1DMNA 3DZLA 2XEPA 1IU7A 2O9UX 1WMOA 5AEWB 1JKGB 2W03A 5IENA 2GXFA 4EXRA 3T0UA 1STDA 3JUQA 2CKFB 3V92A 2O3OA 1O7HB 1UI7A 4K1VA 1AVLA 4RZMA 3X3XA 1FGRA 3MG3A 3S28A 4XB5A 1GD4A 4PEJA 2BT3A 3UL6A 1W00A 3BNCA 3GZXB 5D82A 1Y4KA 3G8ZA 2QA43 1QVG2 1LVNA 3FF0A 1M1K4 3G0KA 1VQ43 5AI1A 3X41A 3EC9A 2C10A 3B8LA 3Q2PA 4WFOA 2ML5A 3H51A 4EV2A 3J7Yd 3CCS3 1N5PA 4FMBA 3TDGA 1IQYA 1ZO2A 3U1WA 2Z77A 3FCSB 3LZAA 3NX0A 2W6JH 3PCSA 3GZRA 5KP4A 3LMLA 4H3UA 4HYZA 5IERA 2W9QA 3LTAA 3FG4A 2OCTA 4KFDA 1E3RA 1A90A 3GZYB 4IPBA 4FR9A 1O7PB 1OACA 1QVF2 1S5AA 1FGTA 1IVXA 3IPTA 5AIHA 2JDIH 1ULJB 2CH9A 2KRTA 3CCV3 3GAXA 1GY5A 3KE7A 1EG9B 2IA7A 1IK3A 5G2GA 4EBGA 3B7CA 2P09A 2K0MA 1D6ZA 3CU3A 3FGYA 1NDOB 1JB4A 2KCDA 3CCL3 1JKGA 1QAKA 2D1WA 1FGOA 1CYUA 1EQKA 1RN7A 1TUHA 2HMKB 1UW1A 1A2VA 2INXA 2W9PA 3IJEB 4NHFA 5IEPA 4XDVA 2GU1A 5FW5A 4NREA 2YFLB 2P0MA 4HM7B 1W4NA 2WOHA 1GD3A 1QAFA 1U8CB 1OH0A 5CK6A 3L0RA 1LXEA 3FH1A 1A67A 3DY5A 4K1UA 2CWTA 4OUQA 1ZX2A 1K8A4 4O2HA 1A2KA 1HU9A 1OGXA 3AMOA 5IG5A 1YIJ3 3OWSA 1OHPA 3CCU3 2YX9A 5AEUB 1RRLA 3OW22 4Q53A 3KFQC 4OK0A 3K63A 2WGOA 4N6MA 3OV4A 1GS3A 3KIIA 5LC6A 1WMNA 2MF7A 3DGLA 1AR0A 3X42A 1F8NA 1JB5A 4STDA 1QALA 1RJOA 1WQLB 3EQQB 3KKGA 4R9LA 2W2CA 1S723 1PU4A 1O7MB 1IVUA 2JQ5A 3DMCA 3CD63 3E99A 1SJWA 2CG1A 2BNGA 3O8YA 4MMYB 1N8QA 1OUNA 3ER7A 3M8CA 3S5CA 2STDA 1FGMA 4AKZA 1CEWI 1O7WB 1Q824 3CCR3 5IG0A 2K54A 4GL6A 1Q42A 4HJLB 1NB3I 1K28A 3CNMA 4MMXB 5ELJA 2FXTA 3I563 1SIIA 3ALAA 1U5OA 3CNXA 2CHCA 5IG3A 2V1LA 3OWUA 2A15A 3LH4A 3MSOA 3HI7A 2CFWA 1W02A 5JPUA 4WHAA 1UUVB 1O7GB 4LGQA 3JUMA 1OPYA 1DVCA 3OX9A 3NBRA 3FG3A 5AIIA 1RRHA 1GY7A 3F8HA 1Q40A 3VGNA 2UX0A 5EQLA 3S27A 3T8NA 4FCZA 5CLKA 3MYTA 3K9MC 5ELUA 1KQS2 3NBBA 1TIJA 3BB9A 4O8SA 3DGMA 3F9SA 5IW9A 4N6OB 1GY6A 3VSYA 1M1XB 4RNZA 5D83A 1IVWA 5A0OB 4TX4A 3Q1CA 2HMMB 1JB2A 2R4IA 1VQ53 3CPW2 4BTYA 2CFLA 2XR8B 3AMOB 1D6YA 3LT9A 4FMDA 1N5HA 3FZWA 2XSHB 3U97A 2IUKA 2SBLA 3DM8A 1G96A 1N9JA 4H61A 4N6TA 2OTL3 3SOAA 1FA3A 4OVMA 1KWIA 2W56A 4LEHA 1KC84 1YJ93 1VQL3 3WOFB 3N8BA 3PGBA 3N9HA 5EEOA 2WOFA 4JF8A 3JUOA 4RNYA 2HMLB 2XH9A 3B4PA 4KFEA 4XBXA 2RFRA 2MC8A 4L8OA 4JRFA 1HKXA 3CC43 5IEOA 2CWUA 3RGRA 1IV7A 2IUJA 3NQYA 4FMCA 2OQEA 1STFI 1WMPA 2CC3A 1W5ZA 2YFIB 1WTHA 3QK9A 1LOXA 2ZL8A 5I97A 3NQZA 3BNEA 3FF2A 1YGEA 4FCJA 4BTXA 1IT7A 3MWZA 5AYSC 2P38A 2WO0A 5CF1A 4HKVB 2BHMA 5STDA 1YJW3 3N54B 3HZPA 4IT7A 1OHOA 3UJMA 3CME3 7STDA 3GWRA 3MKIA 3PZWA 2PNCA 1K41A 5D81A 2OOVC 3ECFA 4HM3B 5AYRB 3BLZA 2E2TA 2OQEC 2FNQA 4N6NB 1ROVA 3NM2A 3JVCA 2Z7AA 1IV9A 3ROBA 1OF5A 1D6UA 2CG0A 3STDA 4CCVA 1V74A 1TFOA 3QRDA 1AV4A 4HM2B 3NV0A 3OWYA 1Q40B 4O3VA 4KFFA 1VQN3 1TP6A 2RCDA 5JBSA 5JPPA 3KN4A 2P0XA 3MHEA 4R9KA 2QIYA 3S67A 2CFGA 2GEXA 2L4VA 2BMOB 1YI23 4X2OA 1NO3A 1IVVA 2PZVA 2ML6A 3MG1A 4XDWA 3CCE3 3HIGA 4LMIA 3G713 3DXOA 2RSXA 1TU5A 3FSDA 3EHCA 3WOEB 2CK3H 1Z1SA 3EE1A 4N6UA 4HM6B 3WMDA 2W56B 4BTWA 3EN1B 5AIGA 3V98A 4EC6A 3PYJA 4R1KA 4L7KA 3LYGA 1SPUA 1IQ8A 1W2ZA 4R4KA 4WP5A 2BMRB 5KP3A 2F86B 3RDEA 1RKYA 1Q864 2F98A 1N8R4 1GYBA 4ZM8A 1ASKA 3H3HA 1JNQA 3EN8A 3X40A 1J2BA 4FMAA 2OTJ3 2Z76A 3B4OA 1JN5B 1IDPA 2XRXB 3D9RA 1K734 1YVBI 3HX8A 3WA2X 1KD14 3NBJA 3MPHA 1VQ83 5DREA 2FGTA 3Q90A 1M9GA 1AVKA 1JJ22 4K61A 1IT8A 3DGOA 4MJDA 3A76A 3UNLA 3F8XA 1FUWA 1WNHA 2CWVA 4HM5B 5BXQA 3NXJA 4G1MB 1IQXA 1MOLA 3LTBA 4RBNA 1W6GA 2KXGA 2HMOB 2CW9A 4KVHA 5EVHA 1Q814 4AEQA 1UI8A 4IIAA 4K90B 2C11A 1KSIA 4HM8B 4J9AA 5CXOA 2XGLA 2GBWB 1YIT3 3SOYA 3HK4A 1ULIB 1VQ73 1CQSA 2CFKA 3HIIA 5FGOA 2BO9B 2B24B 2F99A 1OF5B 3KZTA 3S29A 4EYCA 3CC73 1W2B2 4XBYA 1NB5I 3CMA3 1QJGA 3NV0B 5IG4A 3CC23 2ZDJA 4LSOA 3NUVA 1SIHA 1OCVA 3X3YA 2QEX3 1E97A 4HZBB 2XSOB 1W6YA 3BNBA 1YHQ3 4R80A 3X3ZA 4CDLA 4N6V0 1E3VA 1CYVA 2HMNB 1NWWA 1O7NB 1K9M4 2W0QA 3V99A 2XF3A 8CHOA 1T5YA 2OOVA 1MNLA 4O02B 1OGZA 1PFPA 2I9WA 2Y73A 5HGRA 3GRDA 1JV2B 1JN5A 4XM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TGN A;  2HMJ B;  5BVB A;  3JUP A;  5KP1 A;  2RGQ A;  1QMA A;  1EA2 A;  5DRV A;  3EJV A;  4ORL A;  3NHX A;  2GEY A;  2OWP A;  4GB5 A;  3MG2 A;  4U13 A;  1VZZ A;  1NU3 A;  3K7C A;  2QGU A;  2B1X B;  3F7S A;  3EX9 A;  4X2H A;  2IMJ A;  4I4K A;  5IF6 A;  4J8T A;  5AIF A;  4N3V A;  1C7H A;  2BMQ B;  4WYK B;  3EF8 A;  5CF2 A;  1ISK A;  3CPO A;  3FKA A;  3EBY A;  4FCM A;  2GBX B;  3F40 A;  3DUK A;  4HM1 B;  4WWU C;  1UUW B;  3F14 A;  4HZ9 B;  3K0Z A;  3OXA A;  1DMM A;  3FLJ A;  2YFJ B;  4HM4 B;  4HM0 B;  1W01 A;  3I0Y A;  1OHS A;  4HVN A;  3T8U A;  3G16 A;  3RGA A;  3F7X A;  1DMQ A;  3JUN A;  4L8P A;  4XBT A;  3GZB A;  3KSP A;  3SED A;  3EBT A;  1BUQ A;  6STD A;  4WYK A;  1DMN A;  3DZL A;  5AEW B;  1JKG B;  5IEN A;  2GXF A;  1STD A;  3JUQ A;  2CKF B;  1O7H B;  4K1V A;  4RZM A;  3MG3 A;  4XB5 A;  4PEJ A;  1W00 A;  3GZX B;  5D82 A;  3G8Z A;  3FF0 A;  3G0K A;  5AI1 A;  3EC9 A;  3B8L A;  3H51 A;  1ZO2 A;  2Z77 A;  3LZA A;  3GZR A;  5KP4 A;  4H3U A;  5IER A;  1E3R A;  3GZY B;  1O7P B;  1S5A A;  3IPT A;  5AIH A;  1ULJ B;  1GY5 A;  3KE7 A;  1EG9 B;  5G2G A;  3B7C A;  3CU3 A;  3FGY A;  1NDO B;  1JB4 A;  1JKG A;  1TUH A;  2HMK B;  2INX A;  5IEP A;  4XDV A;  5FW5 A;  2YFL B;  4HM7 B;  1OH0 A;  5CK6 A;  3FH1 A;  4K1U A;  4OUQ A;  1ZX2 A;  1A2K A;  1OGX A;  5IG5 A;  3OWS A;  1OHP A;  5AEU B;  4Q53 A;  3OV4 A;  1GS3 A;  1AR0 A;  1JB5 A;  4STD A;  1WQL B;  3EQQ B;  3KKG A;  4R9L A;  2W2C A;  1O7M B;  2JQ5 A;  3DMC A;  3E99 A;  1SJW A;  2BNG A;  1OUN A;  3ER7 A;  3M8C A;  3S5C A;  2STD A;  1O7W B;  5IG0 A;  2K54 A;  4HJL B;  1Q42 A;  3CNM A;  1U5O A;  3CNX A;  2CHC A;  5IG3 A;  3OWU A;  2A15 A;  3MSO A;  5JPU A;  1W02 A;  1UUV B;  1O7G B;  4LGQ A;  3JUM A;  1OPY A;  3OX9 A;  3NBR A;  5AII A;  1GY7 A;  3F8H A;  1Q40 A;  3VGN A;  2UX0 A;  3T8N A;  5CLK A;  3MYT A;  3BB9 A;  3F9S A;  1GY6 A;  3VSY A;  5D83 A;  2HMM B;  1JB2 A;  2R4I A;  2XR8 B;  3FZW A;  2XSH B;  3DM8 A;  3SOA A;  4OVM A;  4LEH A;  3JUO A;  2HML B;  3B4P A;  4XBX A;  2RFR A;  4L8O A;  1HKX A;  5IEO A;  3RGR A;  2YFI B;  3FF2 A;  4FCJ A;  5CF1 A;  4HKV B;  5STD A;  3HZP A;  1OHO A;  3UJM A;  7STD A;  3GWR A;  3MKI A;  1K41 A;  5D81 A;  3ECF A;  4HM3 B;  3BLZ A;  3NM2 A;  2Z7A A;  3ROB A;  1OF5 A;  3STD A;  4HM2 B;  3NV0 A;  3OWY A;  1Q40 B;  1TP6 A;  2RCD A;  5JPP A;  3MHE A;  4R9K A;  2QIY A;  2GEX A;  2BMO B;  4X2O A;  2PZV A;  3MG1 A;  4XDW A;  4LMI A;  3DXO A;  3FSD A;  3EHC A;  1Z1S A;  4HM6 B;  3WMD A;  3EN1 B;  5AIG A;  4R1K A;  4L7K A;  3LYG A;  4WP5 A;  2BMR B;  5KP3 A;  2F86 B;  2F98 A;  1GYB A;  1ASK A;  3H3H A;  3EN8 A;  2Z76 A;  3B4O A;  1JN5 B;  1IDP A;  2XRX B;  3D9R A;  3HX8 A;  5DRE A;  3Q90 A;  4MJD A;  3A76 A;  3UNL A;  3F8X A;  5BXQ A;  4HM5 B;  3NXJ A;  5EVH A;  2HMO B;  4KVH A;  4IIA A;  4HM8 B;  4J9A A;  5CXO A;  2GBW B;  3SOY A;  3HK4 A;  1ULI B;  1CQS A;  2F99 A;  2B24 B;  1OF5 B;  3KZT A;  4XBY A;  1QJG A;  3NV0 B;  5IG4 A;  3NUV A;  1OCV A;  1E97 A;  4HZB B;  2XSO B;  1W6Y A;  4CDL A;  1E3V A;  2HMN B;  1NWW A;  1O7N B;  8CHO A;  1OGZ A;  2I9W A;  5HGR A;  3GRD A;  1JN5 A;  4XM4 A; 
#chains in the Genus database with same CATH topology
 1GSP A;  5TGN A;  3DGN A;  1N9E A;  2HMJ B;  3ZFZ A;  1US1 A;  2R41 A;  4LZI A;  3JUP A;  5BVB A;  5KP1 A;  1RHL A;  1I2E A;  2RGQ A;  1QMA A;  3D79 A;  6GSP A;  1EA2 A;  5DRV A;  2M7O A;  3EJV A;  1ZGX A;  5G1L A;  3WOD G;  4ORL A;  4EV5 A;  3NHX A;  2GEY A;  1UCJ A;  4QWT A;  2OWP A;  2XFT A;  1FGQ A;  1I0X A;  4GB5 A;  3MG2 A;  4U13 A;  1VZZ A;  5RNT A;  4KZ1 A;  3CXC 2;  1NU3 A;  3VF1 A;  5LC7 A;  1RDS A;  3K7C A;  3PS8 A;  1TJD A;  2QGU A;  1VQK 3;  2GSP A;  2F56 A;  2B1X B;  3F7S A;  1RCL A;  3EX9 A;  1BNR A;  1LNH A;  4X2H A;  1SQW A;  1R4C A;  1T3B A;  2IMJ A;  3UL5 A;  1LOV A;  4I4K A;  5IF6 A;  3CCM 3;  4J8T A;  2LYX A;  5AIF A;  1I70 A;  4N3V A;  2LQV A;  1C7H A;  2BMQ B;  3CCJ 3;  4WYK B;  4HBR A;  8RNT A;  3EF8 A;  2W04 A;  2XGN A;  1A2P A;  2E2U A;  2CFD A;  2XFS A;  3NM7 A;  3LOY A;  4MEI A;  5CF2 A;  3G4S 3;  3LTC A;  1ISK A;  1RN4 A;  3CPO A;  1BGS A;  1W7C A;  3FKA A;  2P05 A;  1LNI A;  3EBY A;  4FCM A;  1Q7Y 4;  4N6L A;  2H0G A;  2GBX B;  3F40 A;  3DUK A;  2Y74 A;  3LTD A;  4HM1 B;  3BIR A;  4WWU C;  3SX1 A;  1B2U A;  2D42 A;  3G6E 3;  1JBR A;  1VQM 3;  1UUW B;  2E2V A;  2GU3 A;  4MMZ B;  1VQ6 3;  3F14 A;  2AAE A;  3PXM A;  1CH0 A;  3BND A;  1VQO 3;  4HZ9 B;  2IYJ A;  3K0Z A;  3LXU X;  5BU4 A;  2Q07 A;  3OXA A;  1L5G B;  3K5T A;  1DMM A;  1JZO A;  3FLJ A;  2YFJ B;  3AHW A;  3SLU A;  4AKY A;  2UUG C;  4HM4 B;  4HM0 B;  1EKM A;  1MWT A;  1W01 A;  1BVI A;  3I0Y A;  1LOY A;  1OHS A;  4HVN A;  3WDG B;  3DH2 A;  3IMA B;  3T8U A;  3G16 A;  1VQP 3;  2RBI A;  3EB8 A;  3SVA A;  4EW5 A;  3RGA A;  1YJN 3;  1DVD A;  1M90 4;  3KSE D;  1UCK A;  3PCR A;  3D3L A;  1DYU A;  3F7X A;  3WA3 A;  2WGQ A;  1VQ9 3;  1I8V A;  1BSC A;  2F5W A;  3SXX A;  1ROA A;  3UB1 A;  3CCQ 3;  1RGF A;  1DMQ A;  3I55 3;  3JUN A;  1FW7 A;  1B2Z A;  3FG1 A;  4L8P A;  1W6C A;  4XBT A;  3LT8 A;  1NJI 4;  2CIU A;  1B21 A;  2Z6B A;  1JRQ A;  2HOH A;  3GZB A;  1BOX A;  1SAR A;  1TFK A;  3KSP A;  3RNT A;  3SED A;  3EBT A;  1BUQ A;  6STD A;  2F5M A;  4WYK A;  1DMN A;  1MWS A;  3DZL A;  2XEP A;  2KF5 A;  1JBT A;  1IU7 A;  3AHS A;  3GSP A;  1Q7H A;  2O9U X;  1WMO A;  5AEW B;  1JKG B;  1BNG A;  2W03 A;  5IEN A;  2GXF A;  4EXR A;  3T0U A;  1STD A;  3JUQ A;  2CKF B;  3V92 A;  2O3O A;  4I5Q A;  1O7H B;  2KAA A;  1UI7 A;  4K1V A;  1AVL A;  4RZM A;  3X3X A;  1FGR A;  1RGL A;  3MG3 A;  3S28 A;  4XB5 A;  1GD4 A;  4PEJ A;  2BT3 A;  3UL6 A;  1W00 A;  3BNC A;  1I0V A;  3GZX B;  1MWR A;  5D82 A;  1Y4K A;  1FUS A;  1RNT A;  3G8Z A;  2QA4 3;  1QVG 2;  1BRI A;  1LVN A;  3FF0 A;  1M1K 4;  1V57 A;  3G0K A;  1VQ4 3;  1JZD A;  5AI1 A;  3X41 A;  3EC9 A;  2C10 A;  3B8L A;  3Q2P A;  4WFO A;  2ML5 A;  3H51 A;  4EV2 A;  3J7Y d;  4DKI A;  3CCS 3;  1N5P A;  4FMB A;  3TDG A;  1IQY A;  1ZO2 A;  3U1W A;  2Z77 A;  3FCS B;  3LZA A;  4KT3 B;  3NX0 A;  2W6J H;  3PCS A;  3GZR A;  3WR2 A;  5KP4 A;  3LML A;  4H3U A;  2RNT A;  4HYZ A;  5IER A;  2W9Q A;  3LTA A;  3FG4 A;  2OCT A;  4KFD A;  1E3R A;  1A90 A;  3GZY B;  4RNT A;  1YVS A;  4IPB A;  4FR9 A;  1O7P B;  1BNE A;  1OAC A;  1QVF 2;  1S5A A;  1FGT A;  1IVX A;  3IPT A;  5AIH A;  2JDI H;  7RNT A;  1ULJ B;  2CH9 A;  2KRT A;  3CCV 3;  3GAX A;  1GY5 A;  3KE7 A;  4BU4 A;  1EG9 B;  2IA7 A;  1IK3 A;  5G2G A;  4EBG A;  3B7C A;  2P09 A;  5GSP A;  2K0M A;  1D6Z A;  2C4B A;  2AAD A;  3CU3 A;  3FGY A;  1NDO B;  1JB4 A;  2KCD A;  3CCL 3;  1JKG A;  1QAK A;  2D1W A;  1FGO A;  1CYU A;  1BAN A;  1BNJ A;  3WHO A;  1RN7 A;  1EQK A;  1TUH A;  2HMK B;  1UW1 A;  1A2V A;  2INX A;  2W9P A;  3IJE B;  4NHF A;  5IEP A;  4XDV A;  1G02 A;  1DE3 A;  1I2G A;  2GU1 A;  5FW5 A;  1LRA A;  2YFL B;  4NRE A;  2J8X B;  2P0M A;  4HM7 B;  1W4N A;  2WOH A;  1GD3 A;  1BRJ A;  3SYU A;  1QAF A;  1U8C B;  3Q3F A;  1OH0 A;  5CK6 A;  3L0R A;  1LXE A;  3FH1 A;  1A67 A;  3DY5 A;  4K1U A;  2CWT A;  4OUQ A;  1ZX2 A;  1K8A 4;  1BRH A;  1ZS7 A;  4O2H A;  1A2K A;  1HU9 A;  1OGX A;  3D5G A;  3AMO A;  5IG5 A;  1YIJ 3;  3OWS A;  1OHP A;  3CCU 3;  2YX9 A;  3ZG0 A;  5AEU B;  1RRL A;  1RNB A;  3OW2 2;  4Q53 A;  3KFQ C;  4OK0 A;  3K63 A;  2WGO A;  4N6M A;  3OV4 A;  2BIR A;  1GS3 A;  3KII A;  5LC6 A;  9RNT A;  1WMN A;  1T2I A;  2MF7 A;  3DGL A;  1AR0 A;  3X42 A;  1R4Y A;  1F8N A;  1JB5 A;  4STD A;  1QAL A;  1RJO A;  1WQL B;  3EQQ B;  1BRS A;  3BU4 A;  3KKG A;  4R9L A;  2W2C A;  1S72 3;  1PU4 A;  1GMQ A;  1IVU A;  1O7M B;  5M1A A;  2JQ5 A;  1DET A;  3DMC A;  1X1Y A;  3CD6 3;  3E99 A;  1FZU A;  1SJW A;  2CG1 A;  2BNG A;  3O8Y A;  4MMY B;  4CPK A;  1YGW A;  1N8Q A;  1OUN A;  3ER7 A;  3M8C A;  3S5C A;  3D4A A;  2K3D A;  2STD A;  1FGM A;  4AKZ A;  1CEW I;  1O7W B;  1Q82 4;  3CCR 3;  1RGK A;  2K54 A;  5IG0 A;  4GL6 A;  1Q42 A;  4HJL B;  1AQZ A;  1NB3 I;  1K28 A;  3CNM A;  4MMX B;  5ELJ A;  2FXT A;  3I56 3;  1SII A;  3AGN A;  1U5O A;  3ALA A;  3CNX A;  2CHC A;  5IG3 A;  1B3S A;  2V1L A;  4LYL B;  3OWU A;  2A15 A;  3LH4 A;  3MSO A;  1GOV A;  1RGH A;  3HI7 A;  2CFW A;  1W02 A;  5JPU A;  4WHA A;  1UUV B;  1O7G B;  4LGQ A;  3JUM A;  1LQG C;  3D5I A;  1OPY A;  1DVC A;  3OX9 A;  3NBR A;  3FG3 A;  5AII A;  1RRH A;  1GY7 A;  3F8H A;  2SAR A;  1Q40 A;  3VGN A;  2UX0 A;  1NNV A;  5EQL A;  1BSE A;  3S27 A;  3T8N A;  4FCZ A;  2ZA4 A;  5CLK A;  3MYT A;  3K9M C;  5ELU A;  1KQS 2;  2KF6 A;  3NBB A;  1TIJ A;  1TRQ A;  3BB9 A;  3DGM A;  3F9S A;  4O8S A;  5IW9 A;  4N6O B;  1GY6 A;  1IYY A;  1UUG B;  3VSY A;  2IY2 A;  1M1X B;  7GSP A;  1TRP A;  1FUT A;  4RNZ A;  5D83 A;  1IVW A;  1BSA A;  5A0O B;  4TX4 A;  3Q1C A;  1MGW A;  2CX0 A;  2HMM B;  1JB2 A;  2R4I A;  1VQ5 3;  3CPW 2;  2UGI A;  2CFL A;  2XR8 B;  3AMO B;  4BTY A;  1D6Y A;  3LT9 A;  4FMD A;  1N5H A;  3FZW A;  2XSH B;  3U97 A;  2IUK A;  2SBL A;  3DM8 A;  1G96 A;  1N9J A;  4H61 A;  4N6T A;  1EUI C;  3SOA A;  2OTL 3;  1YNV X;  1FA3 A;  4OVM A;  1KWI A;  2W56 A;  4LEH A;  1T2H A;  1YJ9 3;  1KC8 4;  3WOF B;  1VQL 3;  3N8B A;  3PGB A;  3N9H A;  5EEO A;  1X1W A;  2WOF A;  5BIR A;  1C54 A;  4JF8 A;  3JUO A;  4RNY A;  2HML B;  2XH9 A;  3B4P A;  1RN1 A;  4KFE A;  4XBX A;  2RFR A;  1GMR A;  4L8O A;  2MC8 A;  2KF4 A;  4JRF A;  1HKX A;  3CC4 3;  5IEO A;  2CWU A;  3RGR A;  1IV7 A;  2IUJ A;  3NQY A;  4FMC A;  1LQM B;  4GHO A;  2OQE A;  1STF I;  1PYL A;  1WMP A;  2CC3 A;  1W5Z A;  2YFI B;  1WTH A;  3QK9 A;  1LOX A;  2ZL8 A;  5I97 A;  1B20 A;  1BU4 A;  3NQZ A;  3BNE A;  2CX1 A;  1YGE A;  3FF2 A;  4FCJ A;  1UCL A;  1IT7 A;  4BTX A;  1MGR A;  3MWZ A;  5AYS C;  2P38 A;  2WO0 A;  1B27 A;  5CF1 A;  4HKV B;  2BHM A;  5STD A;  1YJW 3;  2H0H A;  3HZP A;  3N54 B;  4IT7 A;  1OHO A;  3UJM A;  3CME 3;  1RMS A;  2KF3 A;  7STD A;  3GWR A;  3MKI A;  3PZW A;  6RNT A;  2PNC A;  1K41 A;  5D81 A;  2OOV C;  3ECF A;  4HM3 B;  5AYR B;  3BLZ A;  1X1U A;  2E2T A;  1RGA A;  2OQE C;  1GOY A;  5M19 A;  2FNQ A;  2L1S A;  4N6N B;  1ROV A;  3NM2 A;  1FYS A;  3JVC A;  2Z7A A;  1IV9 A;  2H0I A;  1UCI A;  1OF5 A;  1D6U A;  1BNF A;  2CG0 A;  3KCH A;  3ROB A;  3STD A;  4BL3 A;  1BNI A;  4CCV A;  1V74 A;  1TFO A;  1GMP A;  1AV4 A;  3QRD A;  3NV0 A;  4HM2 B;  3URP A;  3OWY A;  1GOU A;  1Q40 B;  4O3V A;  1BAO A;  1BSB A;  4KFF A;  1VQN 3;  1RGE A;  1TP6 A;  2RCD A;  5JBS A;  5JPP A;  3KN4 A;  2P0X A;  3MHE A;  1TTO A;  4R9K A;  2QIY A;  3S67 A;  2CFG A;  1BNS A;  2GEX A;  1Q9E A;  2L4V A;  1VQQ A;  2BMO B;  1YI2 3;  4X2O A;  1NO3 A;  1IVV A;  4ILF A;  2PZV A;  2ML6 A;  3MG1 A;  4GSP A;  4XDW A;  3CCE 3;  3AGO A;  1RGG A;  3HIG A;  4LMI A;  1AY7 A;  3G71 3;  3DXO A;  2RSX A;  1TU5 A;  3FSD A;  1RCK A;  1UGI A;  2CK3 H;  3EHC A;  3WOE B;  4BIR A;  1Z1S A;  3EE1 A;  4NPB A;  4N6U A;  1LOW A;  2ZHX B;  4HM6 B;  3WMD A;  2W56 B;  4BTW A;  3EN1 B;  5AIG A;  3V98 A;  4EC6 A;  3PYJ A;  4HOH A;  4R1K A;  4L7K A;  3LYG A;  1SPU A;  1IQ8 A;  1W2Z A;  4R4K A;  1BRK A;  4WP5 A;  2BMR B;  5KP3 A;  2F86 B;  3RDE A;  1RKY A;  1Q86 4;  2F98 A;  1N8R 4;  1GYB A;  4ZM8 A;  1ASK A;  3H3H A;  1JNQ A;  1MWU A;  3EN8 A;  3X40 A;  4FMA A;  5M18 A;  1JBS A;  1J2B A;  2OTJ 3;  2Z76 A;  3B4O A;  1JN5 B;  1UDI I;  1IDP A;  2XRX B;  1BUJ A;  3D9R A;  1K73 4;  1YVB I;  3HX8 A;  3WA2 X;  1V58 A;  3NBJ A;  3MPH A;  1KD1 4;  1RLS A;  1VQ8 3;  5DRE A;  2FGT A;  3Q90 A;  1M9G A;  1AVK A;  1JJ2 2;  4K61 A;  1IT8 A;  1RTU A;  3DGO A;  1BRG A;  4MJD A;  3A76 A;  3UNL A;  1X1X A;  3F8X A;  1WNH A;  2CWV A;  4HM5 B;  5BXQ A;  1FUW A;  3NXJ A;  4G1M B;  1IQX A;  1B2S A;  1MOL A;  3LTB A;  1W6G A;  4RBN A;  4CJN A;  1BRN L;  2KXG A;  2HMO B;  2CW9 A;  4KVH A;  5EVH A;  5G1K A;  4AEQ A;  2F4Y A;  1Q81 4;  1B2M A;  1UGH I;  1UI8 A;  4IIA A;  4HAA A;  4K90 B;  2C11 A;  1KSI A;  4HM8 B;  4J9A A;  5CXO A;  2XGL A;  4J5K A;  2GBW B;  1YIT 3;  3SOY A;  3HK4 A;  1ULI B;  1VQ7 3;  1CQS A;  2CFK A;  3HII A;  5FGO A;  2BO9 B;  2B24 B;  2F99 A;  1OF5 B;  3KZT A;  3S29 A;  4EYC A;  3CC7 3;  1W2B 2;  4XBY A;  3ZG5 A;  1NB5 I;  1QJG A;  1BIR A;  3CMA 3;  1HYF A;  3NV0 B;  5IG4 A;  1I3F A;  3CC2 3;  2ZDJ A;  4LSO A;  3NUV A;  1SIH A;  1OCV A;  3X3Y A;  2QEX 3;  1EEJ A;  1E97 A;  4HZB B;  1HZ1 A;  2XSO B;  1G0T A;  1W6Y A;  3BNB A;  4J5G A;  5HOH A;  1YHQ 3;  1I3I A;  4R80 A;  1RSN A;  3X3Z A;  3HOH A;  1I2F A;  4CDL A;  1PY3 A;  4N6V 0;  1E3V A;  1CYV A;  2HMN B;  1NWW A;  1O7N B;  1K9M 4;  2W0Q A;  3V99 A;  2XF3 A;  8CHO A;  1T5Y A;  3A5E A;  2OOV A;  1MNL A;  4BL2 A;  4O02 B;  1OGZ A;  2BU4 A;  1PFP A;  2I9W A;  2Y73 A;  5HGR A;  1B2X A;  3DGY A;  1JV2 B;  3GRD A;  1BSD A;  1JN5 A;  1RGC A;  4XM4 A; 
#chains in the Genus database with same CATH homology
 5TGN A;  3DGN A;  1N9E A;  2HMJ B;  1US1 A;  4LZI A;  5BVB A;  3JUP A;  5KP1 A;  2RGQ A;  1QMA A;  1EA2 A;  5DRV A;  2M7O A;  3EJV A;  3WOD G;  4EV5 A;  4ORL A;  3NHX A;  2GEY A;  4QWT A;  2OWP A;  2XFT A;  1FGQ A;  4GB5 A;  3MG2 A;  4U13 A;  1VZZ A;  4KZ1 A;  3CXC 2;  1NU3 A;  3VF1 A;  5LC7 A;  3K7C A;  3PS8 A;  1VQK 3;  2QGU A;  2B1X B;  3F7S A;  3EX9 A;  1LNH A;  4X2H A;  1SQW A;  1R4C A;  2IMJ A;  3UL5 A;  4I4K A;  5IF6 A;  3CCM 3;  4J8T A;  2LYX A;  5AIF A;  4N3V A;  2LQV A;  1C7H A;  2BMQ B;  3CCJ 3;  4WYK B;  4HBR A;  3EF8 A;  2W04 A;  2XGN A;  2E2U A;  2CFD A;  2XFS A;  3NM7 A;  3LOY A;  4MEI A;  5CF2 A;  3G4S 3;  3LTC A;  1ISK A;  3CPO A;  1W7C A;  3FKA A;  2P05 A;  3EBY A;  4FCM A;  1Q7Y 4;  4N6L A;  2GBX B;  3F40 A;  3DUK A;  2Y74 A;  3LTD A;  4HM1 B;  4WWU C;  3SX1 A;  2D42 A;  3G6E 3;  1VQM 3;  1UUW B;  2E2V A;  2GU3 A;  4MMZ B;  1VQ6 3;  3F14 A;  3PXM A;  3BND A;  1VQO 3;  4HZ9 B;  3K0Z A;  3LXU X;  2Q07 A;  3OXA A;  1L5G B;  3K5T A;  1DMM A;  3FLJ A;  2YFJ B;  3SLU A;  4AKY A;  4HM4 B;  4HM0 B;  1EKM A;  1W01 A;  3I0Y A;  1OHS A;  4HVN A;  3WDG B;  3IMA B;  3T8U A;  3G16 A;  1VQP 3;  3EB8 A;  3SVA A;  1YJN 3;  3RGA A;  1DVD A;  1M90 4;  3KSE D;  3PCR A;  3D3L A;  1DYU A;  3F7X A;  3WA3 A;  2WGQ A;  1VQ9 3;  3SXX A;  3UB1 A;  1ROA A;  3CCQ 3;  1DMQ A;  3I55 3;  3JUN A;  3FG1 A;  4L8P A;  1W6C A;  4XBT A;  3LT8 A;  1NJI 4;  2CIU A;  2Z6B A;  1JRQ A;  3GZB A;  1TFK A;  3KSP A;  3SED A;  3EBT A;  1BUQ A;  6STD A;  4WYK A;  1DMN A;  3DZL A;  2XEP A;  1IU7 A;  2O9U X;  1WMO A;  5AEW B;  1JKG B;  2W03 A;  5IEN A;  2GXF A;  4EXR A;  3T0U A;  1STD A;  3JUQ A;  2CKF B;  3V92 A;  2O3O A;  1O7H B;  1UI7 A;  4K1V A;  1AVL A;  4RZM A;  3X3X A;  1FGR A;  3MG3 A;  3S28 A;  4XB5 A;  1GD4 A;  4PEJ A;  2BT3 A;  3UL6 A;  1W00 A;  3BNC A;  3GZX B;  5D82 A;  1Y4K A;  3G8Z A;  2QA4 3;  1QVG 2;  1LVN A;  3FF0 A;  1M1K 4;  3G0K A;  1VQ4 3;  5AI1 A;  3X41 A;  3EC9 A;  2C10 A;  3B8L A;  3Q2P A;  4WFO A;  2ML5 A;  3H51 A;  4EV2 A;  3J7Y d;  3CCS 3;  1N5P A;  4FMB A;  3TDG A;  1IQY A;  1ZO2 A;  3U1W A;  2Z77 A;  3FCS B;  3LZA A;  3NX0 A;  2W6J H;  3PCS A;  3GZR A;  5KP4 A;  3LML A;  4H3U A;  4HYZ A;  5IER A;  2W9Q A;  3LTA A;  3FG4 A;  2OCT A;  4KFD A;  1E3R A;  1A90 A;  3GZY B;  4IPB A;  4FR9 A;  1O7P B;  1OAC A;  1QVF 2;  1S5A A;  1FGT A;  1IVX A;  3IPT A;  5AIH A;  2JDI H;  1ULJ B;  2CH9 A;  2KRT A;  3CCV 3;  3GAX A;  1GY5 A;  3KE7 A;  1EG9 B;  2IA7 A;  1IK3 A;  5G2G A;  4EBG A;  3B7C A;  2P09 A;  2K0M A;  1D6Z A;  3CU3 A;  3FGY A;  1NDO B;  1JB4 A;  2KCD A;  3CCL 3;  1JKG A;  1QAK A;  2D1W A;  1FGO A;  1CYU A;  1EQK A;  1RN7 A;  1TUH A;  2HMK B;  1UW1 A;  1A2V A;  2INX A;  2W9P A;  3IJE B;  4NHF A;  5IEP A;  4XDV A;  2GU1 A;  5FW5 A;  4NRE A;  2YFL B;  2P0M A;  4HM7 B;  1W4N A;  2WOH A;  1GD3 A;  1QAF A;  1U8C B;  1OH0 A;  5CK6 A;  3L0R A;  1LXE A;  3FH1 A;  1A67 A;  3DY5 A;  4K1U A;  2CWT A;  4OUQ A;  1ZX2 A;  1K8A 4;  4O2H A;  1A2K A;  1HU9 A;  1OGX A;  3AMO A;  5IG5 A;  1YIJ 3;  3OWS A;  1OHP A;  3CCU 3;  2YX9 A;  5AEU B;  1RRL A;  3OW2 2;  4Q53 A;  3KFQ C;  4OK0 A;  3K63 A;  2WGO A;  4N6M A;  3OV4 A;  1GS3 A;  3KII A;  5LC6 A;  1WMN A;  2MF7 A;  3DGL A;  1AR0 A;  3X42 A;  1F8N A;  1JB5 A;  4STD A;  1QAL A;  1RJO A;  1WQL B;  3EQQ B;  3KKG A;  4R9L A;  2W2C A;  1S72 3;  1PU4 A;  1O7M B;  1IVU A;  2JQ5 A;  3DMC A;  3CD6 3;  3E99 A;  1SJW A;  2CG1 A;  2BNG A;  3O8Y A;  4MMY B;  1N8Q A;  1OUN A;  3ER7 A;  3M8C A;  3S5C A;  2STD A;  1FGM A;  4AKZ A;  1CEW I;  1O7W B;  1Q82 4;  3CCR 3;  5IG0 A;  2K54 A;  4GL6 A;  1Q42 A;  4HJL B;  1NB3 I;  1K28 A;  3CNM A;  4MMX B;  5ELJ A;  2FXT A;  3I56 3;  1SII A;  3ALA A;  1U5O A;  3CNX A;  2CHC A;  5IG3 A;  2V1L A;  3OWU A;  2A15 A;  3LH4 A;  3MSO A;  3HI7 A;  2CFW A;  1W02 A;  5JPU A;  4WHA A;  1UUV B;  1O7G B;  4LGQ A;  3JUM A;  1OPY A;  1DVC A;  3OX9 A;  3NBR A;  3FG3 A;  5AII A;  1RRH A;  1GY7 A;  3F8H A;  1Q40 A;  3VGN A;  2UX0 A;  5EQL A;  3S27 A;  3T8N A;  4FCZ A;  5CLK A;  3MYT A;  3K9M C;  5ELU A;  1KQS 2;  3NBB A;  1TIJ A;  3BB9 A;  4O8S A;  3DGM A;  3F9S A;  5IW9 A;  4N6O B;  1GY6 A;  3VSY A;  1M1X B;  4RNZ A;  5D83 A;  1IVW A;  5A0O B;  4TX4 A;  3Q1C A;  2HMM B;  1JB2 A;  2R4I A;  1VQ5 3;  3CPW 2;  4BTY A;  2CFL A;  2XR8 B;  3AMO B;  1D6Y A;  3LT9 A;  4FMD A;  1N5H A;  3FZW A;  2XSH B;  3U97 A;  2IUK A;  2SBL A;  3DM8 A;  1G96 A;  1N9J A;  4H61 A;  4N6T A;  2OTL 3;  3SOA A;  1FA3 A;  4OVM A;  1KWI A;  2W56 A;  4LEH A;  1KC8 4;  1YJ9 3;  1VQL 3;  3WOF B;  3N8B A;  3PGB A;  3N9H A;  5EEO A;  2WOF A;  4JF8 A;  3JUO A;  4RNY A;  2HML B;  2XH9 A;  3B4P A;  4KFE A;  4XBX A;  2RFR A;  2MC8 A;  4L8O A;  4JRF A;  1HKX A;  3CC4 3;  5IEO A;  2CWU A;  3RGR A;  1IV7 A;  2IUJ A;  3NQY A;  4FMC A;  2OQE A;  1STF I;  1WMP A;  2CC3 A;  1W5Z A;  2YFI B;  1WTH A;  3QK9 A;  1LOX A;  2ZL8 A;  5I97 A;  3NQZ A;  3BNE A;  3FF2 A;  1YGE A;  4FCJ A;  4BTX A;  1IT7 A;  3MWZ A;  5AYS C;  2P38 A;  2WO0 A;  5CF1 A;  4HKV B;  2BHM A;  5STD A;  1YJW 3;  3N54 B;  3HZP A;  4IT7 A;  1OHO A;  3UJM A;  3CME 3;  7STD A;  3GWR A;  3MKI A;  3PZW A;  2PNC A;  1K41 A;  5D81 A;  2OOV C;  3ECF A;  4HM3 B;  5AYR B;  3BLZ A;  2E2T A;  2OQE C;  2FNQ A;  4N6N B;  1ROV A;  3NM2 A;  3JVC A;  2Z7A A;  1IV9 A;  3ROB A;  1OF5 A;  1D6U A;  2CG0 A;  3STD A;  4CCV A;  1V74 A;  1TFO A;  3QRD A;  1AV4 A;  4HM2 B;  3NV0 A;  3OWY A;  1Q40 B;  4O3V A;  4KFF A;  1VQN 3;  1TP6 A;  2RCD A;  5JBS A;  5JPP A;  3KN4 A;  2P0X A;  3MHE A;  4R9K A;  2QIY A;  3S67 A;  2CFG A;  2GEX A;  2L4V A;  2BMO B;  1YI2 3;  4X2O A;  1NO3 A;  1IVV A;  2PZV A;  2ML6 A;  3MG1 A;  4XDW A;  3CCE 3;  3HIG A;  4LMI A;  3G71 3;  3DXO A;  2RSX A;  1TU5 A;  3FSD A;  3EHC A;  3WOE B;  2CK3 H;  1Z1S A;  3EE1 A;  4N6U A;  4HM6 B;  3WMD A;  2W56 B;  4BTW A;  3EN1 B;  5AIG A;  3V98 A;  4EC6 A;  3PYJ A;  4R1K A;  4L7K A;  3LYG A;  1SPU A;  1IQ8 A;  1W2Z A;  4R4K A;  4WP5 A;  2BMR B;  5KP3 A;  2F86 B;  3RDE A;  1RKY A;  1Q86 4;  2F98 A;  1N8R 4;  1GYB A;  4ZM8 A;  1ASK A;  3H3H A;  1JNQ A;  3EN8 A;  3X40 A;  1J2B A;  4FMA A;  2OTJ 3;  2Z76 A;  3B4O A;  1JN5 B;  1IDP A;  2XRX B;  3D9R A;  1K73 4;  1YVB I;  3HX8 A;  3WA2 X;  1KD1 4;  3NBJ A;  3MPH A;  1VQ8 3;  5DRE A;  2FGT A;  3Q90 A;  1M9G A;  1AVK A;  1JJ2 2;  4K61 A;  1IT8 A;  3DGO A;  4MJD A;  3A76 A;  3UNL A;  3F8X A;  1FUW A;  1WNH A;  2CWV A;  4HM5 B;  5BXQ A;  3NXJ A;  4G1M B;  1IQX A;  1MOL A;  3LTB A;  4RBN A;  1W6G A;  2KXG A;  2HMO B;  2CW9 A;  4KVH A;  5EVH A;  1Q81 4;  4AEQ A;  1UI8 A;  4IIA A;  4K90 B;  2C11 A;  1KSI A;  4HM8 B;  4J9A A;  5CXO A;  2XGL A;  2GBW B;  1YIT 3;  3SOY A;  3HK4 A;  1ULI B;  1VQ7 3;  1CQS A;  2CFK A;  3HII A;  5FGO A;  2BO9 B;  2B24 B;  2F99 A;  1OF5 B;  3KZT A;  3S29 A;  4EYC A;  3CC7 3;  1W2B 2;  4XBY A;  1NB5 I;  3CMA 3;  1QJG A;  3NV0 B;  5IG4 A;  3CC2 3;  2ZDJ A;  4LSO A;  3NUV A;  1SIH A;  1OCV A;  3X3Y A;  2QEX 3;  1E97 A;  4HZB B;  2XSO B;  1W6Y A;  3BNB A;  1YHQ 3;  4R80 A;  3X3Z A;  4CDL A;  4N6V 0;  1E3V A;  1CYV A;  2HMN B;  1NWW A;  1O7N B;  1K9M 4;  2W0Q A;  3V99 A;  2XF3 A;  8CHO A;  1T5Y A;  2OOV A;  1MNL A;  4O02 B;  1OGZ A;  1PFP A;  2I9W A;  2Y73 A;  5HGR A;  3GRD A;  1JV2 B;  1JN5 A;  4XM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...