3F14A

Crystal structure of ntf2-like protein of unknown function (yp_680363.1) from cytophaga hutchinsonii atcc 33406 at 1.45 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
GMETTHYSIAQHFSSGDFPAVYACFNDIIEWNIIGNQVVKGKADVIDFCNKMLPEMKGAVLTNDNVIQNENQIVIEGKCRYFDAEGKEAFVSYCDIYRFENDTIKTITSYCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF2-like protein of unknown function (YP_680363.1) from CYTOPHAGA HUTCHINSONII ATCC 33406 at 1.45 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized NTF2-like protein
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f14A00
3EJVA 3Q90A 2RFRA 3HZPA 4LMIA 1GS3A 4OVMA 1JN5A 5TGNA 5IEPA 5AIHA 5IG4A 7STDA 3FF0A 1GY5A 3JUQA 3NXJA 3SOYA 1S5AA 4R9LA 2GBXB 5BXQA 2GEYA 5IG5A 4WYKB 1OCVA 3RGAA 3NHXA 4GB5A 4OUQA 3GRDA 3B4PA 1DMQA 1DMNA 3A76A 4Q53A 4STDA 4WP5A 2XSHB 3G0KA 5CXOA 4XB5A 2Z76A 3F14A 1OGZA 2I9WA 1OUNA 3GWRA 2JQ5A 3FZWA 4HZ9B 1O7WB 4HZBB 1NU3A 3NV0B 3MHEA 2BNGA 1ISKA 1C7HA 3OX9A 1VZZA 4MJDA 1OF5B 3F9SA 4HM1B 4R9KA 3VSYA 1BUQA 5IENA 3STDA 5KP4A 2Z7AA 3B8LA 1EG9B 3M8CA 4HJLB 3CU3A 4KVHA 3ROBA 1JKGA 1OGXA 1QMAA 1OHSA 2RCDA 2YFIB 2XR8B 2YFLB 3GZYB 1GY6A 2CHCA 2GEXA 3D9RA 4HM3B 4XBXA 3DXOA 1U5OA 1O7GB 3BLZA 4FCMA 3UNLA 3G16A 3GZRA 5IG0A 3MG3A 2QIYA 4L8PA 2K54A 5D82A 5JPPA 2BMRB 4IIAA 1IDPA 1ZX2A 2Z77A 1ASKA 3EN8A 3ER7A 1OH0A 1E3VA 3NUVA 5DREA 5CLKA 5FW5A 5D81A 1UUVB 4X2OA 4HM2B 4HM7B 1JKGB 4K1UA 4WYKA 2A15A 5AIIA 2HMNB 2W2CA 3DUKA 3OWSA 2HMJB 5AEUB 4HKVB 4XDVA 5IG3A 3MG2A 3CPOA 1STDA 2HMLB 5IF6A 4K1VA 5D83A 4FCJA 5G2GA 3EX9A 3CNXA 3KZTA 4I4KA 5HGRA 3FKAA 3KSPA 1OHPA 5CK6A 1SJWA 1W6YA 4RZMA 2HMMB 3FGYA 3F7XA 4XBYA 3MG1A 3HK4A 4XBTA 1JB4A 3G8ZA 3NBRA 4WWUC 5BVBA 2B1XB 4HM8B 2IMJA 3LZAA 3LYGA 3RGRA 1ULIB 3F40A 1Z1SA 3BB9A 3FLJA 3DMCA 3OV4A 4LEHA 4X2HA 5DRVA 3SEDA 1NWWA 5AIGA 3F8HA 3IPTA 5STDA 2INXA 1QJGA 4R1KA 4CDLA 4HM0B 2XSOB 3JUPA 2GBWB 3KKGA 3MSOA 2HMKB 4HVNA 5IERA 2GXFA 1O7HB 3B4OA 2HMOB 3KE7A 3EN1B 4PEJA 2BMOB 3EBYA 3VGNA 4H3UA 4HM5B 5CF1A 1W01A 3GZBA 1OHOA 1W00A 2BMQB 2YFJB 4HM4B 1JB5A 1DMMA 2F99A 2OWPA 1Q42A 3B7CA 5AEWB 2R4IA 1A2KA 3ECFA 1AR0A 3EQQB 5AIFA 3CNMA 3MKIA 1E3RA 3EC9A 4J9AA 3NM2A 2F98A 3F7SA 3K7CA 5CF2A 3I0YA 3MYTA 3DM8A 3S5CA 6STDA 1EA2A 1GY7A 1Q40B 3EBTA 4N3VA 5EVHA 1OF5A 3HX8A 3JUNA 3GZXB 3F8XA 5AI1A 1UUWB 1CQSA 3T8UA 1OPYA 4U13A 1K41A 1ZO2A 1NDOB 2PZVA 2CKFB 2UX0A 3UJMA 3WMDA 3JUMA 1E97A 1HKXA 1W02A 3SOAA 2STDA 3OXAA 5IEOA 1WQLB 4XM4A 1TP6A 4L7KA 3EHCA 3FH1A 3OWYA 5KP3A 1O7NB 3DZLA 5KP1A 3E99A 3FF2A 1ULJB 3K0ZA 1O7PB 3H51A 4LGQA 4XDWA 2RGQA 1O7MB 3FSDA 2QGUA 3EF8A 1JN5B 1Q40A 3NV0A 4L8OA 3T8NA 1JB2A 8CHOA 1TUHA 4HM6B 4ORLA 1GYBA 5JPUA 3H3HA 3OWUA 2B24B 2XRXB 2F86B 4J8TA 3JUOA
chains in the Genus database with same CATH superfamily
2M7OA 3CCU3 2K0MA 4O8SA 4EV2A 3MWZA 1D6UA 2H0HA 5AYRB 3ZFZA 1Q9EA 4EXRA 2OTJ3 5IG4A 4IPBA 6RNTA 1B21A 1GY5A 1ROVA 1S5AA 1Q7Y4 2P0MA 1OACA 2XGLA 3NHXA 4OUQA 3Q2PA 2F5MA 1NNVA 1DMNA 2FGTA 2RBIA 4Q53A 3DGOA 3RNTA 4BU4A 1FW7A 4XB5A 5M18A 3BNCA 4ZM8A 3MHEA 2BNGA 1BUQA 1OF5B 4HOHA 1BNRA 2Z7AA 3KIIA 4BTXA 1ROAA 3ROBA 1BNSA 3CU3A 1OGXA 4HZ9B 3GZYB 2E2UA 2XR8B 2XFTA 1T2IA 4PEJA 1I2EA 1GMPA 4XBXA 1VQL3 1YIJ3 1X1XA 1GOVA 3BLZA 2CH9A 2V1LA 3D5GA 3UNLA 5IG0A 2CIUA 1I2GA 3KCHA 2JDIH 4N6LA 1Q7HA 5D82A 5JPPA 3U1WA 1BNEA 1IDPA 1ZX2A 2IUKA 1ASKA 3EN8A 1NB3I 4FCZA 3S27A 4BIRA 4O3VA 1KSIA 1F8NA 2F56A 5FW5A 1JBRA 4H61A 1B20A 1JKGB 1ZS7A 4FMCA 1QAKA 2HMNB 3OWSA 4QWTA 3G6E3 1FUWA 1VQ83 3A5EA 2ML5A 5EEOA 1YI23 2SBLA 3CNXA 3KZTA 1FYSA 1V58A 2CWUA 2UUGC 3FKAA 3GAXA 1JBSA 1FGTA 1I0XA 1SJWA 5HOHA 4GSPA 4RZMA 3FGYA 3F7XA 2H0GA 3PCRA 3MG1A 2H0IA 3N9HA 3NBRA 4WWUC 3QK9A 4DKIA 2W9PA 1UGHI 1KC84 1IVXA 3FLJA 1NJI4 4X2HA 1EKMA 3SEDA 1BRSA 1NWWA 2D1WA 3L0RA 3IPTA 1M1XB 1I2FA 1G0TA 1W2B2 2MF7A 1ISKA 3WR2A 1BAOA 1AVLA 1GOUA 1LNIA 2HMKB 3WODG 3X3XA 1BU4A 1MWRA 3NBBA 4KZ1A 3CCL3 1KQS2 1LOVA 2W56A 1PYLA 1BSEA 1W6GA 4HM5B 5CF1A 3LTDA 1W01A 3GZBA 1MGWA 2YFJB 1TRPA 2IUJA 1Q42A 1BRHA 2KCDA 1I3FA 2W56B 4N6UA 5AIFA 1IU7A 2CFWA 2CFGA 5CF2A 3S5CA 1IT7A 3DGNA 5G1LA 1GY7A 4CJNA 1DE3A 4R4KA 1Q40B 3CCS3 1VQQA 2CFDA 2OOVA 1PU4A 1GMQA 4N3VA 3GZXB 3F8XA 1RKYA 1UUWB 2C11A 1OPYA 1AVKA 1ZO2A 3GSPA 2O3OA 4AKYA 1E97A 1K28A 1UCJA 4RNYA 2STDA 3OXAA 2CX1A 3NM7A 3Q1CA 2QA43 3OWYA 2P0XA 3UL5A 3NQYA 3E99A 4XDWA 1BRIA 1O7PB 3H51A 4LGQA 4HAAA 3EE1A 1JN5B 3AGNA 8CHOA 1KD14 4ORLA 1DVCA 1I8VA 1GSPA 1B2MA 2B24B 1E3VA 2QEX3 2CX0A 4KT3B 1YNVX 2RFRA 3HZPA 3O8YA 4LMIA 3NQZA 3X41A 4N6MA 3N8BA 2AAEA 5TGNA 3T0UA 3WA2X 5AIHA 5LC6A 3V99A 4NPBA 1FGRA 3LTAA 2GBXB 1YVBI 2WOFA 1FGQA 4GB5A 3S29A 3GRDA 1DMQA 1DYUA 4J5KA 3HIGA 3G0KA 4WHAA 1S723 1OGZA 2O9UX 4NREA 1O7WB 4HZBB 1NU3A 4EC6A 3URPA 1RGFA 4GHOA 4R9KA 1T3BA 3F9SA 4HM1B 3B8LA 4BTWA 1EG9B 3M8CA 4HJLB 4KVHA 2CWTA 4KFEA 1YGWA 1OHSA 4HM3B 1RCLA 1GY6A 2CWVA 2GEXA 3DXOA 1O7GB 1HU9A 1AQZA 2KF5A 3G16A 1JJ22 1VQ93 1RTUA 1MNLA 1MWTA 1RDSA 4L8PA 2ZDJA 2K54A 1BVIA 1RNTA 1N5HA 2W9QA 2OTL3 1SIIA 1BSAA 1N9EA 3ER7A 3X3YA 4KFFA 1C54A 1IK3A 4N6V0 1I70A 4FR9A 5D81A 4HM2B 4HM7B 3BNDA 2W2CA 1BIRA 2HMJB 5M19A 2XEPA 4XDVA 4EBGA 1DETA 5IG3A 1VQO3 1D6YA 4K1VA 1CEWI 1A90A 3ZG5A 1RGGA 1EEJA 2PNCA 2UGIA 4LZIA 7RNTA 1IYYA 1YIT3 3HK4A 1YGEA 1W6CA 4HM8B 2IMJA 3RGRA 2XFSA 1Z1SA 1JV2B 3BB9A 1FA3A 3FG1A 3F8HA 4TX4A 3Q3FA 1Y4KA 1TFKA 1SARA 2IY2A 2XSOB 2D42A 3JUPA 3KKGA 1BSCA 3PXMA 4HM0B 3U97A 1Q824 3KE7A 3EN1B 1RN4A 4IT7A 1KWIA 1LOWA 1JZOA 4MMZB 1TU5A 1IV7A 4OK0A 1OHOA 1W00A 2BMQB 3LMLA 2F99A 3CPW2 1VQ53 2R4IA 1A2KA 1B2SA 4N6NB 1DVDA 3EC9A 3F7SA 3K7CA 1IVVA 1CYUA 3LOYA 1QALA 1UCLA 3KSED 1V57A 1WTHA 8RNTA 3RDEA 3EB8A 4CPKA 3CC43 5EVHA 5A0OB 1TRQA 3V98A 1K41A 2PZVA 1VQ73 1W4NA 2CKFB 2UX0A 4O2HA 3UJMA 3LTBA 3AGOA 1BNJA 1STFI 1FZUA 1W02A 1M1K4 3CD63 4XM4A 1IV9A 3WHOA 2XGNA 1WMPA 2AADA 3FH1A 5KP3A 3S28A 3WOEB 5BIRA 2WO0A 1R4CA 1B3SA 3FF2A 1ULJB 3KN4A 2RGQA 5JBSA 3FSDA 3NBJA 1BRJA 3EF8A 3T8NA 1JB2A 2R41A 1TUHA 2W04A 3PCSA 4HM6B 2OQEC 3CCJ3 1A2PA 1YHQ3 2XRXB 4J8TA 3CCQ3 4EV5A 3Q90A 1TFOA 1IQYA 1TTOA 1GS3A 2Y74A 3KFQC 1RGAA 3N54B 4RBNA 1BSDA 2RNTA 2BO9B 4K61A 4KFDA 5IEPA 1UCKA 1BUJA 1SPUA 3VF1A 3JUQA 3K5TA 4FMAA 4R9LA 1BNFA 3SOYA 5BXQA 3SYUA 3RGAA 2ZL8A 3LTCA 1RN1A 3BNBA 3B4PA 2LYXA 1NB5I 2Z76A 1A2VA 2I9WA 1OUNA 2JQ5A 3ALAA 3D79A 1RHLA 4GL6A 4MMXB 1IT8A 2GSPA 3OX9A 1K8A4 2P05A 4JRFA 4K90B 3STDA 3BIRA 5KP4A 1BGSA 2YX9A 2P38A 3X42A 4HKVB 1QMAA 2RCDA 5DRVA 3V92A 3D9RA 5RNTA 2MC8A 4FCMA 3WDGB 2GU3A 1RMSA 3GZRA 2QIYA 1UCIA 3MG3A 4BTYA 4N6OB 3I563 1JBTA 1YJW3 2FXTA 2LQVA 4IIAA 3BNEA 1B2UA 4MEIA 1JRQA 1RSNA 3X3ZA 2KF4A 3CME3 3AMOA 4ILFA 2KF3A 1MWSA 3K9MC 1RCKA 3NUVA 5DREA 5CLKA 2L1SA 1LNHA 4K1UA 5AIIA 3AMOB 4WYKA 1RN7A 3I553 1UUGB 2W6JH 3CPOA 3MG2A 2HMLB 5IF6A 3LH4A 3LXUX 5D83A 5G2GA 4I4KA 1VQM3 2OOVC 3KSPA 5CK6A 3NX0A 1SQWA 1W5ZA 4O02B 5I97A 1Q864 1RGHA 4XBTA 1UGIA 1JB4A 3PYJA 5BVBA 3BU4A 1GD3A 1IVWA 1LRAA 3JVCA 2P09A 1RGLA 5AIGA 1RGEA 3K63A 5STDA 3CCV3 1VQ63 4EYCA 1RNBA 2CG0A 2KRTA 2GBWB 1IQXA 1V74A 1O7HB 2HMOB 2KF6A 2BMOB 3QRDA 3FG4A 3VGNA 4H3UA 2W0QA 1FGOA 1FUSA 2C10A 1JB5A 2ML6A 2L4VA 2OWPA 5AEWB 9RNTA 1R4YA 3ECFA 3CNMA 2Z6BA 1T2HA 3NM2A 3I0YA 3MYTA 1WMNA 2E2TA 1I3IA 1UW1A 3LT9A 1EQKA 5BU4A 2CFKA 3HI7A 3EBTA 6GSPA 1LXEA 2IA7A 3UL6A 3HX8A 5AI1A 1CQSA 3T8UA 1CYVA 4U13A 1B2ZA 3X40A 3J7Yd 3WMDA 3OW22 3JUMA 1BOXA 1HKXA 4LSOA 3SOAA 5IEOA 3S67A 1VQN3 1VQ43 3EHCA 3CCM3 4HBRA 1O7NB 1RGCA 2E2VA 2ZA4A 2CK3H 2F5WA 4RNTA 3NV0A 2BIRA 4JF8A 4L8OA 1GYBA 3DGLA 2WOHA 3H3HA 1B27A 3OWUA 2F86B 3JUOA 3ZG0A 3EJVA 1YVSA 1IQ8A 1YJN3 4FMBA 1BNIA 2Q07A 2HOHA 1JN5A 4OVMA 1BRGA 1TIJA 2XF3A 3G4S3 1MOLA 7STDA 3WA3A 1QVG2 3FF0A 3NXJA 2C4BA 2GEYA 4AKZA 4WYKB 1G02A 1OCVA 2IYJA 1SIHA 4BL2A 1FGMA 5IG5A 1MGRA 1I0VA 2XH9A 4NHFA 4STDA 3A76A 4FMDA 4WP5A 3SX1A 2XSHB 5CXOA 1BRKA 3F14A 3GWRA 2K3DA 3D3LA 4I5QA 3FZWA 5AYSC 1IVUA 1L5GB 3NV0B 1JNQA 1C7HA 3VSYA 1VZZA 1UDII 4MJDA 5IENA 1K9M4 3DY5A 4WFOA 1RRLA 1JKGA 2YFLB 2YFIB 5IERA 3IJEB 2CHCA 1FUTA 1TJDA 1U5OA 1BSBA 3CXC2 3CC23 1JZDA 1QVF2 1B2XA 1RRHA 1LQMB 1PFPA 2CW9A 2BMRB 3CCR3 2Z77A 3G713 1QAFA 4R80A 1OH0A 2KAAA 3DGMA 2OQEA 3D4AA 2WGOA 4BL3A 1D6ZA 1UUVB 4X2OA 1Q814 5EQLA 1WNHA 2A15A 1HZ1A 3DUKA 3PGBA 5AEUB 3PZWA 4N6TA 1STDA 4AEQA 4LYLB 1N9JA 2Y73A 4FCJA 3EX9A 1WMOA 5HGRA 3AHSA 5ELUA 1OHPA 1W6YA 3IMAB 3WOFB 2HMMB 3CCE3 4XBYA 1AY7A 1LOXA 1A67A 5GSPA 2BU4A 3D5IA 1MWUA 2BHMA 2B1XB 3G8ZA 5LC7A 1UI7A 3LZAA 3LYGA 1GOYA 1ULIB 3F40A 4LEHA 3DMCA 3FG3A 1PY3A 1U8CB 3OV4A 1N8R4 3PS8A 5M1AA 1YJ93 2BT3A 2INXA 3TDGA 1RLSA 1QJGA 1ZGXA 4R1KA 1T5YA 1UI8A 3MSOA 4CDLA 1EUIC 1J2BA 3SXXA 2J8XB 2OCTA 4HVNA 3DGYA 2CC3A 2GXFA 1LQGC 2WGQA 3B4OA 4MMYB 2ZHXB 1HYFA 3EBYA 1VQK3 3LT8A 7GSPA 5IW9A 3CMA3 3HOHA 4HM4B 1DMMA 3B7CA 3EQQB 1AR0A 5FGOA 1LOYA 1RJOA 1E3RA 3MKIA 2RSXA 3MPHA 4J9AA 2F98A 2GU1A 3CC73 3DM8A 4J5GA 6STDA 1BNGA 1EA2A 1K734 2CG1A 2SARA 3AHWA 1OF5A 4G1MB 3JUNA 1NO3A 1W2ZA 3SVAA 4EW5A 5G1KA 1G96A 2CFLA 2W03A 1NDOB 2KXGA 5ELJA 1W7CA 1N8QA 1WQLB 3FCSB 1TP6A 4L7KA 1GD4A 1CH0A 1BANA 1X1WA 1LVNA 2F4YA 1VQP3 3DZLA 5KP1A 1M9GA 1M904 2FNQA 3K0ZA 4RNZA 1GMRA 1O7MB 1X1YA 4HYZA 1BRNL 2QGUA 4CCVA 1Q40A 1US1A 1RGKA 1X1UA 5JPUA 3HIIA 1AV4A 1N5PA 3SLUA 3DH2A 3UB1A
chains in the Genus database with same CATH topology
2M7OA 3CCU3 2K0MA 4O8SA 4EV2A 3MWZA 1D6UA 5AYRB 4EXRA 2OTJ3 5IG4A 4IPBA 1GY5A 1ROVA 1S5AA 1Q7Y4 2P0MA 1OACA 2XGLA 3NHXA 4OUQA 3Q2PA 2FGTA 1DMNA 4Q53A 3DGOA 4XB5A 3BNCA 4ZM8A 3MHEA 2BNGA 1BUQA 1OF5B 2Z7AA 3KIIA 4BTXA 1ROAA 3ROBA 3CU3A 1OGXA 4HZ9B 3GZYB 2E2UA 2XR8B 2XFTA 4PEJA 4XBXA 1VQL3 1YIJ3 3BLZA 2CH9A 2V1LA 3UNLA 5IG0A 2CIUA 2JDIH 4N6LA 5D82A 5JPPA 3U1WA 1IDPA 1ZX2A 2IUKA 1ASKA 3EN8A 1NB3I 4FCZA 3S27A 4O3VA 1KSIA 1F8NA 5FW5A 4H61A 1JKGB 4FMCA 1QAKA 2HMNB 3OWSA 4QWTA 3G6E3 1VQ83 5EEOA 2ML5A 1YI23 2SBLA 3CNXA 3KZTA 2CWUA 3GAXA 3FKAA 1FGTA 1SJWA 4RZMA 3FGYA 3F7XA 3PCRA 3MG1A 3N9HA 3NBRA 4WWUC 3QK9A 2W9PA 1KC84 1IVXA 3FLJA 1NJI4 4X2HA 1EKMA 3SEDA 1NWWA 3L0RA 2D1WA 3IPTA 1M1XB 1W2B2 2MF7A 1ISKA 2HMKB 1AVLA 3X3XA 3WODG 3NBBA 1KQS2 4KZ1A 3CCL3 2W56A 1W6GA 4HM5B 5CF1A 3LTDA 1W01A 3GZBA 2YFJB 2IUJA 1Q42A 2KCDA 2W56B 4N6UA 5AIFA 1IU7A 2CFWA 2CFGA 5CF2A 3S5CA 1IT7A 3DGNA 1GY7A 4R4KA 1Q40B 3CCS3 2CFDA 2OOVA 1PU4A 4N3VA 3GZXB 3F8XA 1RKYA 1UUWB 2C11A 1OPYA 1AVKA 1ZO2A 2O3OA 4AKYA 1E97A 1K28A 4RNYA 2STDA 3OXAA 3NM7A 3Q1CA 2QA43 3OWYA 2P0XA 3UL5A 3NQYA 3E99A 4XDWA 1O7PB 3H51A 4LGQA 3EE1A 1JN5B 8CHOA 1KD14 4ORLA 1DVCA 2B24B 1E3VA 2QEX3 2RFRA 3HZPA 3O8YA 4LMIA 3NQZA 3X41A 4N6MA 3N8BA 3T0UA 5TGNA 3WA2X 5AIHA 5LC6A 3V99A 1FGRA 3LTAA 2GBXB 1YVBI 2WOFA 1FGQA 4GB5A 3S29A 3GRDA 1DMQA 1DYUA 3HIGA 3G0KA 4WHAA 1S723 1OGZA 2O9UX 4NREA 1O7WB 4HZBB 1NU3A 4EC6A 4R9KA 3F9SA 4HM1B 3B8LA 4BTWA 1EG9B 3M8CA 4HJLB 4KVHA 2CWTA 4KFEA 1OHSA 4HM3B 2CWVA 1GY6A 2GEXA 3DXOA 1O7GB 1HU9A 1JJ22 3G16A 1VQ93 1MNLA 4L8PA 2ZDJA 2K54A 2W9QA 1N5HA 2OTL3 1SIIA 3ER7A 1N9EA 3X3YA 4KFFA 1IK3A 4N6V0 4FR9A 5D81A 4HM2B 4HM7B 3BNDA 2W2CA 2HMJB 2XEPA 4XDVA 4EBGA 5IG3A 1VQO3 1D6YA 4K1VA 1CEWI 1A90A 2PNCA 4LZIA 1YIT3 3HK4A 1YGEA 1W6CA 4HM8B 2IMJA 3RGRA 2XFSA 1Z1SA 1JV2B 3BB9A 1FA3A 3FG1A 3F8HA 4TX4A 1Y4KA 1TFKA 4HM0B 2XSOB 2D42A 3JUPA 3KKGA 3PXMA 1Q824 3U97A 3KE7A 3EN1B 4IT7A 1KWIA 4MMZB 1TU5A 1IV7A 4OK0A 1OHOA 1W00A 2BMQB 3LMLA 2F99A 3CPW2 1VQ53 2R4IA 1A2KA 4N6NB 1DVDA 3EC9A 3F7SA 3K7CA 1IVVA 3LOYA 1QALA 3KSED 1WTHA 3RDEA 3EB8A 3CC43 5EVHA 5A0OB 3V98A 1K41A 2PZVA 1VQ73 1W4NA 2CKFB 2UX0A 4O2HA 3UJMA 3LTBA 1STFI 1W02A 1M1K4 3CD63 4XM4A 1IV9A 2XGNA 1WMPA 3FH1A 5KP3A 3S28A 3WOEB 2WO0A 1R4CA 3FF2A 3KN4A 1ULJB 2RGQA 5JBSA 3FSDA 3NBJA 3EF8A 3T8NA 1JB2A 2W04A 1TUHA 4HM6B 3PCSA 3CCJ3 2OQEC 1YHQ3 2XRXB 4J8TA 3CCQ3 4EV5A 3Q90A 1TFOA 1IQYA 1GS3A 2Y74A 3KFQC 3N54B 4RBNA 2BO9B 4K61A 4KFDA 5IEPA 1SPUA 3VF1A 3JUQA 3K5TA 4FMAA 4R9LA 3SOYA 5BXQA 3RGAA 2ZL8A 3LTCA 3BNBA 3B4PA 2LYXA 1NB5I 2Z76A 1A2VA 2I9WA 1OUNA 2JQ5A 3ALAA 4GL6A 4MMXB 1IT8A 3OX9A 1K8A4 2P05A 4JRFA 4K90B 3STDA 5KP4A 2YX9A 2P38A 3X42A 4HKVB 1QMAA 2RCDA 5DRVA 3V92A 3D9RA 2MC8A 4FCMA 3WDGB 2GU3A 3GZRA 3MG3A 2QIYA 4BTYA 3I563 4N6OB 1YJW3 2FXTA 2LQVA 4IIAA 3BNEA 4MEIA 1JRQA 3X3ZA 3CME3 3AMOA 3K9MC 3NUVA 5DREA 5CLKA 1LNHA 4K1UA 5AIIA 3AMOB 4WYKA 1RN7A 3I553 2W6JH 3CPOA 3MG2A 2HMLB 5IF6A 3LH4A 3LXUX 5D83A 5G2GA 4I4KA 1VQM3 2OOVC 3KSPA 5CK6A 3NX0A 1SQWA 1W5ZA 4O02B 5I97A 1Q864 4XBTA 1JB4A 3PYJA 5BVBA 1GD3A 1IVWA 3JVCA 2P09A 5AIGA 3CCV3 3K63A 5STDA 1VQ63 4EYCA 2CG0A 2KRTA 2GBWB 1IQXA 1V74A 1O7HB 2HMOB 2BMOB 3QRDA 3FG4A 3VGNA 4H3UA 2W0QA 1FGOA 2C10A 1JB5A 2ML6A 2L4VA 2OWPA 5AEWB 3ECFA 3CNMA 2Z6BA 3NM2A 3I0YA 3MYTA 1WMNA 2E2TA 1UW1A 3LT9A 1EQKA 2CFKA 3HI7A 3EBTA 1LXEA 2IA7A 3UL6A 3HX8A 5AI1A 1CQSA 3T8UA 1CYVA 4U13A 3X40A 3J7Yd 3WMDA 3OW22 3JUMA 1HKXA 4LSOA 3SOAA 5IEOA 3S67A 1VQN3 1VQ43 3EHCA 3CCM3 4HBRA 1O7NB 2E2VA 2CK3H 3NV0A 4JF8A 4L8OA 1GYBA 3DGLA 2WOHA 3H3HA 3OWUA 2F86B 3JUOA 3EJVA 1IQ8A 4FMBA 2Q07A 4OVMA 1JN5A 1TIJA 2XF3A 3G4S3 1MOLA 7STDA 3WA3A 1QVG2 3FF0A 3NXJA 2GEYA 4AKZA 4WYKB 1OCVA 5IG5A 1FUWA 1SIHA 1FGMA 1CYUA 2XH9A 4NHFA 4STDA 3A76A 4FMDA 4WP5A 3SX1A 2XSHB 5CXOA 3F14A 3GWRA 3D3LA 5AYSC 1L5GB 3FZWA 1IVUA 3NV0B 1JNQA 1C7HA 3VSYA 1VZZA 4MJDA 5IENA 1K9M4 3DY5A 4WFOA 1RRLA 2YFLB 1JKGA 2YFIB 5IERA 3IJEB 2CHCA 1U5OA 3CC23 3CXC2 1QVF2 1RRHA 1PFPA 2CW9A 2BMRB 3CCR3 2Z77A 3G713 1QAFA 4R80A 1OH0A 3DGMA 2OQEA 2WGOA 1D6ZA 1UUVB 4X2OA 1Q814 5EQLA 1WNHA 2A15A 3DUKA 3PGBA 5AEUB 3PZWA 4N6TA 1STDA 4AEQA 1N9JA 2Y73A 4FCJA 3EX9A 1WMOA 5HGRA 5ELUA 1OHPA 1W6YA 3IMAB 3WOFB 2HMMB 3CCE3 4XBYA 1A67A 1LOXA 3G8ZA 2BHMA 2B1XB 5LC7A 1UI7A 3LZAA 3LYGA 1ULIB 3F40A 4LEHA 3DMCA 3FG3A 1U8CB 3OV4A 1N8R4 3PS8A 1YJ93 2BT3A 2INXA 3TDGA 1QJGA 4R1KA 1T5YA 1UI8A 3MSOA 4CDLA 1J2BA 3SXXA 2OCTA 4HVNA 2CC3A 2GXFA 2WGQA 3B4OA 4MMYB 3EBYA 1VQK3 3LT8A 5IW9A 3CMA3 4HM4B 1DMMA 3B7CA 3EQQB 1AR0A 5FGOA 1RJOA 1E3RA 3MKIA 2RSXA 3MPHA 4J9AA 2F98A 2GU1A 3CC73 3DM8A 6STDA 1EA2A 2CG1A 1OF5A 4G1MB 3JUNA 1NO3A 1W2ZA 3SVAA 1G96A 2CFLA 2W03A 1NDOB 2KXGA 5ELJA 1W7CA 1N8QA 1WQLB 3FCSB 1TP6A 4L7KA 1GD4A 1YJN3 1K734 1LVNA 1VQP3 3DZLA 5KP1A 1M9GA 1M904 2FNQA 3K0ZA 4RNZA 1O7MB 4HYZA 2QGUA 4CCVA 1Q40A 1US1A 5JPUA 3HIIA 1AV4A 1N5PA 3SLUA 3UB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJV A;  3Q90 A;  2RFR A;  3HZP A;  4LMI A;  1GS3 A;  4OVM A;  1JN5 A;  5TGN A;  5IEP A;  5AIH A;  5IG4 A;  7STD A;  3FF0 A;  1GY5 A;  3JUQ A;  3NXJ A;  3SOY A;  1S5A A;  4R9L A;  2GBX B;  5BXQ A;  2GEY A;  5IG5 A;  4WYK B;  1OCV A;  3RGA A;  3NHX A;  4GB5 A;  4OUQ A;  3GRD A;  3B4P A;  1DMQ A;  1DMN A;  3A76 A;  4Q53 A;  4STD A;  4WP5 A;  2XSH B;  3G0K A;  5CXO A;  4XB5 A;  2Z76 A;  3F14 A;  1OGZ A;  2I9W A;  1OUN A;  3GWR A;  2JQ5 A;  3FZW A;  4HZ9 B;  1O7W B;  4HZB B;  1NU3 A;  3NV0 B;  3MHE A;  2BNG A;  1ISK A;  1C7H A;  3OX9 A;  1VZZ A;  4MJD A;  1OF5 B;  3F9S A;  4HM1 B;  4R9K A;  3VSY A;  1BUQ A;  5IEN A;  3STD A;  5KP4 A;  2Z7A A;  3B8L A;  1EG9 B;  3M8C A;  4HJL B;  3CU3 A;  4KVH A;  3ROB A;  1JKG A;  1OGX A;  1QMA A;  1OHS A;  2RCD A;  2YFI B;  2XR8 B;  2YFL B;  3GZY B;  1GY6 A;  2CHC A;  2GEX A;  3D9R A;  4HM3 B;  4XBX A;  3DXO A;  1U5O A;  1O7G B;  3BLZ A;  4FCM A;  3UNL A;  3G16 A;  3GZR A;  5IG0 A;  3MG3 A;  2QIY A;  4L8P A;  2K54 A;  5D82 A;  5JPP A;  2BMR B;  4IIA A;  1IDP A;  1ZX2 A;  2Z77 A;  1ASK A;  3EN8 A;  3ER7 A;  1OH0 A;  1E3V A;  3NUV A;  5DRE A;  5CLK A;  5FW5 A;  5D81 A;  1UUV B;  4X2O A;  4HM2 B;  4HM7 B;  1JKG B;  4K1U A;  4WYK A;  2A15 A;  5AII A;  2HMN B;  2W2C A;  3DUK A;  3OWS A;  2HMJ B;  5AEU B;  4HKV B;  4XDV A;  5IG3 A;  3MG2 A;  3CPO A;  1STD A;  2HML B;  5IF6 A;  4K1V A;  5D83 A;  4FCJ A;  5G2G A;  3EX9 A;  3CNX A;  3KZT A;  4I4K A;  5HGR A;  3FKA A;  3KSP A;  1OHP A;  5CK6 A;  1SJW A;  1W6Y A;  4RZM A;  2HMM B;  3FGY A;  3F7X A;  4XBY A;  3MG1 A;  3HK4 A;  4XBT A;  1JB4 A;  3G8Z A;  3NBR A;  4WWU C;  5BVB A;  2B1X B;  4HM8 B;  2IMJ A;  3LZA A;  3LYG A;  3RGR A;  1ULI B;  3F40 A;  1Z1S A;  3BB9 A;  3FLJ A;  3DMC A;  3OV4 A;  4LEH A;  4X2H A;  5DRV A;  3SED A;  1NWW A;  5AIG A;  3F8H A;  3IPT A;  5STD A;  2INX A;  1QJG A;  4R1K A;  4CDL A;  4HM0 B;  2XSO B;  3JUP A;  2GBW B;  3KKG A;  3MSO A;  2HMK B;  4HVN A;  5IER A;  2GXF A;  1O7H B;  3B4O A;  2HMO B;  3KE7 A;  3EN1 B;  4PEJ A;  2BMO B;  3EBY A;  3VGN A;  4H3U A;  4HM5 B;  5CF1 A;  1W01 A;  3GZB A;  1OHO A;  1W00 A;  2BMQ B;  2YFJ B;  4HM4 B;  1JB5 A;  1DMM A;  2F99 A;  2OWP A;  1Q42 A;  3B7C A;  5AEW B;  2R4I A;  1A2K A;  3ECF A;  1AR0 A;  3EQQ B;  5AIF A;  3CNM A;  3MKI A;  1E3R A;  3EC9 A;  4J9A A;  3NM2 A;  2F98 A;  3F7S A;  3K7C A;  5CF2 A;  3I0Y A;  3MYT A;  3DM8 A;  3S5C A;  6STD A;  1EA2 A;  1GY7 A;  1Q40 B;  3EBT A;  4N3V A;  5EVH A;  1OF5 A;  3HX8 A;  3JUN A;  3GZX B;  3F8X A;  5AI1 A;  1UUW B;  1CQS A;  3T8U A;  1OPY A;  4U13 A;  1K41 A;  1ZO2 A;  1NDO B;  2PZV A;  2CKF B;  2UX0 A;  3UJM A;  3WMD A;  3JUM A;  1E97 A;  1HKX A;  1W02 A;  3SOA A;  2STD A;  3OXA A;  5IEO A;  1WQL B;  4XM4 A;  1TP6 A;  4L7K A;  3EHC A;  3FH1 A;  3OWY A;  5KP3 A;  1O7N B;  3DZL A;  5KP1 A;  3E99 A;  3FF2 A;  1ULJ B;  3K0Z A;  1O7P B;  3H51 A;  4LGQ A;  4XDW A;  2RGQ A;  1O7M B;  3FSD A;  2QGU A;  3EF8 A;  1JN5 B;  1Q40 A;  3NV0 A;  4L8O A;  3T8N A;  1JB2 A;  8CHO A;  1TUH A;  4HM6 B;  4ORL A;  1GYB A;  5JPU A;  3H3H A;  3OWU A;  2B24 B;  2XRX B;  2F86 B;  4J8T A;  3JUO A; 
#chains in the Genus database with same CATH topology
 2M7O A;  3CCU 3;  2K0M A;  4O8S A;  4EV2 A;  3MWZ A;  1D6U A;  2H0H A;  5AYR B;  3ZFZ A;  1Q9E A;  4EXR A;  2OTJ 3;  5IG4 A;  4IPB A;  6RNT A;  1B21 A;  1GY5 A;  1ROV A;  1S5A A;  1Q7Y 4;  2P0M A;  1OAC A;  2XGL A;  3NHX A;  4OUQ A;  3Q2P A;  2F5M A;  1NNV A;  1DMN A;  2FGT A;  2RBI A;  4Q53 A;  3DGO A;  3RNT A;  4BU4 A;  1FW7 A;  4XB5 A;  5M18 A;  3BNC A;  4ZM8 A;  3MHE A;  2BNG A;  1BUQ A;  1OF5 B;  4HOH A;  1BNR A;  2Z7A A;  3KII A;  4BTX A;  1ROA A;  3ROB A;  1BNS A;  3CU3 A;  1OGX A;  4HZ9 B;  3GZY B;  2E2U A;  2XR8 B;  2XFT A;  1T2I A;  4PEJ A;  1I2E A;  1GMP A;  4XBX A;  1VQL 3;  1YIJ 3;  1X1X A;  1GOV A;  3BLZ A;  2CH9 A;  2V1L A;  3D5G A;  3UNL A;  5IG0 A;  2CIU A;  1I2G A;  3KCH A;  2JDI H;  4N6L A;  1Q7H A;  5D82 A;  5JPP A;  3U1W A;  1BNE A;  1IDP A;  1ZX2 A;  2IUK A;  1ASK A;  3EN8 A;  1NB3 I;  4FCZ A;  3S27 A;  4BIR A;  4O3V A;  1KSI A;  1F8N A;  2F56 A;  5FW5 A;  1JBR A;  4H61 A;  1B20 A;  1JKG B;  1ZS7 A;  4FMC A;  1QAK A;  2HMN B;  3OWS A;  4QWT A;  3G6E 3;  1FUW A;  1VQ8 3;  3A5E A;  2ML5 A;  5EEO A;  1YI2 3;  2SBL A;  3CNX A;  3KZT A;  1FYS A;  1V58 A;  2CWU A;  2UUG C;  3FKA A;  3GAX A;  1JBS A;  1FGT A;  1I0X A;  1SJW A;  5HOH A;  4GSP A;  4RZM A;  3FGY A;  3F7X A;  2H0G A;  3PCR A;  3MG1 A;  2H0I A;  3N9H A;  3NBR A;  4WWU C;  3QK9 A;  4DKI A;  2W9P A;  1UGH I;  1KC8 4;  1IVX A;  3FLJ A;  1NJI 4;  4X2H A;  1EKM A;  3SED A;  1BRS A;  1NWW A;  2D1W A;  3L0R A;  3IPT A;  1M1X B;  1I2F A;  1G0T A;  1W2B 2;  2MF7 A;  1ISK A;  3WR2 A;  1BAO A;  1AVL A;  1GOU A;  1LNI A;  2HMK B;  3WOD G;  3X3X A;  1BU4 A;  1MWR A;  3NBB A;  4KZ1 A;  3CCL 3;  1KQS 2;  1LOV A;  2W56 A;  1PYL A;  1BSE A;  1W6G A;  4HM5 B;  5CF1 A;  3LTD A;  1W01 A;  3GZB A;  1MGW A;  2YFJ B;  1TRP A;  2IUJ A;  1Q42 A;  1BRH A;  2KCD A;  1I3F A;  2W56 B;  4N6U A;  5AIF A;  1IU7 A;  2CFW A;  2CFG A;  5CF2 A;  3S5C A;  1IT7 A;  3DGN A;  5G1L A;  1GY7 A;  4CJN A;  1DE3 A;  4R4K A;  1Q40 B;  3CCS 3;  1VQQ A;  2CFD A;  2OOV A;  1PU4 A;  1GMQ A;  4N3V A;  3GZX B;  3F8X A;  1RKY A;  1UUW B;  2C11 A;  1OPY A;  1AVK A;  1ZO2 A;  3GSP A;  2O3O A;  4AKY A;  1E97 A;  1K28 A;  1UCJ A;  4RNY A;  2STD A;  3OXA A;  2CX1 A;  3NM7 A;  3Q1C A;  2QA4 3;  3OWY A;  2P0X A;  3UL5 A;  3NQY A;  3E99 A;  4XDW A;  1BRI A;  1O7P B;  3H51 A;  4LGQ A;  4HAA A;  3EE1 A;  1JN5 B;  3AGN A;  8CHO A;  1KD1 4;  4ORL A;  1DVC A;  1I8V A;  1GSP A;  1B2M A;  2B24 B;  1E3V A;  2QEX 3;  2CX0 A;  4KT3 B;  1YNV X;  2RFR A;  3HZP A;  3O8Y A;  4LMI A;  3NQZ A;  3X41 A;  4N6M A;  3N8B A;  2AAE A;  5TGN A;  3T0U A;  3WA2 X;  5AIH A;  5LC6 A;  3V99 A;  4NPB A;  1FGR A;  3LTA A;  2GBX B;  1YVB I;  2WOF A;  1FGQ A;  4GB5 A;  3S29 A;  3GRD A;  1DMQ A;  1DYU A;  4J5K A;  3HIG A;  3G0K A;  4WHA A;  1S72 3;  1OGZ A;  2O9U X;  4NRE A;  1O7W B;  4HZB B;  1NU3 A;  4EC6 A;  3URP A;  1RGF A;  4GHO A;  4R9K A;  1T3B A;  3F9S A;  4HM1 B;  3B8L A;  4BTW A;  1EG9 B;  3M8C A;  4HJL B;  4KVH A;  2CWT A;  4KFE A;  1YGW A;  1OHS A;  4HM3 B;  1RCL A;  1GY6 A;  2CWV A;  2GEX A;  3DXO A;  1O7G B;  1HU9 A;  1AQZ A;  2KF5 A;  3G16 A;  1JJ2 2;  1VQ9 3;  1RTU A;  1MNL A;  1MWT A;  1RDS A;  4L8P A;  2ZDJ A;  2K54 A;  1BVI A;  1RNT A;  1N5H A;  2W9Q A;  2OTL 3;  1SII A;  1BSA A;  1N9E A;  3ER7 A;  3X3Y A;  4KFF A;  1C54 A;  1IK3 A;  4N6V 0;  1I70 A;  4FR9 A;  5D81 A;  4HM2 B;  4HM7 B;  3BND A;  2W2C A;  1BIR A;  2HMJ B;  5M19 A;  2XEP A;  4XDV A;  4EBG A;  1DET A;  5IG3 A;  1VQO 3;  1D6Y A;  4K1V A;  1CEW I;  1A90 A;  3ZG5 A;  1RGG A;  1EEJ A;  2PNC A;  2UGI A;  4LZI A;  7RNT A;  1IYY A;  1YIT 3;  3HK4 A;  1YGE A;  1W6C A;  4HM8 B;  2IMJ A;  3RGR A;  2XFS A;  1Z1S A;  1JV2 B;  3BB9 A;  1FA3 A;  3FG1 A;  3F8H A;  4TX4 A;  3Q3F A;  1Y4K A;  1TFK A;  1SAR A;  2IY2 A;  2XSO B;  2D42 A;  3JUP A;  3KKG A;  1BSC A;  3PXM A;  4HM0 B;  3U97 A;  1Q82 4;  3KE7 A;  3EN1 B;  1RN4 A;  4IT7 A;  1KWI A;  1LOW A;  1JZO A;  4MMZ B;  1TU5 A;  1IV7 A;  4OK0 A;  1OHO A;  1W00 A;  2BMQ B;  3LML A;  2F99 A;  3CPW 2;  1VQ5 3;  2R4I A;  1A2K A;  1B2S A;  4N6N B;  1DVD A;  3EC9 A;  3F7S A;  3K7C A;  1IVV A;  1CYU A;  3LOY A;  1QAL A;  1UCL A;  3KSE D;  1V57 A;  1WTH A;  8RNT A;  3RDE A;  3EB8 A;  4CPK A;  3CC4 3;  5EVH A;  5A0O B;  1TRQ A;  3V98 A;  1K41 A;  2PZV A;  1VQ7 3;  1W4N A;  2CKF B;  2UX0 A;  4O2H A;  3UJM A;  3LTB A;  3AGO A;  1BNJ A;  1STF I;  1FZU A;  1W02 A;  1M1K 4;  3CD6 3;  4XM4 A;  1IV9 A;  3WHO A;  2XGN A;  1WMP A;  2AAD A;  3FH1 A;  5KP3 A;  3S28 A;  3WOE B;  5BIR A;  2WO0 A;  1R4C A;  1B3S A;  3FF2 A;  1ULJ B;  3KN4 A;  2RGQ A;  5JBS A;  3FSD A;  3NBJ A;  1BRJ A;  3EF8 A;  3T8N A;  1JB2 A;  2R41 A;  1TUH A;  2W04 A;  3PCS A;  4HM6 B;  2OQE C;  3CCJ 3;  1A2P A;  1YHQ 3;  2XRX B;  4J8T A;  3CCQ 3;  4EV5 A;  3Q90 A;  1TFO A;  1IQY A;  1TTO A;  1GS3 A;  2Y74 A;  3KFQ C;  1RGA A;  3N54 B;  4RBN A;  1BSD A;  2RNT A;  2BO9 B;  4K61 A;  4KFD A;  5IEP A;  1UCK A;  1BUJ A;  1SPU A;  3VF1 A;  3JUQ A;  3K5T A;  4FMA A;  4R9L A;  1BNF A;  3SOY A;  5BXQ A;  3SYU A;  3RGA A;  2ZL8 A;  3LTC A;  1RN1 A;  3BNB A;  3B4P A;  2LYX A;  1NB5 I;  2Z76 A;  1A2V A;  2I9W A;  1OUN A;  2JQ5 A;  3ALA A;  3D79 A;  1RHL A;  4GL6 A;  4MMX B;  1IT8 A;  2GSP A;  3OX9 A;  1K8A 4;  2P05 A;  4JRF A;  4K90 B;  3STD A;  3BIR A;  5KP4 A;  1BGS A;  2YX9 A;  2P38 A;  3X42 A;  4HKV B;  1QMA A;  2RCD A;  5DRV A;  3V92 A;  3D9R A;  5RNT A;  2MC8 A;  4FCM A;  3WDG B;  2GU3 A;  1RMS A;  3GZR A;  2QIY A;  1UCI A;  3MG3 A;  4BTY A;  4N6O B;  3I56 3;  1JBT A;  1YJW 3;  2FXT A;  2LQV A;  4IIA A;  3BNE A;  1B2U A;  4MEI A;  1JRQ A;  1RSN A;  3X3Z A;  2KF4 A;  3CME 3;  3AMO A;  4ILF A;  2KF3 A;  1MWS A;  3K9M C;  1RCK A;  3NUV A;  5DRE A;  5CLK A;  2L1S A;  1LNH A;  4K1U A;  5AII A;  3AMO B;  4WYK A;  1RN7 A;  3I55 3;  1UUG B;  2W6J H;  3CPO A;  3MG2 A;  2HML B;  5IF6 A;  3LH4 A;  3LXU X;  5D83 A;  5G2G A;  4I4K A;  1VQM 3;  2OOV C;  3KSP A;  5CK6 A;  3NX0 A;  1SQW A;  1W5Z A;  4O02 B;  5I97 A;  1Q86 4;  1RGH A;  4XBT A;  1UGI A;  1JB4 A;  3PYJ A;  5BVB A;  3BU4 A;  1GD3 A;  1IVW A;  1LRA A;  3JVC A;  2P09 A;  1RGL A;  5AIG A;  1RGE A;  3K63 A;  5STD A;  3CCV 3;  1VQ6 3;  4EYC A;  1RNB A;  2CG0 A;  2KRT A;  2GBW B;  1IQX A;  1V74 A;  1O7H B;  2HMO B;  2KF6 A;  2BMO B;  3QRD A;  3FG4 A;  3VGN A;  4H3U A;  2W0Q A;  1FGO A;  1FUS A;  2C10 A;  1JB5 A;  2ML6 A;  2L4V A;  2OWP A;  5AEW B;  9RNT A;  1R4Y A;  3ECF A;  3CNM A;  2Z6B A;  1T2H A;  3NM2 A;  3I0Y A;  3MYT A;  1WMN A;  2E2T A;  1I3I A;  1UW1 A;  3LT9 A;  1EQK A;  5BU4 A;  2CFK A;  3HI7 A;  3EBT A;  6GSP A;  1LXE A;  2IA7 A;  3UL6 A;  3HX8 A;  5AI1 A;  1CQS A;  3T8U A;  1CYV A;  4U13 A;  1B2Z A;  3X40 A;  3J7Y d;  3WMD A;  3OW2 2;  3JUM A;  1BOX A;  1HKX A;  4LSO A;  3SOA A;  5IEO A;  3S67 A;  1VQN 3;  1VQ4 3;  3EHC A;  3CCM 3;  4HBR A;  1O7N B;  1RGC A;  2E2V A;  2ZA4 A;  2CK3 H;  2F5W A;  4RNT A;  3NV0 A;  2BIR A;  4JF8 A;  4L8O A;  1GYB A;  3DGL A;  2WOH A;  3H3H A;  1B27 A;  3OWU A;  2F86 B;  3JUO A;  3ZG0 A;  3EJV A;  1YVS A;  1IQ8 A;  1YJN 3;  4FMB A;  1BNI A;  2Q07 A;  2HOH A;  1JN5 A;  4OVM A;  1BRG A;  1TIJ A;  2XF3 A;  3G4S 3;  1MOL A;  7STD A;  3WA3 A;  1QVG 2;  3FF0 A;  3NXJ A;  2C4B A;  2GEY A;  4AKZ A;  4WYK B;  1G02 A;  1OCV A;  2IYJ A;  1SIH A;  4BL2 A;  1FGM A;  5IG5 A;  1MGR A;  1I0V A;  2XH9 A;  4NHF A;  4STD A;  3A76 A;  4FMD A;  4WP5 A;  3SX1 A;  2XSH B;  5CXO A;  1BRK A;  3F14 A;  3GWR A;  2K3D A;  3D3L A;  4I5Q A;  3FZW A;  5AYS C;  1IVU A;  1L5G B;  3NV0 B;  1JNQ A;  1C7H A;  3VSY A;  1VZZ A;  1UDI I;  4MJD A;  5IEN A;  1K9M 4;  3DY5 A;  4WFO A;  1RRL A;  1JKG A;  2YFL B;  2YFI B;  5IER A;  3IJE B;  2CHC A;  1FUT A;  1TJD A;  1U5O A;  1BSB A;  3CXC 2;  3CC2 3;  1JZD A;  1QVF 2;  1B2X A;  1RRH A;  1LQM B;  1PFP A;  2CW9 A;  2BMR B;  3CCR 3;  2Z77 A;  3G71 3;  1QAF A;  4R80 A;  1OH0 A;  2KAA A;  3DGM A;  2OQE A;  3D4A A;  2WGO A;  4BL3 A;  1D6Z A;  1UUV B;  4X2O A;  1Q81 4;  5EQL A;  1WNH A;  2A15 A;  1HZ1 A;  3DUK A;  3PGB A;  5AEU B;  3PZW A;  4N6T A;  1STD A;  4AEQ A;  4LYL B;  1N9J A;  2Y73 A;  4FCJ A;  3EX9 A;  1WMO A;  5HGR A;  3AHS A;  5ELU A;  1OHP A;  1W6Y A;  3IMA B;  3WOF B;  2HMM B;  3CCE 3;  4XBY A;  1AY7 A;  1LOX A;  1A67 A;  5GSP A;  2BU4 A;  3D5I A;  1MWU A;  2BHM A;  2B1X B;  3G8Z A;  5LC7 A;  1UI7 A;  3LZA A;  3LYG A;  1GOY A;  1ULI B;  3F40 A;  4LEH A;  3DMC A;  3FG3 A;  1PY3 A;  1U8C B;  3OV4 A;  1N8R 4;  3PS8 A;  5M1A A;  1YJ9 3;  2BT3 A;  2INX A;  3TDG A;  1RLS A;  1QJG A;  1ZGX A;  4R1K A;  1T5Y A;  1UI8 A;  3MSO A;  4CDL A;  1EUI C;  1J2B A;  3SXX A;  2J8X B;  2OCT A;  4HVN A;  3DGY A;  2CC3 A;  2GXF A;  1LQG C;  2WGQ A;  3B4O A;  4MMY B;  2ZHX B;  1HYF A;  3EBY A;  1VQK 3;  3LT8 A;  7GSP A;  5IW9 A;  3CMA 3;  3HOH A;  4HM4 B;  1DMM A;  3B7C A;  3EQQ B;  1AR0 A;  5FGO A;  1LOY A;  1RJO A;  1E3R A;  3MKI A;  2RSX A;  3MPH A;  4J9A A;  2F98 A;  2GU1 A;  3CC7 3;  3DM8 A;  4J5G A;  6STD A;  1BNG A;  1EA2 A;  1K73 4;  2CG1 A;  2SAR A;  3AHW A;  1OF5 A;  4G1M B;  3JUN A;  1NO3 A;  1W2Z A;  3SVA A;  4EW5 A;  5G1K A;  1G96 A;  2CFL A;  2W03 A;  1NDO B;  2KXG A;  5ELJ A;  1W7C A;  1N8Q A;  1WQL B;  3FCS B;  1TP6 A;  4L7K A;  1GD4 A;  1CH0 A;  1BAN A;  1X1W A;  1LVN A;  2F4Y A;  1VQP 3;  3DZL A;  5KP1 A;  1M9G A;  1M90 4;  2FNQ A;  3K0Z A;  4RNZ A;  1GMR A;  1O7M B;  1X1Y A;  4HYZ A;  1BRN L;  2QGU A;  4CCV A;  1Q40 A;  1US1 A;  1RGK A;  1X1U A;  5JPU A;  3HII A;  1AV4 A;  1N5P A;  3SLU A;  3DH2 A;  3UB1 A; 
#chains in the Genus database with same CATH homology
 2M7O A;  3CCU 3;  2K0M A;  4O8S A;  4EV2 A;  3MWZ A;  1D6U A;  5AYR B;  4EXR A;  2OTJ 3;  5IG4 A;  4IPB A;  1GY5 A;  1ROV A;  1S5A A;  1Q7Y 4;  2P0M A;  1OAC A;  2XGL A;  3NHX A;  4OUQ A;  3Q2P A;  2FGT A;  1DMN A;  4Q53 A;  3DGO A;  4XB5 A;  3BNC A;  4ZM8 A;  3MHE A;  2BNG A;  1BUQ A;  1OF5 B;  2Z7A A;  3KII A;  4BTX A;  1ROA A;  3ROB A;  3CU3 A;  1OGX A;  4HZ9 B;  3GZY B;  2E2U A;  2XR8 B;  2XFT A;  4PEJ A;  4XBX A;  1VQL 3;  1YIJ 3;  3BLZ A;  2CH9 A;  2V1L A;  3UNL A;  5IG0 A;  2CIU A;  2JDI H;  4N6L A;  5D82 A;  5JPP A;  3U1W A;  1IDP A;  1ZX2 A;  2IUK A;  1ASK A;  3EN8 A;  1NB3 I;  4FCZ A;  3S27 A;  4O3V A;  1KSI A;  1F8N A;  5FW5 A;  4H61 A;  1JKG B;  4FMC A;  1QAK A;  2HMN B;  3OWS A;  4QWT A;  3G6E 3;  1VQ8 3;  5EEO A;  2ML5 A;  1YI2 3;  2SBL A;  3CNX A;  3KZT A;  2CWU A;  3GAX A;  3FKA A;  1FGT A;  1SJW A;  4RZM A;  3FGY A;  3F7X A;  3PCR A;  3MG1 A;  3N9H A;  3NBR A;  4WWU C;  3QK9 A;  2W9P A;  1KC8 4;  1IVX A;  3FLJ A;  1NJI 4;  4X2H A;  1EKM A;  3SED A;  1NWW A;  3L0R A;  2D1W A;  3IPT A;  1M1X B;  1W2B 2;  2MF7 A;  1ISK A;  2HMK B;  1AVL A;  3X3X A;  3WOD G;  3NBB A;  1KQS 2;  4KZ1 A;  3CCL 3;  2W56 A;  1W6G A;  4HM5 B;  5CF1 A;  3LTD A;  1W01 A;  3GZB A;  2YFJ B;  2IUJ A;  1Q42 A;  2KCD A;  2W56 B;  4N6U A;  5AIF A;  1IU7 A;  2CFW A;  2CFG A;  5CF2 A;  3S5C A;  1IT7 A;  3DGN A;  1GY7 A;  4R4K A;  1Q40 B;  3CCS 3;  2CFD A;  2OOV A;  1PU4 A;  4N3V A;  3GZX B;  3F8X A;  1RKY A;  1UUW B;  2C11 A;  1OPY A;  1AVK A;  1ZO2 A;  2O3O A;  4AKY A;  1E97 A;  1K28 A;  4RNY A;  2STD A;  3OXA A;  3NM7 A;  3Q1C A;  2QA4 3;  3OWY A;  2P0X A;  3UL5 A;  3NQY A;  3E99 A;  4XDW A;  1O7P B;  3H51 A;  4LGQ A;  3EE1 A;  1JN5 B;  8CHO A;  1KD1 4;  4ORL A;  1DVC A;  2B24 B;  1E3V A;  2QEX 3;  2RFR A;  3HZP A;  3O8Y A;  4LMI A;  3NQZ A;  3X41 A;  4N6M A;  3N8B A;  3T0U A;  5TGN A;  3WA2 X;  5AIH A;  5LC6 A;  3V99 A;  1FGR A;  3LTA A;  2GBX B;  1YVB I;  2WOF A;  1FGQ A;  4GB5 A;  3S29 A;  3GRD A;  1DMQ A;  1DYU A;  3HIG A;  3G0K A;  4WHA A;  1S72 3;  1OGZ A;  2O9U X;  4NRE A;  1O7W B;  4HZB B;  1NU3 A;  4EC6 A;  4R9K A;  3F9S A;  4HM1 B;  3B8L A;  4BTW A;  1EG9 B;  3M8C A;  4HJL B;  4KVH A;  2CWT A;  4KFE A;  1OHS A;  4HM3 B;  2CWV A;  1GY6 A;  2GEX A;  3DXO A;  1O7G B;  1HU9 A;  1JJ2 2;  3G16 A;  1VQ9 3;  1MNL A;  4L8P A;  2ZDJ A;  2K54 A;  2W9Q A;  1N5H A;  2OTL 3;  1SII A;  3ER7 A;  1N9E A;  3X3Y A;  4KFF A;  1IK3 A;  4N6V 0;  4FR9 A;  5D81 A;  4HM2 B;  4HM7 B;  3BND A;  2W2C A;  2HMJ B;  2XEP A;  4XDV A;  4EBG A;  5IG3 A;  1VQO 3;  1D6Y A;  4K1V A;  1CEW I;  1A90 A;  2PNC A;  4LZI A;  1YIT 3;  3HK4 A;  1YGE A;  1W6C A;  4HM8 B;  2IMJ A;  3RGR A;  2XFS A;  1Z1S A;  1JV2 B;  3BB9 A;  1FA3 A;  3FG1 A;  3F8H A;  4TX4 A;  1Y4K A;  1TFK A;  4HM0 B;  2XSO B;  2D42 A;  3JUP A;  3KKG A;  3PXM A;  1Q82 4;  3U97 A;  3KE7 A;  3EN1 B;  4IT7 A;  1KWI A;  4MMZ B;  1TU5 A;  1IV7 A;  4OK0 A;  1OHO A;  1W00 A;  2BMQ B;  3LML A;  2F99 A;  3CPW 2;  1VQ5 3;  2R4I A;  1A2K A;  4N6N B;  1DVD A;  3EC9 A;  3F7S A;  3K7C A;  1IVV A;  3LOY A;  1QAL A;  3KSE D;  1WTH A;  3RDE A;  3EB8 A;  3CC4 3;  5EVH A;  5A0O B;  3V98 A;  1K41 A;  2PZV A;  1VQ7 3;  1W4N A;  2CKF B;  2UX0 A;  4O2H A;  3UJM A;  3LTB A;  1STF I;  1W02 A;  1M1K 4;  3CD6 3;  4XM4 A;  1IV9 A;  2XGN A;  1WMP A;  3FH1 A;  5KP3 A;  3S28 A;  3WOE B;  2WO0 A;  1R4C A;  3FF2 A;  3KN4 A;  1ULJ B;  2RGQ A;  5JBS A;  3FSD A;  3NBJ A;  3EF8 A;  3T8N A;  1JB2 A;  2W04 A;  1TUH A;  4HM6 B;  3PCS A;  3CCJ 3;  2OQE C;  1YHQ 3;  2XRX B;  4J8T A;  3CCQ 3;  4EV5 A;  3Q90 A;  1TFO A;  1IQY A;  1GS3 A;  2Y74 A;  3KFQ C;  3N54 B;  4RBN A;  2BO9 B;  4K61 A;  4KFD A;  5IEP A;  1SPU A;  3VF1 A;  3JUQ A;  3K5T A;  4FMA A;  4R9L A;  3SOY A;  5BXQ A;  3RGA A;  2ZL8 A;  3LTC A;  3BNB A;  3B4P A;  2LYX A;  1NB5 I;  2Z76 A;  1A2V A;  2I9W A;  1OUN A;  2JQ5 A;  3ALA A;  4GL6 A;  4MMX B;  1IT8 A;  3OX9 A;  1K8A 4;  2P05 A;  4JRF A;  4K90 B;  3STD A;  5KP4 A;  2YX9 A;  2P38 A;  3X42 A;  4HKV B;  1QMA A;  2RCD A;  5DRV A;  3V92 A;  3D9R A;  2MC8 A;  4FCM A;  3WDG B;  2GU3 A;  3GZR A;  3MG3 A;  2QIY A;  4BTY A;  3I56 3;  4N6O B;  1YJW 3;  2FXT A;  2LQV A;  4IIA A;  3BNE A;  4MEI A;  1JRQ A;  3X3Z A;  3CME 3;  3AMO A;  3K9M C;  3NUV A;  5DRE A;  5CLK A;  1LNH A;  4K1U A;  5AII A;  3AMO B;  4WYK A;  1RN7 A;  3I55 3;  2W6J H;  3CPO A;  3MG2 A;  2HML B;  5IF6 A;  3LH4 A;  3LXU X;  5D83 A;  5G2G A;  4I4K A;  1VQM 3;  2OOV C;  3KSP A;  5CK6 A;  3NX0 A;  1SQW A;  1W5Z A;  4O02 B;  5I97 A;  1Q86 4;  4XBT A;  1JB4 A;  3PYJ A;  5BVB A;  1GD3 A;  1IVW A;  3JVC A;  2P09 A;  5AIG A;  3CCV 3;  3K63 A;  5STD A;  1VQ6 3;  4EYC A;  2CG0 A;  2KRT A;  2GBW B;  1IQX A;  1V74 A;  1O7H B;  2HMO B;  2BMO B;  3QRD A;  3FG4 A;  3VGN A;  4H3U A;  2W0Q A;  1FGO A;  2C10 A;  1JB5 A;  2ML6 A;  2L4V A;  2OWP A;  5AEW B;  3ECF A;  3CNM A;  2Z6B A;  3NM2 A;  3I0Y A;  3MYT A;  1WMN A;  2E2T A;  1UW1 A;  3LT9 A;  1EQK A;  2CFK A;  3HI7 A;  3EBT A;  1LXE A;  2IA7 A;  3UL6 A;  3HX8 A;  5AI1 A;  1CQS A;  3T8U A;  1CYV A;  4U13 A;  3X40 A;  3J7Y d;  3WMD A;  3OW2 2;  3JUM A;  1HKX A;  4LSO A;  3SOA A;  5IEO A;  3S67 A;  1VQN 3;  1VQ4 3;  3EHC A;  3CCM 3;  4HBR A;  1O7N B;  2E2V A;  2CK3 H;  3NV0 A;  4JF8 A;  4L8O A;  1GYB A;  3DGL A;  2WOH A;  3H3H A;  3OWU A;  2F86 B;  3JUO A;  3EJV A;  1IQ8 A;  4FMB A;  2Q07 A;  4OVM A;  1JN5 A;  1TIJ A;  2XF3 A;  3G4S 3;  1MOL A;  7STD A;  3WA3 A;  1QVG 2;  3FF0 A;  3NXJ A;  2GEY A;  4AKZ A;  4WYK B;  1OCV A;  5IG5 A;  1FUW A;  1SIH A;  1FGM A;  1CYU A;  2XH9 A;  4NHF A;  4STD A;  3A76 A;  4FMD A;  4WP5 A;  3SX1 A;  2XSH B;  5CXO A;  3F14 A;  3GWR A;  3D3L A;  5AYS C;  1L5G B;  3FZW A;  1IVU A;  3NV0 B;  1JNQ A;  1C7H A;  3VSY A;  1VZZ A;  4MJD A;  5IEN A;  1K9M 4;  3DY5 A;  4WFO A;  1RRL A;  2YFL B;  1JKG A;  2YFI B;  5IER A;  3IJE B;  2CHC A;  1U5O A;  3CC2 3;  3CXC 2;  1QVF 2;  1RRH A;  1PFP A;  2CW9 A;  2BMR B;  3CCR 3;  2Z77 A;  3G71 3;  1QAF A;  4R80 A;  1OH0 A;  3DGM A;  2OQE A;  2WGO A;  1D6Z A;  1UUV B;  4X2O A;  1Q81 4;  5EQL A;  1WNH A;  2A15 A;  3DUK A;  3PGB A;  5AEU B;  3PZW A;  4N6T A;  1STD A;  4AEQ A;  1N9J A;  2Y73 A;  4FCJ A;  3EX9 A;  1WMO A;  5HGR A;  5ELU A;  1OHP A;  1W6Y A;  3IMA B;  3WOF B;  2HMM B;  3CCE 3;  4XBY A;  1A67 A;  1LOX A;  3G8Z A;  2BHM A;  2B1X B;  5LC7 A;  1UI7 A;  3LZA A;  3LYG A;  1ULI B;  3F40 A;  4LEH A;  3DMC A;  3FG3 A;  1U8C B;  3OV4 A;  1N8R 4;  3PS8 A;  1YJ9 3;  2BT3 A;  2INX A;  3TDG A;  1QJG A;  4R1K A;  1T5Y A;  1UI8 A;  3MSO A;  4CDL A;  1J2B A;  3SXX A;  2OCT A;  4HVN A;  2CC3 A;  2GXF A;  2WGQ A;  3B4O A;  4MMY B;  3EBY A;  1VQK 3;  3LT8 A;  5IW9 A;  3CMA 3;  4HM4 B;  1DMM A;  3B7C A;  3EQQ B;  1AR0 A;  5FGO A;  1RJO A;  1E3R A;  3MKI A;  2RSX A;  3MPH A;  4J9A A;  2F98 A;  2GU1 A;  3CC7 3;  3DM8 A;  6STD A;  1EA2 A;  2CG1 A;  1OF5 A;  4G1M B;  3JUN A;  1NO3 A;  1W2Z A;  3SVA A;  1G96 A;  2CFL A;  2W03 A;  1NDO B;  2KXG A;  5ELJ A;  1W7C A;  1N8Q A;  1WQL B;  3FCS B;  1TP6 A;  4L7K A;  1GD4 A;  1YJN 3;  1K73 4;  1LVN A;  1VQP 3;  3DZL A;  5KP1 A;  1M9G A;  1M90 4;  2FNQ A;  3K0Z A;  4RNZ A;  1O7M B;  4HYZ A;  2QGU A;  4CCV A;  1Q40 A;  1US1 A;  5JPU A;  3HII A;  1AV4 A;  1N5P A;  3SLU A;  3UB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...