3F14A

Crystal structure of ntf2-like protein of unknown function (yp_680363.1) from cytophaga hutchinsonii atcc 33406 at 1.45 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
GMETTHYSIAQHFSSGDFPAVYACFNDIIEWNIIGNQVVKGKADVIDFCNKMLPEMKGAVLTNDNVIQNENQIVIEGKCRYFDAEGKEAFVSYCDIYRFENDTIKTITSYCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_680363.1) from CYTOPHAGA HUTCHINSONII ATCC 33406 at 1.45 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f14A00
1W01A 1ASKA 3BB9A 4HM6B 5KP3A 4J8TA 4U13A 2Z76A 5AIGA 3H3HA 3KE7A 4H3UA 1OGZA 1JKGA 2HMJB 3CNXA 4R9KA 3EN1B 3I0YA 3GZYB 4LGQA 4KVHA 4HKVB 3GZBA 3HX8A 1OF5A 5D83A 2B1XB 3EBTA 3S5CA 1O7NB 1OCVA 5BXQA 3RGRA 3MHEA 2QIYA 4K1UA 1DMMA 4HM3B 1W6YA 4XBTA 5AI1A 2GEYA 3JUOA 3A76A 3ER7A 2BMRB 5TGNA 3JUMA 4WYKA 3SOYA 1Q42A 1GYBA 1OGXA 3NV0A 1OH0A 1CQSA 3FF2A 2XSHB 2R4IA 2YFJB 3OXAA 3UJMA 3K7CA 2F99A 3OWSA 3EC9A 3DM8A 3HZPA 1QJGA 1OHPA 2A15A 2UX0A 5JPPA 3KZTA 5CF2A 3B4OA 5IEOA 3T8UA 3SOAA 1OUNA 4HM5B 1AR0A 2RGQA 2INXA 4XBXA 5BVBA 2RCDA 2YFIB 1GY7A 1Q40A 4HZBB 1K41A 3EJVA 3JUQA 4HM0B 1E3RA 5JPUA 3GZRA 5CLKA 2GXFA 2BMQB 4HM2B 2QGUA 3FSDA 1ISKA 3NM2A 2JQ5A 5EVHA 2Z7AA 3OX9A 4K1VA 5IERA 1GY6A 3D9RA 4J9AA 5AEUB 1TUHA 5IEPA 3M8CA 5DREA 2B24B 3GWRA 3LYGA 1C7HA 4IIAA 2F98A 1WQLB 4FCJA 3KKGA 5AIHA 7STDA 2HMNB 5CF1A 3DMCA 2XR8B 2XSOB 1S5AA 2IMJA 2HMOB 3JUNA 3FLJA 3FZWA 1EG9B 4LEHA 3FKAA 1JB2A 3ROBA 4OVMA 2CKFB 3OV4A 2F86B 4L8OA 3F14A 1VZZA 3G0KA 1U5OA 3EN8A 5IENA 3CU3A 3F7SA 1HKXA 1ZO2A 5IG0A 2Z77A 2HMLB 2BNGA 1O7PB 3NUVA 3MYTA 4PEJA 2STDA 3OWUA 2YFLB 1E97A 3GRDA 1NDOB 3BLZA 3IPTA 5IG5A 4RZMA 3MKIA 4HM1B 2XRXB 1O7GB 4LMIA 3B8LA 6STDA 3B7CA 3STDA 3K0ZA 1UUVB 4OUQA 1OPYA 3WMDA 3G8ZA 4XBYA 5AIFA 1OHOA 4ORLA 1A2KA 5G2GA 4R1KA 1JB4A 3T8NA 3KSPA 3LZAA 5AIIA 4L7KA 1JN5B 4N3VA 3DXOA 4HM8B 5DRVA 1NU3A 3F9SA 3DZLA 5IG3A 4HVNA 2PZVA 1BUQA 3ECFA 3CPOA 3H51A 1ZX2A 4L8PA 1JB5A 2GEXA 8CHOA 3HK4A 3NBRA 1DMNA 1OHSA 4CDLA 2HMMB 5FW5A 1NWWA 3F40A 5KP4A 1JKGB 1EA2A 4HJLB 4XM4A 2OWPA 3FF0A 3FH1A 1OF5B 5D81A 3MSOA 1TP6A 3MG2A 3NXJA 3EBYA 1UUWB 4XDVA 5D82A 5IF6A 4FCMA 2GBWB 3FGYA 4MJDA 3OWYA 3Q90A 3UNLA 5KP1A 3EX9A 3F7XA 3VSYA 1QMAA 4Q53A 5HGRA 4I4KA 4WYKB 2I9WA 4WP5A 1W00A 3NV0B 3JUPA 5AEWB 3VGNA 3RGAA 5CK6A 1O7HB 3EQQB 3MG3A 1ULIB 2GBXB 3CNMA 4WWUC 4X2OA 1O7WB 3NHXA 1Z1SA 5CXOA 3G16A 3F8XA 2CHCA 4HM4B 1IDPA 4XB5A 1E3VA 3MG1A 4XDWA 4R9LA 2K54A 3SEDA 1SJWA 3EHCA 4HZ9B 4STDA 4HM7B 1DMQA 1W02A 2HMKB 4X2HA 3EF8A 1O7MB 3GZXB 2BMOB 1Q40B 2W2CA 1GS3A 1GY5A 3DUKA 1JN5A 1STDA 4GB5A 1ULJB 3F8HA 3B4PA 5IG4A 2RFRA 5STDA 3E99A
chains in the Genus database with same CATH superfamily
2M7OA 3PZWA 1W01A 4BL2A 1ASKA 3BB9A 1I2EA 3CPW2 4HM6B 5KP3A 1NB5I 3U1WA 2QA43 4J8TA 4U13A 1IT7A 3LT9A 2Z76A 5AIGA 5GSPA 3H3HA 3KE7A 3SX1A 2CFKA 3BNBA 4H3UA 3J7Yd 1OGZA 3CME3 1IU7A 3AMOA 1BNFA 1JKGA 2HMJB 3CNXA 3G713 1RNTA 3N54B 4R9KA 3EN1B 3I0YA 1YHQ3 3LMLA 3UB1A 3GZYB 3FG1A 4NPBA 1VQ73 4LGQA 1IVXA 3V99A 4KVHA 4HKVB 2CH9A 5BU4A 3GZBA 1US1A 3HX8A 1BSAA 1OF5A 5D83A 2B1XB 3EBTA 3S5CA 1O7NB 2WOHA 4FMAA 2OOVA 1CYVA 1RDSA 1OCVA 1LOVA 5BXQA 3RGRA 2KF4A 1K9M4 1FGMA 1BSDA 1ZS7A 3MHEA 1TJDA 2QIYA 4O02B 3WOFB 1IQ8A 4AKZA 1JBRA 4K1UA 4KFFA 1UI8A 1DMMA 4HM3B 4IPBA 1I0XA 3X42A 7GSPA 3ZG0A 1W6YA 3Q2PA 3T0UA 2C4BA 1LRAA 4AKYA 4RNYA 1PY3A 4XBTA 5AI1A 1IK3A 5HOHA 2GEYA 1VQ43 3ALAA 3I563 1I70A 2FGTA 2C11A 2CX1A 3A76A 3ER7A 1JZDA 3JUOA 3OW22 1MNLA 4N6OB 2SBLA 4NREA 1B2MA 2BMRB 2PNCA 5TGNA 3JUMA 3CCE3 1T5YA 2K0MA 1BRGA 1R4YA 2W6JH 4WYKA 3SOYA 1Q42A 1GYBA 5AYRB 1RGEA 2CWVA 1OGXA 1Q814 1OH0A 2W56B 1CQSA 3NV0A 2L1SA 3FF2A 1K734 3WHOA 2XSHB 2R4IA 5RNTA 3HIGA 2XH9A 1FW7A 5LC6A 1HZ1A 2ZDJA 2YFJB 1B2UA 3OXAA 2JDIH 3UJMA 4EV2A 1AQZA 3A5EA 3X3ZA 2K3DA 2ZHXB 3K7CA 2F99A 3D3LA 4G1MB 1Q7HA 1RTUA 3OWSA 3EC9A 3DM8A 3HZPA 5FGOA 1BANA 1D6ZA 1KC84 2BIRA 1QJGA 1LQMB 1OHPA 1K8A4 3QK9A 3BNCA 2A15A 4HAAA 4K61A 2CFLA 1YI23 1VQ63 2UX0A 5JPPA 1BGSA 3CC73 3HOHA 3KZTA 1GOYA 1G0TA 5CF2A 3K9MC 3KN4A 3B4OA 1CEWI 1B20A 3K5TA 6GSPA 1GD4A 1LNIA 3Q1CA 1ROAA 5ELJA 2F5MA 3ZFZA 5A0OB 3V98A 1C54A 1HYFA 1RSNA 5IEOA 1VQK3 1FGRA 3L0RA 3T8UA 1IVVA 3SOAA 2F56A 2IUKA 1OUNA 1BOXA 1LOXA 2V1LA 3BU4A 5EQLA 4HM5B 3UL5A 1YJ93 5G1LA 3N8BA 1BRJA 3NM7A 1AR0A 5G1KA 3SXXA 5M18A 2RGQA 1VQO3 2INXA 3EB8A 4XBXA 1RGAA 5BVBA 2RCDA 1J2BA 1AVKA 1I3FA 1IVWA 2YFIB 1GY7A 2AAEA 3AHSA 1Q40A 4HZBB 4DKIA 1A90A 2CWUA 4TX4A 2CK3H 2L4VA 5EEOA 2H0HA 4BL3A 2CFGA 1K41A 3EJVA 3JUQA 4CPKA 2MF7A 1EQKA 4HM0B 2GU3A 1KQS2 1E3RA 3WOEB 5JPUA 1U8CB 1B3SA 2P09A 4BTXA 3D4AA 3DGLA 3GZRA 3D5GA 1YNVX 4WFOA 1BRKA 5CLKA 4H61A 2GXFA 3CCQ3 2BMQB 4IT7A 3X3XA 4ILFA 4HM2B 3CCR3 3G4S3 1EEJA 2QGUA 5I97A 1UCIA 3FSDA 1BNJA 1ISKA 2P38A 3NM2A 1A67A 2XF3A 2XGNA 2JQ5A 5EVHA 1JNQA 2Z7AA 3OX9A 1TIJA 1VQM3 4K1VA 5IERA 1GY6A 3D9RA 2XEPA 4J9AA 5AEUB 1GMPA 2KCDA 1GOUA 2CX0A 2BO9B 1TUHA 5IEPA 4AEQA 3WA3A 1IV9A 1LQGC 1W7CA 5AYSC 2ML6A 4JRFA 1F8NA 2RBIA 3M8CA 1N5PA 4RBNA 1NNVA 5DREA 1LXEA 1RHLA 1QAFA 2B24B 2W04A 1GOVA 4OK0A 2C10A 3S29A 1WMPA 3SVAA 3GWRA 3LYGA 3PGBA 1C7HA 2W03A 3CXC2 1B2XA 2E2VA 2ML5A 1YJN3 4IIAA 4ZM8A 2BHMA 2F98A 1VQP3 4HOHA 2E2TA 3Q3FA 2OQEC 1WQLB 3AGNA 1VQL3 1Q824 1RGLA 4FCJA 3KKGA 2UUGC 1KSIA 2E2UA 1BNGA 3HI7A 4MMZB 1UCJA 2BT3A 1B21A 1V74A 3PXMA 5AIHA 7STDA 8RNTA 4CJNA 2HMNB 3S27A 1RRHA 3FG3A 3DMCA 5CF1A 2XR8B 3DGNA 2XSOB 3D5IA 4LSOA 1S5AA 2KRTA 2IMJA 1TU5A 1IQXA 2HMOB 4EBGA 1JBTA 2P0MA 2FNQA 2H0IA 1N8QA 3JUNA 4KFEA 3BIRA 3FLJA 1MGRA 1WNHA 3FZWA 1AVLA 4EC6A 2W56A 3PCSA 2KF6A 1EG9B 4LEHA 1I0VA 3O8YA 3FKAA 4MMYB 1JB2A 3ROBA 4OVMA 4GHOA 2CKFB 1SQWA 1ROVA 2OTJ3 1QVF2 3OV4A 4HYZA 1SIHA 3AGOA 2F86B 4L8OA 4R4KA 3F14A 1VZZA 3G0KA 1BRIA 1U5OA 3EN8A 3KIIA 1W6CA 1BIRA 4JF8A 2WGOA 1B2SA 1RGHA 3CU3A 2BU4A 3F7SA 5IENA 1BAOA 1FGOA 3NQZA 1JRQA 1HKXA 1ZO2A 4KT3B 3EE1A 5BIRA 1DE3A 4N6LA 1OACA 2SARA 5IG0A 1TFOA 2HMLB 2Z77A 1IT8A 1LOWA 1STFI 2BNGA 1YIJ3 1W2B2 1O7PB 1Q864 3NUVA 4EXRA 3MYTA 1FZUA 3D79A 1LNHA 4N6TA 4PEJA 1RRLA 1MGWA 2STDA 2WO0A 1DVDA 3JVCA 3OWUA 4BU4A 2YFLB 1A2PA 1E97A 2OCTA 3GRDA 3NBBA 1PFPA 2XGLA 1NDOB 3BLZA 2OTL3 2O3OA 3IPTA 3KFQC 3CC43 4R80A 1B27A 2Y74A 3WR2A 3LTDA 5M19A 1UGIA 3TDGA 5IG5A 4RZMA 4KFDA 2KF3A 3MKIA 4HM1B 3X40A 4N6UA 2XRXB 1RJOA 1O7GB 4LMIA 3CCS3 4O2HA 3B8LA 6STDA 4QWTA 1G02A 1EKMA 3B7CA 4EV5A 3STDA 1IYYA 3K0ZA 3SLUA 1M1XB 1UUVB 4OUQA 1OPYA 1RNBA 3CC23 3WMDA 2RSXA 3G8ZA 4FR9A 4XBYA 1W4NA 5AIFA 6RNTA 1OHOA 4ORLA 4MEIA 1A2KA 5G2GA 4R1KA 1FGQA 1WMNA 2AADA 2CWTA 3LT8A 1JB4A 3UL6A 1D6YA 1A2VA 1VQ53 1UCKA 3T8NA 1FUWA 3CCJ3 2CIUA 3KSPA 3LZAA 5IW9A 2GU1A 3PS8A 5AIIA 1DETA 1SPUA 4L7KA 1BNRA 1JN5B 1YGWA 2R41A 1KWIA 4N3VA 2CW9A 3DXOA 4HM8B 1QALA 1FGTA 5DRVA 3X41A 1NU3A 2KXGA 3F9SA 2WGQA 1D6UA 3DZLA 5ELUA 3CCL3 5IG3A 4HVNA 2PZVA 1BUQA 4K90B 4HBRA 4BTYA 3ECFA 3CPOA 1FUSA 3LH4A 4LZIA 1YJW3 3H51A 9RNTA 1ZX2A 3BNEA 4L8PA 1JB5A 2CG0A 2GEXA 8CHOA 4RNTA 3HK4A 2W9QA 1UDII 3GAXA 1BRNL 1WMOA 1BNEA 4NHFA 1QAKA 3NBRA 2Y73A 1DMNA 2YX9A 4BIRA 4EYCA 1OHSA 1MOLA 1VQQA 2P05A 1WTHA 3PCRA 3QRDA 3RNTA 4CDLA 1T2HA 2HMMB 5FW5A 1NWWA 3F40A 5KP4A 1GSPA 3AMOB 1JKGB 1BRSA 1DYUA 2OQEA 1RKYA 1EA2A 4FCZA 2IYJA 3SYUA 1BSEA 4HJLB 4XM4A 1YGEA 1M9GA 2XFTA 3LOYA 2OWPA 3KCHA 2O9UX 3FF0A 3MWZA 1JJ22 3FH1A 1DVCA 3AHWA 1OF5B 5D81A 1W5ZA 3MSOA 5LC7A 1NJI4 2ZL8A 1V58A 1TP6A 3MG2A 1BRHA 2RNTA 2W9PA 3NXJA 3DY5A 3CCM3 1BVIA 3IJEB 1VQ83 2WOFA 4N6MA 2J8XB 1UUGB 2H0GA 1RGKA 3EBYA 3ZG5A 1RGCA 4N6V0 1N9EA 1JBSA 3CMA3 2XFSA 1UUWB 1SARA 4XDVA 1MWSA 1GMRA 1RGGA 2D42A 2OOVC 5D82A 5IF6A 1PYLA 2QEX3 4GL6A 1HU9A 2HOHA 4FCMA 2GBWB 3FGYA 3DGYA 3IMAB 1RN7A 3OWYA 3Q90A 4MJDA 1X1YA 2UGIA 1UI7A 1ZGXA 1UW1A 3UNLA 3S28A 2CC3A 4CCVA 2LYXA 5KP1A 1SIIA 4N6NB 1IV7A 3CD63 1BSCA 1NO3A 1BNSA 1UGHI 3DGMA 3EX9A 3F7XA 2IUJA 2Z6BA 3VSYA 1MWUA 1QMAA 4Q53A 4I4KA 5HGRA 2KAAA 4WYKB 3CCU3 2F5WA 2I9WA 1FYSA 1I8VA 1W00A 4J5KA 4WP5A 1UCLA 4FMBA 3FG4A 1KD14 2FXTA 5M1AA 1RGFA 3G6E3 2ZA4A 2GSPA 7RNTA 1AY7A 1GMQA 3NV0B 1PU4A 1LVNA 3JUPA 1G96A 3X3YA 1N9JA 3U97A 5AEWB 1R4CA 1X1UA 2CG1A 1S723 3VGNA 1CH0A 2MC8A 3I553 3HIIA 4BTWA 3RGAA 1Q9EA 5CK6A 1O7HB 3EQQB 2CFDA 1W2ZA 4O8SA 3MG3A 1TTOA 1ULIB 1YIT3 1GD3A 1RMSA 2GBXB 1YVBI 3LTAA 1NB3I 3CNMA 4WWUC 3URPA 3V92A 3S67A 3NBJA 4X2OA 2KF5A 4RNZA 4EW5A 1O7WB 1V57A 2IY2A 1X1WA 1N5HA 3FCSB 3PYJA 3LTBA 3WODG 3NHXA 2IA7A 1Z1SA 2LQVA 3KSED 5CXOA 4FMCA 4KZ1A 3G16A 3NQYA 1TRQA 3F8XA 2CHCA 4HM4B 1IDPA 1T2IA 1RCLA 1I2FA 3CCV3 1AV4A 4XB5A 1E3VA 1MWRA 3MPHA 1MWTA 4MMXB 3MG1A 4XDWA 4R9LA 4WHAA 3DGOA 4J5GA 3VF1A 1CYUA 1FA3A 1RN1A 1RN4A 1X1XA 4FMDA 2K54A 3RDEA 3NX0A 3WDGB 3SEDA 1JZOA 1EUIC 1SJWA 1TFKA 1M1K4 1I3IA 1W6GA 3EHCA 3BNDA 4HZ9B 3DH2A 2P0XA 4HM7B 1DMQA 4I5QA 4STDA 3K63A 1VQ93 1BNIA 1W02A 2HMKB 1RCKA 4X2HA 1Y4KA 3EF8A 2F4YA 5JBSA 1BUJA 4LYLB 1IQYA 1O7MB 1FUTA 3GZXB 2BMOB 1JV2B 1Q40B 3N9HA 1VQN3 2W2CA 1B2ZA 1GS3A 1K28A 1L5GB 1GY5A 2D1WA 3DUKA 3WA2X 2CFWA 1IVUA 1JN5A 1STDA 1BU4A 2W0QA 4GB5A 4GSPA 1M904 1I2GA 1ULJB 1LOYA 1N8R4 3F8HA 1RLSA 1YVSA 3B4PA 3LTCA 5IG4A 1QVG2 1T3BA 4O3VA 3GSPA 3LXUX 2RFRA 1BSBA 1TRPA 2Q07A 5STDA 1Q7Y4 3E99A
chains in the Genus database with same CATH topology
2M7OA 3PZWA 1W01A 1ASKA 3BB9A 3CPW2 4HM6B 5KP3A 1NB5I 3U1WA 2QA43 4J8TA 4U13A 1IT7A 3LT9A 2Z76A 5AIGA 3H3HA 3KE7A 3SX1A 2CFKA 3BNBA 4H3UA 3J7Yd 1OGZA 3CME3 1IU7A 3AMOA 1JKGA 2HMJB 3CNXA 3G713 3N54B 4R9KA 3EN1B 3I0YA 1YHQ3 3LMLA 3UB1A 3GZYB 3FG1A 1VQ73 4LGQA 1IVXA 3V99A 4KVHA 4HKVB 2CH9A 3GZBA 1US1A 3HX8A 1OF5A 5D83A 2B1XB 3EBTA 3S5CA 1O7NB 2WOHA 4FMAA 2OOVA 1CYVA 1OCVA 5BXQA 3RGRA 1K9M4 1FGMA 3MHEA 4O02B 2QIYA 3WOFB 1IQ8A 4AKZA 4K1UA 4KFFA 1UI8A 1DMMA 4HM3B 4IPBA 3X42A 1W6YA 3Q2PA 3T0UA 4AKYA 4RNYA 4XBTA 5AI1A 1IK3A 2GEYA 1VQ43 3ALAA 3I563 2FGTA 2C11A 3A76A 3ER7A 3JUOA 3OW22 1MNLA 4N6OB 2SBLA 4NREA 2BMRB 2PNCA 5TGNA 3JUMA 3CCE3 1T5YA 2K0MA 2W6JH 4WYKA 3SOYA 1Q42A 1GYBA 5AYRB 2CWVA 1OGXA 1Q814 1OH0A 2W56B 1CQSA 3NV0A 3FF2A 1K734 2XSHB 2R4IA 3HIGA 2XH9A 5LC6A 2ZDJA 2YFJB 3OXAA 2JDIH 3UJMA 4EV2A 3X3ZA 4G1MB 3K7CA 2F99A 3D3LA 3OWSA 3EC9A 3DM8A 3HZPA 5FGOA 1D6ZA 1KC84 1QJGA 1OHPA 1K8A4 3QK9A 3BNCA 2A15A 4K61A 1YI23 2CFLA 1VQ63 2UX0A 5JPPA 3CC73 3KZTA 5CF2A 3K9MC 3KN4A 3B4OA 1CEWI 3K5TA 1GD4A 3Q1CA 5A0OB 1ROAA 5ELJA 3V98A 5IEOA 1VQK3 1FGRA 3L0RA 3T8UA 1IVVA 3SOAA 2IUKA 1OUNA 2V1LA 1LOXA 5EQLA 4HM5B 3UL5A 1YJ93 3N8BA 3NM7A 1VQO3 1AR0A 3SXXA 2RGQA 2INXA 3EB8A 4XBXA 5BVBA 2RCDA 1J2BA 1AVKA 1IVWA 2YFIB 1GY7A 1Q40A 4HZBB 1A90A 2CWUA 4TX4A 2CK3H 2L4VA 5EEOA 2CFGA 1K41A 3EJVA 3JUQA 2MF7A 1EQKA 4HM0B 2GU3A 1KQS2 1E3RA 3WOEB 5JPUA 1U8CB 2P09A 4BTXA 3DGLA 3GZRA 4WFOA 5CLKA 4H61A 2GXFA 3CCQ3 2BMQB 4IT7A 3X3XA 3CCR3 4HM2B 3G4S3 2QGUA 5I97A 3FSDA 1ISKA 2P38A 3NM2A 2XF3A 2XGNA 2JQ5A 5EVHA 1JNQA 2Z7AA 3OX9A 1TIJA 1VQM3 4K1VA 5IERA 1GY6A 3D9RA 2XEPA 4J9AA 5AEUB 2KCDA 2BO9B 1TUHA 5IEPA 4AEQA 3WA3A 1IV9A 1W7CA 5AYSC 2ML6A 4JRFA 1F8NA 3M8CA 1N5PA 4RBNA 5DREA 1LXEA 1QAFA 2B24B 2W04A 4OK0A 2C10A 3S29A 1WMPA 3SVAA 3GWRA 3LYGA 3PGBA 1C7HA 2W03A 3CXC2 2E2VA 2ML5A 1YJN3 4IIAA 4ZM8A 2BHMA 2F98A 1VQP3 2E2TA 2OQEC 1WQLB 1VQL3 1Q824 4FCJA 3KKGA 1KSIA 2E2UA 3HI7A 4MMZB 2BT3A 1V74A 3PXMA 5AIHA 7STDA 2HMNB 3S27A 1RRHA 3FG3A 3DMCA 5CF1A 2XR8B 3DGNA 2XSOB 4LSOA 1S5AA 2KRTA 2IMJA 1TU5A 1IQXA 2HMOB 2P0MA 2FNQA 3JUNA 1N8QA 4KFEA 3FLJA 1WNHA 3FZWA 1AVLA 4EC6A 2W56A 3PCSA 1EG9B 4LEHA 3O8YA 3FKAA 4MMYB 1JB2A 3ROBA 4OVMA 2CKFB 1SQWA 1ROVA 2OTJ3 1QVF2 3OV4A 4HYZA 1SIHA 2F86B 4L8OA 4R4KA 3F14A 1VZZA 3G0KA 1U5OA 3EN8A 3KIIA 1W6CA 4JF8A 2WGOA 5IENA 3CU3A 1A67A 3F7SA 3NQZA 1FGOA 1JRQA 1HKXA 1ZO2A 3EE1A 4N6LA 1OACA 5IG0A 1TFOA 2HMLB 2Z77A 1IT8A 1STFI 2BNGA 1YIJ3 1W2B2 1O7PB 1Q864 3NUVA 4EXRA 3MYTA 1LNHA 4N6TA 4PEJA 1RRLA 2STDA 2WO0A 1DVDA 3JVCA 3OWUA 2YFLB 1E97A 2OCTA 3GRDA 3NBBA 1PFPA 2XGLA 1NDOB 3BLZA 2OTL3 2O3OA 3IPTA 3KFQC 3CC43 4R80A 2Y74A 3LTDA 3TDGA 5IG5A 4RZMA 4KFDA 3MKIA 4HM1B 3X40A 4N6UA 2XRXB 1RJOA 1O7GB 4LMIA 3CCS3 4O2HA 3B8LA 6STDA 4QWTA 3B7CA 1EKMA 4EV5A 3STDA 3K0ZA 3SLUA 1M1XB 1UUVB 4OUQA 1OPYA 3CC23 3WMDA 2RSXA 3G8ZA 4FR9A 4XBYA 1W4NA 5AIFA 1OHOA 4ORLA 4MEIA 1A2KA 5G2GA 4R1KA 1FGQA 1WMNA 2CWTA 3LT8A 1JB4A 3UL6A 1D6YA 1A2VA 1VQ53 3T8NA 1FUWA 3CCJ3 2CIUA 3KSPA 3LZAA 5IW9A 2GU1A 3PS8A 5AIIA 1SPUA 4L7KA 1JN5B 1KWIA 4N3VA 2CW9A 3DXOA 4HM8B 1QALA 1FGTA 5DRVA 3X41A 1NU3A 2KXGA 3F9SA 2WGQA 1D6UA 3DZLA 5ELUA 3CCL3 5IG3A 4HVNA 2PZVA 1BUQA 4K90B 4HBRA 4BTYA 3ECFA 3CPOA 4LZIA 3LH4A 1YJW3 3H51A 1ZX2A 3BNEA 4L8PA 1JB5A 2CG0A 2GEXA 8CHOA 3HK4A 2W9QA 3GAXA 1WMOA 4NHFA 1QAKA 3NBRA 2Y73A 1DMNA 2YX9A 4EYCA 1OHSA 1MOLA 2P05A 1WTHA 3PCRA 3QRDA 4CDLA 2HMMB 5FW5A 1NWWA 3F40A 5KP4A 3AMOB 1JKGB 1DYUA 2OQEA 1RKYA 1EA2A 4FCZA 4HJLB 4XM4A 1YGEA 1M9GA 2XFTA 3LOYA 2OWPA 2O9UX 3FF0A 3MWZA 1JJ22 3FH1A 1DVCA 1OF5B 5D81A 1W5ZA 3MSOA 5LC7A 1NJI4 2ZL8A 1TP6A 3MG2A 2W9PA 3NXJA 3DY5A 3CCM3 3IJEB 1VQ83 2WOFA 4N6MA 3EBYA 4N6V0 1N9EA 3CMA3 2XFSA 1UUWB 4XDVA 5D82A 2D42A 2QEX3 2OOVC 5IF6A 4GL6A 1HU9A 4FCMA 2GBWB 3FGYA 3IMAB 1RN7A 3OWYA 3Q90A 4MJDA 1UI7A 1UW1A 3UNLA 3S28A 2CC3A 4CCVA 2LYXA 5KP1A 1SIIA 4N6NB 1IV7A 3CD63 1NO3A 3EX9A 3F7XA 2IUJA 3DGMA 3VSYA 4EBGA 2Z6BA 1QMAA 4Q53A 5HGRA 4I4KA 4WYKB 3CCU3 2I9WA 4WP5A 1W00A 1KD14 4FMBA 3FG4A 2FXTA 3G6E3 3NV0B 1PU4A 1LVNA 3JUPA 1G96A 3X3YA 1N9JA 3U97A 5AEWB 1R4CA 2CG1A 1S723 3VGNA 2MC8A 3I553 3HIIA 4BTWA 3RGAA 5CK6A 1O7HB 3EQQB 2CFDA 1W2ZA 4O8SA 3MG3A 1ULIB 1YIT3 1GD3A 2GBXB 1YVBI 3LTAA 1NB3I 3CNMA 4WWUC 3V92A 3S67A 3NBJA 4X2OA 4RNZA 1O7WB 3FCSB 3PYJA 1N5HA 3LTBA 3WODG 3NHXA 2IA7A 1Z1SA 2LQVA 3KSED 5CXOA 4FMCA 4KZ1A 3G16A 3NQYA 3F8XA 2CHCA 4HM4B 1IDPA 3CCV3 1AV4A 4XB5A 1E3VA 3MPHA 4MMXB 3MG1A 4XDWA 4R9LA 4WHAA 3DGOA 3VF1A 1CYUA 1FA3A 4FMDA 2K54A 3RDEA 3NX0A 3WDGB 3SEDA 1SJWA 1TFKA 1M1K4 1W6GA 3EHCA 3BNDA 4HZ9B 4STDA 2P0XA 4HM7B 1DMQA 1VQ93 3K63A 1W02A 2HMKB 4X2HA 1Y4KA 3EF8A 5JBSA 1IQYA 1O7MB 3GZXB 2BMOB 1JV2B 1Q40B 3N9HA 1VQN3 2W2CA 1GS3A 1K28A 1L5GB 1GY5A 2D1WA 3DUKA 3WA2X 2CFWA 1IVUA 1JN5A 1STDA 2W0QA 4GB5A 1M904 1ULJB 1N8R4 3F8HA 3B4PA 3LTCA 5IG4A 1QVG2 4O3VA 3LXUX 2RFRA 2Q07A 5STDA 1Q7Y4 3E99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W01 A;  1ASK A;  3BB9 A;  4HM6 B;  5KP3 A;  4J8T A;  4U13 A;  2Z76 A;  5AIG A;  3H3H A;  3KE7 A;  4H3U A;  1OGZ A;  1JKG A;  2HMJ B;  3CNX A;  4R9K A;  3EN1 B;  3I0Y A;  3GZY B;  4LGQ A;  4KVH A;  4HKV B;  3GZB A;  3HX8 A;  1OF5 A;  5D83 A;  2B1X B;  3EBT A;  3S5C A;  1O7N B;  1OCV A;  5BXQ A;  3RGR A;  3MHE A;  2QIY A;  4K1U A;  1DMM A;  4HM3 B;  1W6Y A;  4XBT A;  5AI1 A;  2GEY A;  3JUO A;  3A76 A;  3ER7 A;  2BMR B;  5TGN A;  3JUM A;  4WYK A;  3SOY A;  1Q42 A;  1GYB A;  1OGX A;  3NV0 A;  1OH0 A;  1CQS A;  3FF2 A;  2XSH B;  2R4I A;  2YFJ B;  3OXA A;  3UJM A;  3K7C A;  2F99 A;  3OWS A;  3EC9 A;  3DM8 A;  3HZP A;  1QJG A;  1OHP A;  2A15 A;  2UX0 A;  5JPP A;  3KZT A;  5CF2 A;  3B4O A;  5IEO A;  3T8U A;  3SOA A;  1OUN A;  4HM5 B;  1AR0 A;  2RGQ A;  2INX A;  4XBX A;  5BVB A;  2RCD A;  2YFI B;  1GY7 A;  1Q40 A;  4HZB B;  1K41 A;  3EJV A;  3JUQ A;  4HM0 B;  1E3R A;  5JPU A;  3GZR A;  5CLK A;  2GXF A;  2BMQ B;  4HM2 B;  2QGU A;  3FSD A;  1ISK A;  3NM2 A;  2JQ5 A;  5EVH A;  2Z7A A;  3OX9 A;  4K1V A;  5IER A;  1GY6 A;  3D9R A;  4J9A A;  5AEU B;  1TUH A;  5IEP A;  3M8C A;  5DRE A;  2B24 B;  3GWR A;  3LYG A;  1C7H A;  4IIA A;  2F98 A;  1WQL B;  4FCJ A;  3KKG A;  5AIH A;  7STD A;  2HMN B;  5CF1 A;  3DMC A;  2XR8 B;  2XSO B;  1S5A A;  2IMJ A;  2HMO B;  3JUN A;  3FLJ A;  3FZW A;  1EG9 B;  4LEH A;  3FKA A;  1JB2 A;  3ROB A;  4OVM A;  2CKF B;  3OV4 A;  2F86 B;  4L8O A;  3F14 A;  1VZZ A;  3G0K A;  1U5O A;  3EN8 A;  5IEN A;  3CU3 A;  3F7S A;  1HKX A;  1ZO2 A;  5IG0 A;  2Z77 A;  2HML B;  2BNG A;  1O7P B;  3NUV A;  3MYT A;  4PEJ A;  2STD A;  3OWU A;  2YFL B;  1E97 A;  3GRD A;  1NDO B;  3BLZ A;  3IPT A;  5IG5 A;  4RZM A;  3MKI A;  4HM1 B;  2XRX B;  1O7G B;  4LMI A;  3B8L A;  6STD A;  3B7C A;  3STD A;  3K0Z A;  1UUV B;  4OUQ A;  1OPY A;  3WMD A;  3G8Z A;  4XBY A;  5AIF A;  1OHO A;  4ORL A;  1A2K A;  5G2G A;  4R1K A;  1JB4 A;  3T8N A;  3KSP A;  3LZA A;  5AII A;  4L7K A;  1JN5 B;  4N3V A;  3DXO A;  4HM8 B;  5DRV A;  1NU3 A;  3F9S A;  3DZL A;  5IG3 A;  4HVN A;  2PZV A;  1BUQ A;  3ECF A;  3CPO A;  3H51 A;  1ZX2 A;  4L8P A;  1JB5 A;  2GEX A;  8CHO A;  3HK4 A;  3NBR A;  1DMN A;  1OHS A;  4CDL A;  2HMM B;  5FW5 A;  1NWW A;  3F40 A;  5KP4 A;  1JKG B;  1EA2 A;  4HJL B;  4XM4 A;  2OWP A;  3FF0 A;  3FH1 A;  1OF5 B;  5D81 A;  3MSO A;  1TP6 A;  3MG2 A;  3NXJ A;  3EBY A;  1UUW B;  4XDV A;  5D82 A;  5IF6 A;  4FCM A;  2GBW B;  3FGY A;  4MJD A;  3OWY A;  3Q90 A;  3UNL A;  5KP1 A;  3EX9 A;  3F7X A;  3VSY A;  1QMA A;  4Q53 A;  5HGR A;  4I4K A;  4WYK B;  2I9W A;  4WP5 A;  1W00 A;  3NV0 B;  3JUP A;  5AEW B;  3VGN A;  3RGA A;  5CK6 A;  1O7H B;  3EQQ B;  3MG3 A;  1ULI B;  2GBX B;  3CNM A;  4WWU C;  4X2O A;  1O7W B;  3NHX A;  1Z1S A;  5CXO A;  3G16 A;  3F8X A;  2CHC A;  4HM4 B;  1IDP A;  4XB5 A;  1E3V A;  3MG1 A;  4XDW A;  4R9L A;  2K54 A;  3SED A;  1SJW A;  3EHC A;  4HZ9 B;  4STD A;  4HM7 B;  1DMQ A;  1W02 A;  2HMK B;  4X2H A;  3EF8 A;  1O7M B;  3GZX B;  2BMO B;  1Q40 B;  2W2C A;  1GS3 A;  1GY5 A;  3DUK A;  1JN5 A;  1STD A;  4GB5 A;  1ULJ B;  3F8H A;  3B4P A;  5IG4 A;  2RFR A;  5STD A;  3E99 A; 
#chains in the Genus database with same CATH topology
 2M7O A;  3PZW A;  1W01 A;  4BL2 A;  1ASK A;  3BB9 A;  1I2E A;  3CPW 2;  4HM6 B;  5KP3 A;  1NB5 I;  3U1W A;  2QA4 3;  4J8T A;  4U13 A;  1IT7 A;  3LT9 A;  2Z76 A;  5AIG A;  5GSP A;  3H3H A;  3KE7 A;  3SX1 A;  2CFK A;  3BNB A;  4H3U A;  3J7Y d;  1OGZ A;  3CME 3;  1IU7 A;  3AMO A;  1BNF A;  1JKG A;  2HMJ B;  3CNX A;  3G71 3;  1RNT A;  3N54 B;  4R9K A;  3EN1 B;  3I0Y A;  1YHQ 3;  3LML A;  3UB1 A;  3GZY B;  3FG1 A;  4NPB A;  1VQ7 3;  4LGQ A;  1IVX A;  3V99 A;  4KVH A;  4HKV B;  2CH9 A;  5BU4 A;  3GZB A;  1US1 A;  3HX8 A;  1BSA A;  1OF5 A;  5D83 A;  2B1X B;  3EBT A;  3S5C A;  1O7N B;  2WOH A;  4FMA A;  2OOV A;  1CYV A;  1RDS A;  1OCV A;  1LOV A;  5BXQ A;  3RGR A;  2KF4 A;  1K9M 4;  1FGM A;  1BSD A;  1ZS7 A;  3MHE A;  1TJD A;  2QIY A;  4O02 B;  3WOF B;  1IQ8 A;  4AKZ A;  1JBR A;  4K1U A;  4KFF A;  1UI8 A;  1DMM A;  4HM3 B;  4IPB A;  1I0X A;  3X42 A;  7GSP A;  3ZG0 A;  1W6Y A;  3Q2P A;  3T0U A;  2C4B A;  1LRA A;  4AKY A;  4RNY A;  1PY3 A;  4XBT A;  5AI1 A;  1IK3 A;  5HOH A;  2GEY A;  1VQ4 3;  3ALA A;  3I56 3;  1I70 A;  2FGT A;  2C11 A;  2CX1 A;  3A76 A;  3ER7 A;  1JZD A;  3JUO A;  3OW2 2;  1MNL A;  4N6O B;  2SBL A;  4NRE A;  1B2M A;  2BMR B;  2PNC A;  5TGN A;  3JUM A;  3CCE 3;  1T5Y A;  2K0M A;  1BRG A;  1R4Y A;  2W6J H;  4WYK A;  3SOY A;  1Q42 A;  1GYB A;  5AYR B;  1RGE A;  2CWV A;  1OGX A;  1Q81 4;  1OH0 A;  2W56 B;  1CQS A;  3NV0 A;  2L1S A;  3FF2 A;  1K73 4;  3WHO A;  2XSH B;  2R4I A;  5RNT A;  3HIG A;  2XH9 A;  1FW7 A;  5LC6 A;  1HZ1 A;  2ZDJ A;  2YFJ B;  1B2U A;  3OXA A;  2JDI H;  3UJM A;  4EV2 A;  1AQZ A;  3A5E A;  3X3Z A;  2K3D A;  2ZHX B;  3K7C A;  2F99 A;  3D3L A;  4G1M B;  1Q7H A;  1RTU A;  3OWS A;  3EC9 A;  3DM8 A;  3HZP A;  5FGO A;  1BAN A;  1D6Z A;  1KC8 4;  2BIR A;  1QJG A;  1LQM B;  1OHP A;  1K8A 4;  3QK9 A;  3BNC A;  2A15 A;  4HAA A;  4K61 A;  2CFL A;  1YI2 3;  1VQ6 3;  2UX0 A;  5JPP A;  1BGS A;  3CC7 3;  3HOH A;  3KZT A;  1GOY A;  1G0T A;  5CF2 A;  3K9M C;  3KN4 A;  3B4O A;  1CEW I;  1B20 A;  3K5T A;  6GSP A;  1GD4 A;  1LNI A;  3Q1C A;  1ROA A;  5ELJ A;  2F5M A;  3ZFZ A;  5A0O B;  3V98 A;  1C54 A;  1HYF A;  1RSN A;  5IEO A;  1VQK 3;  1FGR A;  3L0R A;  3T8U A;  1IVV A;  3SOA A;  2F56 A;  2IUK A;  1OUN A;  1BOX A;  1LOX A;  2V1L A;  3BU4 A;  5EQL A;  4HM5 B;  3UL5 A;  1YJ9 3;  5G1L A;  3N8B A;  1BRJ A;  3NM7 A;  1AR0 A;  5G1K A;  3SXX A;  5M18 A;  2RGQ A;  1VQO 3;  2INX A;  3EB8 A;  4XBX A;  1RGA A;  5BVB A;  2RCD A;  1J2B A;  1AVK A;  1I3F A;  1IVW A;  2YFI B;  1GY7 A;  2AAE A;  3AHS A;  1Q40 A;  4HZB B;  4DKI A;  1A90 A;  2CWU A;  4TX4 A;  2CK3 H;  2L4V A;  5EEO A;  2H0H A;  4BL3 A;  2CFG A;  1K41 A;  3EJV A;  3JUQ A;  4CPK A;  2MF7 A;  1EQK A;  4HM0 B;  2GU3 A;  1KQS 2;  1E3R A;  3WOE B;  5JPU A;  1U8C B;  1B3S A;  2P09 A;  4BTX A;  3D4A A;  3DGL A;  3GZR A;  3D5G A;  1YNV X;  4WFO A;  1BRK A;  5CLK A;  4H61 A;  2GXF A;  3CCQ 3;  2BMQ B;  4IT7 A;  3X3X A;  4ILF A;  4HM2 B;  3CCR 3;  3G4S 3;  1EEJ A;  2QGU A;  5I97 A;  1UCI A;  3FSD A;  1BNJ A;  1ISK A;  2P38 A;  3NM2 A;  1A67 A;  2XF3 A;  2XGN A;  2JQ5 A;  5EVH A;  1JNQ A;  2Z7A A;  3OX9 A;  1TIJ A;  1VQM 3;  4K1V A;  5IER A;  1GY6 A;  3D9R A;  2XEP A;  4J9A A;  5AEU B;  1GMP A;  2KCD A;  1GOU A;  2CX0 A;  2BO9 B;  1TUH A;  5IEP A;  4AEQ A;  3WA3 A;  1IV9 A;  1LQG C;  1W7C A;  5AYS C;  2ML6 A;  4JRF A;  1F8N A;  2RBI A;  3M8C A;  1N5P A;  4RBN A;  1NNV A;  5DRE A;  1LXE A;  1RHL A;  1QAF A;  2B24 B;  2W04 A;  1GOV A;  4OK0 A;  2C10 A;  3S29 A;  1WMP A;  3SVA A;  3GWR A;  3LYG A;  3PGB A;  1C7H A;  2W03 A;  3CXC 2;  1B2X A;  2E2V A;  2ML5 A;  1YJN 3;  4IIA A;  4ZM8 A;  2BHM A;  2F98 A;  1VQP 3;  4HOH A;  2E2T A;  3Q3F A;  2OQE C;  1WQL B;  3AGN A;  1VQL 3;  1Q82 4;  1RGL A;  4FCJ A;  3KKG A;  2UUG C;  1KSI A;  2E2U A;  1BNG A;  3HI7 A;  4MMZ B;  1UCJ A;  2BT3 A;  1B21 A;  1V74 A;  3PXM A;  5AIH A;  7STD A;  8RNT A;  4CJN A;  2HMN B;  3S27 A;  1RRH A;  3FG3 A;  3DMC A;  5CF1 A;  2XR8 B;  3DGN A;  2XSO B;  3D5I A;  4LSO A;  1S5A A;  2KRT A;  2IMJ A;  1TU5 A;  1IQX A;  2HMO B;  4EBG A;  1JBT A;  2P0M A;  2FNQ A;  2H0I A;  1N8Q A;  3JUN A;  4KFE A;  3BIR A;  3FLJ A;  1MGR A;  1WNH A;  3FZW A;  1AVL A;  4EC6 A;  2W56 A;  3PCS A;  2KF6 A;  1EG9 B;  4LEH A;  1I0V A;  3O8Y A;  3FKA A;  4MMY B;  1JB2 A;  3ROB A;  4OVM A;  4GHO A;  2CKF B;  1SQW A;  1ROV A;  2OTJ 3;  1QVF 2;  3OV4 A;  4HYZ A;  1SIH A;  3AGO A;  2F86 B;  4L8O A;  4R4K A;  3F14 A;  1VZZ A;  3G0K A;  1BRI A;  1U5O A;  3EN8 A;  3KII A;  1W6C A;  1BIR A;  4JF8 A;  2WGO A;  1B2S A;  1RGH A;  3CU3 A;  2BU4 A;  3F7S A;  5IEN A;  1BAO A;  1FGO A;  3NQZ A;  1JRQ A;  1HKX A;  1ZO2 A;  4KT3 B;  3EE1 A;  5BIR A;  1DE3 A;  4N6L A;  1OAC A;  2SAR A;  5IG0 A;  1TFO A;  2HML B;  2Z77 A;  1IT8 A;  1LOW A;  1STF I;  2BNG A;  1YIJ 3;  1W2B 2;  1O7P B;  1Q86 4;  3NUV A;  4EXR A;  3MYT A;  1FZU A;  3D79 A;  1LNH A;  4N6T A;  4PEJ A;  1RRL A;  1MGW A;  2STD A;  2WO0 A;  1DVD A;  3JVC A;  3OWU A;  4BU4 A;  2YFL B;  1A2P A;  1E97 A;  2OCT A;  3GRD A;  3NBB A;  1PFP A;  2XGL A;  1NDO B;  3BLZ A;  2OTL 3;  2O3O A;  3IPT A;  3KFQ C;  3CC4 3;  4R80 A;  1B27 A;  2Y74 A;  3WR2 A;  3LTD A;  5M19 A;  1UGI A;  3TDG A;  5IG5 A;  4RZM A;  4KFD A;  2KF3 A;  3MKI A;  4HM1 B;  3X40 A;  4N6U A;  2XRX B;  1RJO A;  1O7G B;  4LMI A;  3CCS 3;  4O2H A;  3B8L A;  6STD A;  4QWT A;  1G02 A;  1EKM A;  3B7C A;  4EV5 A;  3STD A;  1IYY A;  3K0Z A;  3SLU A;  1M1X B;  1UUV B;  4OUQ A;  1OPY A;  1RNB A;  3CC2 3;  3WMD A;  2RSX A;  3G8Z A;  4FR9 A;  4XBY A;  1W4N A;  5AIF A;  6RNT A;  1OHO A;  4ORL A;  4MEI A;  1A2K A;  5G2G A;  4R1K A;  1FGQ A;  1WMN A;  2AAD A;  2CWT A;  3LT8 A;  1JB4 A;  3UL6 A;  1D6Y A;  1A2V A;  1VQ5 3;  1UCK A;  3T8N A;  1FUW A;  3CCJ 3;  2CIU A;  3KSP A;  3LZA A;  5IW9 A;  2GU1 A;  3PS8 A;  5AII A;  1DET A;  1SPU A;  4L7K A;  1BNR A;  1JN5 B;  1YGW A;  2R41 A;  1KWI A;  4N3V A;  2CW9 A;  3DXO A;  4HM8 B;  1QAL A;  1FGT A;  5DRV A;  3X41 A;  1NU3 A;  2KXG A;  3F9S A;  2WGQ A;  1D6U A;  3DZL A;  5ELU A;  3CCL 3;  5IG3 A;  4HVN A;  2PZV A;  1BUQ A;  4K90 B;  4HBR A;  4BTY A;  3ECF A;  3CPO A;  1FUS A;  3LH4 A;  4LZI A;  1YJW 3;  3H51 A;  9RNT A;  1ZX2 A;  3BNE A;  4L8P A;  1JB5 A;  2CG0 A;  2GEX A;  8CHO A;  4RNT A;  3HK4 A;  2W9Q A;  1UDI I;  3GAX A;  1BRN L;  1WMO A;  1BNE A;  4NHF A;  1QAK A;  3NBR A;  2Y73 A;  1DMN A;  2YX9 A;  4BIR A;  4EYC A;  1OHS A;  1MOL A;  1VQQ A;  2P05 A;  1WTH A;  3PCR A;  3QRD A;  3RNT A;  4CDL A;  1T2H A;  2HMM B;  5FW5 A;  1NWW A;  3F40 A;  5KP4 A;  1GSP A;  3AMO B;  1JKG B;  1BRS A;  1DYU A;  2OQE A;  1RKY A;  1EA2 A;  4FCZ A;  2IYJ A;  3SYU A;  1BSE A;  4HJL B;  4XM4 A;  1YGE A;  1M9G A;  2XFT A;  3LOY A;  2OWP A;  3KCH A;  2O9U X;  3FF0 A;  3MWZ A;  1JJ2 2;  3FH1 A;  1DVC A;  3AHW A;  1OF5 B;  5D81 A;  1W5Z A;  3MSO A;  5LC7 A;  1NJI 4;  2ZL8 A;  1V58 A;  1TP6 A;  3MG2 A;  1BRH A;  2RNT A;  2W9P A;  3NXJ A;  3DY5 A;  3CCM 3;  1BVI A;  3IJE B;  1VQ8 3;  2WOF A;  4N6M A;  2J8X B;  1UUG B;  2H0G A;  1RGK A;  3EBY A;  3ZG5 A;  1RGC A;  4N6V 0;  1N9E A;  1JBS A;  3CMA 3;  2XFS A;  1UUW B;  1SAR A;  4XDV A;  1MWS A;  1GMR A;  1RGG A;  2D42 A;  2OOV C;  5D82 A;  5IF6 A;  1PYL A;  2QEX 3;  4GL6 A;  1HU9 A;  2HOH A;  4FCM A;  2GBW B;  3FGY A;  3DGY A;  3IMA B;  1RN7 A;  3OWY A;  3Q90 A;  4MJD A;  1X1Y A;  2UGI A;  1UI7 A;  1ZGX A;  1UW1 A;  3UNL A;  3S28 A;  2CC3 A;  4CCV A;  2LYX A;  5KP1 A;  1SII A;  4N6N B;  1IV7 A;  3CD6 3;  1BSC A;  1NO3 A;  1BNS A;  1UGH I;  3DGM A;  3EX9 A;  3F7X A;  2IUJ A;  2Z6B A;  3VSY A;  1MWU A;  1QMA A;  4Q53 A;  4I4K A;  5HGR A;  2KAA A;  4WYK B;  3CCU 3;  2F5W A;  2I9W A;  1FYS A;  1I8V A;  1W00 A;  4J5K A;  4WP5 A;  1UCL A;  4FMB A;  3FG4 A;  1KD1 4;  2FXT A;  5M1A A;  1RGF A;  3G6E 3;  2ZA4 A;  2GSP A;  7RNT A;  1AY7 A;  1GMQ A;  3NV0 B;  1PU4 A;  1LVN A;  3JUP A;  1G96 A;  3X3Y A;  1N9J A;  3U97 A;  5AEW B;  1R4C A;  1X1U A;  2CG1 A;  1S72 3;  3VGN A;  1CH0 A;  2MC8 A;  3I55 3;  3HII A;  4BTW A;  3RGA A;  1Q9E A;  5CK6 A;  1O7H B;  3EQQ B;  2CFD A;  1W2Z A;  4O8S A;  3MG3 A;  1TTO A;  1ULI B;  1YIT 3;  1GD3 A;  1RMS A;  2GBX B;  1YVB I;  3LTA A;  1NB3 I;  3CNM A;  4WWU C;  3URP A;  3V92 A;  3S67 A;  3NBJ A;  4X2O A;  2KF5 A;  4RNZ A;  4EW5 A;  1O7W B;  1V57 A;  2IY2 A;  1X1W A;  1N5H A;  3FCS B;  3PYJ A;  3LTB A;  3WOD G;  3NHX A;  2IA7 A;  1Z1S A;  2LQV A;  3KSE D;  5CXO A;  4FMC A;  4KZ1 A;  3G16 A;  3NQY A;  1TRQ A;  3F8X A;  2CHC A;  4HM4 B;  1IDP A;  1T2I A;  1RCL A;  1I2F A;  3CCV 3;  1AV4 A;  4XB5 A;  1E3V A;  1MWR A;  3MPH A;  1MWT A;  4MMX B;  3MG1 A;  4XDW A;  4R9L A;  4WHA A;  3DGO A;  4J5G A;  3VF1 A;  1CYU A;  1FA3 A;  1RN1 A;  1RN4 A;  1X1X A;  4FMD A;  2K54 A;  3RDE A;  3NX0 A;  3WDG B;  3SED A;  1JZO A;  1EUI C;  1SJW A;  1TFK A;  1M1K 4;  1I3I A;  1W6G A;  3EHC A;  3BND A;  4HZ9 B;  3DH2 A;  2P0X A;  4HM7 B;  1DMQ A;  4I5Q A;  4STD A;  3K63 A;  1VQ9 3;  1BNI A;  1W02 A;  2HMK B;  1RCK A;  4X2H A;  1Y4K A;  3EF8 A;  2F4Y A;  5JBS A;  1BUJ A;  4LYL B;  1IQY A;  1O7M B;  1FUT A;  3GZX B;  2BMO B;  1JV2 B;  1Q40 B;  3N9H A;  1VQN 3;  2W2C A;  1B2Z A;  1GS3 A;  1K28 A;  1L5G B;  1GY5 A;  2D1W A;  3DUK A;  3WA2 X;  2CFW A;  1IVU A;  1JN5 A;  1STD A;  1BU4 A;  2W0Q A;  4GB5 A;  4GSP A;  1M90 4;  1I2G A;  1ULJ B;  1LOY A;  1N8R 4;  3F8H A;  1RLS A;  1YVS A;  3B4P A;  3LTC A;  5IG4 A;  1QVG 2;  1T3B A;  4O3V A;  3GSP A;  3LXU X;  2RFR A;  1BSB A;  1TRP A;  2Q07 A;  5STD A;  1Q7Y 4;  3E99 A; 
#chains in the Genus database with same CATH homology
 2M7O A;  3PZW A;  1W01 A;  1ASK A;  3BB9 A;  3CPW 2;  4HM6 B;  5KP3 A;  1NB5 I;  3U1W A;  2QA4 3;  4J8T A;  4U13 A;  1IT7 A;  3LT9 A;  2Z76 A;  5AIG A;  3H3H A;  3KE7 A;  3SX1 A;  2CFK A;  3BNB A;  4H3U A;  3J7Y d;  1OGZ A;  3CME 3;  1IU7 A;  3AMO A;  1JKG A;  2HMJ B;  3CNX A;  3G71 3;  3N54 B;  4R9K A;  3EN1 B;  3I0Y A;  1YHQ 3;  3LML A;  3UB1 A;  3GZY B;  3FG1 A;  1VQ7 3;  4LGQ A;  1IVX A;  3V99 A;  4KVH A;  4HKV B;  2CH9 A;  3GZB A;  1US1 A;  3HX8 A;  1OF5 A;  5D83 A;  2B1X B;  3EBT A;  3S5C A;  1O7N B;  2WOH A;  4FMA A;  2OOV A;  1CYV A;  1OCV A;  5BXQ A;  3RGR A;  1K9M 4;  1FGM A;  3MHE A;  4O02 B;  2QIY A;  3WOF B;  1IQ8 A;  4AKZ A;  4K1U A;  4KFF A;  1UI8 A;  1DMM A;  4HM3 B;  4IPB A;  3X42 A;  1W6Y A;  3Q2P A;  3T0U A;  4AKY A;  4RNY A;  4XBT A;  5AI1 A;  1IK3 A;  2GEY A;  1VQ4 3;  3ALA A;  3I56 3;  2FGT A;  2C11 A;  3A76 A;  3ER7 A;  3JUO A;  3OW2 2;  1MNL A;  4N6O B;  2SBL A;  4NRE A;  2BMR B;  2PNC A;  5TGN A;  3JUM A;  3CCE 3;  1T5Y A;  2K0M A;  2W6J H;  4WYK A;  3SOY A;  1Q42 A;  1GYB A;  5AYR B;  2CWV A;  1OGX A;  1Q81 4;  1OH0 A;  2W56 B;  1CQS A;  3NV0 A;  3FF2 A;  1K73 4;  2XSH B;  2R4I A;  3HIG A;  2XH9 A;  5LC6 A;  2ZDJ A;  2YFJ B;  3OXA A;  2JDI H;  3UJM A;  4EV2 A;  3X3Z A;  4G1M B;  3K7C A;  2F99 A;  3D3L A;  3OWS A;  3EC9 A;  3DM8 A;  3HZP A;  5FGO A;  1D6Z A;  1KC8 4;  1QJG A;  1OHP A;  1K8A 4;  3QK9 A;  3BNC A;  2A15 A;  4K61 A;  1YI2 3;  2CFL A;  1VQ6 3;  2UX0 A;  5JPP A;  3CC7 3;  3KZT A;  5CF2 A;  3K9M C;  3KN4 A;  3B4O A;  1CEW I;  3K5T A;  1GD4 A;  3Q1C A;  5A0O B;  1ROA A;  5ELJ A;  3V98 A;  5IEO A;  1VQK 3;  1FGR A;  3L0R A;  3T8U A;  1IVV A;  3SOA A;  2IUK A;  1OUN A;  2V1L A;  1LOX A;  5EQL A;  4HM5 B;  3UL5 A;  1YJ9 3;  3N8B A;  3NM7 A;  1VQO 3;  1AR0 A;  3SXX A;  2RGQ A;  2INX A;  3EB8 A;  4XBX A;  5BVB A;  2RCD A;  1J2B A;  1AVK A;  1IVW A;  2YFI B;  1GY7 A;  1Q40 A;  4HZB B;  1A90 A;  2CWU A;  4TX4 A;  2CK3 H;  2L4V A;  5EEO A;  2CFG A;  1K41 A;  3EJV A;  3JUQ A;  2MF7 A;  1EQK A;  4HM0 B;  2GU3 A;  1KQS 2;  1E3R A;  3WOE B;  5JPU A;  1U8C B;  2P09 A;  4BTX A;  3DGL A;  3GZR A;  4WFO A;  5CLK A;  4H61 A;  2GXF A;  3CCQ 3;  2BMQ B;  4IT7 A;  3X3X A;  3CCR 3;  4HM2 B;  3G4S 3;  2QGU A;  5I97 A;  3FSD A;  1ISK A;  2P38 A;  3NM2 A;  2XF3 A;  2XGN A;  2JQ5 A;  5EVH A;  1JNQ A;  2Z7A A;  3OX9 A;  1TIJ A;  1VQM 3;  4K1V A;  5IER A;  1GY6 A;  3D9R A;  2XEP A;  4J9A A;  5AEU B;  2KCD A;  2BO9 B;  1TUH A;  5IEP A;  4AEQ A;  3WA3 A;  1IV9 A;  1W7C A;  5AYS C;  2ML6 A;  4JRF A;  1F8N A;  3M8C A;  1N5P A;  4RBN A;  5DRE A;  1LXE A;  1QAF A;  2B24 B;  2W04 A;  4OK0 A;  2C10 A;  3S29 A;  1WMP A;  3SVA A;  3GWR A;  3LYG A;  3PGB A;  1C7H A;  2W03 A;  3CXC 2;  2E2V A;  2ML5 A;  1YJN 3;  4IIA A;  4ZM8 A;  2BHM A;  2F98 A;  1VQP 3;  2E2T A;  2OQE C;  1WQL B;  1VQL 3;  1Q82 4;  4FCJ A;  3KKG A;  1KSI A;  2E2U A;  3HI7 A;  4MMZ B;  2BT3 A;  1V74 A;  3PXM A;  5AIH A;  7STD A;  2HMN B;  3S27 A;  1RRH A;  3FG3 A;  3DMC A;  5CF1 A;  2XR8 B;  3DGN A;  2XSO B;  4LSO A;  1S5A A;  2KRT A;  2IMJ A;  1TU5 A;  1IQX A;  2HMO B;  2P0M A;  2FNQ A;  3JUN A;  1N8Q A;  4KFE A;  3FLJ A;  1WNH A;  3FZW A;  1AVL A;  4EC6 A;  2W56 A;  3PCS A;  1EG9 B;  4LEH A;  3O8Y A;  3FKA A;  4MMY B;  1JB2 A;  3ROB A;  4OVM A;  2CKF B;  1SQW A;  1ROV A;  2OTJ 3;  1QVF 2;  3OV4 A;  4HYZ A;  1SIH A;  2F86 B;  4L8O A;  4R4K A;  3F14 A;  1VZZ A;  3G0K A;  1U5O A;  3EN8 A;  3KII A;  1W6C A;  4JF8 A;  2WGO A;  5IEN A;  3CU3 A;  1A67 A;  3F7S A;  3NQZ A;  1FGO A;  1JRQ A;  1HKX A;  1ZO2 A;  3EE1 A;  4N6L A;  1OAC A;  5IG0 A;  1TFO A;  2HML B;  2Z77 A;  1IT8 A;  1STF I;  2BNG A;  1YIJ 3;  1W2B 2;  1O7P B;  1Q86 4;  3NUV A;  4EXR A;  3MYT A;  1LNH A;  4N6T A;  4PEJ A;  1RRL A;  2STD A;  2WO0 A;  1DVD A;  3JVC A;  3OWU A;  2YFL B;  1E97 A;  2OCT A;  3GRD A;  3NBB A;  1PFP A;  2XGL A;  1NDO B;  3BLZ A;  2OTL 3;  2O3O A;  3IPT A;  3KFQ C;  3CC4 3;  4R80 A;  2Y74 A;  3LTD A;  3TDG A;  5IG5 A;  4RZM A;  4KFD A;  3MKI A;  4HM1 B;  3X40 A;  4N6U A;  2XRX B;  1RJO A;  1O7G B;  4LMI A;  3CCS 3;  4O2H A;  3B8L A;  6STD A;  4QWT A;  3B7C A;  1EKM A;  4EV5 A;  3STD A;  3K0Z A;  3SLU A;  1M1X B;  1UUV B;  4OUQ A;  1OPY A;  3CC2 3;  3WMD A;  2RSX A;  3G8Z A;  4FR9 A;  4XBY A;  1W4N A;  5AIF A;  1OHO A;  4ORL A;  4MEI A;  1A2K A;  5G2G A;  4R1K A;  1FGQ A;  1WMN A;  2CWT A;  3LT8 A;  1JB4 A;  3UL6 A;  1D6Y A;  1A2V A;  1VQ5 3;  3T8N A;  1FUW A;  3CCJ 3;  2CIU A;  3KSP A;  3LZA A;  5IW9 A;  2GU1 A;  3PS8 A;  5AII A;  1SPU A;  4L7K A;  1JN5 B;  1KWI A;  4N3V A;  2CW9 A;  3DXO A;  4HM8 B;  1QAL A;  1FGT A;  5DRV A;  3X41 A;  1NU3 A;  2KXG A;  3F9S A;  2WGQ A;  1D6U A;  3DZL A;  5ELU A;  3CCL 3;  5IG3 A;  4HVN A;  2PZV A;  1BUQ A;  4K90 B;  4HBR A;  4BTY A;  3ECF A;  3CPO A;  4LZI A;  3LH4 A;  1YJW 3;  3H51 A;  1ZX2 A;  3BNE A;  4L8P A;  1JB5 A;  2CG0 A;  2GEX A;  8CHO A;  3HK4 A;  2W9Q A;  3GAX A;  1WMO A;  4NHF A;  1QAK A;  3NBR A;  2Y73 A;  1DMN A;  2YX9 A;  4EYC A;  1OHS A;  1MOL A;  2P05 A;  1WTH A;  3PCR A;  3QRD A;  4CDL A;  2HMM B;  5FW5 A;  1NWW A;  3F40 A;  5KP4 A;  3AMO B;  1JKG B;  1DYU A;  2OQE A;  1RKY A;  1EA2 A;  4FCZ A;  4HJL B;  4XM4 A;  1YGE A;  1M9G A;  2XFT A;  3LOY A;  2OWP A;  2O9U X;  3FF0 A;  3MWZ A;  1JJ2 2;  3FH1 A;  1DVC A;  1OF5 B;  5D81 A;  1W5Z A;  3MSO A;  5LC7 A;  1NJI 4;  2ZL8 A;  1TP6 A;  3MG2 A;  2W9P A;  3NXJ A;  3DY5 A;  3CCM 3;  3IJE B;  1VQ8 3;  2WOF A;  4N6M A;  3EBY A;  4N6V 0;  1N9E A;  3CMA 3;  2XFS A;  1UUW B;  4XDV A;  5D82 A;  2D42 A;  2QEX 3;  2OOV C;  5IF6 A;  4GL6 A;  1HU9 A;  4FCM A;  2GBW B;  3FGY A;  3IMA B;  1RN7 A;  3OWY A;  3Q90 A;  4MJD A;  1UI7 A;  1UW1 A;  3UNL A;  3S28 A;  2CC3 A;  4CCV A;  2LYX A;  5KP1 A;  1SII A;  4N6N B;  1IV7 A;  3CD6 3;  1NO3 A;  3EX9 A;  3F7X A;  2IUJ A;  3DGM A;  3VSY A;  4EBG A;  2Z6B A;  1QMA A;  4Q53 A;  5HGR A;  4I4K A;  4WYK B;  3CCU 3;  2I9W A;  4WP5 A;  1W00 A;  1KD1 4;  4FMB A;  3FG4 A;  2FXT A;  3G6E 3;  3NV0 B;  1PU4 A;  1LVN A;  3JUP A;  1G96 A;  3X3Y A;  1N9J A;  3U97 A;  5AEW B;  1R4C A;  2CG1 A;  1S72 3;  3VGN A;  2MC8 A;  3I55 3;  3HII A;  4BTW A;  3RGA A;  5CK6 A;  1O7H B;  3EQQ B;  2CFD A;  1W2Z A;  4O8S A;  3MG3 A;  1ULI B;  1YIT 3;  1GD3 A;  2GBX B;  1YVB I;  3LTA A;  1NB3 I;  3CNM A;  4WWU C;  3V92 A;  3S67 A;  3NBJ A;  4X2O A;  4RNZ A;  1O7W B;  3FCS B;  3PYJ A;  1N5H A;  3LTB A;  3WOD G;  3NHX A;  2IA7 A;  1Z1S A;  2LQV A;  3KSE D;  5CXO A;  4FMC A;  4KZ1 A;  3G16 A;  3NQY A;  3F8X A;  2CHC A;  4HM4 B;  1IDP A;  3CCV 3;  1AV4 A;  4XB5 A;  1E3V A;  3MPH A;  4MMX B;  3MG1 A;  4XDW A;  4R9L A;  4WHA A;  3DGO A;  3VF1 A;  1CYU A;  1FA3 A;  4FMD A;  2K54 A;  3RDE A;  3NX0 A;  3WDG B;  3SED A;  1SJW A;  1TFK A;  1M1K 4;  1W6G A;  3EHC A;  3BND A;  4HZ9 B;  4STD A;  2P0X A;  4HM7 B;  1DMQ A;  1VQ9 3;  3K63 A;  1W02 A;  2HMK B;  4X2H A;  1Y4K A;  3EF8 A;  5JBS A;  1IQY A;  1O7M B;  3GZX B;  2BMO B;  1JV2 B;  1Q40 B;  3N9H A;  1VQN 3;  2W2C A;  1GS3 A;  1K28 A;  1L5G B;  1GY5 A;  2D1W A;  3DUK A;  3WA2 X;  2CFW A;  1IVU A;  1JN5 A;  1STD A;  2W0Q A;  4GB5 A;  1M90 4;  1ULJ B;  1N8R 4;  3F8H A;  3B4P A;  3LTC A;  5IG4 A;  1QVG 2;  4O3V A;  3LXU X;  2RFR A;  2Q07 A;  5STD A;  1Q7Y 4;  3E99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...