2BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2bu4A00
5BU4A 1AY7A 1Q9EA 1LOVA 3A5EA 1FUSA 1JBSA 1BU4A 1RGFA 2HOHA 2SARA 2RNTA 1X1YA 1GMQA 2KAAA 4GHOA 1BRSA 6RNTA 3GSPA 5GSPA 1FW7A 1BOXA 1G02A 2RBIA 1GMPA 3WHOA 1RCKA 1RGGA 9RNTA 1RGKA 1FZUA 1UCJA 2BIRA 2C4BA 1RN1A 3D4AA 1BSEA 1BRJA 2ZA4A 6GSPA 2GSPA 3SYUA 1X1XA 1BANA 4J5KA 1I2FA 1BNJA 2AADA 3Q3FA 1RMSA 1BSCA 1B2ZA 1DETA 3BIRA 1I3IA 1CH0A 3AGOA 2KF4A 1B27A 1RN4A 1X1WA 1UCIA 1BSDA 1RLSA 1GSPA 1RNTA 1BUJA 1BIRA 3HOHA 1I8VA 1HZ1A 1BRGA 1YVSA 1MGWA 1I70A 1BNGA 3DH2A 1BRKA 2AAEA 1I0VA 1JBTA 8RNTA 1I0XA 1RGLA 1I3FA 1GOVA 3DGYA 2F56A 1TTOA 1DE3A 1BVIA 7GSPA 2KF5A 1FYSA 1RHLA 3D5GA 3RNTA 4BIRA 1BSAA 1RTUA 1UCLA 1T2HA 1I2EA 3AGNA 1BNFA 1GOYA 3BU4A 1LOYA 4J5GA 3AHSA 1RNBA 1B2XA 1SARA 1UCKA 1B20A 4RNTA 1LOWA 1RGHA 1B3SA 1I2GA 1YGWA 1MGRA 1BGSA 1C54A 3URPA 7RNTA 1BNIA 1RGAA 1GOUA 2F5WA 1TRPA 1T2IA 1B21A 1X1UA 1FUTA 4HAAA 1TRQA 2KF3A 3WR2A 1ZGXA 1BRHA 1BNEA 1JBRA 1RSNA 2F4YA 4HOHA 5HOHA 1YNVX 1IYYA 1LNIA 1BNRA 1RGEA 2KF6A 1B2UA 1BAOA 1AQZA 5RNTA 2BU4A 1B2MA 1BSBA 1LRAA 1RGCA 1GMRA 1B2SA 1BNSA 1BRNL 3AHWA 1PY3A 4GSPA 1PYLA 1HYFA 1R4YA 1RCLA 1A2PA 1BRIA 2F5MA 5BIRA 3KCHA 1RDSA 4BU4A 3D5IA
chains in the Genus database with same CATH superfamily
3HX8A 2R4IA 3NXJA 4XM4A 2INXA 5AIHA 2L4VA 1BU4A 3O8YA 2K3DA 4GHOA 3I553 5CLKA 1G0TA 3M8CA 4BTYA 3BNBA 4GB5A 1OF5B 3F14A 3FH1A 2O9UX 3LYGA 2CIUA 3G4S3 1ZS7A 4HKVB 1LQMB 4IPBA 1S723 3G8ZA 1G02A 3N9HA 4XB5A 4BL3A 4KVHA 1VQK3 2A15A 2V1LA 2W2CA 3K0ZA 1IK3A 3GZYB 1Q814 1KD14 1BSEA 4HZBB 1O7PB 3CCS3 1EEJA 3N54B 1X1XA 2STDA 4J5KA 3IMAB 2P38A 1YJW3 4HJLB 1I2FA 1JB2A 2CWUA 2CFKA 2D1WA 1OH0A 1RMSA 5D82A 3U97A 1KC84 1DVCA 2SBLA 4H3UA 1W2ZA 3PYJA 4I4KA 3B7CA 3AGOA 2HMOB 5JBSA 1UCIA 5IG0A 4OK0A 4K1UA 4KFFA 1Z1SA 5KP3A 3PGBA 4U13A 1IQ8A 4AKYA 2XR8B 3HOHA 1O7NB 1E97A 1IQXA 1UW1A 2JDIH 3DM8A 2CX0A 4I5QA 3K63A 5G1KA 1KQS2 1W6CA 1YJ93 1OGXA 4HM1B 1BUQA 1I3FA 1GOVA 1Q42A 2XGLA 3SX1A 2F56A 3MG2A 1IVVA 3HZPA 2F86B 3ALAA 3X41A 2KXGA 5ELJA 4WWUC 4LZIA 4NPBA 2QIYA 2H0GA 2UX0A 1WTHA 3CC23 1T2HA 1DYUA 3BU4A 4TX4A 4XBXA 1GYBA 1LOYA 2F98A 4FMCA 3RDEA 3HIIA 1RNBA 1AVKA 2ZDJA 2HMLB 1MWRA 3OWUA 4FCZA 3SLUA 2L1SA 3ECFA 1ZO2A 1J2BA 2XH9A 3H51A 4K61A 1CQSA 3EN1B 1N8R4 5IERA 4R9KA 5EEOA 4J9AA 1B21A 1X1UA 3I563 3JUNA 2CC3A 3WA3A 2B1XB 2KF3A 2QEX3 1GD4A 3WOFB 1AVLA 2CH9A 2W6JH 1UI8A 2RFRA 2F4YA 5HOHA 2ZHXB 1LQGC 3CCV3 1IQYA 3AMOB 1Q824 3OX9A 1O7GB 2YFJB 3LH4A 1BAOA 5BVBA 1B2MA 1LRAA 4WHAA 1FGQA 1U5OA 1N8QA 1L5GB 3F8XA 1FGOA 2XGNA 4HM8B 1HYFA 3ER7A 2FNQA 3DGOA 3G6E3 3K7CA 3FF2A 3DY5A 3VF1A 1A2PA 1OPYA 3IPTA 3LTCA 1PFPA 3KCHA 4FCMA 5ELUA 5GSPA 1RDSA 4Q53A 3D5IA 1YHQ3 3TDGA 3JUPA 2RSXA 3GZRA 1O7WB 4ZM8A 1YIT3 3Q1CA 2E2TA 1DVDA 2FGTA 1AY7A 2BNGA 3A5EA 5FGOA 2BHMA 2CG1A 1ASKA 1DMNA 2GBWB 2UGIA 2K54A 4FMAA 1JN5A 2O3OA 2WO0A 1IVWA 1FGMA 1ROAA 1RN7A 3PZWA 3PS8A 4N6UA 3MYTA 4G1MB 5M18A 3KE7A 3ZG0A 3KFQC 3CCM3 5AIIA 3CNXA 3EBTA 1FZUA 1W5ZA 1OF5A 3SOAA 2Y74A 1N5PA 3EQQB 2HMKB 1VQ73 3D4AA 4IIAA 5IEPA 1IV9A 1BRJA 1QAKA 2BO9B 3A76A 1N9EA 2GSPA 3SYUA 5IG3A 6STDA 3EX9A 4HM3B 4AEQA 3FLJA 3DGMA 3NM2A 4R4KA 3MG1A 1QAFA 2WGOA 1VQ53 1BSCA 1W02A 1B2ZA 1DETA 3JUMA 1YJN3 1CH0A 2KF4A 1X1WA 3LT9A 2XFTA 2I9WA 1W00A 2XFSA 5AIGA 2HMNB 4KT3B 2OWPA 4ORLA 3DMCA 2H0HA 3EJVA 3CCJ3 1IDPA 3KIIA 1BIRA 1O7MB 1OHPA 1TP6A 2M7OA 3GAXA 2C10A 3S27A 1HZ1A 5CF2A 1YVSA 3EB8A 3FCSB 1W6YA 1T3BA 1I70A 1OACA 3F9SA 2IYJA 2FXTA 2BMOB 3G0KA 1BRKA 1I0VA 1I0XA 1FGRA 1UDII 2PZVA 1HKXA 1DE3A 3LOYA 1LXEA 3T8UA 1JB4A 1EQKA 5M19A 1ROVA 1SJWA 3D5GA 3RNTA 1GY5A 3V99A 4BL2A 1TJDA 1NWWA 4HBRA 1TIJA 1UCLA 3AGNA 1N5HA 1BNFA 1T5YA 3JUOA 2BMQB 3S29A 3OW22 4DKIA 1AR0A 3EBYA 3L0RA 4MEIA 3VGNA 1B2XA 1SARA 4WP5A 1UCKA 2QGUA 3B4OA 1EUIC 3CC73 1CEWI 1K28A 3OV4A 4HM4B 1RGHA 1B3SA 3NHXA 1YGWA 3KN4A 1VQM3 4HM6B 2CWTA 1BNIA 1RGAA 1GOUA 4J8TA 4FMDA 2XSOB 3EHCA 1WMNA 3LMLA 3PCSA 5EQLA 4KFEA 3EN8A 2ZL8A 2HMJB 3JUQA 3S67A 1TRQA 3WMDA 3CMA3 2OTJ3 4L8PA 2RGQA 1EA2A 3OXAA 3BNEA 3NV0B 1RSNA 4HM0B 4HOHA 2W04A 1YNVX 1BNRA 1HU9A 2KF6A 3BNDA 4N6LA 3KSPA 1MNLA 1MWTA 5CXOA 1BSBA 2W56B 5IG5A 1GMRA 3K9MC 1SIIA 3LT8A 1B2SA 2Z76A 1LNHA 3AMOA 1BRNL 1PY3A 1D6ZA 1QJGA 5CF1A 4GSPA 7STDA 3MPHA 1YIJ3 1KWIA 1Q40A 3Q2PA 1GY7A 2E2UA 4HM2B 1YGEA 5AIFA 3WOEB 1WQLB 5BIRA 3GWRA 2CFLA 4BIRA 4BU4A 1IYYA 2CW9A 3UNLA 3SOYA 1ULJB 4LGQA 1DMQA 1MOLA 2IY2A 3OWYA 4OVMA 1NB3I 1V74A 2KRTA 3D3LA 1QVG2 1JBSA 3FG3A 3V92A 1W2B2 2RNTA 1X1YA 2IA7A 2KAAA 3FF0A 3UJMA 1TU5A 6RNTA 3G713 5EVHA 1US1A 4MJDA 1FW7A 1MWSA 2XRXB 1OGZA 1W6GA 1OCVA 1JKGB 1Q40B 4RBNA 3T0UA 4BTXA 2RBIA 3GRDA 3WHOA 1IV7A 2OOVC 2R41A 3EC9A 4XBTA 3CXC2 1RGKA 1IU7A 2CX1A 2BIRA 1QMAA 3B4PA 1M1K4 1RN1A 4EYCA 4N6TA 5G2GA 6GSPA 3CCE3 3K5TA 1UI7A 3CPOA 1O7HB 1Q7Y4 1BNJA 1D6UA 1IT8A 3B8LA 3FG4A 3Q3FA 1YI23 3NQYA 4N6MA 1VQ43 1I3IA 2C11A 3NBJA 1RN4A 2HMMB 1VQ83 1W01A 1BSDA 2GXFA 3CME3 1RLSA 1GSPA 4WYKB 1BUJA 1E3RA 3DXOA 3NBRA 4O02B 3S28A 3CNMA 1BRGA 3SXXA 1NNVA 1STFI 2K0MA 3JVCA 2Y73A 1MGWA 3LXUX 2E2VA 3WA2X 3X3YA 3CCL3 4FCJA 1D6YA 1N9JA 1GY6A 3FZWA 1DMMA 3X3ZA 8RNTA 2GU1A 1QALA 5BXQA 2CK3H 4HM5B 4N6OB 3BNCA 3DGYA 4AKZA 1TTOA 1WMPA 1M1XB 1BVIA 2P0XA 1SIHA 3HIGA 3F7SA 2KF5A 1FUWA 1VZZA 2JQ5A 3N8BA 1K9M4 2XEPA 5AEWB 1BSAA 1Q7HA 1RTUA 3BB9A 4KFDA 1VQ93 1I2EA 2WOFA 5A0OB 1GOYA 1W4NA 5CK6A 3X3XA 1JJ22 4OUQA 5IF6A 4RNZA 4JRFA 1UUVB 1LVNA 2OQEC 2B24B 2UUGC 1B20A 4H61A 4WFOA 3T8NA 2XF3A 3UL5A 5JPPA 4RNTA 4XDVA 1V58A 1LOWA 3D9RA 1RKYA 5JPUA 1I2GA 1MGRA 1BGSA 2P09A 4HZ9B 5IEOA 3OWSA 3URPA 3E99A 3FGYA 3LTAA 5D83A 1K41A 1JRQA 3X42A 1VQ63 3LTBA 1T2IA 4GL6A 1NO3A 1Q864 2W9PA 1FUTA 4RZMA 1BNEA 4EXRA 1JBRA 2D42A 1LOXA 1AV4A 1LNIA 3D79A 1RGEA 4X2HA 1B2UA 3HI7A 2W9QA 2IUJA 1AQZA 5RNTA 4EBGA 1ISKA 4CJNA 4NREA 4RNYA 3KZTA 2YFIB 1SPUA 3NUVA 1NDOB 3NV0A 1M9GA 3GZXB 2Z77A 3LZAA 1CYUA 5LC6A 5IG4A 3AHWA 2GEYA 1NU3A 1F8NA 2W56A 3S5CA 1R4YA 2GBXB 3H3HA 4EV5A 1RJOA 3FG1A 1BRIA 2GU3A 3CU3A 3X40A 5I97A 1IVXA 4STDA 3NBBA 5FW5A 1NB5I 3HK4A 3KSED 5BU4A 1C7HA 1OHOA 1VQO3 1VQQA 1Q9EA 1LOVA 1FUSA 5DRVA 2HOHA 1RGFA 2SARA 2YFLB 2J8XB 1GMQA 2LQVA 5KP4A 2P0MA 1BRSA 3DGNA 4LMIA 3GSPA 1VQP3 2F99A 1A90A 3GZBA 1M904 4O3VA 5G1LA 1FGTA 1U8CB 1BOXA 4KZ1A 4PEJA 2MC8A 1GMPA 1NJI4 1FA3A 1RCKA 1RGGA 4HM7B 1PU4A 5LC7A 9RNTA 1UCJA 4O8SA 2C4BA 3CPW2 4EW5A 2ZA4A 1JKGA 1UUWB 4LSOA 3MWZA 4ILFA 4MMYB 1VQL3 1STDA 1BANA 5AI1A 5DREA 5AYRB 1OUNA 5IENA 5HGRA 2AADA 3WDGB 5TGNA 3V98A 1UGHI 2KCDA 5AYSC 3G16A 4EC6A 3BIRA 1K734 2CFWA 3U1WA 2Z7AA 1B27A 5M1AA 1IVUA 3UB1A 2CFDA 4FR9A 3QK9A 1UUGB 5AEUB 3LTDA 3NM7A 1RNTA 3BLZA 2PNCA 1I8VA 5IW9A 2WGQA 2RCDA 4CCVA 1EG9B 1A67A 1R4CA 4QWTA 1BNGA 3DH2A 2AAEA 8CHOA 1YVBI 4WYKA 3CCQ3 1JBTA 1RGLA 3STDA 1TUHA 3DZLA 1UGIA 3MHEA 4N6NB 2Z6BA 3J7Yd 2WOHA 2CKFB 3KKGA 3QRDA 5STDA 1GS3A 7GSPA 2BMRB 1Y4KA 3DGLA 3FKAA 3IJEB 4HYZA 4BTWA 4N3VA 1FYSA 1RHLA 2ML6A 2OOVA 1JNQA 4MMZB 3UL6A 3CCR3 1G96A 3FSDA 1OHSA 1ULIB 1V57A 2W0QA 3I0YA 4LEHA 4O2HA 3CD63 3F7XA 3PXMA 4L7KA 4NHFA 4CDLA 3DUKA 1ZX2A 2OCTA 4J5GA 1JB5A 3AHSA 3CC43 1QVF2 1A2KA 1GD3A 1JZOA 1JZDA 1VQN3 2LYXA 1MWUA 4R9LA 4X2OA 4EV2A 4CPKA 3F40A 1C54A 3SEDA 5D81A 3RGAA 4HVNA 7RNTA 3VSYA 1CYVA 1RRLA 1IT7A 2F5WA 1A2VA 3EF8A 4N6V0 1TRPA 3RGRA 3F8HA 5KP1A 2P05A 2CWVA 4HAAA 2W03A 3ZG5A 1RRHA 1ZGXA 1BRHA 3WR2A 3NX0A 3Q90A 2Q07A 1WMOA 4MMXB 1JV2B 2IUKA 3ZFZA 2QA43 2IMJA 4IT7A 4XDWA 1TFOA 2H0IA 1WNHA 2BU4A 3PCRA 1SQWA 1RGCA 3MKIA 3NQZA 1K8A4 2YX9A 2OQEA 1E3VA 2MF7A 1S5AA 2XSHB 1W7CA 1BNSA 4LYLB 4K90B 2CG0A 4R1KA 2OTL3 3MSOA 1EKMA 3CCU3 4XBYA 2ML5A 1KSIA 1PYLA 4R80A 2GEXA 3SVAA 2CFGA 4FMBA 4K1VA 3ROBA 1RCLA 3WODG 1TFKA 2CHCA 2BT3A 3EE1A 2F5MA 3MG3A 4JF8A 1JN5B 4L8OA
chains in the Genus database with same CATH topology
5BU4A 1AY7A 1Q9EA 1LOVA 3A5EA 1FUSA 1JBSA 1BU4A 1RGFA 2HOHA 2SARA 2RNTA 1X1YA 1GMQA 2KAAA 4GHOA 1BRSA 6RNTA 3GSPA 5GSPA 1FW7A 1BOXA 1G02A 2RBIA 1GMPA 3WHOA 1RCKA 1RGGA 9RNTA 1RGKA 1FZUA 1UCJA 2BIRA 2C4BA 1RN1A 3D4AA 1BSEA 1BRJA 2ZA4A 6GSPA 2GSPA 3SYUA 1X1XA 1BANA 4J5KA 1I2FA 1BNJA 2AADA 3Q3FA 1RMSA 1BSCA 1B2ZA 1DETA 3BIRA 1I3IA 1CH0A 3AGOA 2KF4A 1B27A 1RN4A 1X1WA 1UCIA 1BSDA 1RLSA 1GSPA 1RNTA 1BUJA 1BIRA 3HOHA 1I8VA 1HZ1A 1BRGA 1YVSA 1MGWA 1I70A 1BNGA 3DH2A 1BRKA 2AAEA 1I0VA 1JBTA 8RNTA 1I0XA 1RGLA 1I3FA 1GOVA 3DGYA 2F56A 1TTOA 1DE3A 1BVIA 7GSPA 2KF5A 1FYSA 1RHLA 3D5GA 3RNTA 4BIRA 1BSAA 1RTUA 1UCLA 1T2HA 1I2EA 3AGNA 1BNFA 1GOYA 3BU4A 1LOYA 4J5GA 3AHSA 1RNBA 1B2XA 1SARA 1UCKA 1B20A 4RNTA 1LOWA 1RGHA 1B3SA 1I2GA 1YGWA 1MGRA 1BGSA 1C54A 3URPA 7RNTA 1BNIA 1RGAA 1GOUA 2F5WA 1TRPA 1T2IA 1B21A 1X1UA 1FUTA 4HAAA 1TRQA 2KF3A 3WR2A 1ZGXA 1BRHA 1BNEA 1JBRA 1RSNA 2F4YA 4HOHA 5HOHA 1YNVX 1IYYA 1LNIA 1BNRA 1RGEA 2KF6A 1B2UA 1BAOA 1AQZA 5RNTA 2BU4A 1B2MA 1BSBA 1LRAA 1RGCA 1GMRA 1B2SA 1BNSA 1BRNL 3AHWA 1PY3A 4GSPA 1PYLA 1HYFA 1R4YA 1RCLA 1A2PA 1BRIA 2F5MA 5BIRA 3KCHA 1RDSA 4BU4A 3D5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BU4 A;  1AY7 A;  1Q9E A;  1LOV A;  3A5E A;  1FUS A;  1JBS A;  1BU4 A;  1RGF A;  2HOH A;  2SAR A;  2RNT A;  1X1Y A;  1GMQ A;  2KAA A;  4GHO A;  1BRS A;  6RNT A;  3GSP A;  5GSP A;  1FW7 A;  1BOX A;  1G02 A;  2RBI A;  1GMP A;  3WHO A;  1RCK A;  1RGG A;  9RNT A;  1RGK A;  1FZU A;  1UCJ A;  2BIR A;  2C4B A;  1RN1 A;  3D4A A;  1BSE A;  1BRJ A;  2ZA4 A;  6GSP A;  2GSP A;  3SYU A;  1X1X A;  1BAN A;  4J5K A;  1I2F A;  1BNJ A;  2AAD A;  3Q3F A;  1RMS A;  1BSC A;  1B2Z A;  1DET A;  3BIR A;  1I3I A;  1CH0 A;  3AGO A;  2KF4 A;  1B27 A;  1RN4 A;  1X1W A;  1UCI A;  1BSD A;  1RLS A;  1GSP A;  1RNT A;  1BUJ A;  1BIR A;  3HOH A;  1I8V A;  1HZ1 A;  1BRG A;  1YVS A;  1MGW A;  1I70 A;  1BNG A;  3DH2 A;  1BRK A;  2AAE A;  1I0V A;  1JBT A;  8RNT A;  1I0X A;  1RGL A;  1I3F A;  1GOV A;  3DGY A;  2F56 A;  1TTO A;  1DE3 A;  1BVI A;  7GSP A;  2KF5 A;  1FYS A;  1RHL A;  3D5G A;  3RNT A;  4BIR A;  1BSA A;  1RTU A;  1UCL A;  1T2H A;  1I2E A;  3AGN A;  1BNF A;  1GOY A;  3BU4 A;  1LOY A;  4J5G A;  3AHS A;  1RNB A;  1B2X A;  1SAR A;  1UCK A;  1B20 A;  4RNT A;  1LOW A;  1RGH A;  1B3S A;  1I2G A;  1YGW A;  1MGR A;  1BGS A;  1C54 A;  3URP A;  7RNT A;  1BNI A;  1RGA A;  1GOU A;  2F5W A;  1TRP A;  1T2I A;  1B21 A;  1X1U A;  1FUT A;  4HAA A;  1TRQ A;  2KF3 A;  3WR2 A;  1ZGX A;  1BRH A;  1BNE A;  1JBR A;  1RSN A;  2F4Y A;  4HOH A;  5HOH A;  1YNV X;  1IYY A;  1LNI A;  1BNR A;  1RGE A;  2KF6 A;  1B2U A;  1BAO A;  1AQZ A;  5RNT A;  2BU4 A;  1B2M A;  1BSB A;  1LRA A;  1RGC A;  1GMR A;  1B2S A;  1BNS A;  1BRN L;  3AHW A;  1PY3 A;  4GSP A;  1PYL A;  1HYF A;  1R4Y A;  1RCL A;  1A2P A;  1BRI A;  2F5M A;  5BIR A;  3KCH A;  1RDS A;  4BU4 A;  3D5I A; 
#chains in the Genus database with same CATH topology
 3HX8 A;  2R4I A;  3NXJ A;  4XM4 A;  2INX A;  5AIH A;  2L4V A;  1BU4 A;  3O8Y A;  2K3D A;  4GHO A;  3I55 3;  5CLK A;  1G0T A;  3M8C A;  4BTY A;  3BNB A;  4GB5 A;  1OF5 B;  3F14 A;  3FH1 A;  2O9U X;  3LYG A;  2CIU A;  3G4S 3;  1ZS7 A;  4HKV B;  1LQM B;  4IPB A;  1S72 3;  3G8Z A;  1G02 A;  3N9H A;  4XB5 A;  4BL3 A;  4KVH A;  1VQK 3;  2A15 A;  2V1L A;  2W2C A;  3K0Z A;  1IK3 A;  3GZY B;  1Q81 4;  1KD1 4;  1BSE A;  4HZB B;  1O7P B;  3CCS 3;  1EEJ A;  3N54 B;  1X1X A;  2STD A;  4J5K A;  3IMA B;  2P38 A;  1YJW 3;  4HJL B;  1I2F A;  1JB2 A;  2CWU A;  2CFK A;  2D1W A;  1OH0 A;  1RMS A;  5D82 A;  3U97 A;  1KC8 4;  1DVC A;  2SBL A;  4H3U A;  1W2Z A;  3PYJ A;  4I4K A;  3B7C A;  3AGO A;  2HMO B;  5JBS A;  1UCI A;  5IG0 A;  4OK0 A;  4K1U A;  4KFF A;  1Z1S A;  5KP3 A;  3PGB A;  4U13 A;  1IQ8 A;  4AKY A;  2XR8 B;  3HOH A;  1O7N B;  1E97 A;  1IQX A;  1UW1 A;  2JDI H;  3DM8 A;  2CX0 A;  4I5Q A;  3K63 A;  5G1K A;  1KQS 2;  1W6C A;  1YJ9 3;  1OGX A;  4HM1 B;  1BUQ A;  1I3F A;  1GOV A;  1Q42 A;  2XGL A;  3SX1 A;  2F56 A;  3MG2 A;  1IVV A;  3HZP A;  2F86 B;  3ALA A;  3X41 A;  2KXG A;  5ELJ A;  4WWU C;  4LZI A;  4NPB A;  2QIY A;  2H0G A;  2UX0 A;  1WTH A;  3CC2 3;  1T2H A;  1DYU A;  3BU4 A;  4TX4 A;  4XBX A;  1GYB A;  1LOY A;  2F98 A;  4FMC A;  3RDE A;  3HII A;  1RNB A;  1AVK A;  2ZDJ A;  2HML B;  1MWR A;  3OWU A;  4FCZ A;  3SLU A;  2L1S A;  3ECF A;  1ZO2 A;  1J2B A;  2XH9 A;  3H51 A;  4K61 A;  1CQS A;  3EN1 B;  1N8R 4;  5IER A;  4R9K A;  5EEO A;  4J9A A;  1B21 A;  1X1U A;  3I56 3;  3JUN A;  2CC3 A;  3WA3 A;  2B1X B;  2KF3 A;  2QEX 3;  1GD4 A;  3WOF B;  1AVL A;  2CH9 A;  2W6J H;  1UI8 A;  2RFR A;  2F4Y A;  5HOH A;  2ZHX B;  1LQG C;  3CCV 3;  1IQY A;  3AMO B;  1Q82 4;  3OX9 A;  1O7G B;  2YFJ B;  3LH4 A;  1BAO A;  5BVB A;  1B2M A;  1LRA A;  4WHA A;  1FGQ A;  1U5O A;  1N8Q A;  1L5G B;  3F8X A;  1FGO A;  2XGN A;  4HM8 B;  1HYF A;  3ER7 A;  2FNQ A;  3DGO A;  3G6E 3;  3K7C A;  3FF2 A;  3DY5 A;  3VF1 A;  1A2P A;  1OPY A;  3IPT A;  3LTC A;  1PFP A;  3KCH A;  4FCM A;  5ELU A;  5GSP A;  1RDS A;  4Q53 A;  3D5I A;  1YHQ 3;  3TDG A;  3JUP A;  2RSX A;  3GZR A;  1O7W B;  4ZM8 A;  1YIT 3;  3Q1C A;  2E2T A;  1DVD A;  2FGT A;  1AY7 A;  2BNG A;  3A5E A;  5FGO A;  2BHM A;  2CG1 A;  1ASK A;  1DMN A;  2GBW B;  2UGI A;  2K54 A;  4FMA A;  1JN5 A;  2O3O A;  2WO0 A;  1IVW A;  1FGM A;  1ROA A;  1RN7 A;  3PZW A;  3PS8 A;  4N6U A;  3MYT A;  4G1M B;  5M18 A;  3KE7 A;  3ZG0 A;  3KFQ C;  3CCM 3;  5AII A;  3CNX A;  3EBT A;  1FZU A;  1W5Z A;  1OF5 A;  3SOA A;  2Y74 A;  1N5P A;  3EQQ B;  2HMK B;  1VQ7 3;  3D4A A;  4IIA A;  5IEP A;  1IV9 A;  1BRJ A;  1QAK A;  2BO9 B;  3A76 A;  1N9E A;  2GSP A;  3SYU A;  5IG3 A;  6STD A;  3EX9 A;  4HM3 B;  4AEQ A;  3FLJ A;  3DGM A;  3NM2 A;  4R4K A;  3MG1 A;  1QAF A;  2WGO A;  1VQ5 3;  1BSC A;  1W02 A;  1B2Z A;  1DET A;  3JUM A;  1YJN 3;  1CH0 A;  2KF4 A;  1X1W A;  3LT9 A;  2XFT A;  2I9W A;  1W00 A;  2XFS A;  5AIG A;  2HMN B;  4KT3 B;  2OWP A;  4ORL A;  3DMC A;  2H0H A;  3EJV A;  3CCJ 3;  1IDP A;  3KII A;  1BIR A;  1O7M B;  1OHP A;  1TP6 A;  2M7O A;  3GAX A;  2C10 A;  3S27 A;  1HZ1 A;  5CF2 A;  1YVS A;  3EB8 A;  3FCS B;  1W6Y A;  1T3B A;  1I70 A;  1OAC A;  3F9S A;  2IYJ A;  2FXT A;  2BMO B;  3G0K A;  1BRK A;  1I0V A;  1I0X A;  1FGR A;  1UDI I;  2PZV A;  1HKX A;  1DE3 A;  3LOY A;  1LXE A;  3T8U A;  1JB4 A;  1EQK A;  5M19 A;  1ROV A;  1SJW A;  3D5G A;  3RNT A;  1GY5 A;  3V99 A;  4BL2 A;  1TJD A;  1NWW A;  4HBR A;  1TIJ A;  1UCL A;  3AGN A;  1N5H A;  1BNF A;  1T5Y A;  3JUO A;  2BMQ B;  3S29 A;  3OW2 2;  4DKI A;  1AR0 A;  3EBY A;  3L0R A;  4MEI A;  3VGN A;  1B2X A;  1SAR A;  4WP5 A;  1UCK A;  2QGU A;  3B4O A;  1EUI C;  3CC7 3;  1CEW I;  1K28 A;  3OV4 A;  4HM4 B;  1RGH A;  1B3S A;  3NHX A;  1YGW A;  3KN4 A;  1VQM 3;  4HM6 B;  2CWT A;  1BNI A;  1RGA A;  1GOU A;  4J8T A;  4FMD A;  2XSO B;  3EHC A;  1WMN A;  3LML A;  3PCS A;  5EQL A;  4KFE A;  3EN8 A;  2ZL8 A;  2HMJ B;  3JUQ A;  3S67 A;  1TRQ A;  3WMD A;  3CMA 3;  2OTJ 3;  4L8P A;  2RGQ A;  1EA2 A;  3OXA A;  3BNE A;  3NV0 B;  1RSN A;  4HM0 B;  4HOH A;  2W04 A;  1YNV X;  1BNR A;  1HU9 A;  2KF6 A;  3BND A;  4N6L A;  3KSP A;  1MNL A;  1MWT A;  5CXO A;  1BSB A;  2W56 B;  5IG5 A;  1GMR A;  3K9M C;  1SII A;  3LT8 A;  1B2S A;  2Z76 A;  1LNH A;  3AMO A;  1BRN L;  1PY3 A;  1D6Z A;  1QJG A;  5CF1 A;  4GSP A;  7STD A;  3MPH A;  1YIJ 3;  1KWI A;  1Q40 A;  3Q2P A;  1GY7 A;  2E2U A;  4HM2 B;  1YGE A;  5AIF A;  3WOE B;  1WQL B;  5BIR A;  3GWR A;  2CFL A;  4BIR A;  4BU4 A;  1IYY A;  2CW9 A;  3UNL A;  3SOY A;  1ULJ B;  4LGQ A;  1DMQ A;  1MOL A;  2IY2 A;  3OWY A;  4OVM A;  1NB3 I;  1V74 A;  2KRT A;  3D3L A;  1QVG 2;  1JBS A;  3FG3 A;  3V92 A;  1W2B 2;  2RNT A;  1X1Y A;  2IA7 A;  2KAA A;  3FF0 A;  3UJM A;  1TU5 A;  6RNT A;  3G71 3;  5EVH A;  1US1 A;  4MJD A;  1FW7 A;  1MWS A;  2XRX B;  1OGZ A;  1W6G A;  1OCV A;  1JKG B;  1Q40 B;  4RBN A;  3T0U A;  4BTX A;  2RBI A;  3GRD A;  3WHO A;  1IV7 A;  2OOV C;  2R41 A;  3EC9 A;  4XBT A;  3CXC 2;  1RGK A;  1IU7 A;  2CX1 A;  2BIR A;  1QMA A;  3B4P A;  1M1K 4;  1RN1 A;  4EYC A;  4N6T A;  5G2G A;  6GSP A;  3CCE 3;  3K5T A;  1UI7 A;  3CPO A;  1O7H B;  1Q7Y 4;  1BNJ A;  1D6U A;  1IT8 A;  3B8L A;  3FG4 A;  3Q3F A;  1YI2 3;  3NQY A;  4N6M A;  1VQ4 3;  1I3I A;  2C11 A;  3NBJ A;  1RN4 A;  2HMM B;  1VQ8 3;  1W01 A;  1BSD A;  2GXF A;  3CME 3;  1RLS A;  1GSP A;  4WYK B;  1BUJ A;  1E3R A;  3DXO A;  3NBR A;  4O02 B;  3S28 A;  3CNM A;  1BRG A;  3SXX A;  1NNV A;  1STF I;  2K0M A;  3JVC A;  2Y73 A;  1MGW A;  3LXU X;  2E2V A;  3WA2 X;  3X3Y A;  3CCL 3;  4FCJ A;  1D6Y A;  1N9J A;  1GY6 A;  3FZW A;  1DMM A;  3X3Z A;  8RNT A;  2GU1 A;  1QAL A;  5BXQ A;  2CK3 H;  4HM5 B;  4N6O B;  3BNC A;  3DGY A;  4AKZ A;  1TTO A;  1WMP A;  1M1X B;  1BVI A;  2P0X A;  1SIH A;  3HIG A;  3F7S A;  2KF5 A;  1FUW A;  1VZZ A;  2JQ5 A;  3N8B A;  1K9M 4;  2XEP A;  5AEW B;  1BSA A;  1Q7H A;  1RTU A;  3BB9 A;  4KFD A;  1VQ9 3;  1I2E A;  2WOF A;  5A0O B;  1GOY A;  1W4N A;  5CK6 A;  3X3X A;  1JJ2 2;  4OUQ A;  5IF6 A;  4RNZ A;  4JRF A;  1UUV B;  1LVN A;  2OQE C;  2B24 B;  2UUG C;  1B20 A;  4H61 A;  4WFO A;  3T8N A;  2XF3 A;  3UL5 A;  5JPP A;  4RNT A;  4XDV A;  1V58 A;  1LOW A;  3D9R A;  1RKY A;  5JPU A;  1I2G A;  1MGR A;  1BGS A;  2P09 A;  4HZ9 B;  5IEO A;  3OWS A;  3URP A;  3E99 A;  3FGY A;  3LTA A;  5D83 A;  1K41 A;  1JRQ A;  3X42 A;  1VQ6 3;  3LTB A;  1T2I A;  4GL6 A;  1NO3 A;  1Q86 4;  2W9P A;  1FUT A;  4RZM A;  1BNE A;  4EXR A;  1JBR A;  2D42 A;  1LOX A;  1AV4 A;  1LNI A;  3D79 A;  1RGE A;  4X2H A;  1B2U A;  3HI7 A;  2W9Q A;  2IUJ A;  1AQZ A;  5RNT A;  4EBG A;  1ISK A;  4CJN A;  4NRE A;  4RNY A;  3KZT A;  2YFI B;  1SPU A;  3NUV A;  1NDO B;  3NV0 A;  1M9G A;  3GZX B;  2Z77 A;  3LZA A;  1CYU A;  5LC6 A;  5IG4 A;  3AHW A;  2GEY A;  1NU3 A;  1F8N A;  2W56 A;  3S5C A;  1R4Y A;  2GBX B;  3H3H A;  4EV5 A;  1RJO A;  3FG1 A;  1BRI A;  2GU3 A;  3CU3 A;  3X40 A;  5I97 A;  1IVX A;  4STD A;  3NBB A;  5FW5 A;  1NB5 I;  3HK4 A;  3KSE D;  5BU4 A;  1C7H A;  1OHO A;  1VQO 3;  1VQQ A;  1Q9E A;  1LOV A;  1FUS A;  5DRV A;  2HOH A;  1RGF A;  2SAR A;  2YFL B;  2J8X B;  1GMQ A;  2LQV A;  5KP4 A;  2P0M A;  1BRS A;  3DGN A;  4LMI A;  3GSP A;  1VQP 3;  2F99 A;  1A90 A;  3GZB A;  1M90 4;  4O3V A;  5G1L A;  1FGT A;  1U8C B;  1BOX A;  4KZ1 A;  4PEJ A;  2MC8 A;  1GMP A;  1NJI 4;  1FA3 A;  1RCK A;  1RGG A;  4HM7 B;  1PU4 A;  5LC7 A;  9RNT A;  1UCJ A;  4O8S A;  2C4B A;  3CPW 2;  4EW5 A;  2ZA4 A;  1JKG A;  1UUW B;  4LSO A;  3MWZ A;  4ILF A;  4MMY B;  1VQL 3;  1STD A;  1BAN A;  5AI1 A;  5DRE A;  5AYR B;  1OUN A;  5IEN A;  5HGR A;  2AAD A;  3WDG B;  5TGN A;  3V98 A;  1UGH I;  2KCD A;  5AYS C;  3G16 A;  4EC6 A;  3BIR A;  1K73 4;  2CFW A;  3U1W A;  2Z7A A;  1B27 A;  5M1A A;  1IVU A;  3UB1 A;  2CFD A;  4FR9 A;  3QK9 A;  1UUG B;  5AEU B;  3LTD A;  3NM7 A;  1RNT A;  3BLZ A;  2PNC A;  1I8V A;  5IW9 A;  2WGQ A;  2RCD A;  4CCV A;  1EG9 B;  1A67 A;  1R4C A;  4QWT A;  1BNG A;  3DH2 A;  2AAE A;  8CHO A;  1YVB I;  4WYK A;  3CCQ 3;  1JBT A;  1RGL A;  3STD A;  1TUH A;  3DZL A;  1UGI A;  3MHE A;  4N6N B;  2Z6B A;  3J7Y d;  2WOH A;  2CKF B;  3KKG A;  3QRD A;  5STD A;  1GS3 A;  7GSP A;  2BMR B;  1Y4K A;  3DGL A;  3FKA A;  3IJE B;  4HYZ A;  4BTW A;  4N3V A;  1FYS A;  1RHL A;  2ML6 A;  2OOV A;  1JNQ A;  4MMZ B;  3UL6 A;  3CCR 3;  1G96 A;  3FSD A;  1OHS A;  1ULI B;  1V57 A;  2W0Q A;  3I0Y A;  4LEH A;  4O2H A;  3CD6 3;  3F7X A;  3PXM A;  4L7K A;  4NHF A;  4CDL A;  3DUK A;  1ZX2 A;  2OCT A;  4J5G A;  1JB5 A;  3AHS A;  3CC4 3;  1QVF 2;  1A2K A;  1GD3 A;  1JZO A;  1JZD A;  1VQN 3;  2LYX A;  1MWU A;  4R9L A;  4X2O A;  4EV2 A;  4CPK A;  3F40 A;  1C54 A;  3SED A;  5D81 A;  3RGA A;  4HVN A;  7RNT A;  3VSY A;  1CYV A;  1RRL A;  1IT7 A;  2F5W A;  1A2V A;  3EF8 A;  4N6V 0;  1TRP A;  3RGR A;  3F8H A;  5KP1 A;  2P05 A;  2CWV A;  4HAA A;  2W03 A;  3ZG5 A;  1RRH A;  1ZGX A;  1BRH A;  3WR2 A;  3NX0 A;  3Q90 A;  2Q07 A;  1WMO A;  4MMX B;  1JV2 B;  2IUK A;  3ZFZ A;  2QA4 3;  2IMJ A;  4IT7 A;  4XDW A;  1TFO A;  2H0I A;  1WNH A;  2BU4 A;  3PCR A;  1SQW A;  1RGC A;  3MKI A;  3NQZ A;  1K8A 4;  2YX9 A;  2OQE A;  1E3V A;  2MF7 A;  1S5A A;  2XSH B;  1W7C A;  1BNS A;  4LYL B;  4K90 B;  2CG0 A;  4R1K A;  2OTL 3;  3MSO A;  1EKM A;  3CCU 3;  4XBY A;  2ML5 A;  1KSI A;  1PYL A;  4R80 A;  2GEX A;  3SVA A;  2CFG A;  4FMB A;  4K1V A;  3ROB A;  1RCL A;  3WOD G;  1TFK A;  2CHC A;  2BT3 A;  3EE1 A;  2F5M A;  3MG3 A;  4JF8 A;  1JN5 B;  4L8O A; 
#chains in the Genus database with same CATH homology
 5BU4 A;  1AY7 A;  1Q9E A;  1LOV A;  3A5E A;  1FUS A;  1JBS A;  1BU4 A;  1RGF A;  2HOH A;  2SAR A;  2RNT A;  1X1Y A;  1GMQ A;  2KAA A;  4GHO A;  1BRS A;  6RNT A;  3GSP A;  5GSP A;  1FW7 A;  1BOX A;  1G02 A;  2RBI A;  1GMP A;  3WHO A;  1RCK A;  1RGG A;  9RNT A;  1RGK A;  1FZU A;  1UCJ A;  2BIR A;  2C4B A;  1RN1 A;  3D4A A;  1BSE A;  1BRJ A;  2ZA4 A;  6GSP A;  2GSP A;  3SYU A;  1X1X A;  1BAN A;  4J5K A;  1I2F A;  1BNJ A;  2AAD A;  3Q3F A;  1RMS A;  1BSC A;  1B2Z A;  1DET A;  3BIR A;  1I3I A;  1CH0 A;  3AGO A;  2KF4 A;  1B27 A;  1RN4 A;  1X1W A;  1UCI A;  1BSD A;  1RLS A;  1GSP A;  1RNT A;  1BUJ A;  1BIR A;  3HOH A;  1I8V A;  1HZ1 A;  1BRG A;  1YVS A;  1MGW A;  1I70 A;  1BNG A;  3DH2 A;  1BRK A;  2AAE A;  1I0V A;  1JBT A;  8RNT A;  1I0X A;  1RGL A;  1I3F A;  1GOV A;  3DGY A;  2F56 A;  1TTO A;  1DE3 A;  1BVI A;  7GSP A;  2KF5 A;  1FYS A;  1RHL A;  3D5G A;  3RNT A;  4BIR A;  1BSA A;  1RTU A;  1UCL A;  1T2H A;  1I2E A;  3AGN A;  1BNF A;  1GOY A;  3BU4 A;  1LOY A;  4J5G A;  3AHS A;  1RNB A;  1B2X A;  1SAR A;  1UCK A;  1B20 A;  4RNT A;  1LOW A;  1RGH A;  1B3S A;  1I2G A;  1YGW A;  1MGR A;  1BGS A;  1C54 A;  3URP A;  7RNT A;  1BNI A;  1RGA A;  1GOU A;  2F5W A;  1TRP A;  1T2I A;  1B21 A;  1X1U A;  1FUT A;  4HAA A;  1TRQ A;  2KF3 A;  3WR2 A;  1ZGX A;  1BRH A;  1BNE A;  1JBR A;  1RSN A;  2F4Y A;  4HOH A;  5HOH A;  1YNV X;  1IYY A;  1LNI A;  1BNR A;  1RGE A;  2KF6 A;  1B2U A;  1BAO A;  1AQZ A;  5RNT A;  2BU4 A;  1B2M A;  1BSB A;  1LRA A;  1RGC A;  1GMR A;  1B2S A;  1BNS A;  1BRN L;  3AHW A;  1PY3 A;  4GSP A;  1PYL A;  1HYF A;  1R4Y A;  1RCL A;  1A2P A;  1BRI A;  2F5M A;  5BIR A;  3KCH A;  1RDS A;  4BU4 A;  3D5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...