2BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2bu4A00
1BANA 1IYYA 4J5GA 3KCHA 3HOHA 2BIRA 1RGEA 1SARA 1RGCA 1BNEA 1YGWA 1CH0A 1BUJA 1A2PA 1BNJA 1BSAA 1AQZA 1RCLA 7GSPA 2C4BA 1ZGXA 2HOHA 5RNTA 1BRIA 2KF4A 1GMRA 1BIRA 4HAAA 5HOHA 4GSPA 1RGGA 2ZA4A 1GMQA 1BSCA 3URPA 5BIRA 2F5WA 2AADA 1I2GA 1TRQA 1GMPA 4J5KA 3AGNA 1DETA 5BU4A 6GSPA 1RGAA 1FUTA 3RNTA 3AHSA 1BGSA 3AGOA 1PY3A 3A5EA 3DH2A 1BAOA 1LOYA 1BRJA 1TRPA 1I2FA 1RGFA 1B2MA 7RNTA 1B20A 1BRHA 1BSDA 2F56A 1GSPA 1T2HA 4GHOA 1UCJA 1FUSA 1I2EA 1X1XA 3D4AA 1JBSA 1T2IA 9RNTA 1RN4A 3SYUA 2KAAA 1GOVA 1LOWA 1RCKA 1BU4A 1BNFA 3GSPA 6RNTA 1RGKA 1MGWA 1B3SA 1RN1A 1I8VA 1RGHA 2F4YA 3D5IA 1X1WA 1G02A 1BRKA 4RNTA 1JBRA 2F5MA 1RSNA 5GSPA 1BNIA 1HYFA 1JBTA 4BIRA 1AY7A 1B2XA 1YVSA 1B2ZA 1UCKA 1I3FA 1TTOA 1FW7A 1LOVA 3D5GA 2RBIA 1GOUA 1I70A 1RGLA 1LRAA 1MGRA 1BOXA 1FYSA 1GOYA 1I0VA 2KF5A 1C54A 1FZUA 1RTUA 1DE3A 1PYLA 4HOHA 1BSBA 1YNVX 3DGYA 1UCLA 3BU4A 1B21A 1BSEA 1BRGA 1RMSA 1RDSA 1Q9EA 2KF6A 1BVIA 2KF3A 1B27A 1B2SA 1BNRA 1UCIA 1BRSA 2GSPA 4BU4A 1X1UA 1RNBA 3WHOA 1RLSA 8RNTA 3Q3FA 1B2UA 1RHLA 2BU4A 2RNTA 3AHWA 2SARA 1I3IA 1I0XA 1BRNL 1HZ1A 2AAEA 3WR2A 1R4YA 1BNSA 1X1YA 1LNIA 1RNTA 3BIRA 1BNGA
chains in the Genus database with same CATH superfamily
4XDVA 5AI1A 1IYYA 3V98A 1K8A4 3G16A 3HOHA 1RGCA 3LZAA 4WWUC 1YGWA 1ZO2A 1E97A 2B24B 1KD14 2WGOA 2OOVA 1BSAA 3HIGA 3DXOA 4ILFA 3MWZA 2QA43 1Q40B 1WQLB 1OH0A 2OQEC 1Q7HA 4OK0A 4AEQA 3OWSA 3DMCA 3DM8A 4HM8B 5BIRA 3B7CA 1Q814 3JUQA 1TRQA 4STDA 3E99A 1N9EA 1QJGA 3FH1A 4J5KA 5D81A 5IERA 1OF5A 2WGQA 3MSOA 3X3YA 1M1K4 5G1KA 6GSPA 5D82A 3VSYA 3IJEB 1SQWA 2C10A 1OACA 4N3VA 4BTWA 3AHSA 1VQ63 1F8NA 1YIJ3 1K28A 5AIHA 2ZDJA 2GU3A 3CC23 1LOYA 1TJDA 4XM4A 1JN5B 1I2FA 4FMCA 3SLUA 3PCRA 3ER7A 2WOHA 3J7Yd 3N8BA 1W5ZA 5HGRA 3ALAA 4TX4A 5EEOA 1U8CB 1IVXA 2OQEA 4BL3A 4XB5A 5JPPA 4GB5A 1T2IA 1D6UA 3PZWA 5M1AA 3HK4A 1RN4A 2KAAA 1Q7Y4 2B1XB 4MMYB 7STDA 1VQQA 1YVBI 5AEUB 1GOVA 1Z1SA 2CW9A 2JDIH 1NDOB 2UGIA 4H61A 2GEXA 1FA3A 4XBYA 2W9PA 3G4S3 3U97A 1MGWA 2F86B 3V92A 2CK3H 3G0KA 3D79A 2F4YA 3T8UA 5JBSA 3ZG0A 3HX8A 3D5IA 1LNHA 2V1LA 3EC9A 3K7CA 4L7KA 5KP3A 1A2VA 1G02A 1S5AA 3JUNA 1W6YA 4FMAA 2RSXA 2UX0A 1CEWI 5IG3A 3U1WA 1RSNA 1JB5A 3X40A 2R41A 2CWUA 3BLZA 3GZBA 1JV2B 1B2XA 2R4IA 2QGUA 1FW7A 1MNLA 1Q40A 1IVVA 1QAFA 1KC84 1DYUA 1UGIA 3RGRA 3OX9A 1GOUA 1YJN3 1I70A 1Q824 3WDGB 3KIIA 3FG4A 2RFRA 3S5CA 4AKZA 5AYRB 1M904 2IUKA 1GOYA 1Y4KA 1I0VA 1EG9B 2HMJB 1UW1A 2CFGA 3AMOB 3T8NA 4HM5B 2ZL8A 1PYLA 1WMOA 2C11A 4L8OA 3BU4A 5CF1A 2F99A 1RMSA 8CHOA 2IMJA 3T0UA 2ZHXB 3CPOA 5CK6A 3JUOA 4EV5A 1E3RA 4PEJA 2BMRB 2W6JH 1YI23 5DREA 1RLSA 3WHOA 1IK3A 1JRQA 1JNQA 2HMMB 2KRTA 2L4VA 3LTDA 1QVF2 3LMLA 2BU4A 1UI7A 2RNTA 3AHWA 2SARA 3CNXA 4WYKA 2A15A 1UI8A 1I0XA 1BRNL 2BNGA 2AAEA 1OPYA 3K5TA 1R4YA 3RDEA 2CWVA 1O7MB 5BXQA 5LC7A 1X1YA 2INXA 1LNIA 1IT7A 2O9UX 1BANA 4HJLB 2JQ5A 3KCHA 3SVAA 3ZG5A 2BIRA 1RGEA 4K61A 1N5HA 1BNEA 2KCDA 1M1XB 4AKYA 4LMIA 1BUJA 1A2PA 4NHFA 3MYTA 3CCM3 1G96A 1UUVB 7GSPA 1ZGXA 2HOHA 2YX9A 3GZXB 5RNTA 1TFKA 1GMRA 1BIRA 1W2ZA 2W9QA 5HOHA 2XF3A 4KFFA 4R80A 3VF1A 4KFEA 3B4PA 2ZA4A 3WA2X 3X42A 1GMQA 1BSCA 1DVCA 3PS8A 1ISKA 3H3HA 3EHCA 1IQYA 5IENA 1NB3I 5KP1A 5FW5A 1GMPA 2CG1A 3DGNA 4MMXB 5BU4A 1EKMA 5LC6A 2K3DA 1DVDA 4RNYA 2MF7A 5IEOA 1RRHA 3RNTA 3S27A 4JF8A 1SPUA 3DY5A 4HM1B 3FF0A 2GBXB 4DKIA 1PY3A 4NREA 3DH2A 1BAOA 3MKIA 3N54B 4XDWA 3MG2A 1TRPA 4WYKB 3LH4A 4U13A 1RJOA 4I5QA 3SEDA 3IMAB 4N6OB 4BL2A 5CLKA 4CDLA 1OHOA 1IV9A 1BSDA 2OOVC 1M9GA 5EVHA 4GL6A 3GWRA 1ASKA 4XBTA 1HKXA 1X1XA 1DMQA 2O3OA 3LTBA 1IU7A 1W7CA 2SBLA 3F8XA 2UUGC 2CH9A 2K0MA 2BT3A 6STDA 3GSPA 3KN4A 3D3LA 1VQN3 2I9WA 1FGMA 3NQZA 3BNBA 1RN1A 3S28A 3S29A 1NB5I 3G713 3EBTA 2E2UA 3UB1A 4R9LA 4RNTA 3GAXA 3STDA 2P0XA 1JBRA 1G0TA 1W6CA 1VZZA 1ZS7A 4OUQA 3LTAA 3CCR3 4BTYA 1GS3A 1OGXA 1TU5A 3LYGA 5D83A 2GU1A 5GSPA 3S67A 5G2GA 1W01A 3CD63 3EF8A 1FUWA 1B2ZA 1UCKA 4KFDA 1WMNA 2QIYA 3LTCA 3QRDA 3O8YA 5CF2A 3CMA3 2CFLA 2HMNB 3GZYB 3EX9A 3BNEA 4N6LA 3RGAA 2OTL3 1JZOA 1LRAA 1RGLA 3DGMA 4EBGA 1EA2A 3LXUX 3NM7A 4LSOA 3SOYA 1NU3A 2Z77A 2KF5A 4CPKA 1C54A 1RTUA 1D6YA 3D9RA 3LOYA 2E2TA 2P05A 4RZMA 1JKGA 1BRGA 3PGBA 2J8XB 1AR0A 2Z76A 4HM0B 3OW22 2OTJ3 4HBRA 4WP5A 4LZIA 1A2KA 1B2SA 3F40A 3UL6A 2HMOB 1OCVA 4BU4A 1LOXA 1PFPA 1X1UA 2ML5A 4IT7A 1VQ73 3NXJA 1O7PB 4FR9A 1R4CA 4MMZB 3B8LA 3HIIA 1LQMB 3KSPA 1SIIA 3OWYA 1LVNA 1I3IA 1O7WB 1T5YA 3WA3A 3FGYA 3WR2A 3KE7A 4BTXA 1IQ8A 1BNSA 4HM3B 4N6MA 3ECFA 4LEHA 5KP4A 2HMLB 5IF6A 3CNMA 4X2HA 4EW5A 1S723 4IPBA 1ROVA 5IG4A 1BNJA 2CG0A 2YFLB 1RCLA 3OV4A 4ORLA 2C4BA 1VQL3 2XSOB 2CFDA 2KF4A 2CFKA 4HAAA 3EB8A 1KSIA 2BMOB 3LT9A 1O7HB 2W56A 5STDA 2W56B 3G8ZA 2M7OA 4JRFA 4WFOA 4CJNA 2HMKB 3MHEA 3X3XA 5JPUA 3QK9A 1N8QA 2F5WA 3CPW2 3NUVA 1DMNA 2AADA 2WOFA 1QVG2 1I2GA 1W00A 1HU9A 1DETA 1FGTA 1QALA 1W4NA 2IA7A 3EJVA 2CWTA 1JN5A 1RGAA 1RKYA 1FUTA 4HVNA 2PNCA 3F7XA 1KWIA 1GD3A 1IT8A 3F14A 3PYJA 2IY2A 5DRVA 2GXFA 1BGSA 3UNLA 1EQKA 3IPTA 3A5EA 2XH9A 1BRJA 4OVMA 3FZWA 1GY7A 3I553 7RNTA 1K734 4Q53A 1SIHA 4WHAA 1B20A 4FCMA 3KZTA 3PCSA 2RGQA 4R1KA 1Q864 2QEX3 4O8SA 1UCJA 2CX1A 1FUSA 1CYUA 3NBJA 3A76A 3D4AA 4HYZA 4FCJA 4FMDA 4O2HA 1JBSA 3WODG 3KFQC 2CHCA 3VGNA 1VQM3 3Q2PA 1N5PA 1LOWA 1WNHA 1BU4A 2W0QA 3MPHA 2Y73A 4HM4B 1B3SA 1RRLA 1K41A 1AVKA 1L5GB 1RGHA 1ROAA 1VQ83 1UUGB 5AIFA 5IG0A 1AV4A 3BB9A 1X1WA 3OXAA 3OWUA 3SX1A 3WOFB 1QAKA 2BHMA 3DGLA 4RNZA 5ELUA 2XFTA 2F5MA 3B4OA 3NX0A 2W03A 1N9JA 2D1WA 2FGTA 5EQLA 1YVSA 3FKAA 1YJ93 1STFI 2STDA 1MWTA 1JB2A 3JUMA 2H0HA 2WO0A 3D5GA 4EYCA 3SXXA 1VQO3 1NJI4 2ML6A 1E3VA 3DGOA 1O7NB 1IDPA 4G1MB 4N6TA 1BOXA 1WTHA 3FF2A 1IQXA 2YFJB 3BNDA 4HOHA 1VQ43 3DGYA 1UCLA 4KZ1A 1B21A 1TIJA 1BSEA 4EC6A 3KKGA 3L0RA 1LXEA 1QMAA 2L1SA 3DUKA 3EQQB 2BMQB 3F9SA 3I0YA 4R4KA 4L8PA 3CCS3 2IYJA 1UCIA 1V58A 5FGOA 1BRSA 1NNVA 1OUNA 3N9HA 5IEPA 1BNRA 5IG5A 1FGRA 4N6V0 1VQ93 4O02B 2FXTA 8RNTA 1LQGC 1VQK3 3Q3FA 4RBNA 1B2UA 3CXC2 3CCJ3 3F7SA 1MWRA 2Z7AA 2GBWB 1JZDA 4IIAA 2K54A 4MJDA 1ULJB 1HZ1A 3EN8A 4J8TA 4CCVA 1K9M4 1ZX2A 4EV2A 1SJWA 1RNTA 1BNGA 1V57A 2E2VA 4J5GA 5AIGA 1PU4A 5I97A 1A67A 2KXGA 1SARA 5M18A 1CH0A 1J2BA 2W04A 3CCV3 5IW9A 1AQZA 1IV7A 1BRIA 1AVLA 1UDII 4FMBA 4GSPA 1EUIC 1KQS2 2CX0A 1RGGA 2YFIB 4KVHA 1BUQA 2H0IA 2XRXB 3URPA 3BNCA 3EE1A 3NV0B 1V74A 4O3VA 3AGNA 5AEWB 1W2B2 5A0OB 3AMOA 3CU3A 3K0ZA 2Y74A 4N6NB 1U5OA 4K1VA 3SOAA 3HI7A 2PZVA 4K1UA 3UL5A 3CCQ3 1YIT3 3LT8A 1JJ22 1DMMA 3AGOA 4NPBA 5TGNA 3WOEB 2H0GA 2CFWA 2XGNA 3CCL3 4N6UA 3Q90A 4ZM8A 1GY5A 1RGFA 1NWWA 3DZLA 1EEJA 1NO3A 3JUPA 2MC8A 3X41A 1B2MA 1IVUA 1BRHA 1UUWB 5AIIA 3EN1B 4LYLB 4HM7B 1GY6A 3CME3 1YJW3 1US1A 2F56A 2P09A 2Q07A 3K9MC 1GSPA 1FGOA 2XGLA 1T2HA 4GHOA 3FSDA 1I2EA 3KSED 3PXMA 3CCE3 9RNTA 4HZBB 3SYUA 1STDA 2FNQA 1WMPA 4LGQA 3FG3A 1RCKA 6RNTA 1BNFA 1A90A 2XEPA 5M19A 4KT3B 1RGKA 1ULIB 3CC43 1TP6A 3I563 1JB4A 1GYBA 3CC73 1RN7A 4HKVB 4FCZA 1MOLA 2P38A 3K63A 4XBXA 1I8VA 2LYXA 3G6E3 1OHPA 1CYVA 3NBBA 3FCSB 3NV0A 3ROBA 1VQP3 1BRKA 3JVCA 4MEIA 1MWSA 4HM2B 4HM6B 1BNIA 1HYFA 1T3BA 4BIRA 1JBTA 1AY7A 1CQSA 1I3FA 1TTOA 2XFSA 5CXOA 1LOVA 2LQVA 2RBIA 3GZRA 3NBRA 2CC3A 3TDGA 3MG3A 1JKGB 1MGRA 1OHSA 3X3ZA 1FYSA 4I4KA 3F8HA 1UGHI 1O7GB 2W2CA 3V99A 1FZUA 1DE3A 5G1LA 1BSBA 1C7HA 1Q42A 1YNVX 2CKFB 3Q1CA 1GD4A 1W6GA 1OGZA 1Q9EA 1RDSA 1W02A 3NM2A 4X2OA 2KF6A 1IVWA 3FG1A 2GEYA 2RCDA 2Z6BA 3GRDA 3M8CA 2D42A 3FLJA 4H3UA 1BVIA 1OF5B 1YGEA 1TUHA 2KF3A 2OCTA 3NHXA 4EXRA 1B27A 2GSPA 3MG1A 1D6ZA 2CIUA 3CCU3 1RNBA 4J9AA 3WMDA 1VQ53 1TFOA 2XR8B 1FGQA 1MWUA 4HZ9B 4R9KA 1RHLA 2F98A 3H51A 2XSHB 3HZPA 5BVBA 1YHQ3 3NQYA 2BO9B 4QWTA 1N8R4 5ELJA 3EBYA 4K90B 2P0MA 3UJMA 2OWPA 5AYSC 3ZFZA 3BIRA 2IUJA
chains in the Genus database with same CATH topology
1BANA 1IYYA 4J5GA 3KCHA 3HOHA 2BIRA 1RGEA 1SARA 1RGCA 1BNEA 1YGWA 1CH0A 1BUJA 1A2PA 1BNJA 1BSAA 1AQZA 1RCLA 7GSPA 2C4BA 1ZGXA 2HOHA 5RNTA 1BRIA 2KF4A 1GMRA 1BIRA 4HAAA 5HOHA 4GSPA 1RGGA 2ZA4A 1GMQA 1BSCA 3URPA 5BIRA 2F5WA 2AADA 1I2GA 1TRQA 1GMPA 4J5KA 3AGNA 1DETA 5BU4A 6GSPA 1RGAA 1FUTA 3RNTA 3AHSA 1BGSA 3AGOA 1PY3A 3A5EA 3DH2A 1BAOA 1LOYA 1BRJA 1TRPA 1I2FA 1RGFA 1B2MA 7RNTA 1B20A 1BRHA 1BSDA 2F56A 1GSPA 1T2HA 4GHOA 1UCJA 1FUSA 1I2EA 1X1XA 3D4AA 1JBSA 1T2IA 9RNTA 1RN4A 3SYUA 2KAAA 1GOVA 1LOWA 1RCKA 1BU4A 1BNFA 3GSPA 6RNTA 1RGKA 1MGWA 1B3SA 1RN1A 1I8VA 1RGHA 2F4YA 3D5IA 1X1WA 1G02A 1BRKA 4RNTA 1JBRA 2F5MA 1RSNA 5GSPA 1BNIA 1HYFA 1JBTA 4BIRA 1AY7A 1B2XA 1YVSA 1B2ZA 1UCKA 1I3FA 1TTOA 1FW7A 1LOVA 3D5GA 2RBIA 1GOUA 1I70A 1RGLA 1LRAA 1MGRA 1BOXA 1FYSA 1GOYA 1I0VA 2KF5A 1C54A 1FZUA 1RTUA 1DE3A 1PYLA 4HOHA 1BSBA 1YNVX 3DGYA 1UCLA 3BU4A 1B21A 1BSEA 1BRGA 1RMSA 1RDSA 1Q9EA 2KF6A 1BVIA 2KF3A 1B27A 1B2SA 1BNRA 1UCIA 1BRSA 2GSPA 4BU4A 1X1UA 1RNBA 3WHOA 1RLSA 8RNTA 3Q3FA 1B2UA 1RHLA 2BU4A 2RNTA 3AHWA 2SARA 1I3IA 1I0XA 1BRNL 1HZ1A 2AAEA 3WR2A 1R4YA 1BNSA 1X1YA 1LNIA 1RNTA 3BIRA 1BNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAN A;  1IYY A;  4J5G A;  3KCH A;  3HOH A;  2BIR A;  1RGE A;  1SAR A;  1RGC A;  1BNE A;  1YGW A;  1CH0 A;  1BUJ A;  1A2P A;  1BNJ A;  1BSA A;  1AQZ A;  1RCL A;  7GSP A;  2C4B A;  1ZGX A;  2HOH A;  5RNT A;  1BRI A;  2KF4 A;  1GMR A;  1BIR A;  4HAA A;  5HOH A;  4GSP A;  1RGG A;  2ZA4 A;  1GMQ A;  1BSC A;  3URP A;  5BIR A;  2F5W A;  2AAD A;  1I2G A;  1TRQ A;  1GMP A;  4J5K A;  3AGN A;  1DET A;  5BU4 A;  6GSP A;  1RGA A;  1FUT A;  3RNT A;  3AHS A;  1BGS A;  3AGO A;  1PY3 A;  3A5E A;  3DH2 A;  1BAO A;  1LOY A;  1BRJ A;  1TRP A;  1I2F A;  1RGF A;  1B2M A;  7RNT A;  1B20 A;  1BRH A;  1BSD A;  2F56 A;  1GSP A;  1T2H A;  4GHO A;  1UCJ A;  1FUS A;  1I2E A;  1X1X A;  3D4A A;  1JBS A;  1T2I A;  9RNT A;  1RN4 A;  3SYU A;  2KAA A;  1GOV A;  1LOW A;  1RCK A;  1BU4 A;  1BNF A;  3GSP A;  6RNT A;  1RGK A;  1MGW A;  1B3S A;  1RN1 A;  1I8V A;  1RGH A;  2F4Y A;  3D5I A;  1X1W A;  1G02 A;  1BRK A;  4RNT A;  1JBR A;  2F5M A;  1RSN A;  5GSP A;  1BNI A;  1HYF A;  1JBT A;  4BIR A;  1AY7 A;  1B2X A;  1YVS A;  1B2Z A;  1UCK A;  1I3F A;  1TTO A;  1FW7 A;  1LOV A;  3D5G A;  2RBI A;  1GOU A;  1I70 A;  1RGL A;  1LRA A;  1MGR A;  1BOX A;  1FYS A;  1GOY A;  1I0V A;  2KF5 A;  1C54 A;  1FZU A;  1RTU A;  1DE3 A;  1PYL A;  4HOH A;  1BSB A;  1YNV X;  3DGY A;  1UCL A;  3BU4 A;  1B21 A;  1BSE A;  1BRG A;  1RMS A;  1RDS A;  1Q9E A;  2KF6 A;  1BVI A;  2KF3 A;  1B27 A;  1B2S A;  1BNR A;  1UCI A;  1BRS A;  2GSP A;  4BU4 A;  1X1U A;  1RNB A;  3WHO A;  1RLS A;  8RNT A;  3Q3F A;  1B2U A;  1RHL A;  2BU4 A;  2RNT A;  3AHW A;  2SAR A;  1I3I A;  1I0X A;  1BRN L;  1HZ1 A;  2AAE A;  3WR2 A;  1R4Y A;  1BNS A;  1X1Y A;  1LNI A;  1RNT A;  3BIR A;  1BNG A; 
#chains in the Genus database with same CATH topology
 4XDV A;  5AI1 A;  1IYY A;  3V98 A;  1K8A 4;  3G16 A;  3HOH A;  1RGC A;  3LZA A;  4WWU C;  1YGW A;  1ZO2 A;  1E97 A;  2B24 B;  1KD1 4;  2WGO A;  2OOV A;  1BSA A;  3HIG A;  3DXO A;  4ILF A;  3MWZ A;  2QA4 3;  1Q40 B;  1WQL B;  1OH0 A;  2OQE C;  1Q7H A;  4OK0 A;  4AEQ A;  3OWS A;  3DMC A;  3DM8 A;  4HM8 B;  5BIR A;  3B7C A;  1Q81 4;  3JUQ A;  1TRQ A;  4STD A;  3E99 A;  1N9E A;  1QJG A;  3FH1 A;  4J5K A;  5D81 A;  5IER A;  1OF5 A;  2WGQ A;  3MSO A;  3X3Y A;  1M1K 4;  5G1K A;  6GSP A;  5D82 A;  3VSY A;  3IJE B;  1SQW A;  2C10 A;  1OAC A;  4N3V A;  4BTW A;  3AHS A;  1VQ6 3;  1F8N A;  1YIJ 3;  1K28 A;  5AIH A;  2ZDJ A;  2GU3 A;  3CC2 3;  1LOY A;  1TJD A;  4XM4 A;  1JN5 B;  1I2F A;  4FMC A;  3SLU A;  3PCR A;  3ER7 A;  2WOH A;  3J7Y d;  3N8B A;  1W5Z A;  5HGR A;  3ALA A;  4TX4 A;  5EEO A;  1U8C B;  1IVX A;  2OQE A;  4BL3 A;  4XB5 A;  5JPP A;  4GB5 A;  1T2I A;  1D6U A;  3PZW A;  5M1A A;  3HK4 A;  1RN4 A;  2KAA A;  1Q7Y 4;  2B1X B;  4MMY B;  7STD A;  1VQQ A;  1YVB I;  5AEU B;  1GOV A;  1Z1S A;  2CW9 A;  2JDI H;  1NDO B;  2UGI A;  4H61 A;  2GEX A;  1FA3 A;  4XBY A;  2W9P A;  3G4S 3;  3U97 A;  1MGW A;  2F86 B;  3V92 A;  2CK3 H;  3G0K A;  3D79 A;  2F4Y A;  3T8U A;  5JBS A;  3ZG0 A;  3HX8 A;  3D5I A;  1LNH A;  2V1L A;  3EC9 A;  3K7C A;  4L7K A;  5KP3 A;  1A2V A;  1G02 A;  1S5A A;  3JUN A;  1W6Y A;  4FMA A;  2RSX A;  2UX0 A;  1CEW I;  5IG3 A;  3U1W A;  1RSN A;  1JB5 A;  3X40 A;  2R41 A;  2CWU A;  3BLZ A;  3GZB A;  1JV2 B;  1B2X A;  2R4I A;  2QGU A;  1FW7 A;  1MNL A;  1Q40 A;  1IVV A;  1QAF A;  1KC8 4;  1DYU A;  1UGI A;  3RGR A;  3OX9 A;  1GOU A;  1YJN 3;  1I70 A;  1Q82 4;  3WDG B;  3KII A;  3FG4 A;  2RFR A;  3S5C A;  4AKZ A;  5AYR B;  1M90 4;  2IUK A;  1GOY A;  1Y4K A;  1I0V A;  1EG9 B;  2HMJ B;  1UW1 A;  2CFG A;  3AMO B;  3T8N A;  4HM5 B;  2ZL8 A;  1PYL A;  1WMO A;  2C11 A;  4L8O A;  3BU4 A;  5CF1 A;  2F99 A;  1RMS A;  8CHO A;  2IMJ A;  3T0U A;  2ZHX B;  3CPO A;  5CK6 A;  3JUO A;  4EV5 A;  1E3R A;  4PEJ A;  2BMR B;  2W6J H;  1YI2 3;  5DRE A;  1RLS A;  3WHO A;  1IK3 A;  1JRQ A;  1JNQ A;  2HMM B;  2KRT A;  2L4V A;  3LTD A;  1QVF 2;  3LML A;  2BU4 A;  1UI7 A;  2RNT A;  3AHW A;  2SAR A;  3CNX A;  4WYK A;  2A15 A;  1UI8 A;  1I0X A;  1BRN L;  2BNG A;  2AAE A;  1OPY A;  3K5T A;  1R4Y A;  3RDE A;  2CWV A;  1O7M B;  5BXQ A;  5LC7 A;  1X1Y A;  2INX A;  1LNI A;  1IT7 A;  2O9U X;  1BAN A;  4HJL B;  2JQ5 A;  3KCH A;  3SVA A;  3ZG5 A;  2BIR A;  1RGE A;  4K61 A;  1N5H A;  1BNE A;  2KCD A;  1M1X B;  4AKY A;  4LMI A;  1BUJ A;  1A2P A;  4NHF A;  3MYT A;  3CCM 3;  1G96 A;  1UUV B;  7GSP A;  1ZGX A;  2HOH A;  2YX9 A;  3GZX B;  5RNT A;  1TFK A;  1GMR A;  1BIR A;  1W2Z A;  2W9Q A;  5HOH A;  2XF3 A;  4KFF A;  4R80 A;  3VF1 A;  4KFE A;  3B4P A;  2ZA4 A;  3WA2 X;  3X42 A;  1GMQ A;  1BSC A;  1DVC A;  3PS8 A;  1ISK A;  3H3H A;  3EHC A;  1IQY A;  5IEN A;  1NB3 I;  5KP1 A;  5FW5 A;  1GMP A;  2CG1 A;  3DGN A;  4MMX B;  5BU4 A;  1EKM A;  5LC6 A;  2K3D A;  1DVD A;  4RNY A;  2MF7 A;  5IEO A;  1RRH A;  3RNT A;  3S27 A;  4JF8 A;  1SPU A;  3DY5 A;  4HM1 B;  3FF0 A;  2GBX B;  4DKI A;  1PY3 A;  4NRE A;  3DH2 A;  1BAO A;  3MKI A;  3N54 B;  4XDW A;  3MG2 A;  1TRP A;  4WYK B;  3LH4 A;  4U13 A;  1RJO A;  4I5Q A;  3SED A;  3IMA B;  4N6O B;  4BL2 A;  5CLK A;  4CDL A;  1OHO A;  1IV9 A;  1BSD A;  2OOV C;  1M9G A;  5EVH A;  4GL6 A;  3GWR A;  1ASK A;  4XBT A;  1HKX A;  1X1X A;  1DMQ A;  2O3O A;  3LTB A;  1IU7 A;  1W7C A;  2SBL A;  3F8X A;  2UUG C;  2CH9 A;  2K0M A;  2BT3 A;  6STD A;  3GSP A;  3KN4 A;  3D3L A;  1VQN 3;  2I9W A;  1FGM A;  3NQZ A;  3BNB A;  1RN1 A;  3S28 A;  3S29 A;  1NB5 I;  3G71 3;  3EBT A;  2E2U A;  3UB1 A;  4R9L A;  4RNT A;  3GAX A;  3STD A;  2P0X A;  1JBR A;  1G0T A;  1W6C A;  1VZZ A;  1ZS7 A;  4OUQ A;  3LTA A;  3CCR 3;  4BTY A;  1GS3 A;  1OGX A;  1TU5 A;  3LYG A;  5D83 A;  2GU1 A;  5GSP A;  3S67 A;  5G2G A;  1W01 A;  3CD6 3;  3EF8 A;  1FUW A;  1B2Z A;  1UCK A;  4KFD A;  1WMN A;  2QIY A;  3LTC A;  3QRD A;  3O8Y A;  5CF2 A;  3CMA 3;  2CFL A;  2HMN B;  3GZY B;  3EX9 A;  3BNE A;  4N6L A;  3RGA A;  2OTL 3;  1JZO A;  1LRA A;  1RGL A;  3DGM A;  4EBG A;  1EA2 A;  3LXU X;  3NM7 A;  4LSO A;  3SOY A;  1NU3 A;  2Z77 A;  2KF5 A;  4CPK A;  1C54 A;  1RTU A;  1D6Y A;  3D9R A;  3LOY A;  2E2T A;  2P05 A;  4RZM A;  1JKG A;  1BRG A;  3PGB A;  2J8X B;  1AR0 A;  2Z76 A;  4HM0 B;  3OW2 2;  2OTJ 3;  4HBR A;  4WP5 A;  4LZI A;  1A2K A;  1B2S A;  3F40 A;  3UL6 A;  2HMO B;  1OCV A;  4BU4 A;  1LOX A;  1PFP A;  1X1U A;  2ML5 A;  4IT7 A;  1VQ7 3;  3NXJ A;  1O7P B;  4FR9 A;  1R4C A;  4MMZ B;  3B8L A;  3HII A;  1LQM B;  3KSP A;  1SII A;  3OWY A;  1LVN A;  1I3I A;  1O7W B;  1T5Y A;  3WA3 A;  3FGY A;  3WR2 A;  3KE7 A;  4BTX A;  1IQ8 A;  1BNS A;  4HM3 B;  4N6M A;  3ECF A;  4LEH A;  5KP4 A;  2HML B;  5IF6 A;  3CNM A;  4X2H A;  4EW5 A;  1S72 3;  4IPB A;  1ROV A;  5IG4 A;  1BNJ A;  2CG0 A;  2YFL B;  1RCL A;  3OV4 A;  4ORL A;  2C4B A;  1VQL 3;  2XSO B;  2CFD A;  2KF4 A;  2CFK A;  4HAA A;  3EB8 A;  1KSI A;  2BMO B;  3LT9 A;  1O7H B;  2W56 A;  5STD A;  2W56 B;  3G8Z A;  2M7O A;  4JRF A;  4WFO A;  4CJN A;  2HMK B;  3MHE A;  3X3X A;  5JPU A;  3QK9 A;  1N8Q A;  2F5W A;  3CPW 2;  3NUV A;  1DMN A;  2AAD A;  2WOF A;  1QVG 2;  1I2G A;  1W00 A;  1HU9 A;  1DET A;  1FGT A;  1QAL A;  1W4N A;  2IA7 A;  3EJV A;  2CWT A;  1JN5 A;  1RGA A;  1RKY A;  1FUT A;  4HVN A;  2PNC A;  3F7X A;  1KWI A;  1GD3 A;  1IT8 A;  3F14 A;  3PYJ A;  2IY2 A;  5DRV A;  2GXF A;  1BGS A;  3UNL A;  1EQK A;  3IPT A;  3A5E A;  2XH9 A;  1BRJ A;  4OVM A;  3FZW A;  1GY7 A;  3I55 3;  7RNT A;  1K73 4;  4Q53 A;  1SIH A;  4WHA A;  1B20 A;  4FCM A;  3KZT A;  3PCS A;  2RGQ A;  4R1K A;  1Q86 4;  2QEX 3;  4O8S A;  1UCJ A;  2CX1 A;  1FUS A;  1CYU A;  3NBJ A;  3A76 A;  3D4A A;  4HYZ A;  4FCJ A;  4FMD A;  4O2H A;  1JBS A;  3WOD G;  3KFQ C;  2CHC A;  3VGN A;  1VQM 3;  3Q2P A;  1N5P A;  1LOW A;  1WNH A;  1BU4 A;  2W0Q A;  3MPH A;  2Y73 A;  4HM4 B;  1B3S A;  1RRL A;  1K41 A;  1AVK A;  1L5G B;  1RGH A;  1ROA A;  1VQ8 3;  1UUG B;  5AIF A;  5IG0 A;  1AV4 A;  3BB9 A;  1X1W A;  3OXA A;  3OWU A;  3SX1 A;  3WOF B;  1QAK A;  2BHM A;  3DGL A;  4RNZ A;  5ELU A;  2XFT A;  2F5M A;  3B4O A;  3NX0 A;  2W03 A;  1N9J A;  2D1W A;  2FGT A;  5EQL A;  1YVS A;  3FKA A;  1YJ9 3;  1STF I;  2STD A;  1MWT A;  1JB2 A;  3JUM A;  2H0H A;  2WO0 A;  3D5G A;  4EYC A;  3SXX A;  1VQO 3;  1NJI 4;  2ML6 A;  1E3V A;  3DGO A;  1O7N B;  1IDP A;  4G1M B;  4N6T A;  1BOX A;  1WTH A;  3FF2 A;  1IQX A;  2YFJ B;  3BND A;  4HOH A;  1VQ4 3;  3DGY A;  1UCL A;  4KZ1 A;  1B21 A;  1TIJ A;  1BSE A;  4EC6 A;  3KKG A;  3L0R A;  1LXE A;  1QMA A;  2L1S A;  3DUK A;  3EQQ B;  2BMQ B;  3F9S A;  3I0Y A;  4R4K A;  4L8P A;  3CCS 3;  2IYJ A;  1UCI A;  1V58 A;  5FGO A;  1BRS A;  1NNV A;  1OUN A;  3N9H A;  5IEP A;  1BNR A;  5IG5 A;  1FGR A;  4N6V 0;  1VQ9 3;  4O02 B;  2FXT A;  8RNT A;  1LQG C;  1VQK 3;  3Q3F A;  4RBN A;  1B2U A;  3CXC 2;  3CCJ 3;  3F7S A;  1MWR A;  2Z7A A;  2GBW B;  1JZD A;  4IIA A;  2K54 A;  4MJD A;  1ULJ B;  1HZ1 A;  3EN8 A;  4J8T A;  4CCV A;  1K9M 4;  1ZX2 A;  4EV2 A;  1SJW A;  1RNT A;  1BNG A;  1V57 A;  2E2V A;  4J5G A;  5AIG A;  1PU4 A;  5I97 A;  1A67 A;  2KXG A;  1SAR A;  5M18 A;  1CH0 A;  1J2B A;  2W04 A;  3CCV 3;  5IW9 A;  1AQZ A;  1IV7 A;  1BRI A;  1AVL A;  1UDI I;  4FMB A;  4GSP A;  1EUI C;  1KQS 2;  2CX0 A;  1RGG A;  2YFI B;  4KVH A;  1BUQ A;  2H0I A;  2XRX B;  3URP A;  3BNC A;  3EE1 A;  3NV0 B;  1V74 A;  4O3V A;  3AGN A;  5AEW B;  1W2B 2;  5A0O B;  3AMO A;  3CU3 A;  3K0Z A;  2Y74 A;  4N6N B;  1U5O A;  4K1V A;  3SOA A;  3HI7 A;  2PZV A;  4K1U A;  3UL5 A;  3CCQ 3;  1YIT 3;  3LT8 A;  1JJ2 2;  1DMM A;  3AGO A;  4NPB A;  5TGN A;  3WOE B;  2H0G A;  2CFW A;  2XGN A;  3CCL 3;  4N6U A;  3Q90 A;  4ZM8 A;  1GY5 A;  1RGF A;  1NWW A;  3DZL A;  1EEJ A;  1NO3 A;  3JUP A;  2MC8 A;  3X41 A;  1B2M A;  1IVU A;  1BRH A;  1UUW B;  5AII A;  3EN1 B;  4LYL B;  4HM7 B;  1GY6 A;  3CME 3;  1YJW 3;  1US1 A;  2F56 A;  2P09 A;  2Q07 A;  3K9M C;  1GSP A;  1FGO A;  2XGL A;  1T2H A;  4GHO A;  3FSD A;  1I2E A;  3KSE D;  3PXM A;  3CCE 3;  9RNT A;  4HZB B;  3SYU A;  1STD A;  2FNQ A;  1WMP A;  4LGQ A;  3FG3 A;  1RCK A;  6RNT A;  1BNF A;  1A90 A;  2XEP A;  5M19 A;  4KT3 B;  1RGK A;  1ULI B;  3CC4 3;  1TP6 A;  3I56 3;  1JB4 A;  1GYB A;  3CC7 3;  1RN7 A;  4HKV B;  4FCZ A;  1MOL A;  2P38 A;  3K63 A;  4XBX A;  1I8V A;  2LYX A;  3G6E 3;  1OHP A;  1CYV A;  3NBB A;  3FCS B;  3NV0 A;  3ROB A;  1VQP 3;  1BRK A;  3JVC A;  4MEI A;  1MWS A;  4HM2 B;  4HM6 B;  1BNI A;  1HYF A;  1T3B A;  4BIR A;  1JBT A;  1AY7 A;  1CQS A;  1I3F A;  1TTO A;  2XFS A;  5CXO A;  1LOV A;  2LQV A;  2RBI A;  3GZR A;  3NBR A;  2CC3 A;  3TDG A;  3MG3 A;  1JKG B;  1MGR A;  1OHS A;  3X3Z A;  1FYS A;  4I4K A;  3F8H A;  1UGH I;  1O7G B;  2W2C A;  3V99 A;  1FZU A;  1DE3 A;  5G1L A;  1BSB A;  1C7H A;  1Q42 A;  1YNV X;  2CKF B;  3Q1C A;  1GD4 A;  1W6G A;  1OGZ A;  1Q9E A;  1RDS A;  1W02 A;  3NM2 A;  4X2O A;  2KF6 A;  1IVW A;  3FG1 A;  2GEY A;  2RCD A;  2Z6B A;  3GRD A;  3M8C A;  2D42 A;  3FLJ A;  4H3U A;  1BVI A;  1OF5 B;  1YGE A;  1TUH A;  2KF3 A;  2OCT A;  3NHX A;  4EXR A;  1B27 A;  2GSP A;  3MG1 A;  1D6Z A;  2CIU A;  3CCU 3;  1RNB A;  4J9A A;  3WMD A;  1VQ5 3;  1TFO A;  2XR8 B;  1FGQ A;  1MWU A;  4HZ9 B;  4R9K A;  1RHL A;  2F98 A;  3H51 A;  2XSH B;  3HZP A;  5BVB A;  1YHQ 3;  3NQY A;  2BO9 B;  4QWT A;  1N8R 4;  5ELJ A;  3EBY A;  4K90 B;  2P0M A;  3UJM A;  2OWP A;  5AYS C;  3ZFZ A;  3BIR A;  2IUJ A; 
#chains in the Genus database with same CATH homology
 1BAN A;  1IYY A;  4J5G A;  3KCH A;  3HOH A;  2BIR A;  1RGE A;  1SAR A;  1RGC A;  1BNE A;  1YGW A;  1CH0 A;  1BUJ A;  1A2P A;  1BNJ A;  1BSA A;  1AQZ A;  1RCL A;  7GSP A;  2C4B A;  1ZGX A;  2HOH A;  5RNT A;  1BRI A;  2KF4 A;  1GMR A;  1BIR A;  4HAA A;  5HOH A;  4GSP A;  1RGG A;  2ZA4 A;  1GMQ A;  1BSC A;  3URP A;  5BIR A;  2F5W A;  2AAD A;  1I2G A;  1TRQ A;  1GMP A;  4J5K A;  3AGN A;  1DET A;  5BU4 A;  6GSP A;  1RGA A;  1FUT A;  3RNT A;  3AHS A;  1BGS A;  3AGO A;  1PY3 A;  3A5E A;  3DH2 A;  1BAO A;  1LOY A;  1BRJ A;  1TRP A;  1I2F A;  1RGF A;  1B2M A;  7RNT A;  1B20 A;  1BRH A;  1BSD A;  2F56 A;  1GSP A;  1T2H A;  4GHO A;  1UCJ A;  1FUS A;  1I2E A;  1X1X A;  3D4A A;  1JBS A;  1T2I A;  9RNT A;  1RN4 A;  3SYU A;  2KAA A;  1GOV A;  1LOW A;  1RCK A;  1BU4 A;  1BNF A;  3GSP A;  6RNT A;  1RGK A;  1MGW A;  1B3S A;  1RN1 A;  1I8V A;  1RGH A;  2F4Y A;  3D5I A;  1X1W A;  1G02 A;  1BRK A;  4RNT A;  1JBR A;  2F5M A;  1RSN A;  5GSP A;  1BNI A;  1HYF A;  1JBT A;  4BIR A;  1AY7 A;  1B2X A;  1YVS A;  1B2Z A;  1UCK A;  1I3F A;  1TTO A;  1FW7 A;  1LOV A;  3D5G A;  2RBI A;  1GOU A;  1I70 A;  1RGL A;  1LRA A;  1MGR A;  1BOX A;  1FYS A;  1GOY A;  1I0V A;  2KF5 A;  1C54 A;  1FZU A;  1RTU A;  1DE3 A;  1PYL A;  4HOH A;  1BSB A;  1YNV X;  3DGY A;  1UCL A;  3BU4 A;  1B21 A;  1BSE A;  1BRG A;  1RMS A;  1RDS A;  1Q9E A;  2KF6 A;  1BVI A;  2KF3 A;  1B27 A;  1B2S A;  1BNR A;  1UCI A;  1BRS A;  2GSP A;  4BU4 A;  1X1U A;  1RNB A;  3WHO A;  1RLS A;  8RNT A;  3Q3F A;  1B2U A;  1RHL A;  2BU4 A;  2RNT A;  3AHW A;  2SAR A;  1I3I A;  1I0X A;  1BRN L;  1HZ1 A;  2AAE A;  3WR2 A;  1R4Y A;  1BNS A;  1X1Y A;  1LNI A;  1RNT A;  3BIR A;  1BNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...