2BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2bu4A00
1YGWA 1LOWA 1RGFA 1SARA 1AQZA 3GSPA 1BRNL 2F56A 1T2HA 1R4YA 1FZUA 1I8VA 1X1WA 1BVIA 2KF4A 1RNBA 1HYFA 1B2UA 1BNSA 1Q9EA 1B27A 3HOHA 3AHWA 1RCKA 1RHLA 1RNTA 1B2ZA 1BGSA 1BNFA 1UCJA 1YNVX 1RN1A 4BU4A 1GOUA 1RGCA 5BIRA 2KAAA 2BIRA 3D5GA 1BU4A 1UCKA 1TRQA 3Q3FA 3AGOA 1BNIA 1DE3A 1I0XA 1RN4A 1BRKA 2F4YA 1B2XA 1RDSA 5RNTA 1I0VA 1LOVA 1B21A 1LOYA 1LRAA 2KF5A 2ZA4A 1TTOA 5BU4A 3AHSA 1B2SA 1BNJA 1GMQA 1BIRA 1RMSA 2KF6A 3D5IA 4J5GA 1RSNA 1GMRA 1LNIA 4J5KA 1BAOA 1BRJA 1YVSA 2KF3A 6RNTA 1RGHA 1RGGA 1BNGA 1AY7A 1BNEA 1MGRA 2F5WA 1I2GA 3AGNA 3BU4A 1JBRA 1G02A 2F5MA 2SARA 1X1XA 4BIRA 1B3SA 1GMPA 5GSPA 6GSPA 1BRGA 1DETA 1X1UA 1X1YA 1GOVA 1FUTA 7RNTA 3RNTA 3URPA 4HOHA 1BUJA 3BIRA 3DGYA 1RGKA 8RNTA 1BRSA 1BSDA 2HOHA 1I70A 1FYSA 1CH0A 1I2EA 1T2IA 1RGEA 3DH2A 1UCLA 4RNTA 1JBTA 1B2MA 1GOYA 1JBSA 1BSCA 1BANA 1BSAA 1I2FA 1ZGXA 3WHOA 1PY3A 1RGAA 2AADA 1C54A 1UCIA 2C4BA 7GSPA 1BRHA 4GHOA 2RBIA 4GSPA 1BNRA 2AAEA 1RTUA 2BU4A 5HOHA 2GSPA 1BRIA 3WR2A 1BSEA 1FW7A 3SYUA 3D4AA 3A5EA 1RLSA 1HZ1A 1PYLA 1RCLA 1B20A 1I3IA 1I3FA 1IYYA 2RNTA 9RNTA 4HAAA 1GSPA 3KCHA 1RGLA 1FUSA 1BOXA 1TRPA 1MGWA 1A2PA 1BSBA
chains in the Genus database with same CATH superfamily
4IIAA 1AQZA 4L8OA 3M8CA 4R9KA 3GZXB 1R4YA 3LZAA 2KF4A 1HYFA 1OHSA 5G1KA 1KWIA 2HMOB 1BNSA 1SIIA 3DXOA 3F14A 4EXRA 2E2TA 3AHWA 5IERA 1OUNA 3ER7A 3S67A 3X3YA 1RHLA 2H0GA 3SXXA 4AEQA 1GY7A 3K63A 1GD3A 3SLUA 6STDA 4MMXB 5STDA 5AEUB 2F98A 3NM2A 4MMZB 1FGMA 3K9MC 1EUIC 3MKIA 1O7NB 1A90A 3DMCA 5JPPA 3CCM3 1UCKA 2HMKB 2CFWA 4CCVA 1RKYA 1ULJB 1TFOA 3CXC2 3LOYA 4WYKB 5EEOA 3N8BA 1RRHA 3DUKA 1GS3A 2XEPA 1B2XA 1VQQA 2INXA 5RNTA 1UGIA 1LOVA 2WGQA 4FMAA 2KF5A 1W2ZA 5BU4A 3JUPA 3SOYA 2IYJA 1TUHA 1LQMB 3AMOA 1J2BA 3OV4A 2W56B 1QMAA 4CJNA 1MWSA 3OWYA 2IUJA 3KFQC 1VQ93 1G0TA 3D5IA 1LNIA 4XDVA 1BRJA 3GRDA 3PCSA 4EYCA 5IG0A 3DGLA 4FCMA 1MGRA 3NUVA 1O7HB 3VF1A 1JBRA 4FMCA 5D82A 1B3SA 3DM8A 1IT8A 1AR0A 2HMJB 4H61A 1V74A 1F8NA 2CX0A 3EN1B 3S29A 4O2HA 3NXJA 3UL6A 4N6V0 1RGKA 1Q814 2CWUA 1Y4KA 8RNTA 3LTAA 1BRSA 2XR8B 1I70A 3KIIA 5CF1A 3CCS3 5D81A 4HJLB 1I2EA 2WGOA 1T2IA 2Z7AA 4N6OB 2CFDA 3QK9A 1FUWA 1RGEA 4LSOA 3NQYA 1OHPA 1W00A 3G713 3DH2A 1UCLA 3UB1A 1UI8A 4RNTA 3AMOB 1VZZA 3A76A 4J8TA 1B2MA 1EEJA 1BSCA 1BSAA 3G4S3 3OXAA 2AADA 4LMIA 1HU9A 1C54A 4XBTA 1T3BA 4X2HA 3NV0A 4FMBA 3WOFB 3LH4A 4GHOA 2BT3A 2Y74A 4GSPA 1VQM3 1MWTA 3KE7A 2PZVA 1N9JA 3WDGB 2XH9A 1N5PA 2AAEA 1RTUA 2BU4A 2B1XB 5EQLA 1JB2A 1UUGB 1SIHA 1SQWA 1BSEA 2E2UA 3S5CA 2C11A 3EN8A 3KSED 3WMDA 2B24B 4U13A 3A5EA 2BMRB 1HZ1A 1B20A 1I3FA 4XM4A 2J8XB 3EF8A 1JRQA 2STDA 2RNTA 5AYSC 4I5QA 4K61A 1OGXA 3I0YA 5IG5A 1IT7A 3NBJA 3CNMA 1RGLA 4WHAA 1JN5A 4R80A 3PXMA 1TRPA 1RJOA 1A2PA 1BSBA 2KRTA 2CIUA 2BMQB 1ROVA 1GY6A 2CH9A 2XGLA 2H0HA 1YGWA 4HM0B 3WOEB 1SARA 2CKFB 1A67A 2C10A 3V98A 1BRNL 4OK0A 1FZUA 1I8VA 1BVIA 1ZX2A 3G8ZA 4HZBB 1MOLA 3HOHA 5BXQA 4BTWA 3I553 2W6JH 3F40A 3NV0B 1B2ZA 2UUGC 2CFLA 1UCJA 3WA3A 3VGNA 3Q90A 4RBNA 2HMLB 4BL2A 3F8XA 1IV7A 3JVCA 5BIRA 1YHQ3 1SJWA 3SEDA 2OOVA 1Q7Y4 4KZ1A 1BU4A 3FG4A 5D83A 3LTCA 4STDA 2YFJB 4HM3B 5AIIA 4Q53A 1YIT3 1STFI 1IQXA 1JV2B 1BRKA 1RN4A 1UW1A 1RDSA 2F4YA 1LVNA 3D9RA 1ISKA 1LRAA 3V92A 1HKXA 3CMA3 2L4VA 1A2KA 4GB5A 5LC6A 1YJW3 3GWRA 1JN5B 1SPUA 2V1LA 3HIIA 1EKMA 1E97A 1W5ZA 4J5KA 4J5GA 1BAOA 1YVSA 4LZIA 1L5GB 4HM7B 2WOFA 1BNGA 1AY7A 2BMOB 3FKAA 1W6YA 1I2GA 1G02A 1TFKA 2F5MA 4RNZA 1W2B2 3BB9A 2YFIB 3MHEA 1M1XB 6GSPA 1BRGA 3F7SA 1X1UA 1V58A 2YX9A 1JB5A 3LMLA 5IG4A 2D42A 1IK3A 1FUTA 1WTHA 2IMJA 3EB8A 3JUOA 3ZG5A 4EW5A 1M904 3URPA 5FGOA 1BUJA 3DGYA 1DVDA 2KCDA 3CCQ3 1YVBI 5IG3A 3KSPA 1N9EA 3V99A 1BSDA 5DRVA 2HMNB 1RN7A 2P0MA 1JZDA 1FYSA 1W4NA 2CWVA 5JBSA 2R41A 1NJI4 4MMYB 1AVLA 5IENA 2ML5A 1VQ63 3F8HA 3X3ZA 3FF2A 3LT9A 1UI7A 3ROBA 3GZYB 3HX8A 1PU4A 4CPKA 2Z6BA 2FXTA 2OWPA 1JBTA 1IQYA 3GAXA 5A0OB 1JBSA 1JNQA 1QAKA 2Z76A 1MNLA 1Q40A 3NHXA 2C4BA 1W02A 2IUKA 4QWTA 1YJN3 3O8YA 5M19A 4BTXA 5M1AA 2RBIA 5DREA 4KFDA 2K0MA 2CX1A 4FMDA 3TDGA 5KP1A 3Q2PA 2FNQA 4FCZA 3WR2A 1K28A 2A15A 2BNGA 3FSDA 4HM5B 5CXOA 1FW7A 1JKGA 4N6NB 4EC6A 3D4AA 3OWSA 5IF6A 1RCLA 3H3HA 5TGNA 1N8R4 1I3IA 3RGAA 1YJ93 2P0XA 3KN4A 3WODG 1EQKA 1IYYA 9RNTA 3L0RA 3B4OA 3NM7A 4MJDA 3SOAA 1QALA 3CCU3 1GY5A 1TU5A 1D6UA 3KCHA 1O7MB 4J9AA 3OW22 4RNYA 4KVHA 5AI1A 3UJMA 1K734 4ZM8A 2BO9B 1DVCA 2W9PA 2I9WA 4HM6B 1OPYA 1LOWA 1RGFA 3B8LA 4PEJA 3GSPA 2ZHXB 3DZLA 1MWRA 2SBLA 1N5HA 2Q07A 1T2HA 3NX0A 3N54B 3QRDA 3MSOA 2FGTA 3LYGA 1Q40B 4DKIA 4WP5A 3STDA 3BNDA 1W6GA 1B27A 3CD63 2R4IA 4O8SA 1LQGC 1RCKA 1VQL3 4K1VA 1IVVA 4HM1B 3K5TA 4ILFA 1NO3A 1BNFA 1OF5A 3D3LA 5AIFA 1RN1A 3PS8A 2CG0A 4X2OA 2OQEC 4XBYA 5ELUA 3CCL3 2MF7A 2ZDJA 1KD14 1K9M4 1NNVA 1ZO2A 2KAAA 4HM8B 2BIRA 3D5GA 1JKGB 3NBRA 5ELJA 1FGQA 5AIGA 1CYUA 1C7HA 1TRQA 3K0ZA 3LT8A 1VQN3 1VQ43 3PCRA 3X42A 1DE3A 1I0XA 4L8PA 1VQ83 4HYZA 2XF3A 5KP4A 4BL3A 3JUQA 1Q42A 1AVKA 1O7GB 3AHSA 1CQSA 3CME3 1BNJA 3HK4A 1M1K4 2OTL3 3FZWA 1OH0A 2QGUA 1GMQA 2LYXA 3EHCA 4NPBA 1RMSA 1NWWA 2KF6A 2W04A 5IEOA 1K41A 3J7Yd 1GMRA 3T8UA 3CC43 1WQLB 1RGGA 3CCJ3 3S28A 3ZFZA 1O7WB 2F5WA 1JB4A 2CG1A 4XBXA 2XFTA 3KKGA 2IA7A 2SARA 4ORLA 4IPBA 1E3VA 1YGEA 1GMPA 3FGYA 4RZMA 5GSPA 3HI7A 1Z1SA 2JQ5A 3CCR3 4AKYA 1DETA 1US1A 2W9QA 1X1YA 3F7XA 2W03A 5FW5A 3HZPA 2CWTA 3BNBA 1GOVA 2BHMA 7RNTA 1O7PB 1PFPA 1U5OA 1OF5B 1FGOA 2CFKA 2XSHB 3RNTA 3SX1A 4HOHA 5BVBA 2YFLB 4HKVB 3OWUA 2RFRA 8CHOA 4FR9A 2M7OA 3E99A 3EBTA 4JF8A 1IV9A 3CCV3 2GU3A 1QAFA 1DMMA 2Y73A 3CCE3 3MPHA 4NHFA 3LTBA 1A2VA 1D6ZA 1UUVB 2E2VA 3DGMA 4LYLB 1S723 1ROAA 1TP6A 3T8NA 3EE1A 4BTYA 2OQEA 2UX0A 1N8QA 1BANA 1I2FA 3JUMA 1IVWA 4I4KA 4XB5A 4EBGA 3G6E3 1QVF2 4LGQA 1LNHA 1UCIA 3UL5A 3EX9A 4H3UA 1R4CA 2CHCA 5M18A 1BRHA 3PZWA 3UNLA 4EV5A 1BNRA 3B7CA 1EA2A 2XFSA 1UUWB 1GYBA 2QA43 3FH1A 2GSPA 1BRIA 2F99A 3SYUA 4XDWA 5AEWB 1E3RA 2P09A 4KT3B 4O3VA 5CLKA 2O3OA 2IY2A 1NB3I 4K90B 2WO0A 5JPUA 1GD4A 3JUNA 5EVHA 3EQQB 1VQP3 4NREA 3RDEA 1OGZA 4OVMA 2K54A 1GSPA 1W6CA 3X3XA 5IW9A 1FUSA 3X40A 3GZRA 1W01A 7STDA 3PYJA 1MGWA 3ECFA 3G0KA 1DMNA 1NU3A 2P38A 1WMOA 2CK3H 4HZ9B 4EV2A 1K8A4 1NB5I 1ASKA 3EJVA 2D1WA 2F56A 2LQVA 1X1WA 1G96A 1RNBA 1B2UA 4MEIA 1U8CB 3IMAB 5LC7A 1Q9EA 3EBYA 2ML6A 3FF0A 1KQS2 5AYRB 1JJ22 1JZOA 4R1KA 1EG9B 1RNTA 2RSXA 1BUQA 1BGSA 2RGQA 4N6UA 1WMNA 2UGIA 1YNVX 1FGRA 3NQZA 4FCJA 1S5AA 2O9UX 1GOUA 1RGCA 2W0QA 3MWZA 3NBBA 4L7KA 4BU4A 1AV4A 1W7CA 4O02B 3IJEB 1IU7A 2OTJ3 4R4KA 2QEX3 1YI23 4KFEA 4N3VA 2ZL8A 3Q3FA 1TIJA 5KP3A 1CYVA 1BNIA 3AGOA 3IPTA 3GZBA 3K7CA 2XGNA 5G2GA 4AKZA 1I0VA 4K1UA 1B21A 1LOYA 4HM4B 4N6TA 2ZA4A 1TTOA 1IDPA 2CFGA 1B2SA 3CU3A 4WFOA 1M9GA 1LXEA 2L1SA 2W2CA 1VQK3 3MG3A 1VQ73 1BIRA 3DGOA 3BNEA 4TX4A 1V57A 1RSNA 3U1WA 1DMQA 2KF3A 1IVUA 6RNTA 1OHOA 1RGHA 5HGRA 1BNEA 1RRLA 1ULIB 2RCDA 3AGNA 3BU4A 4OUQA 2PNCA 2OOVC 3LTDA 4IT7A 4R9LA 2GEXA 1X1XA 4BIRA 4JRFA 3I563 2GU1A 3F9SA 1UDII 2CC3A 1Q864 1IQ8A 1CEWI 5G1LA 3BLZA 3BNCA 3CPOA 4LEHA 1NDOB 3BIRA 1WMPA 3CNXA 4N6MA 1LOXA 3T0UA 1WNHA 3B4PA 4HBRA 4G1MB 3S27A 2HOHA 2F86B 3EC9A 5IEPA 4KFFA 2QIYA 1CH0A 1FGTA 2Z77A 3PGBA 1IVXA 1OACA 2GBXB 3FCSB 3FLJA 2WOHA 1TJDA 2H0IA 3LXUX 3VSYA 3ZG0A 3FG3A 1DYUA 4HM2B 2MC8A 1YIJ3 2KXGA 1UGHI 1GOYA 4N6LA 3RGRA 1ZGXA 3WHOA 3DGNA 4HVNA 1PY3A 1RGAA 2K3DA 1T5YA 1VQ53 2XRXB 3CC73 5AIHA 7GSPA 1KC84 3Q1CA 2JDIH 2XSOB 1MWUA 5CF2A 4GL6A 3G16A 3SVAA 3CPW2 3H51A 1FA3A 3KZTA 4CDLA 3ALAA 5HOHA 3U97A 3DY5A 1VQO3 1KSIA 1QVG2 1D6YA 4WWUC 1ZS7A 3N9HA 1RLSA 1PYLA 3D79A 5CK6A 3MG2A 4WYKA 5I97A 2HMMB 3X41A 2GBWB 2GEYA 1STDA 3FG1A 1QJGA 3CC23 4HAAA 2CW9A 2P05A 2W56A 2OCTA 1Q824 3OX9A 1BOXA 3HIGA 1Q7HA 2GXFA 3WA2X 3MYTA 3MG1A 1OCVA
chains in the Genus database with same CATH topology
1YGWA 1LOWA 1RGFA 1SARA 1AQZA 3GSPA 1BRNL 2F56A 1T2HA 1R4YA 1FZUA 1I8VA 1X1WA 1BVIA 2KF4A 1RNBA 1HYFA 1B2UA 1BNSA 1Q9EA 1B27A 3HOHA 3AHWA 1RCKA 1RHLA 1RNTA 1B2ZA 1BGSA 1BNFA 1UCJA 1YNVX 1RN1A 4BU4A 1GOUA 1RGCA 5BIRA 2KAAA 2BIRA 3D5GA 1BU4A 1UCKA 1TRQA 3Q3FA 3AGOA 1BNIA 1DE3A 1I0XA 1RN4A 1BRKA 2F4YA 1B2XA 1RDSA 5RNTA 1I0VA 1LOVA 1B21A 1LOYA 1LRAA 2KF5A 2ZA4A 1TTOA 5BU4A 3AHSA 1B2SA 1BNJA 1GMQA 1BIRA 1RMSA 2KF6A 3D5IA 4J5GA 1RSNA 1GMRA 1LNIA 4J5KA 1BAOA 1BRJA 1YVSA 2KF3A 6RNTA 1RGHA 1RGGA 1BNGA 1AY7A 1BNEA 1MGRA 2F5WA 1I2GA 3AGNA 3BU4A 1JBRA 1G02A 2F5MA 2SARA 1X1XA 4BIRA 1B3SA 1GMPA 5GSPA 6GSPA 1BRGA 1DETA 1X1UA 1X1YA 1GOVA 1FUTA 7RNTA 3RNTA 3URPA 4HOHA 1BUJA 3BIRA 3DGYA 1RGKA 8RNTA 1BRSA 1BSDA 2HOHA 1I70A 1FYSA 1CH0A 1I2EA 1T2IA 1RGEA 3DH2A 1UCLA 4RNTA 1JBTA 1B2MA 1GOYA 1JBSA 1BSCA 1BANA 1BSAA 1I2FA 1ZGXA 3WHOA 1PY3A 1RGAA 2AADA 1C54A 1UCIA 2C4BA 7GSPA 1BRHA 4GHOA 2RBIA 4GSPA 1BNRA 2AAEA 1RTUA 2BU4A 5HOHA 2GSPA 1BRIA 3WR2A 1BSEA 1FW7A 3SYUA 3D4AA 3A5EA 1RLSA 1HZ1A 1PYLA 1RCLA 1B20A 1I3IA 1I3FA 1IYYA 2RNTA 9RNTA 4HAAA 1GSPA 3KCHA 1RGLA 1FUSA 1BOXA 1TRPA 1MGWA 1A2PA 1BSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGW A;  1LOW A;  1RGF A;  1SAR A;  1AQZ A;  3GSP A;  1BRN L;  2F56 A;  1T2H A;  1R4Y A;  1FZU A;  1I8V A;  1X1W A;  1BVI A;  2KF4 A;  1RNB A;  1HYF A;  1B2U A;  1BNS A;  1Q9E A;  1B27 A;  3HOH A;  3AHW A;  1RCK A;  1RHL A;  1RNT A;  1B2Z A;  1BGS A;  1BNF A;  1UCJ A;  1YNV X;  1RN1 A;  4BU4 A;  1GOU A;  1RGC A;  5BIR A;  2KAA A;  2BIR A;  3D5G A;  1BU4 A;  1UCK A;  1TRQ A;  3Q3F A;  3AGO A;  1BNI A;  1DE3 A;  1I0X A;  1RN4 A;  1BRK A;  2F4Y A;  1B2X A;  1RDS A;  5RNT A;  1I0V A;  1LOV A;  1B21 A;  1LOY A;  1LRA A;  2KF5 A;  2ZA4 A;  1TTO A;  5BU4 A;  3AHS A;  1B2S A;  1BNJ A;  1GMQ A;  1BIR A;  1RMS A;  2KF6 A;  3D5I A;  4J5G A;  1RSN A;  1GMR A;  1LNI A;  4J5K A;  1BAO A;  1BRJ A;  1YVS A;  2KF3 A;  6RNT A;  1RGH A;  1RGG A;  1BNG A;  1AY7 A;  1BNE A;  1MGR A;  2F5W A;  1I2G A;  3AGN A;  3BU4 A;  1JBR A;  1G02 A;  2F5M A;  2SAR A;  1X1X A;  4BIR A;  1B3S A;  1GMP A;  5GSP A;  6GSP A;  1BRG A;  1DET A;  1X1U A;  1X1Y A;  1GOV A;  1FUT A;  7RNT A;  3RNT A;  3URP A;  4HOH A;  1BUJ A;  3BIR A;  3DGY A;  1RGK A;  8RNT A;  1BRS A;  1BSD A;  2HOH A;  1I70 A;  1FYS A;  1CH0 A;  1I2E A;  1T2I A;  1RGE A;  3DH2 A;  1UCL A;  4RNT A;  1JBT A;  1B2M A;  1GOY A;  1JBS A;  1BSC A;  1BAN A;  1BSA A;  1I2F A;  1ZGX A;  3WHO A;  1PY3 A;  1RGA A;  2AAD A;  1C54 A;  1UCI A;  2C4B A;  7GSP A;  1BRH A;  4GHO A;  2RBI A;  4GSP A;  1BNR A;  2AAE A;  1RTU A;  2BU4 A;  5HOH A;  2GSP A;  1BRI A;  3WR2 A;  1BSE A;  1FW7 A;  3SYU A;  3D4A A;  3A5E A;  1RLS A;  1HZ1 A;  1PYL A;  1RCL A;  1B20 A;  1I3I A;  1I3F A;  1IYY A;  2RNT A;  9RNT A;  4HAA A;  1GSP A;  3KCH A;  1RGL A;  1FUS A;  1BOX A;  1TRP A;  1MGW A;  1A2P A;  1BSB A; 
#chains in the Genus database with same CATH topology
 4IIA A;  1AQZ A;  4L8O A;  3M8C A;  4R9K A;  3GZX B;  1R4Y A;  3LZA A;  2KF4 A;  1HYF A;  1OHS A;  5G1K A;  1KWI A;  2HMO B;  1BNS A;  1SII A;  3DXO A;  3F14 A;  4EXR A;  2E2T A;  3AHW A;  5IER A;  1OUN A;  3ER7 A;  3S67 A;  3X3Y A;  1RHL A;  2H0G A;  3SXX A;  4AEQ A;  1GY7 A;  3K63 A;  1GD3 A;  3SLU A;  6STD A;  4MMX B;  5STD A;  5AEU B;  2F98 A;  3NM2 A;  4MMZ B;  1FGM A;  3K9M C;  1EUI C;  3MKI A;  1O7N B;  1A90 A;  3DMC A;  5JPP A;  3CCM 3;  1UCK A;  2HMK B;  2CFW A;  4CCV A;  1RKY A;  1ULJ B;  1TFO A;  3CXC 2;  3LOY A;  4WYK B;  5EEO A;  3N8B A;  1RRH A;  3DUK A;  1GS3 A;  2XEP A;  1B2X A;  1VQQ A;  2INX A;  5RNT A;  1UGI A;  1LOV A;  2WGQ A;  4FMA A;  2KF5 A;  1W2Z A;  5BU4 A;  3JUP A;  3SOY A;  2IYJ A;  1TUH A;  1LQM B;  3AMO A;  1J2B A;  3OV4 A;  2W56 B;  1QMA A;  4CJN A;  1MWS A;  3OWY A;  2IUJ A;  3KFQ C;  1VQ9 3;  1G0T A;  3D5I A;  1LNI A;  4XDV A;  1BRJ A;  3GRD A;  3PCS A;  4EYC A;  5IG0 A;  3DGL A;  4FCM A;  1MGR A;  3NUV A;  1O7H B;  3VF1 A;  1JBR A;  4FMC A;  5D82 A;  1B3S A;  3DM8 A;  1IT8 A;  1AR0 A;  2HMJ B;  4H61 A;  1V74 A;  1F8N A;  2CX0 A;  3EN1 B;  3S29 A;  4O2H A;  3NXJ A;  3UL6 A;  4N6V 0;  1RGK A;  1Q81 4;  2CWU A;  1Y4K A;  8RNT A;  3LTA A;  1BRS A;  2XR8 B;  1I70 A;  3KII A;  5CF1 A;  3CCS 3;  5D81 A;  4HJL B;  1I2E A;  2WGO A;  1T2I A;  2Z7A A;  4N6O B;  2CFD A;  3QK9 A;  1FUW A;  1RGE A;  4LSO A;  3NQY A;  1OHP A;  1W00 A;  3G71 3;  3DH2 A;  1UCL A;  3UB1 A;  1UI8 A;  4RNT A;  3AMO B;  1VZZ A;  3A76 A;  4J8T A;  1B2M A;  1EEJ A;  1BSC A;  1BSA A;  3G4S 3;  3OXA A;  2AAD A;  4LMI A;  1HU9 A;  1C54 A;  4XBT A;  1T3B A;  4X2H A;  3NV0 A;  4FMB A;  3WOF B;  3LH4 A;  4GHO A;  2BT3 A;  2Y74 A;  4GSP A;  1VQM 3;  1MWT A;  3KE7 A;  2PZV A;  1N9J A;  3WDG B;  2XH9 A;  1N5P A;  2AAE A;  1RTU A;  2BU4 A;  2B1X B;  5EQL A;  1JB2 A;  1UUG B;  1SIH A;  1SQW A;  1BSE A;  2E2U A;  3S5C A;  2C11 A;  3EN8 A;  3KSE D;  3WMD A;  2B24 B;  4U13 A;  3A5E A;  2BMR B;  1HZ1 A;  1B20 A;  1I3F A;  4XM4 A;  2J8X B;  3EF8 A;  1JRQ A;  2STD A;  2RNT A;  5AYS C;  4I5Q A;  4K61 A;  1OGX A;  3I0Y A;  5IG5 A;  1IT7 A;  3NBJ A;  3CNM A;  1RGL A;  4WHA A;  1JN5 A;  4R80 A;  3PXM A;  1TRP A;  1RJO A;  1A2P A;  1BSB A;  2KRT A;  2CIU A;  2BMQ B;  1ROV A;  1GY6 A;  2CH9 A;  2XGL A;  2H0H A;  1YGW A;  4HM0 B;  3WOE B;  1SAR A;  2CKF B;  1A67 A;  2C10 A;  3V98 A;  1BRN L;  4OK0 A;  1FZU A;  1I8V A;  1BVI A;  1ZX2 A;  3G8Z A;  4HZB B;  1MOL A;  3HOH A;  5BXQ A;  4BTW A;  3I55 3;  2W6J H;  3F40 A;  3NV0 B;  1B2Z A;  2UUG C;  2CFL A;  1UCJ A;  3WA3 A;  3VGN A;  3Q90 A;  4RBN A;  2HML B;  4BL2 A;  3F8X A;  1IV7 A;  3JVC A;  5BIR A;  1YHQ 3;  1SJW A;  3SED A;  2OOV A;  1Q7Y 4;  4KZ1 A;  1BU4 A;  3FG4 A;  5D83 A;  3LTC A;  4STD A;  2YFJ B;  4HM3 B;  5AII A;  4Q53 A;  1YIT 3;  1STF I;  1IQX A;  1JV2 B;  1BRK A;  1RN4 A;  1UW1 A;  1RDS A;  2F4Y A;  1LVN A;  3D9R A;  1ISK A;  1LRA A;  3V92 A;  1HKX A;  3CMA 3;  2L4V A;  1A2K A;  4GB5 A;  5LC6 A;  1YJW 3;  3GWR A;  1JN5 B;  1SPU A;  2V1L A;  3HII A;  1EKM A;  1E97 A;  1W5Z A;  4J5K A;  4J5G A;  1BAO A;  1YVS A;  4LZI A;  1L5G B;  4HM7 B;  2WOF A;  1BNG A;  1AY7 A;  2BMO B;  3FKA A;  1W6Y A;  1I2G A;  1G02 A;  1TFK A;  2F5M A;  4RNZ A;  1W2B 2;  3BB9 A;  2YFI B;  3MHE A;  1M1X B;  6GSP A;  1BRG A;  3F7S A;  1X1U A;  1V58 A;  2YX9 A;  1JB5 A;  3LML A;  5IG4 A;  2D42 A;  1IK3 A;  1FUT A;  1WTH A;  2IMJ A;  3EB8 A;  3JUO A;  3ZG5 A;  4EW5 A;  1M90 4;  3URP A;  5FGO A;  1BUJ A;  3DGY A;  1DVD A;  2KCD A;  3CCQ 3;  1YVB I;  5IG3 A;  3KSP A;  1N9E A;  3V99 A;  1BSD A;  5DRV A;  2HMN B;  1RN7 A;  2P0M A;  1JZD A;  1FYS A;  1W4N A;  2CWV A;  5JBS A;  2R41 A;  1NJI 4;  4MMY B;  1AVL A;  5IEN A;  2ML5 A;  1VQ6 3;  3F8H A;  3X3Z A;  3FF2 A;  3LT9 A;  1UI7 A;  3ROB A;  3GZY B;  3HX8 A;  1PU4 A;  4CPK A;  2Z6B A;  2FXT A;  2OWP A;  1JBT A;  1IQY A;  3GAX A;  5A0O B;  1JBS A;  1JNQ A;  1QAK A;  2Z76 A;  1MNL A;  1Q40 A;  3NHX A;  2C4B A;  1W02 A;  2IUK A;  4QWT A;  1YJN 3;  3O8Y A;  5M19 A;  4BTX A;  5M1A A;  2RBI A;  5DRE A;  4KFD A;  2K0M A;  2CX1 A;  4FMD A;  3TDG A;  5KP1 A;  3Q2P A;  2FNQ A;  4FCZ A;  3WR2 A;  1K28 A;  2A15 A;  2BNG A;  3FSD A;  4HM5 B;  5CXO A;  1FW7 A;  1JKG A;  4N6N B;  4EC6 A;  3D4A A;  3OWS A;  5IF6 A;  1RCL A;  3H3H A;  5TGN A;  1N8R 4;  1I3I A;  3RGA A;  1YJ9 3;  2P0X A;  3KN4 A;  3WOD G;  1EQK A;  1IYY A;  9RNT A;  3L0R A;  3B4O A;  3NM7 A;  4MJD A;  3SOA A;  1QAL A;  3CCU 3;  1GY5 A;  1TU5 A;  1D6U A;  3KCH A;  1O7M B;  4J9A A;  3OW2 2;  4RNY A;  4KVH A;  5AI1 A;  3UJM A;  1K73 4;  4ZM8 A;  2BO9 B;  1DVC A;  2W9P A;  2I9W A;  4HM6 B;  1OPY A;  1LOW A;  1RGF A;  3B8L A;  4PEJ A;  3GSP A;  2ZHX B;  3DZL A;  1MWR A;  2SBL A;  1N5H A;  2Q07 A;  1T2H A;  3NX0 A;  3N54 B;  3QRD A;  3MSO A;  2FGT A;  3LYG A;  1Q40 B;  4DKI A;  4WP5 A;  3STD A;  3BND A;  1W6G A;  1B27 A;  3CD6 3;  2R4I A;  4O8S A;  1LQG C;  1RCK A;  1VQL 3;  4K1V A;  1IVV A;  4HM1 B;  3K5T A;  4ILF A;  1NO3 A;  1BNF A;  1OF5 A;  3D3L A;  5AIF A;  1RN1 A;  3PS8 A;  2CG0 A;  4X2O A;  2OQE C;  4XBY A;  5ELU A;  3CCL 3;  2MF7 A;  2ZDJ A;  1KD1 4;  1K9M 4;  1NNV A;  1ZO2 A;  2KAA A;  4HM8 B;  2BIR A;  3D5G A;  1JKG B;  3NBR A;  5ELJ A;  1FGQ A;  5AIG A;  1CYU A;  1C7H A;  1TRQ A;  3K0Z A;  3LT8 A;  1VQN 3;  1VQ4 3;  3PCR A;  3X42 A;  1DE3 A;  1I0X A;  4L8P A;  1VQ8 3;  4HYZ A;  2XF3 A;  5KP4 A;  4BL3 A;  3JUQ A;  1Q42 A;  1AVK A;  1O7G B;  3AHS A;  1CQS A;  3CME 3;  1BNJ A;  3HK4 A;  1M1K 4;  2OTL 3;  3FZW A;  1OH0 A;  2QGU A;  1GMQ A;  2LYX A;  3EHC A;  4NPB A;  1RMS A;  1NWW A;  2KF6 A;  2W04 A;  5IEO A;  1K41 A;  3J7Y d;  1GMR A;  3T8U A;  3CC4 3;  1WQL B;  1RGG A;  3CCJ 3;  3S28 A;  3ZFZ A;  1O7W B;  2F5W A;  1JB4 A;  2CG1 A;  4XBX A;  2XFT A;  3KKG A;  2IA7 A;  2SAR A;  4ORL A;  4IPB A;  1E3V A;  1YGE A;  1GMP A;  3FGY A;  4RZM A;  5GSP A;  3HI7 A;  1Z1S A;  2JQ5 A;  3CCR 3;  4AKY A;  1DET A;  1US1 A;  2W9Q A;  1X1Y A;  3F7X A;  2W03 A;  5FW5 A;  3HZP A;  2CWT A;  3BNB A;  1GOV A;  2BHM A;  7RNT A;  1O7P B;  1PFP A;  1U5O A;  1OF5 B;  1FGO A;  2CFK A;  2XSH B;  3RNT A;  3SX1 A;  4HOH A;  5BVB A;  2YFL B;  4HKV B;  3OWU A;  2RFR A;  8CHO A;  4FR9 A;  2M7O A;  3E99 A;  3EBT A;  4JF8 A;  1IV9 A;  3CCV 3;  2GU3 A;  1QAF A;  1DMM A;  2Y73 A;  3CCE 3;  3MPH A;  4NHF A;  3LTB A;  1A2V A;  1D6Z A;  1UUV B;  2E2V A;  3DGM A;  4LYL B;  1S72 3;  1ROA A;  1TP6 A;  3T8N A;  3EE1 A;  4BTY A;  2OQE A;  2UX0 A;  1N8Q A;  1BAN A;  1I2F A;  3JUM A;  1IVW A;  4I4K A;  4XB5 A;  4EBG A;  3G6E 3;  1QVF 2;  4LGQ A;  1LNH A;  1UCI A;  3UL5 A;  3EX9 A;  4H3U A;  1R4C A;  2CHC A;  5M18 A;  1BRH A;  3PZW A;  3UNL A;  4EV5 A;  1BNR A;  3B7C A;  1EA2 A;  2XFS A;  1UUW B;  1GYB A;  2QA4 3;  3FH1 A;  2GSP A;  1BRI A;  2F99 A;  3SYU A;  4XDW A;  5AEW B;  1E3R A;  2P09 A;  4KT3 B;  4O3V A;  5CLK A;  2O3O A;  2IY2 A;  1NB3 I;  4K90 B;  2WO0 A;  5JPU A;  1GD4 A;  3JUN A;  5EVH A;  3EQQ B;  1VQP 3;  4NRE A;  3RDE A;  1OGZ A;  4OVM A;  2K54 A;  1GSP A;  1W6C A;  3X3X A;  5IW9 A;  1FUS A;  3X40 A;  3GZR A;  1W01 A;  7STD A;  3PYJ A;  1MGW A;  3ECF A;  3G0K A;  1DMN A;  1NU3 A;  2P38 A;  1WMO A;  2CK3 H;  4HZ9 B;  4EV2 A;  1K8A 4;  1NB5 I;  1ASK A;  3EJV A;  2D1W A;  2F56 A;  2LQV A;  1X1W A;  1G96 A;  1RNB A;  1B2U A;  4MEI A;  1U8C B;  3IMA B;  5LC7 A;  1Q9E A;  3EBY A;  2ML6 A;  3FF0 A;  1KQS 2;  5AYR B;  1JJ2 2;  1JZO A;  4R1K A;  1EG9 B;  1RNT A;  2RSX A;  1BUQ A;  1BGS A;  2RGQ A;  4N6U A;  1WMN A;  2UGI A;  1YNV X;  1FGR A;  3NQZ A;  4FCJ A;  1S5A A;  2O9U X;  1GOU A;  1RGC A;  2W0Q A;  3MWZ A;  3NBB A;  4L7K A;  4BU4 A;  1AV4 A;  1W7C A;  4O02 B;  3IJE B;  1IU7 A;  2OTJ 3;  4R4K A;  2QEX 3;  1YI2 3;  4KFE A;  4N3V A;  2ZL8 A;  3Q3F A;  1TIJ A;  5KP3 A;  1CYV A;  1BNI A;  3AGO A;  3IPT A;  3GZB A;  3K7C A;  2XGN A;  5G2G A;  4AKZ A;  1I0V A;  4K1U A;  1B21 A;  1LOY A;  4HM4 B;  4N6T A;  2ZA4 A;  1TTO A;  1IDP A;  2CFG A;  1B2S A;  3CU3 A;  4WFO A;  1M9G A;  1LXE A;  2L1S A;  2W2C A;  1VQK 3;  3MG3 A;  1VQ7 3;  1BIR A;  3DGO A;  3BNE A;  4TX4 A;  1V57 A;  1RSN A;  3U1W A;  1DMQ A;  2KF3 A;  1IVU A;  6RNT A;  1OHO A;  1RGH A;  5HGR A;  1BNE A;  1RRL A;  1ULI B;  2RCD A;  3AGN A;  3BU4 A;  4OUQ A;  2PNC A;  2OOV C;  3LTD A;  4IT7 A;  4R9L A;  2GEX A;  1X1X A;  4BIR A;  4JRF A;  3I56 3;  2GU1 A;  3F9S A;  1UDI I;  2CC3 A;  1Q86 4;  1IQ8 A;  1CEW I;  5G1L A;  3BLZ A;  3BNC A;  3CPO A;  4LEH A;  1NDO B;  3BIR A;  1WMP A;  3CNX A;  4N6M A;  1LOX A;  3T0U A;  1WNH A;  3B4P A;  4HBR A;  4G1M B;  3S27 A;  2HOH A;  2F86 B;  3EC9 A;  5IEP A;  4KFF A;  2QIY A;  1CH0 A;  1FGT A;  2Z77 A;  3PGB A;  1IVX A;  1OAC A;  2GBX B;  3FCS B;  3FLJ A;  2WOH A;  1TJD A;  2H0I A;  3LXU X;  3VSY A;  3ZG0 A;  3FG3 A;  1DYU A;  4HM2 B;  2MC8 A;  1YIJ 3;  2KXG A;  1UGH I;  1GOY A;  4N6L A;  3RGR A;  1ZGX A;  3WHO A;  3DGN A;  4HVN A;  1PY3 A;  1RGA A;  2K3D A;  1T5Y A;  1VQ5 3;  2XRX B;  3CC7 3;  5AIH A;  7GSP A;  1KC8 4;  3Q1C A;  2JDI H;  2XSO B;  1MWU A;  5CF2 A;  4GL6 A;  3G16 A;  3SVA A;  3CPW 2;  3H51 A;  1FA3 A;  3KZT A;  4CDL A;  3ALA A;  5HOH A;  3U97 A;  3DY5 A;  1VQO 3;  1KSI A;  1QVG 2;  1D6Y A;  4WWU C;  1ZS7 A;  3N9H A;  1RLS A;  1PYL A;  3D79 A;  5CK6 A;  3MG2 A;  4WYK A;  5I97 A;  2HMM B;  3X41 A;  2GBW B;  2GEY A;  1STD A;  3FG1 A;  1QJG A;  3CC2 3;  4HAA A;  2CW9 A;  2P05 A;  2W56 A;  2OCT A;  1Q82 4;  3OX9 A;  1BOX A;  3HIG A;  1Q7H A;  2GXF A;  3WA2 X;  3MYT A;  3MG1 A;  1OCV A; 
#chains in the Genus database with same CATH homology
 1YGW A;  1LOW A;  1RGF A;  1SAR A;  1AQZ A;  3GSP A;  1BRN L;  2F56 A;  1T2H A;  1R4Y A;  1FZU A;  1I8V A;  1X1W A;  1BVI A;  2KF4 A;  1RNB A;  1HYF A;  1B2U A;  1BNS A;  1Q9E A;  1B27 A;  3HOH A;  3AHW A;  1RCK A;  1RHL A;  1RNT A;  1B2Z A;  1BGS A;  1BNF A;  1UCJ A;  1YNV X;  1RN1 A;  4BU4 A;  1GOU A;  1RGC A;  5BIR A;  2KAA A;  2BIR A;  3D5G A;  1BU4 A;  1UCK A;  1TRQ A;  3Q3F A;  3AGO A;  1BNI A;  1DE3 A;  1I0X A;  1RN4 A;  1BRK A;  2F4Y A;  1B2X A;  1RDS A;  5RNT A;  1I0V A;  1LOV A;  1B21 A;  1LOY A;  1LRA A;  2KF5 A;  2ZA4 A;  1TTO A;  5BU4 A;  3AHS A;  1B2S A;  1BNJ A;  1GMQ A;  1BIR A;  1RMS A;  2KF6 A;  3D5I A;  4J5G A;  1RSN A;  1GMR A;  1LNI A;  4J5K A;  1BAO A;  1BRJ A;  1YVS A;  2KF3 A;  6RNT A;  1RGH A;  1RGG A;  1BNG A;  1AY7 A;  1BNE A;  1MGR A;  2F5W A;  1I2G A;  3AGN A;  3BU4 A;  1JBR A;  1G02 A;  2F5M A;  2SAR A;  1X1X A;  4BIR A;  1B3S A;  1GMP A;  5GSP A;  6GSP A;  1BRG A;  1DET A;  1X1U A;  1X1Y A;  1GOV A;  1FUT A;  7RNT A;  3RNT A;  3URP A;  4HOH A;  1BUJ A;  3BIR A;  3DGY A;  1RGK A;  8RNT A;  1BRS A;  1BSD A;  2HOH A;  1I70 A;  1FYS A;  1CH0 A;  1I2E A;  1T2I A;  1RGE A;  3DH2 A;  1UCL A;  4RNT A;  1JBT A;  1B2M A;  1GOY A;  1JBS A;  1BSC A;  1BAN A;  1BSA A;  1I2F A;  1ZGX A;  3WHO A;  1PY3 A;  1RGA A;  2AAD A;  1C54 A;  1UCI A;  2C4B A;  7GSP A;  1BRH A;  4GHO A;  2RBI A;  4GSP A;  1BNR A;  2AAE A;  1RTU A;  2BU4 A;  5HOH A;  2GSP A;  1BRI A;  3WR2 A;  1BSE A;  1FW7 A;  3SYU A;  3D4A A;  3A5E A;  1RLS A;  1HZ1 A;  1PYL A;  1RCL A;  1B20 A;  1I3I A;  1I3F A;  1IYY A;  2RNT A;  9RNT A;  4HAA A;  1GSP A;  3KCH A;  1RGL A;  1FUS A;  1BOX A;  1TRP A;  1MGW A;  1A2P A;  1BSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...