2BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2bu4A00
1BSAA 2SARA 2KF6A 4J5GA 6GSPA 1B2XA 1HYFA 5HOHA 1BUJA 1BNEA 2F4YA 1BSBA 1A2PA 8RNTA 1I2EA 1B3SA 3DH2A 1RGKA 2RNTA 3RNTA 1SARA 1GOYA 3BU4A 1BRIA 2KF5A 4GSPA 1BIRA 1B2MA 1YGWA 1YNVX 2BIRA 1BAOA 2F5WA 1BRNL 1BNGA 1RCKA 1YVSA 1RGHA 1C54A 1MGRA 4BIRA 1B27A 1I0XA 1LRAA 1RSNA 3URPA 1AY7A 1TRPA 1PYLA 3AGNA 3Q3FA 2BU4A 2C4BA 1Q9EA 1TTOA 1JBTA 1BNSA 1PY3A 3DGYA 4GHOA 4HOHA 4RNTA 1BOXA 2F5MA 1BRSA 1GSPA 3HOHA 1X1UA 1BRGA 3WHOA 1TRQA 9RNTA 1B2UA 1FUSA 1FUTA 3D5IA 5BU4A 1BRKA 1G02A 1RGLA 1R4YA 1GMPA 1BNFA 2AAEA 1RMSA 1RTUA 4J5KA 1RNBA 1LOYA 2KAAA 2F56A 2KF3A 3AGOA 1JBRA 1RN1A 1LOVA 3KCHA 1RLSA 1RDSA 3GSPA 1IYYA 1RGEA 3A5EA 3BIRA 1RGFA 1I0VA 1X1WA 1BU4A 2HOHA 1B2ZA 7GSPA 1RNTA 2GSPA 1T2HA 1B20A 1GMQA 1RGAA 1RGGA 1BNIA 1HZ1A 3AHWA 1T2IA 1BNRA 1BANA 1FZUA 1GMRA 1GOUA 1JBSA 3SYUA 1GOVA 1B21A 1BRHA 1I3IA 1MGWA 1I70A 1ZGXA 1B2SA 2RBIA 1RN4A 2AADA 1I8VA 1AQZA 1X1YA 1BSDA 5GSPA 2KF4A 1FYSA 1BNJA 7RNTA 1FW7A 1I2GA 1RHLA 1BVIA 1UCKA 2ZA4A 3D5GA 4BU4A 1BSEA 1RCLA 1RGCA 1BSCA 1UCLA 1DETA 6RNTA 1UCIA 1CH0A 1LNIA 3D4AA 1UCJA 4HAAA 5RNTA 1BGSA 1BRJA 5BIRA 1X1XA 3AHSA 1I3FA 1DE3A 1I2FA 1LOWA 3WR2A
chains in the Genus database with same CATH superfamily
4R9LA 2KF6A 2XEPA 1DVDA 1O7MB 1AVKA 1U5OA 2OCTA 2CHCA 1B2XA 1MNLA 1UUGB 2STDA 1YVBI 3LTDA 1ROAA 5HOHA 1YHQ3 1BUJA 1BSBA 3S5CA 4O02B 1L5GB 2QEX3 3WMDA 1B3SA 2GEYA 2ZL8A 2MC8A 3B4PA 4CPKA 2RNTA 3HZPA 1W2B2 5STDA 2P05A 3SXXA 1YIJ3 1ISKA 2H0GA 1AR0A 2W56B 3BU4A 3DMCA 2KF5A 4GSPA 2YFLB 2IUJA 2W6JH 1GS3A 1YGWA 5G2GA 3S29A 2L4VA 1IU7A 2J8XB 1Q7HA 1RCKA 4OK0A 3NHXA 1FGQA 3WOEB 2ZDJA 2IY2A 4KVHA 1PYLA 3I553 3KN4A 1RRHA 2BU4A 4N6LA 5EQLA 2C4BA 2WOHA 4MEIA 1QVF2 4MMYB 1HU9A 2Z6BA 5ELJA 3EB8A 3UNLA 3QRDA 1W7CA 1W2ZA 1Y4KA 2QIYA 1CEWI 2RCDA 1VQK3 3EF8A 1WNHA 4HOHA 3JUNA 1KQS2 5EVHA 1BRSA 5M1AA 1W00A 1AV4A 1GSPA 5AIGA 3E99A 3LTCA 4BTXA 4K1UA 3CCU3 5A0OB 1JN5A 3NV0B 1JV2B 1O7PB 3X3YA 1TJDA 5BU4A 1G96A 2IYJA 1E3RA 5CF2A 2CFWA 4ZM8A 3ZG0A 4BTWA 1GMPA 3EN8A 1BNFA 1JKGB 3RGRA 1QAFA 3FG4A 2L1SA 1DVCA 3IMAB 5IG0A 5FGOA 2ML5A 2XGNA 1LOVA 4EBGA 1RDSA 1JJ22 4FMCA 3BNCA 1IT8A 1SJWA 3EBTA 3F7SA 3DM8A 4LEHA 1IYYA 4H3UA 1LOXA 3MSOA 2MF7A 1N8QA 1RGFA 4WWUC 2K3DA 1YJN3 1Q864 3SLUA 1SIIA 3M8CA 1TU5A 1Q824 3FZWA 1B2ZA 4JF8A 4WP5A 1VQ83 4J9AA 5AYRB 2YFJB 3S67A 1D6UA 4HJLB 1HZ1A 2XRXB 1VQO3 1BANA 1GMRA 5EEOA 2XH9A 4HKVB 2P0MA 1D6YA 4I5QA 1V58A 2CFDA 5JPPA 3D9RA 3EN1B 2WOFA 1MGWA 3OV4A 1IT7A 1I70A 1ZGXA 4WHAA 5LC7A 2R4IA 1RN4A 3HK4A 1JKGA 3KZTA 3F9SA 1KWIA 1WQLB 2P0XA 1BSDA 1ROVA 5GSPA 5BXQA 3BLZA 1VQP3 3OWUA 1QALA 4WYKA 1FW7A 1I2GA 2OOVA 1OCVA 1K41A 1OGXA 3D5GA 3JVCA 1VQN3 3N9HA 1DYUA 1RGCA 1BSCA 2E2TA 5AI1A 3V99A 6RNTA 3X3XA 1MWSA 2C11A 4LZIA 3STDA 3WA3A 3ALAA 1K28A 5RNTA 1VQ73 1GD4A 1BGSA 5BIRA 1X1XA 1VQQA 1DE3A 4N3VA 3CC43 3DGMA 2SARA 2CX1A 4IPBA 2BT3A 2WO0A 2WGOA 4XB5A 3UB1A 1CYVA 1IQYA 1HYFA 2BNGA 3A76A 1A90A 2F4YA 2CH9A 3EBYA 1Z1SA 3F14A 3SEDA 1A2PA 3GRDA 2PZVA 3RGAA 8CHOA 4L7KA 2V1LA 3CXC2 5JPUA 2CFKA 3LXUX 1IVWA 1OH0A 3ZG5A 4HM8B 3NX0A 4WFOA 4CCVA 5CF1A 3K5TA 1M1XB 2HMMB 3DY5A 1IK3A 1K8A4 1TFKA 1BRIA 4BL3A 1BIRA 1V57A 1NNVA 2BIRA 1BRNL 3CCJ3 3X40A 1YVSA 3HI7A 3H51A 4BIRA 1C54A 1O7HB 1LRAA 2W0QA 3TDGA 1EG9B 4N6UA 3AGNA 3DGNA 4HVNA 1IQXA 3K7CA 3EHCA 3MG2A 2KXGA 3EX9A 3S28A 3NXJA 3T8UA 1OHSA 4ORLA 1LNHA 4GHOA 3WDGB 1BOXA 3LZAA 3EQQB 1JRQA 1QJGA 3T0UA 3U97A 7STDA 1OHOA 1R4CA 1X1UA 2M7OA 4XBYA 5ELUA 1SIHA 1FGOA 4KT3B 5IEOA 1JB4A 3MPHA 1EEJA 1B2UA 3LT9A 3D5IA 1BRKA 1W01A 3B7CA 4GB5A 4CDLA 1YJ93 3X42A 2WGQA 2QGUA 3D79A 1T3BA 2GXFA 4I4KA 1KD14 3LTBA 1RNBA 4G1MB 2KAAA 3KSED 3AGOA 1RN1A 1EA2A 1M9GA 1A2KA 5IG4A 1LXEA 2C10A 3GSPA 3VSYA 4XDWA 3OW22 1O7GB 3EE1A 1AVLA 2INXA 4N6OB 3KKGA 1UI7A 2OTJ3 1X1WA 5DRVA 3MWZA 4BTYA 1TUHA 1B20A 2UUGC 1RGAA 5AYSC 1N5PA 1BNIA 3ECFA 3GZYB 3CMA3 3G6E3 1JBSA 1IVUA 1FGRA 1GOUA 2GBWB 2LYXA 5G1KA 4HM6B 1NDOB 5D82A 1RKYA 1DMNA 3X3ZA 1QVG2 1B21A 2XF3A 1I3IA 1MWTA 4EXRA 3MKIA 4KZ1A 4GL6A 5AIFA 3NM7A 3CNMA 4LYLB 3CCV3 3DXOA 1JZOA 2P38A 2OWPA 1GY7A 3FH1A 1OUNA 1IDPA 1ULIB 2IMJA 3B4OA 4N6V0 1EKMA 3X41A 5IW9A 3CC73 4HM5B 1JB2A 7RNTA 1UI8A 1BVIA 2CG1A 3FSDA 3PCSA 5M19A 1UCKA 4NPBA 4BU4A 3FLJA 3KFQC 1GYBA 5IERA 4L8OA 4J8TA 4HBRA 1W6CA 1UCLA 4KFDA 4EW5A 1DETA 1ASKA 2F99A 1CH0A 3IJEB 4HM1B 3F40A 1LNIA 3D4AA 2O3OA 2XSOB 4L8PA 3G713 2KCDA 2GU3A 1IVVA 2CX0A 4K90B 4N6TA 1W6YA 1I2FA 3BNDA 2FNQA 1BSAA 2HMOB 4PEJA 1IQ8A 1HKXA 4J5GA 6GSPA 1W6GA 2LQVA 3Q1CA 4XM4A 1YIT3 1BNEA 1FUWA 1YJW3 8RNTA 1I2EA 5IF6A 2W2CA 3DH2A 4KFFA 2Y74A 1RGKA 5D83A 4DKIA 3CCE3 3NBBA 2FGTA 4HZ9B 2W9PA 1K734 3G0KA 1NJI4 2CWVA 1US1A 3CCQ3 3JUQA 1YNVX 3LTAA 4FMAA 1SQWA 1ZO2A 1Q814 3G16A 2Q07A 1BNGA 3FF2A 1RGHA 1M904 1I0XA 1JZDA 1RSNA 3URPA 4O3VA 1TRPA 3GZXB 4HYZA 3SVAA 2CG0A 3AMOB 3HIIA 2UX0A 4WYKB 1A67A 1G0TA 1U8CB 2HMLB 1FGTA 1Q9EA 3OWYA 4N6MA 5DREA 2UGIA 2ZHXB 3AMOA 4N6NB 2FXTA 4TX4A 1T5YA 3CME3 2CKFB 3CC23 3WHOA 1TRQA 3KSPA 1F8NA 1Q40B 9RNTA 3J7Yd 2A15A 1NB5I 3D3LA 3GZRA 1FUTA 1IV7A 1G02A 4FMBA 1V74A 5HGRA 2JQ5A 4O2HA 1KSIA 1RTUA 2CC3A 1VQ53 1LOYA 3FG1A 3MG1A 4FCMA 2KF3A 3NBRA 4NREA 2D42A 5CXOA 3DUKA 5I97A 3KCHA 3Q2PA 1RLSA 1JBRA 3CCM3 4MMXB 2CK3H 5AIIA 3LYGA 3L0RA 3RDEA 3V98A 3PGBA 2W03A 2KRTA 3FG3A 4FR9A 1VQM3 1BU4A 3PCRA 3OXAA 3GWRA 1RNTA 2GSPA 1QMAA 1T2HA 5JBSA 1QAKA 1GMQA 1RGGA 1ULJB 4MJDA 3FKAA 5BVBA 5M18A 2OTL3 1YGEA 4R80A 3WODG 1A2VA 1IV9A 2YX9A 3AHWA 1T2IA 3CPW2 4KFEA 1FZUA 5KP1A 2O9UX 4H61A 1E97A 1Q7Y4 2CIUA 3SYUA 1GOVA 4BL2A 1VQ93 4LMIA 1BRHA 2Z76A 3K0ZA 2CW9A 1WTHA 1MWUA 1B2SA 3JUMA 2YFIB 4AKZA 1AQZA 3SX1A 4OVMA 4X2OA 4O8SA 3K9MC 2GEXA 3KE7A 1DMMA 1FYSA 2W04A 4RNZA 1MOLA 2ZA4A 4R9KA 1BSEA 5CK6A 1OHPA 2H0HA 2E2UA 2IA7A 1TIJA 4JRFA 3EJVA 5IG3A 2BMOB 2Z7AA 2CWTA 2K0MA 3UL6A 2CFGA 3EC9A 3WA2X 1GY6A 1UCJA 4EYCA 4FCJA 3F7XA 3IPTA 3CPOA 1BRJA 2GBXB 1O7NB 3CNXA 3HIGA 1I3FA 3U1WA 1VZZA 1ZS7A 3NUVA 4STDA 2RFRA 4HM0B 3DZLA 1JNQA 5D81A 1VQ63 3LOYA 4EV2A 3G4S3 5FW5A 1N5HA 3BNBA 3G8ZA 3PYJA 1E3VA 3WOFB 1RRLA 1UW1A 1J2BA 4XDVA 5IG5A 4Q53A 4HM4B 1NO3A 2CFLA 3PXMA 3V92A 1MWRA 4HZBB 3ZFZA 2I9WA 3MHEA 4RNYA 3RNTA 1SARA 1GOYA 3HX8A 5AEUB 1UUVB 2BHMA 1STDA 1B2MA 1BAOA 2F5WA 3K63A 3S27A 3VGNA 1DMQA 1MGRA 1YI23 1B27A 2PNCA 1AY7A 3PS8A 2IUKA 2H0IA 4K1VA 4OUQA 4RBNA 4AEQA 3N8BA 2QA43 3Q3FA 1N9EA 3ROBA 3SOAA 3UJMA 5AEWB 1RJOA 2ML6A 3FCSB 3CD63 2D1WA 1LQMB 1OGZA 2HMNB 1BUQA 3QK9A 3NV0A 2F98A 1TTOA 1JBTA 2OOVC 1BNSA 1WMOA 3ER7A 3FGYA 3I563 1N9JA 1PY3A 2XSHB 3DGYA 3F8HA 4RNTA 6STDA 3NBJA 4MMZB 2F5MA 5CLKA 4XBTA 3N54B 3FF0A 3NQYA 4K61A 3HOHA 1W4NA 1S5AA 1BRGA 5AIHA 3LH4A 1STFI 3GAXA 2CWUA 2R41A 4IT7A 4NHFA 1FUSA 1WMNA 3F8XA 1SPUA 3LT8A 2E2VA 2Y73A 1RGLA 1R4YA 1VQL3 2AAEA 1NU3A 1RMSA 4IIAA 1OF5A 1D6ZA 3MG3A 2SBLA 4J5KA 4R1KA 1IVXA 5KP4A 4LSOA 5KP3A 1Q40A 2F56A 1ZX2A 2RGQA 1LQGC 4EV5A 5LC6A 2W9QA 1RGEA 3A5EA 3BIRA 4HM7B 3JUOA 4U13A 5IENA 1EQKA 1TP6A 2BMQB 3SOYA 1I0VA 1OPYA 1NWWA 5TGNA 2F86B 4X2HA 4QWTA 3CCS3 2HOHA 3GZBA 7GSPA 3VF1A 3O8YA 2BMRB 2XFSA 1JN5B 2P09A 1RN7A 3MYTA 2HMKB 1CYUA 2GU1A 2HMJB 2XFTA 1Q42A 1BNRA 2B24B 1LVNA 3BNEA 3DGLA 2BO9B 1FGMA 1O7WB 3PZWA 1W5ZA 1C7HA 1PFPA 3B8LA 2W56A 1N8R4 1NB3I 1W02A 2RBIA 2Z77A 1GD3A 3I0YA 2AADA 1I8VA 1VQ43 4R4KA 1X1YA 4FCZA 2RSXA 4ILFA 3H3HA 2OQEA 2KF4A 3LMLA 3CCR3 1CQSA 2JDIH 4RZMA 1S723 1GY5A 1BNJA 3NM2A 2OQEC 3UL5A 5G1LA 1PU4A 3OWSA 4FMDA 1RHLA 3JUPA 4CJNA 1M1K4 1EUIC 4EC6A 1UGIA 4HM3B 3CCL3 1OACA 5IEPA 1UDII 1RCLA 3OX9A 1FA3A 1JB5A 3BB9A 1UGHI 1UCIA 4HM2B 2XGLA 4LGQA 3T8NA 4AKYA 1OF5B 3DGOA 4HAAA 3Q90A 1UUWB 2B1XB 1KC84 2K54A 1K9M4 3AHSA 1WMPA 2XR8B 3KIIA 3CU3A 1TFOA 1LOWA 3NQZA 3WR2A 4XBXA
chains in the Genus database with same CATH topology
1BSAA 2SARA 2KF6A 4J5GA 6GSPA 1B2XA 1HYFA 5HOHA 1BUJA 1BNEA 2F4YA 1BSBA 1A2PA 8RNTA 1I2EA 1B3SA 3DH2A 1RGKA 2RNTA 3RNTA 1SARA 1GOYA 3BU4A 1BRIA 2KF5A 4GSPA 1BIRA 1B2MA 1YGWA 1YNVX 2BIRA 1BAOA 2F5WA 1BRNL 1BNGA 1RCKA 1YVSA 1RGHA 1C54A 1MGRA 4BIRA 1B27A 1I0XA 1LRAA 1RSNA 3URPA 1AY7A 1TRPA 1PYLA 3AGNA 3Q3FA 2BU4A 2C4BA 1Q9EA 1TTOA 1JBTA 1BNSA 1PY3A 3DGYA 4GHOA 4HOHA 4RNTA 1BOXA 2F5MA 1BRSA 1GSPA 3HOHA 1X1UA 1BRGA 3WHOA 1TRQA 9RNTA 1B2UA 1FUSA 1FUTA 3D5IA 5BU4A 1BRKA 1G02A 1RGLA 1R4YA 1GMPA 1BNFA 2AAEA 1RMSA 1RTUA 4J5KA 1RNBA 1LOYA 2KAAA 2F56A 2KF3A 3AGOA 1JBRA 1RN1A 1LOVA 3KCHA 1RLSA 1RDSA 3GSPA 1IYYA 1RGEA 3A5EA 3BIRA 1RGFA 1I0VA 1X1WA 1BU4A 2HOHA 1B2ZA 7GSPA 1RNTA 2GSPA 1T2HA 1B20A 1GMQA 1RGAA 1RGGA 1BNIA 1HZ1A 3AHWA 1T2IA 1BNRA 1BANA 1FZUA 1GMRA 1GOUA 1JBSA 3SYUA 1GOVA 1B21A 1BRHA 1I3IA 1MGWA 1I70A 1ZGXA 1B2SA 2RBIA 1RN4A 2AADA 1I8VA 1AQZA 1X1YA 1BSDA 5GSPA 2KF4A 1FYSA 1BNJA 7RNTA 1FW7A 1I2GA 1RHLA 1BVIA 1UCKA 2ZA4A 3D5GA 4BU4A 1BSEA 1RCLA 1RGCA 1BSCA 1UCLA 1DETA 6RNTA 1UCIA 1CH0A 1LNIA 3D4AA 1UCJA 4HAAA 5RNTA 1BGSA 1BRJA 5BIRA 1X1XA 3AHSA 1I3FA 1DE3A 1I2FA 1LOWA 3WR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSA A;  2SAR A;  2KF6 A;  4J5G A;  6GSP A;  1B2X A;  1HYF A;  5HOH A;  1BUJ A;  1BNE A;  2F4Y A;  1BSB A;  1A2P A;  8RNT A;  1I2E A;  1B3S A;  3DH2 A;  1RGK A;  2RNT A;  3RNT A;  1SAR A;  1GOY A;  3BU4 A;  1BRI A;  2KF5 A;  4GSP A;  1BIR A;  1B2M A;  1YGW A;  1YNV X;  2BIR A;  1BAO A;  2F5W A;  1BRN L;  1BNG A;  1RCK A;  1YVS A;  1RGH A;  1C54 A;  1MGR A;  4BIR A;  1B27 A;  1I0X A;  1LRA A;  1RSN A;  3URP A;  1AY7 A;  1TRP A;  1PYL A;  3AGN A;  3Q3F A;  2BU4 A;  2C4B A;  1Q9E A;  1TTO A;  1JBT A;  1BNS A;  1PY3 A;  3DGY A;  4GHO A;  4HOH A;  4RNT A;  1BOX A;  2F5M A;  1BRS A;  1GSP A;  3HOH A;  1X1U A;  1BRG A;  3WHO A;  1TRQ A;  9RNT A;  1B2U A;  1FUS A;  1FUT A;  3D5I A;  5BU4 A;  1BRK A;  1G02 A;  1RGL A;  1R4Y A;  1GMP A;  1BNF A;  2AAE A;  1RMS A;  1RTU A;  4J5K A;  1RNB A;  1LOY A;  2KAA A;  2F56 A;  2KF3 A;  3AGO A;  1JBR A;  1RN1 A;  1LOV A;  3KCH A;  1RLS A;  1RDS A;  3GSP A;  1IYY A;  1RGE A;  3A5E A;  3BIR A;  1RGF A;  1I0V A;  1X1W A;  1BU4 A;  2HOH A;  1B2Z A;  7GSP A;  1RNT A;  2GSP A;  1T2H A;  1B20 A;  1GMQ A;  1RGA A;  1RGG A;  1BNI A;  1HZ1 A;  3AHW A;  1T2I A;  1BNR A;  1BAN A;  1FZU A;  1GMR A;  1GOU A;  1JBS A;  3SYU A;  1GOV A;  1B21 A;  1BRH A;  1I3I A;  1MGW A;  1I70 A;  1ZGX A;  1B2S A;  2RBI A;  1RN4 A;  2AAD A;  1I8V A;  1AQZ A;  1X1Y A;  1BSD A;  5GSP A;  2KF4 A;  1FYS A;  1BNJ A;  7RNT A;  1FW7 A;  1I2G A;  1RHL A;  1BVI A;  1UCK A;  2ZA4 A;  3D5G A;  4BU4 A;  1BSE A;  1RCL A;  1RGC A;  1BSC A;  1UCL A;  1DET A;  6RNT A;  1UCI A;  1CH0 A;  1LNI A;  3D4A A;  1UCJ A;  4HAA A;  5RNT A;  1BGS A;  1BRJ A;  5BIR A;  1X1X A;  3AHS A;  1I3F A;  1DE3 A;  1I2F A;  1LOW A;  3WR2 A; 
#chains in the Genus database with same CATH topology
 4R9L A;  2KF6 A;  2XEP A;  1DVD A;  1O7M B;  1AVK A;  1U5O A;  2OCT A;  2CHC A;  1B2X A;  1MNL A;  1UUG B;  2STD A;  1YVB I;  3LTD A;  1ROA A;  5HOH A;  1YHQ 3;  1BUJ A;  1BSB A;  3S5C A;  4O02 B;  1L5G B;  2QEX 3;  3WMD A;  1B3S A;  2GEY A;  2ZL8 A;  2MC8 A;  3B4P A;  4CPK A;  2RNT A;  3HZP A;  1W2B 2;  5STD A;  2P05 A;  3SXX A;  1YIJ 3;  1ISK A;  2H0G A;  1AR0 A;  2W56 B;  3BU4 A;  3DMC A;  2KF5 A;  4GSP A;  2YFL B;  2IUJ A;  2W6J H;  1GS3 A;  1YGW A;  5G2G A;  3S29 A;  2L4V A;  1IU7 A;  2J8X B;  1Q7H A;  1RCK A;  4OK0 A;  3NHX A;  1FGQ A;  3WOE B;  2ZDJ A;  2IY2 A;  4KVH A;  1PYL A;  3I55 3;  3KN4 A;  1RRH A;  2BU4 A;  4N6L A;  5EQL A;  2C4B A;  2WOH A;  4MEI A;  1QVF 2;  4MMY B;  1HU9 A;  2Z6B A;  5ELJ A;  3EB8 A;  3UNL A;  3QRD A;  1W7C A;  1W2Z A;  1Y4K A;  2QIY A;  1CEW I;  2RCD A;  1VQK 3;  3EF8 A;  1WNH A;  4HOH A;  3JUN A;  1KQS 2;  5EVH A;  1BRS A;  5M1A A;  1W00 A;  1AV4 A;  1GSP A;  5AIG A;  3E99 A;  3LTC A;  4BTX A;  4K1U A;  3CCU 3;  5A0O B;  1JN5 A;  3NV0 B;  1JV2 B;  1O7P B;  3X3Y A;  1TJD A;  5BU4 A;  1G96 A;  2IYJ A;  1E3R A;  5CF2 A;  2CFW A;  4ZM8 A;  3ZG0 A;  4BTW A;  1GMP A;  3EN8 A;  1BNF A;  1JKG B;  3RGR A;  1QAF A;  3FG4 A;  2L1S A;  1DVC A;  3IMA B;  5IG0 A;  5FGO A;  2ML5 A;  2XGN A;  1LOV A;  4EBG A;  1RDS A;  1JJ2 2;  4FMC A;  3BNC A;  1IT8 A;  1SJW A;  3EBT A;  3F7S A;  3DM8 A;  4LEH A;  1IYY A;  4H3U A;  1LOX A;  3MSO A;  2MF7 A;  1N8Q A;  1RGF A;  4WWU C;  2K3D A;  1YJN 3;  1Q86 4;  3SLU A;  1SII A;  3M8C A;  1TU5 A;  1Q82 4;  3FZW A;  1B2Z A;  4JF8 A;  4WP5 A;  1VQ8 3;  4J9A A;  5AYR B;  2YFJ B;  3S67 A;  1D6U A;  4HJL B;  1HZ1 A;  2XRX B;  1VQO 3;  1BAN A;  1GMR A;  5EEO A;  2XH9 A;  4HKV B;  2P0M A;  1D6Y A;  4I5Q A;  1V58 A;  2CFD A;  5JPP A;  3D9R A;  3EN1 B;  2WOF A;  1MGW A;  3OV4 A;  1IT7 A;  1I70 A;  1ZGX A;  4WHA A;  5LC7 A;  2R4I A;  1RN4 A;  3HK4 A;  1JKG A;  3KZT A;  3F9S A;  1KWI A;  1WQL B;  2P0X A;  1BSD A;  1ROV A;  5GSP A;  5BXQ A;  3BLZ A;  1VQP 3;  3OWU A;  1QAL A;  4WYK A;  1FW7 A;  1I2G A;  2OOV A;  1OCV A;  1K41 A;  1OGX A;  3D5G A;  3JVC A;  1VQN 3;  3N9H A;  1DYU A;  1RGC A;  1BSC A;  2E2T A;  5AI1 A;  3V99 A;  6RNT A;  3X3X A;  1MWS A;  2C11 A;  4LZI A;  3STD A;  3WA3 A;  3ALA A;  1K28 A;  5RNT A;  1VQ7 3;  1GD4 A;  1BGS A;  5BIR A;  1X1X A;  1VQQ A;  1DE3 A;  4N3V A;  3CC4 3;  3DGM A;  2SAR A;  2CX1 A;  4IPB A;  2BT3 A;  2WO0 A;  2WGO A;  4XB5 A;  3UB1 A;  1CYV A;  1IQY A;  1HYF A;  2BNG A;  3A76 A;  1A90 A;  2F4Y A;  2CH9 A;  3EBY A;  1Z1S A;  3F14 A;  3SED A;  1A2P A;  3GRD A;  2PZV A;  3RGA A;  8CHO A;  4L7K A;  2V1L A;  3CXC 2;  5JPU A;  2CFK A;  3LXU X;  1IVW A;  1OH0 A;  3ZG5 A;  4HM8 B;  3NX0 A;  4WFO A;  4CCV A;  5CF1 A;  3K5T A;  1M1X B;  2HMM B;  3DY5 A;  1IK3 A;  1K8A 4;  1TFK A;  1BRI A;  4BL3 A;  1BIR A;  1V57 A;  1NNV A;  2BIR A;  1BRN L;  3CCJ 3;  3X40 A;  1YVS A;  3HI7 A;  3H51 A;  4BIR A;  1C54 A;  1O7H B;  1LRA A;  2W0Q A;  3TDG A;  1EG9 B;  4N6U A;  3AGN A;  3DGN A;  4HVN A;  1IQX A;  3K7C A;  3EHC A;  3MG2 A;  2KXG A;  3EX9 A;  3S28 A;  3NXJ A;  3T8U A;  1OHS A;  4ORL A;  1LNH A;  4GHO A;  3WDG B;  1BOX A;  3LZA A;  3EQQ B;  1JRQ A;  1QJG A;  3T0U A;  3U97 A;  7STD A;  1OHO A;  1R4C A;  1X1U A;  2M7O A;  4XBY A;  5ELU A;  1SIH A;  1FGO A;  4KT3 B;  5IEO A;  1JB4 A;  3MPH A;  1EEJ A;  1B2U A;  3LT9 A;  3D5I A;  1BRK A;  1W01 A;  3B7C A;  4GB5 A;  4CDL A;  1YJ9 3;  3X42 A;  2WGQ A;  2QGU A;  3D79 A;  1T3B A;  2GXF A;  4I4K A;  1KD1 4;  3LTB A;  1RNB A;  4G1M B;  2KAA A;  3KSE D;  3AGO A;  1RN1 A;  1EA2 A;  1M9G A;  1A2K A;  5IG4 A;  1LXE A;  2C10 A;  3GSP A;  3VSY A;  4XDW A;  3OW2 2;  1O7G B;  3EE1 A;  1AVL A;  2INX A;  4N6O B;  3KKG A;  1UI7 A;  2OTJ 3;  1X1W A;  5DRV A;  3MWZ A;  4BTY A;  1TUH A;  1B20 A;  2UUG C;  1RGA A;  5AYS C;  1N5P A;  1BNI A;  3ECF A;  3GZY B;  3CMA 3;  3G6E 3;  1JBS A;  1IVU A;  1FGR A;  1GOU A;  2GBW B;  2LYX A;  5G1K A;  4HM6 B;  1NDO B;  5D82 A;  1RKY A;  1DMN A;  3X3Z A;  1QVG 2;  1B21 A;  2XF3 A;  1I3I A;  1MWT A;  4EXR A;  3MKI A;  4KZ1 A;  4GL6 A;  5AIF A;  3NM7 A;  3CNM A;  4LYL B;  3CCV 3;  3DXO A;  1JZO A;  2P38 A;  2OWP A;  1GY7 A;  3FH1 A;  1OUN A;  1IDP A;  1ULI B;  2IMJ A;  3B4O A;  4N6V 0;  1EKM A;  3X41 A;  5IW9 A;  3CC7 3;  4HM5 B;  1JB2 A;  7RNT A;  1UI8 A;  1BVI A;  2CG1 A;  3FSD A;  3PCS A;  5M19 A;  1UCK A;  4NPB A;  4BU4 A;  3FLJ A;  3KFQ C;  1GYB A;  5IER A;  4L8O A;  4J8T A;  4HBR A;  1W6C A;  1UCL A;  4KFD A;  4EW5 A;  1DET A;  1ASK A;  2F99 A;  1CH0 A;  3IJE B;  4HM1 B;  3F40 A;  1LNI A;  3D4A A;  2O3O A;  2XSO B;  4L8P A;  3G71 3;  2KCD A;  2GU3 A;  1IVV A;  2CX0 A;  4K90 B;  4N6T A;  1W6Y A;  1I2F A;  3BND A;  2FNQ A;  1BSA A;  2HMO B;  4PEJ A;  1IQ8 A;  1HKX A;  4J5G A;  6GSP A;  1W6G A;  2LQV A;  3Q1C A;  4XM4 A;  1YIT 3;  1BNE A;  1FUW A;  1YJW 3;  8RNT A;  1I2E A;  5IF6 A;  2W2C A;  3DH2 A;  4KFF A;  2Y74 A;  1RGK A;  5D83 A;  4DKI A;  3CCE 3;  3NBB A;  2FGT A;  4HZ9 B;  2W9P A;  1K73 4;  3G0K A;  1NJI 4;  2CWV A;  1US1 A;  3CCQ 3;  3JUQ A;  1YNV X;  3LTA A;  4FMA A;  1SQW A;  1ZO2 A;  1Q81 4;  3G16 A;  2Q07 A;  1BNG A;  3FF2 A;  1RGH A;  1M90 4;  1I0X A;  1JZD A;  1RSN A;  3URP A;  4O3V A;  1TRP A;  3GZX B;  4HYZ A;  3SVA A;  2CG0 A;  3AMO B;  3HII A;  2UX0 A;  4WYK B;  1A67 A;  1G0T A;  1U8C B;  2HML B;  1FGT A;  1Q9E A;  3OWY A;  4N6M A;  5DRE A;  2UGI A;  2ZHX B;  3AMO A;  4N6N B;  2FXT A;  4TX4 A;  1T5Y A;  3CME 3;  2CKF B;  3CC2 3;  3WHO A;  1TRQ A;  3KSP A;  1F8N A;  1Q40 B;  9RNT A;  3J7Y d;  2A15 A;  1NB5 I;  3D3L A;  3GZR A;  1FUT A;  1IV7 A;  1G02 A;  4FMB A;  1V74 A;  5HGR A;  2JQ5 A;  4O2H A;  1KSI A;  1RTU A;  2CC3 A;  1VQ5 3;  1LOY A;  3FG1 A;  3MG1 A;  4FCM A;  2KF3 A;  3NBR A;  4NRE A;  2D42 A;  5CXO A;  3DUK A;  5I97 A;  3KCH A;  3Q2P A;  1RLS A;  1JBR A;  3CCM 3;  4MMX B;  2CK3 H;  5AII A;  3LYG A;  3L0R A;  3RDE A;  3V98 A;  3PGB A;  2W03 A;  2KRT A;  3FG3 A;  4FR9 A;  1VQM 3;  1BU4 A;  3PCR A;  3OXA A;  3GWR A;  1RNT A;  2GSP A;  1QMA A;  1T2H A;  5JBS A;  1QAK A;  1GMQ A;  1RGG A;  1ULJ B;  4MJD A;  3FKA A;  5BVB A;  5M18 A;  2OTL 3;  1YGE A;  4R80 A;  3WOD G;  1A2V A;  1IV9 A;  2YX9 A;  3AHW A;  1T2I A;  3CPW 2;  4KFE A;  1FZU A;  5KP1 A;  2O9U X;  4H61 A;  1E97 A;  1Q7Y 4;  2CIU A;  3SYU A;  1GOV A;  4BL2 A;  1VQ9 3;  4LMI A;  1BRH A;  2Z76 A;  3K0Z A;  2CW9 A;  1WTH A;  1MWU A;  1B2S A;  3JUM A;  2YFI B;  4AKZ A;  1AQZ A;  3SX1 A;  4OVM A;  4X2O A;  4O8S A;  3K9M C;  2GEX A;  3KE7 A;  1DMM A;  1FYS A;  2W04 A;  4RNZ A;  1MOL A;  2ZA4 A;  4R9K A;  1BSE A;  5CK6 A;  1OHP A;  2H0H A;  2E2U A;  2IA7 A;  1TIJ A;  4JRF A;  3EJV A;  5IG3 A;  2BMO B;  2Z7A A;  2CWT A;  2K0M A;  3UL6 A;  2CFG A;  3EC9 A;  3WA2 X;  1GY6 A;  1UCJ A;  4EYC A;  4FCJ A;  3F7X A;  3IPT A;  3CPO A;  1BRJ A;  2GBX B;  1O7N B;  3CNX A;  3HIG A;  1I3F A;  3U1W A;  1VZZ A;  1ZS7 A;  3NUV A;  4STD A;  2RFR A;  4HM0 B;  3DZL A;  1JNQ A;  5D81 A;  1VQ6 3;  3LOY A;  4EV2 A;  3G4S 3;  5FW5 A;  1N5H A;  3BNB A;  3G8Z A;  3PYJ A;  1E3V A;  3WOF B;  1RRL A;  1UW1 A;  1J2B A;  4XDV A;  5IG5 A;  4Q53 A;  4HM4 B;  1NO3 A;  2CFL A;  3PXM A;  3V92 A;  1MWR A;  4HZB B;  3ZFZ A;  2I9W A;  3MHE A;  4RNY A;  3RNT A;  1SAR A;  1GOY A;  3HX8 A;  5AEU B;  1UUV B;  2BHM A;  1STD A;  1B2M A;  1BAO A;  2F5W A;  3K63 A;  3S27 A;  3VGN A;  1DMQ A;  1MGR A;  1YI2 3;  1B27 A;  2PNC A;  1AY7 A;  3PS8 A;  2IUK A;  2H0I A;  4K1V A;  4OUQ A;  4RBN A;  4AEQ A;  3N8B A;  2QA4 3;  3Q3F A;  1N9E A;  3ROB A;  3SOA A;  3UJM A;  5AEW B;  1RJO A;  2ML6 A;  3FCS B;  3CD6 3;  2D1W A;  1LQM B;  1OGZ A;  2HMN B;  1BUQ A;  3QK9 A;  3NV0 A;  2F98 A;  1TTO A;  1JBT A;  2OOV C;  1BNS A;  1WMO A;  3ER7 A;  3FGY A;  3I56 3;  1N9J A;  1PY3 A;  2XSH B;  3DGY A;  3F8H A;  4RNT A;  6STD A;  3NBJ A;  4MMZ B;  2F5M A;  5CLK A;  4XBT A;  3N54 B;  3FF0 A;  3NQY A;  4K61 A;  3HOH A;  1W4N A;  1S5A A;  1BRG A;  5AIH A;  3LH4 A;  1STF I;  3GAX A;  2CWU A;  2R41 A;  4IT7 A;  4NHF A;  1FUS A;  1WMN A;  3F8X A;  1SPU A;  3LT8 A;  2E2V A;  2Y73 A;  1RGL A;  1R4Y A;  1VQL 3;  2AAE A;  1NU3 A;  1RMS A;  4IIA A;  1OF5 A;  1D6Z A;  3MG3 A;  2SBL A;  4J5K A;  4R1K A;  1IVX A;  5KP4 A;  4LSO A;  5KP3 A;  1Q40 A;  2F56 A;  1ZX2 A;  2RGQ A;  1LQG C;  4EV5 A;  5LC6 A;  2W9Q A;  1RGE A;  3A5E A;  3BIR A;  4HM7 B;  3JUO A;  4U13 A;  5IEN A;  1EQK A;  1TP6 A;  2BMQ B;  3SOY A;  1I0V A;  1OPY A;  1NWW A;  5TGN A;  2F86 B;  4X2H A;  4QWT A;  3CCS 3;  2HOH A;  3GZB A;  7GSP A;  3VF1 A;  3O8Y A;  2BMR B;  2XFS A;  1JN5 B;  2P09 A;  1RN7 A;  3MYT A;  2HMK B;  1CYU A;  2GU1 A;  2HMJ B;  2XFT A;  1Q42 A;  1BNR A;  2B24 B;  1LVN A;  3BNE A;  3DGL A;  2BO9 B;  1FGM A;  1O7W B;  3PZW A;  1W5Z A;  1C7H A;  1PFP A;  3B8L A;  2W56 A;  1N8R 4;  1NB3 I;  1W02 A;  2RBI A;  2Z77 A;  1GD3 A;  3I0Y A;  2AAD A;  1I8V A;  1VQ4 3;  4R4K A;  1X1Y A;  4FCZ A;  2RSX A;  4ILF A;  3H3H A;  2OQE A;  2KF4 A;  3LML A;  3CCR 3;  1CQS A;  2JDI H;  4RZM A;  1S72 3;  1GY5 A;  1BNJ A;  3NM2 A;  2OQE C;  3UL5 A;  5G1L A;  1PU4 A;  3OWS A;  4FMD A;  1RHL A;  3JUP A;  4CJN A;  1M1K 4;  1EUI C;  4EC6 A;  1UGI A;  4HM3 B;  3CCL 3;  1OAC A;  5IEP A;  1UDI I;  1RCL A;  3OX9 A;  1FA3 A;  1JB5 A;  3BB9 A;  1UGH I;  1UCI A;  4HM2 B;  2XGL A;  4LGQ A;  3T8N A;  4AKY A;  1OF5 B;  3DGO A;  4HAA A;  3Q90 A;  1UUW B;  2B1X B;  1KC8 4;  2K54 A;  1K9M 4;  3AHS A;  1WMP A;  2XR8 B;  3KII A;  3CU3 A;  1TFO A;  1LOW A;  3NQZ A;  3WR2 A;  4XBX A; 
#chains in the Genus database with same CATH homology
 1BSA A;  2SAR A;  2KF6 A;  4J5G A;  6GSP A;  1B2X A;  1HYF A;  5HOH A;  1BUJ A;  1BNE A;  2F4Y A;  1BSB A;  1A2P A;  8RNT A;  1I2E A;  1B3S A;  3DH2 A;  1RGK A;  2RNT A;  3RNT A;  1SAR A;  1GOY A;  3BU4 A;  1BRI A;  2KF5 A;  4GSP A;  1BIR A;  1B2M A;  1YGW A;  1YNV X;  2BIR A;  1BAO A;  2F5W A;  1BRN L;  1BNG A;  1RCK A;  1YVS A;  1RGH A;  1C54 A;  1MGR A;  4BIR A;  1B27 A;  1I0X A;  1LRA A;  1RSN A;  3URP A;  1AY7 A;  1TRP A;  1PYL A;  3AGN A;  3Q3F A;  2BU4 A;  2C4B A;  1Q9E A;  1TTO A;  1JBT A;  1BNS A;  1PY3 A;  3DGY A;  4GHO A;  4HOH A;  4RNT A;  1BOX A;  2F5M A;  1BRS A;  1GSP A;  3HOH A;  1X1U A;  1BRG A;  3WHO A;  1TRQ A;  9RNT A;  1B2U A;  1FUS A;  1FUT A;  3D5I A;  5BU4 A;  1BRK A;  1G02 A;  1RGL A;  1R4Y A;  1GMP A;  1BNF A;  2AAE A;  1RMS A;  1RTU A;  4J5K A;  1RNB A;  1LOY A;  2KAA A;  2F56 A;  2KF3 A;  3AGO A;  1JBR A;  1RN1 A;  1LOV A;  3KCH A;  1RLS A;  1RDS A;  3GSP A;  1IYY A;  1RGE A;  3A5E A;  3BIR A;  1RGF A;  1I0V A;  1X1W A;  1BU4 A;  2HOH A;  1B2Z A;  7GSP A;  1RNT A;  2GSP A;  1T2H A;  1B20 A;  1GMQ A;  1RGA A;  1RGG A;  1BNI A;  1HZ1 A;  3AHW A;  1T2I A;  1BNR A;  1BAN A;  1FZU A;  1GMR A;  1GOU A;  1JBS A;  3SYU A;  1GOV A;  1B21 A;  1BRH A;  1I3I A;  1MGW A;  1I70 A;  1ZGX A;  1B2S A;  2RBI A;  1RN4 A;  2AAD A;  1I8V A;  1AQZ A;  1X1Y A;  1BSD A;  5GSP A;  2KF4 A;  1FYS A;  1BNJ A;  7RNT A;  1FW7 A;  1I2G A;  1RHL A;  1BVI A;  1UCK A;  2ZA4 A;  3D5G A;  4BU4 A;  1BSE A;  1RCL A;  1RGC A;  1BSC A;  1UCL A;  1DET A;  6RNT A;  1UCI A;  1CH0 A;  1LNI A;  3D4A A;  1UCJ A;  4HAA A;  5RNT A;  1BGS A;  1BRJ A;  5BIR A;  1X1X A;  3AHS A;  1I3F A;  1DE3 A;  1I2F A;  1LOW A;  3WR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...