1RN1A

Three-dimensional structure of gln 25-ribonuclease t1 at 1.84 angstroms resolution: structural variations at the base recognition and catalytic sites
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
103
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title Three-dimensional structure of Gln25-ribonuclease T1 at 1.84-A resolution: structural variations at the base recognition and catalytic sites.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 24
structure length 103
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rn1A00
1GMRA 1GOYA 2RNTA 1HYFA 3AHSA 1TRQA 2KF4A 1FZUA 1BUJA 1AQZA 1RGFA 1UCKA 1BVIA 2KF5A 1BRHA 1BNSA 1G02A 1A2PA 3URPA 3BIRA 1JBSA 2BU4A 2F4YA 1JBTA 2C4BA 1B20A 1I2EA 3SYUA 1BRKA 1BRJA 6GSPA 4BIRA 1B2MA 1RDSA 1UCIA 1LOVA 4BU4A 3HOHA 1RLSA 1B27A 1JBRA 1BSBA 1LOYA 1YVSA 1BRIA 1I0XA 1YGWA 1BNFA 1RN1A 3DH2A 1BNIA 3RNTA 6RNTA 1RHLA 3A5EA 3D5GA 1UCLA 3D5IA 1C54A 1RGGA 1BNRA 3DGYA 7RNTA 1BGSA 1DETA 1PYLA 1RGEA 2ZA4A 1BRNL 1BSEA 1FW7A 3BU4A 3KCHA 1Q9EA 1RGLA 1I2GA 2BIRA 1T2IA 1GOVA 4HAAA 1I0VA 2SARA 1FUTA 1BRSA 2AADA 1SARA 2F5WA 1LOWA 1B3SA 2RBIA 1FYSA 1GMPA 1BNGA 2KAAA 1DE3A 1RGKA 1PY3A 3D4AA 1I70A 1RSNA 3AGNA 4GSPA 1YNVX 2AAEA 1RCLA 2F56A 2GSPA 1R4YA 2KF6A 1I3FA 1I8VA 3AHWA 7GSPA 2HOHA 2F5MA 1BNEA 1GOUA 1B2XA 5HOHA 1X1YA 1GMQA 9RNTA 3AGOA 1RN4A 1RGHA 1BRGA 4HOHA 3Q3FA 1BU4A 4J5GA 5GSPA 1TRPA 5BIRA 1RCKA 8RNTA 1MGWA 5BU4A 1LNIA 1RTUA 1I3IA 1BOXA 1B21A 1RMSA 1BAOA 1RNBA 1FUSA 1ZGXA 1BNJA 1I2FA 3WHOA 1UCJA 1HZ1A 1RNTA 1AY7A 1LRAA 1CH0A 1X1UA 1IYYA 4GHOA 1RGAA 2KF3A 5RNTA 1TTOA 3GSPA 3WR2A 1BANA 4RNTA 1X1WA 1MGRA 1B2ZA 1X1XA 1B2UA 1B2SA 1BIRA 4J5KA 1BSAA 1BSCA 1RGCA 1T2HA 1GSPA 1BSDA
chains in the Genus database with same CATH superfamily
1GMRA 5D83A 3CD63 5G1LA 2ZL8A 3X3YA 2PZVA 1YGEA 5BVBA 5AIFA 2GBXB 1JRQA 2KF4A 2P09A 1FZUA 3FCSB 5EQLA 3HK4A 4BTXA 3VGNA 1KC84 1BRHA 2STDA 3URPA 3BIRA 4N3VA 4KFDA 1VQ83 2F4YA 1JBTA 2C4BA 3HIGA 4H61A 2XH9A 1IVVA 3JVCA 2QGUA 4AKZA 1OF5B 3B8LA 4IT7A 3SYUA 2XSHB 2PNCA 1W6YA 1BRJA 3WA2X 4EBGA 3FZWA 4I4KA 3CCU3 3Q1CA 2CX0A 1RDSA 3EJVA 3MG2A 3MG3A 2UGIA 4O8SA 5A0OB 1B27A 1W6CA 2BT3A 4QWTA 1LOYA 3KFQC 3HX8A 3M8CA 5M19A 3SLUA 1QALA 3LH4A 1KQS2 1EEJA 3S27A 5JBSA 1D6UA 3DH2A 3EHCA 2OOVA 3HIIA 3RNTA 1KD14 1T5YA 2D1WA 3VSYA 3PCRA 2FXTA 3D5IA 3V98A 1DMMA 1O7HB 1BNRA 1IU7A 2M7OA 1BGSA 1DETA 3AMOB 3DXOA 2IY2A 1RGEA 2CWUA 2WO0A 2BNGA 3BU4A 2YX9A 1GOVA 4HM5B 1I0VA 4HZ9B 3G16A 5G1KA 2AADA 3NBJA 3X3XA 1PU4A 2RBIA 3PZWA 3K9MC 1BNGA 1JV2B 4RNZA 1A2KA 1PY3A 1V57A 3FKAA 5M18A 1HKXA 5KP4A 1Q7HA 2OCTA 3V99A 1W01A 1FGQA 3EN8A 3GAXA 2R41A 1Q40B 2CFWA 3LTAA 4FMBA 1EA2A 3FG1A 1VQO3 3CCR3 1UDII 2W9PA 3VF1A 5DREA 1FGMA 1GMQA 3KE7A 1RN4A 3EQQB 1IQXA 4STDA 4EXRA 1RKYA 1CYVA 1KSIA 3Q3FA 3BNCA 2P05A 4X2HA 5GSPA 1Y4KA 8RNTA 1UUWB 2H0HA 1LOXA 3DM8A 2O9UX 2H0IA 2C11A 3SEDA 3LOYA 1LNIA 3STDA 2O3OA 3QK9A 2CG0A 1I3IA 1B21A 7STDA 4HKVB 1OPYA 1GYBA 1O7PB 1BAOA 3CME3 2FGTA 1DMQA 4EW5A 3N54B 3ZFZA 2QA43 4N6OB 1R4CA 2WOFA 1BNJA 1RRHA 3WHOA 1NWWA 5CF2A 1J2BA 1AY7A 2UX0A 3GZYB 1FGTA 1LXEA 3OWSA 4HM3B 1DVCA 1A90A 2CFGA 4GL6A 5HGRA 4WHAA 1YHQ3 2XRXB 3GZXB 3WA3A 1N5PA 2WGQA 1US1A 1IT7A 1B2ZA 3LTCA 3NBBA 3X42A 4HZBB 4Q53A 1OHSA 3WMDA 3UL5A 1VQ93 3RGRA 5IEOA 2R4IA 3MHEA 3DGLA 3PGBA 2IUKA 3D9RA 3NXJA 3BB9A 3JUPA 4O2HA 1CYUA 3CCS3 2J8XB 2JQ5A 4XDWA 1S5AA 1ZS7A 3DGMA 3Q2PA 1HYFA 1SJWA 3QRDA 4HM0B 2XF3A 4FCJA 1BUJA 2KF5A 3X40A 5BXQA 3S28A 3LT9A 3OX9A 3ROBA 1JBSA 2HMMB 1IV7A 3Q90A 4TX4A 1OUNA 1VZZA 2W56B 2IUJA 1B20A 1NU3A 4I5QA 4L7KA 3CCQ3 1YVBI 2E2TA 2KCDA 1Q824 1WMNA 4L8OA 1G96A 1K9M4 2OTJ3 2B1XB 2E2VA 1ISKA 3OV4A 2CWVA 4WFOA 1LOVA 2OWPA 4BU4A 1QVF2 2Z7AA 1NO3A 1OF5A 3BNBA 4BTYA 1BRIA 1TIJA 1O7WB 1AVLA 2CH9A 1SQWA 1VQP3 3E99A 1RN1A 6RNTA 1BNIA 4N6TA 1GD3A 1GY7A 1PFPA 1ROAA 2YFIB 1IQ8A 1ULJB 5AIGA 3WODG 3K7CA 3A5EA 3F8HA 3D5GA 4EV5A 1U8CB 2HMNB 3N9HA 3RDEA 1FGRA 3FG3A 1GY5A 2ZA4A 4R9KA 1BRNL 5AYSC 1FW7A 1YI23 1BUQA 4BL2A 1LNHA 1W4NA 1OHOA 3LMLA 1Q9EA 1RGLA 1I2GA 3NV0A 1IV9A 3JUQA 5KP1A 2SARA 4XDVA 1FUTA 1BRSA 3AMOA 2XR8B 2CFKA 1LOWA 3LT8A 4MMZB 5D81A 3F8XA 3ZG0A 3UB1A 1K8A4 1RSNA 1JKGB 3JUOA 4FCZA 5IG3A 1F8NA 2MF7A 3CC23 1W2ZA 2F86B 1D6ZA 1RCLA 4R80A 1EG9B 2GSPA 2GEYA 2Z76A 4JF8A 1N5HA 3I0YA 2QEX3 4NHFA 3KSPA 3F9SA 1LQMB 2F5MA 3S5CA 1BNEA 3IMAB 1MWUA 1GOUA 1TFKA 4OVMA 4LZIA 1X1YA 1UGHI 1Q7Y4 1OACA 2WOHA 1L5GB 1GY6A 2RGQA 3AGOA 1D6YA 3NM2A 1STFI 3DY5A 5IF6A 1BRGA 1JZOA 1WMPA 4FMCA 1BU4A 4J5GA 2CX1A 2INXA 4O02B 8CHOA 1FA3A 3FH1A 1MGWA 2XGLA 1VQK3 3NQYA 3S67A 4HM8B 1VQQA 4N6LA 1EKMA 3ALAA 4N6NB 5LC6A 3X41A 1E3VA 1S723 1FUSA 2LYXA 2CHCA 2L4VA 1RNBA 1O7GB 2OOVC 3CPW2 1VQ73 1TFOA 5FW5A 1HZ1A 1QMAA 3G6E3 4JRFA 1W6GA 1IYYA 1W00A 1MWSA 2LQVA 3L0RA 1IK3A 5IENA 1TTOA 4XBTA 2D42A 3WR2A 5CF1A 1AV4A 1BANA 3CCL3 1VQ53 4HVNA 1NJI4 3B7CA 4KZ1A 5EEOA 1EQKA 2HMOB 2HMKB 3N8BA 3G0KA 1OGZA 2CFDA 4K61A 3KIIA 3DGYA 1RGCA 1QAFA 2WGOA 1TUHA 3KKGA 4FCMA 1A67A 2RNTA 5EVHA 1TP6A 1YJW3 2KRTA 5D82A 2GXFA 3KN4A 1GS3A 2BMQB 2H0GA 3AHSA 1TRQA 5LC7A 2GEXA 2Y73A 3FGYA 1KWIA 4LMIA 5IG5A 2P38A 2ZDJA 2HMJB 1BNSA 1G02A 2I9WA 1A2PA 2L1SA 3EF8A 1RJOA 3LZAA 4U13A 3CC73 2Q07A 1G0TA 2BO9B 4IIAA 4DKIA 4KFEA 2YFJB 4N6UA 3G4S3 3PS8A 1U5OA 3GWRA 6GSPA 4BIRA 4WYKB 3D79A 4J8TA 3ZG5A 2W56A 4HJLB 1JZDA 1LVNA 4O3VA 3WOFB 1N9EA 1RLSA 1JBRA 3EB8A 1VQM3 3CNXA 1WMOA 1MNLA 1YGWA 3NQZA 3F7XA 3EC9A 5ELJA 1Q864 1SIHA 1O7MB 2W03A 4R9LA 2K54A 2K0MA 4CCVA 1UI8A 1CQSA 1N8R4 2OTL3 3TDGA 3ER7A 5JPUA 2F98A 1O7NB 5AEWB 1ZX2A 3CNMA 2GU1A 5STDA 1T2IA 2IMJA 4HM4B 1NB5I 1V74A 4L8PA 3DMCA 1OHPA 1UGIA 4OK0A 1SARA 2F5WA 4OUQA 4GB5A 4EC6A 3I563 2KAAA 1DE3A 2MC8A 1RGKA 3D4AA 1I70A 3AGNA 1E3RA 3IJEB 3SOYA 1QAKA 3SXXA 1M9GA 3MKIA 2F56A 4K90B 3CCJ3 1NDOB 4RNYA 3PYJA 3B4OA 3OWUA 1FUWA 1SIIA 3U97A 2XFTA 4EV2A 1QVG2 3AHWA 3X3ZA 2HOHA 1M904 3HI7A 1B2XA 5AIHA 1ULIB 2GBWB 1C7HA 1SPUA 2OQEA 1W7CA 9RNTA 5M1AA 2F99A 2XSOB 1QJGA 4CJNA 3WOEB 1NNVA 1UUGB 3D3LA 4KT3B 4HOHA 5BIRA 5G2GA 1TRPA 2K3DA 1N9JA 2E2UA 3B4PA 2CKFB 2CIUA 1RTUA 4HYZA 3H3HA 5IEPA 1ASKA 1RMSA 2RFRA 3EN1B 3MPHA 1V58A 3HZPA 4N6MA 2W9QA 3FSDA 1YJ93 3GRDA 3MG1A 1RNTA 1JB2A 3S29A 1X1UA 2CC3A 5CLKA 4GHOA 1RGAA 1K41A 3FF0A 1MWRA 2KF3A 4MJDA 5RNTA 1Z1SA 3OW22 2P0MA 3OWYA 1TU5A 1JN5B 5CK6A 2OQEC 4NREA 1LQGC 4K1VA 4BTWA 1CEWI 3F40A 1X1WA 1MGRA 4HM1B 1Q40A 3SOAA 2UUGC 5AI1A 1IVWA 1B2SA 3CU3A 4H3UA 4RZMA 3EE1A 3FLJA 1WQLB 1TJDA 4N6V0 1VQL3 1M1XB 4J5KA 3WDGB 2FNQA 1BSCA 2SBLA 2CG1A 1T2HA 1UI7A 1MWTA 1RN7A 1GSPA 2KF6A 3DUKA 3NM7A 3LTDA 5TGNA 1GOYA 2RSXA 1W5ZA 3JUMA 1WNHA 4R1KA 2CWTA 4R4KA 4ZM8A 3DGNA 4KVHA 2HMLB 2BMRB 2QIYA 2XFSA 2ZHXB 1AQZA 1RGFA 1UCKA 1BVIA 2V1LA 4XBXA 1MOLA 3NV0B 2RCDA 3F14A 1JB4A 4WP5A 1HU9A 2BU4A 4LGQA 2Y74A 1UUVB 3UL6A 5AIIA 1UW1A 3NUVA 4NPBA 1I2EA 4FMDA 4XBYA 3BNDA 3UNLA 1BRKA 4MMYB 3CXC2 1W2B2 5IG4A 3O8YA 1OCVA 1B2MA 1AVKA 4KFFA 5DRVA 1UCIA 3A76A 3HOHA 4HM6B 4FMAA 1BSBA 1YVSA 3SVAA 2BHMA 3BNEA 1RRLA 1OGXA 1I0XA 2Z6BA 4WYKA 4LEHA 1IDPA 1YIT3 1BNFA 1E97A 4EYCA 3K0ZA 1NB3I 2Z77A 1IQYA 1RHLA 3DGOA 4MEIA 4AEQA 1UCLA 2XGNA 1C54A 4CDLA 1ROVA 1RGGA 1T3BA 7RNTA 1K734 1ZO2A 1PYLA 4BL3A 1WTHA 1BSEA 1DYUA 2IYJA 3CCE3 3KCHA 2BIRA 3U1WA 1DMNA 1K28A 2CK3H 4HAAA 2CFLA 5KP3A 2A15A 4FR9A 4K1UA 3NHXA 1B3SA 3EX9A 1FYSA 1GMPA 4IPBA 1EUIC 3F7SA 5IG0A 2B24B 3MWZA 1IVUA 1N8QA 2GU3A 3PCSA 4GSPA 4G1MB 1YNVX 2KXGA 4ILFA 2AAEA 3JUNA 2IA7A 3SX1A 1IT8A 1R4YA 1I3FA 1FGOA 1I8VA 3CPOA 3MYTA 3EBYA 5AEUB 7GSPA 1JB5A 1Q42A 2YFLB 3FG4A 4LYLB 4J9AA 1OH0A 5JPPA 4MMXB 1AR0A 2C10A 3K5TA 5HOHA 1DVDA 3CC43 3LYGA 1VQ63 2JDIH 4AKYA 1RGHA 2BMOB 2ML5A 3DZLA 3CCM3 3IPTA 2ML6A 3T0UA 3LTBA 3MSOA 1RCKA 3NX0A 1GD4A 5AYRB 4HBRA 3NBRA 5BU4A 3GZRA 2W0QA 4XM4A 1BOXA 3I553 3EBTA 1STDA 3LXUX 3FF2A 3KSED 1IVXA 3V92A 3PXMA 3T8NA 5IW9A 1ZGXA 1Q814 5FGOA 1W02A 5CXOA 6STDA 1I2FA 4WWUC 1UCJA 3RGAA 2XEPA 1M1K4 1LRAA 3UJMA 1CH0A 4ORLA 1VQ43 3H51A 1YJN3 4CPKA 1YIJ3 1JKGA 3T8UA 3GSPA 2CW9A 4XB5A 5IERA 3CCV3 4LSOA 4RNTA 1VQN3 3GZBA 1JNQA 4RBNA 3J7Yd 3G713 3CMA3 2W04A 3K63A 4PEJA 4X2OA 1X1XA 5I97A 3G8ZA 1B2UA 1A2VA 3KZTA 2W2CA 4HM2B 1JJ22 3ECFA 3BLZA 1BIRA 5ELUA 3OXAA 1JN5A 2W6JH 1BSAA 2P0XA 4HM7B 1BSDA
chains in the Genus database with same CATH topology
1GMRA 1GOYA 2RNTA 1HYFA 3AHSA 1TRQA 2KF4A 1FZUA 1BUJA 1AQZA 1RGFA 1UCKA 1BVIA 2KF5A 1BRHA 1BNSA 1G02A 1A2PA 3URPA 3BIRA 1JBSA 2BU4A 2F4YA 1JBTA 2C4BA 1B20A 1I2EA 3SYUA 1BRKA 1BRJA 6GSPA 4BIRA 1B2MA 1RDSA 1UCIA 1LOVA 4BU4A 3HOHA 1RLSA 1B27A 1JBRA 1BSBA 1LOYA 1YVSA 1BRIA 1I0XA 1YGWA 1BNFA 1RN1A 3DH2A 1BNIA 3RNTA 6RNTA 1RHLA 3A5EA 3D5GA 1UCLA 3D5IA 1C54A 1RGGA 1BNRA 3DGYA 7RNTA 1BGSA 1DETA 1PYLA 1RGEA 2ZA4A 1BRNL 1BSEA 1FW7A 3BU4A 3KCHA 1Q9EA 1RGLA 1I2GA 2BIRA 1T2IA 1GOVA 4HAAA 1I0VA 2SARA 1FUTA 1BRSA 2AADA 1SARA 2F5WA 1LOWA 1B3SA 2RBIA 1FYSA 1GMPA 1BNGA 2KAAA 1DE3A 1RGKA 1PY3A 3D4AA 1I70A 1RSNA 3AGNA 4GSPA 1YNVX 2AAEA 1RCLA 2F56A 2GSPA 1R4YA 2KF6A 1I3FA 1I8VA 3AHWA 7GSPA 2HOHA 2F5MA 1BNEA 1GOUA 1B2XA 5HOHA 1X1YA 1GMQA 9RNTA 3AGOA 1RN4A 1RGHA 1BRGA 4HOHA 3Q3FA 1BU4A 4J5GA 5GSPA 1TRPA 5BIRA 1RCKA 8RNTA 1MGWA 5BU4A 1LNIA 1RTUA 1I3IA 1BOXA 1B21A 1RMSA 1BAOA 1RNBA 1FUSA 1ZGXA 1BNJA 1I2FA 3WHOA 1UCJA 1HZ1A 1RNTA 1AY7A 1LRAA 1CH0A 1X1UA 1IYYA 4GHOA 1RGAA 2KF3A 5RNTA 1TTOA 3GSPA 3WR2A 1BANA 4RNTA 1X1WA 1MGRA 1B2ZA 1X1XA 1B2UA 1B2SA 1BIRA 4J5KA 1BSAA 1BSCA 1RGCA 1T2HA 1GSPA 1BSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMR A;  1GOY A;  2RNT A;  1HYF A;  3AHS A;  1TRQ A;  2KF4 A;  1FZU A;  1BUJ A;  1AQZ A;  1RGF A;  1UCK A;  1BVI A;  2KF5 A;  1BRH A;  1BNS A;  1G02 A;  1A2P A;  3URP A;  3BIR A;  1JBS A;  2BU4 A;  2F4Y A;  1JBT A;  2C4B A;  1B20 A;  1I2E A;  3SYU A;  1BRK A;  1BRJ A;  6GSP A;  4BIR A;  1B2M A;  1RDS A;  1UCI A;  1LOV A;  4BU4 A;  3HOH A;  1RLS A;  1B27 A;  1JBR A;  1BSB A;  1LOY A;  1YVS A;  1BRI A;  1I0X A;  1YGW A;  1BNF A;  1RN1 A;  3DH2 A;  1BNI A;  3RNT A;  6RNT A;  1RHL A;  3A5E A;  3D5G A;  1UCL A;  3D5I A;  1C54 A;  1RGG A;  1BNR A;  3DGY A;  7RNT A;  1BGS A;  1DET A;  1PYL A;  1RGE A;  2ZA4 A;  1BRN L;  1BSE A;  1FW7 A;  3BU4 A;  3KCH A;  1Q9E A;  1RGL A;  1I2G A;  2BIR A;  1T2I A;  1GOV A;  4HAA A;  1I0V A;  2SAR A;  1FUT A;  1BRS A;  2AAD A;  1SAR A;  2F5W A;  1LOW A;  1B3S A;  2RBI A;  1FYS A;  1GMP A;  1BNG A;  2KAA A;  1DE3 A;  1RGK A;  1PY3 A;  3D4A A;  1I70 A;  1RSN A;  3AGN A;  4GSP A;  1YNV X;  2AAE A;  1RCL A;  2F56 A;  2GSP A;  1R4Y A;  2KF6 A;  1I3F A;  1I8V A;  3AHW A;  7GSP A;  2HOH A;  2F5M A;  1BNE A;  1GOU A;  1B2X A;  5HOH A;  1X1Y A;  1GMQ A;  9RNT A;  3AGO A;  1RN4 A;  1RGH A;  1BRG A;  4HOH A;  3Q3F A;  1BU4 A;  4J5G A;  5GSP A;  1TRP A;  5BIR A;  1RCK A;  8RNT A;  1MGW A;  5BU4 A;  1LNI A;  1RTU A;  1I3I A;  1BOX A;  1B21 A;  1RMS A;  1BAO A;  1RNB A;  1FUS A;  1ZGX A;  1BNJ A;  1I2F A;  3WHO A;  1UCJ A;  1HZ1 A;  1RNT A;  1AY7 A;  1LRA A;  1CH0 A;  1X1U A;  1IYY A;  4GHO A;  1RGA A;  2KF3 A;  5RNT A;  1TTO A;  3GSP A;  3WR2 A;  1BAN A;  4RNT A;  1X1W A;  1MGR A;  1B2Z A;  1X1X A;  1B2U A;  1B2S A;  1BIR A;  4J5K A;  1BSA A;  1BSC A;  1RGC A;  1T2H A;  1GSP A;  1BSD A; 
#chains in the Genus database with same CATH topology
 1GMR A;  5D83 A;  3CD6 3;  5G1L A;  2ZL8 A;  3X3Y A;  2PZV A;  1YGE A;  5BVB A;  5AIF A;  2GBX B;  1JRQ A;  2KF4 A;  2P09 A;  1FZU A;  3FCS B;  5EQL A;  3HK4 A;  4BTX A;  3VGN A;  1KC8 4;  1BRH A;  2STD A;  3URP A;  3BIR A;  4N3V A;  4KFD A;  1VQ8 3;  2F4Y A;  1JBT A;  2C4B A;  3HIG A;  4H61 A;  2XH9 A;  1IVV A;  3JVC A;  2QGU A;  4AKZ A;  1OF5 B;  3B8L A;  4IT7 A;  3SYU A;  2XSH B;  2PNC A;  1W6Y A;  1BRJ A;  3WA2 X;  4EBG A;  3FZW A;  4I4K A;  3CCU 3;  3Q1C A;  2CX0 A;  1RDS A;  3EJV A;  3MG2 A;  3MG3 A;  2UGI A;  4O8S A;  5A0O B;  1B27 A;  1W6C A;  2BT3 A;  4QWT A;  1LOY A;  3KFQ C;  3HX8 A;  3M8C A;  5M19 A;  3SLU A;  1QAL A;  3LH4 A;  1KQS 2;  1EEJ A;  3S27 A;  5JBS A;  1D6U A;  3DH2 A;  3EHC A;  2OOV A;  3HII A;  3RNT A;  1KD1 4;  1T5Y A;  2D1W A;  3VSY A;  3PCR A;  2FXT A;  3D5I A;  3V98 A;  1DMM A;  1O7H B;  1BNR A;  1IU7 A;  2M7O A;  1BGS A;  1DET A;  3AMO B;  3DXO A;  2IY2 A;  1RGE A;  2CWU A;  2WO0 A;  2BNG A;  3BU4 A;  2YX9 A;  1GOV A;  4HM5 B;  1I0V A;  4HZ9 B;  3G16 A;  5G1K A;  2AAD A;  3NBJ A;  3X3X A;  1PU4 A;  2RBI A;  3PZW A;  3K9M C;  1BNG A;  1JV2 B;  4RNZ A;  1A2K A;  1PY3 A;  1V57 A;  3FKA A;  5M18 A;  1HKX A;  5KP4 A;  1Q7H A;  2OCT A;  3V99 A;  1W01 A;  1FGQ A;  3EN8 A;  3GAX A;  2R41 A;  1Q40 B;  2CFW A;  3LTA A;  4FMB A;  1EA2 A;  3FG1 A;  1VQO 3;  3CCR 3;  1UDI I;  2W9P A;  3VF1 A;  5DRE A;  1FGM A;  1GMQ A;  3KE7 A;  1RN4 A;  3EQQ B;  1IQX A;  4STD A;  4EXR A;  1RKY A;  1CYV A;  1KSI A;  3Q3F A;  3BNC A;  2P05 A;  4X2H A;  5GSP A;  1Y4K A;  8RNT A;  1UUW B;  2H0H A;  1LOX A;  3DM8 A;  2O9U X;  2H0I A;  2C11 A;  3SED A;  3LOY A;  1LNI A;  3STD A;  2O3O A;  3QK9 A;  2CG0 A;  1I3I A;  1B21 A;  7STD A;  4HKV B;  1OPY A;  1GYB A;  1O7P B;  1BAO A;  3CME 3;  2FGT A;  1DMQ A;  4EW5 A;  3N54 B;  3ZFZ A;  2QA4 3;  4N6O B;  1R4C A;  2WOF A;  1BNJ A;  1RRH A;  3WHO A;  1NWW A;  5CF2 A;  1J2B A;  1AY7 A;  2UX0 A;  3GZY B;  1FGT A;  1LXE A;  3OWS A;  4HM3 B;  1DVC A;  1A90 A;  2CFG A;  4GL6 A;  5HGR A;  4WHA A;  1YHQ 3;  2XRX B;  3GZX B;  3WA3 A;  1N5P A;  2WGQ A;  1US1 A;  1IT7 A;  1B2Z A;  3LTC A;  3NBB A;  3X42 A;  4HZB B;  4Q53 A;  1OHS A;  3WMD A;  3UL5 A;  1VQ9 3;  3RGR A;  5IEO A;  2R4I A;  3MHE A;  3DGL A;  3PGB A;  2IUK A;  3D9R A;  3NXJ A;  3BB9 A;  3JUP A;  4O2H A;  1CYU A;  3CCS 3;  2J8X B;  2JQ5 A;  4XDW A;  1S5A A;  1ZS7 A;  3DGM A;  3Q2P A;  1HYF A;  1SJW A;  3QRD A;  4HM0 B;  2XF3 A;  4FCJ A;  1BUJ A;  2KF5 A;  3X40 A;  5BXQ A;  3S28 A;  3LT9 A;  3OX9 A;  3ROB A;  1JBS A;  2HMM B;  1IV7 A;  3Q90 A;  4TX4 A;  1OUN A;  1VZZ A;  2W56 B;  2IUJ A;  1B20 A;  1NU3 A;  4I5Q A;  4L7K A;  3CCQ 3;  1YVB I;  2E2T A;  2KCD A;  1Q82 4;  1WMN A;  4L8O A;  1G96 A;  1K9M 4;  2OTJ 3;  2B1X B;  2E2V A;  1ISK A;  3OV4 A;  2CWV A;  4WFO A;  1LOV A;  2OWP A;  4BU4 A;  1QVF 2;  2Z7A A;  1NO3 A;  1OF5 A;  3BNB A;  4BTY A;  1BRI A;  1TIJ A;  1O7W B;  1AVL A;  2CH9 A;  1SQW A;  1VQP 3;  3E99 A;  1RN1 A;  6RNT A;  1BNI A;  4N6T A;  1GD3 A;  1GY7 A;  1PFP A;  1ROA A;  2YFI B;  1IQ8 A;  1ULJ B;  5AIG A;  3WOD G;  3K7C A;  3A5E A;  3F8H A;  3D5G A;  4EV5 A;  1U8C B;  2HMN B;  3N9H A;  3RDE A;  1FGR A;  3FG3 A;  1GY5 A;  2ZA4 A;  4R9K A;  1BRN L;  5AYS C;  1FW7 A;  1YI2 3;  1BUQ A;  4BL2 A;  1LNH A;  1W4N A;  1OHO A;  3LML A;  1Q9E A;  1RGL A;  1I2G A;  3NV0 A;  1IV9 A;  3JUQ A;  5KP1 A;  2SAR A;  4XDV A;  1FUT A;  1BRS A;  3AMO A;  2XR8 B;  2CFK A;  1LOW A;  3LT8 A;  4MMZ B;  5D81 A;  3F8X A;  3ZG0 A;  3UB1 A;  1K8A 4;  1RSN A;  1JKG B;  3JUO A;  4FCZ A;  5IG3 A;  1F8N A;  2MF7 A;  3CC2 3;  1W2Z A;  2F86 B;  1D6Z A;  1RCL A;  4R80 A;  1EG9 B;  2GSP A;  2GEY A;  2Z76 A;  4JF8 A;  1N5H A;  3I0Y A;  2QEX 3;  4NHF A;  3KSP A;  3F9S A;  1LQM B;  2F5M A;  3S5C A;  1BNE A;  3IMA B;  1MWU A;  1GOU A;  1TFK A;  4OVM A;  4LZI A;  1X1Y A;  1UGH I;  1Q7Y 4;  1OAC A;  2WOH A;  1L5G B;  1GY6 A;  2RGQ A;  3AGO A;  1D6Y A;  3NM2 A;  1STF I;  3DY5 A;  5IF6 A;  1BRG A;  1JZO A;  1WMP A;  4FMC A;  1BU4 A;  4J5G A;  2CX1 A;  2INX A;  4O02 B;  8CHO A;  1FA3 A;  3FH1 A;  1MGW A;  2XGL A;  1VQK 3;  3NQY A;  3S67 A;  4HM8 B;  1VQQ A;  4N6L A;  1EKM A;  3ALA A;  4N6N B;  5LC6 A;  3X41 A;  1E3V A;  1S72 3;  1FUS A;  2LYX A;  2CHC A;  2L4V A;  1RNB A;  1O7G B;  2OOV C;  3CPW 2;  1VQ7 3;  1TFO A;  5FW5 A;  1HZ1 A;  1QMA A;  3G6E 3;  4JRF A;  1W6G A;  1IYY A;  1W00 A;  1MWS A;  2LQV A;  3L0R A;  1IK3 A;  5IEN A;  1TTO A;  4XBT A;  2D42 A;  3WR2 A;  5CF1 A;  1AV4 A;  1BAN A;  3CCL 3;  1VQ5 3;  4HVN A;  1NJI 4;  3B7C A;  4KZ1 A;  5EEO A;  1EQK A;  2HMO B;  2HMK B;  3N8B A;  3G0K A;  1OGZ A;  2CFD A;  4K61 A;  3KII A;  3DGY A;  1RGC A;  1QAF A;  2WGO A;  1TUH A;  3KKG A;  4FCM A;  1A67 A;  2RNT A;  5EVH A;  1TP6 A;  1YJW 3;  2KRT A;  5D82 A;  2GXF A;  3KN4 A;  1GS3 A;  2BMQ B;  2H0G A;  3AHS A;  1TRQ A;  5LC7 A;  2GEX A;  2Y73 A;  3FGY A;  1KWI A;  4LMI A;  5IG5 A;  2P38 A;  2ZDJ A;  2HMJ B;  1BNS A;  1G02 A;  2I9W A;  1A2P A;  2L1S A;  3EF8 A;  1RJO A;  3LZA A;  4U13 A;  3CC7 3;  2Q07 A;  1G0T A;  2BO9 B;  4IIA A;  4DKI A;  4KFE A;  2YFJ B;  4N6U A;  3G4S 3;  3PS8 A;  1U5O A;  3GWR A;  6GSP A;  4BIR A;  4WYK B;  3D79 A;  4J8T A;  3ZG5 A;  2W56 A;  4HJL B;  1JZD A;  1LVN A;  4O3V A;  3WOF B;  1N9E A;  1RLS A;  1JBR A;  3EB8 A;  1VQM 3;  3CNX A;  1WMO A;  1MNL A;  1YGW A;  3NQZ A;  3F7X A;  3EC9 A;  5ELJ A;  1Q86 4;  1SIH A;  1O7M B;  2W03 A;  4R9L A;  2K54 A;  2K0M A;  4CCV A;  1UI8 A;  1CQS A;  1N8R 4;  2OTL 3;  3TDG A;  3ER7 A;  5JPU A;  2F98 A;  1O7N B;  5AEW B;  1ZX2 A;  3CNM A;  2GU1 A;  5STD A;  1T2I A;  2IMJ A;  4HM4 B;  1NB5 I;  1V74 A;  4L8P A;  3DMC A;  1OHP A;  1UGI A;  4OK0 A;  1SAR A;  2F5W A;  4OUQ A;  4GB5 A;  4EC6 A;  3I56 3;  2KAA A;  1DE3 A;  2MC8 A;  1RGK A;  3D4A A;  1I70 A;  3AGN A;  1E3R A;  3IJE B;  3SOY A;  1QAK A;  3SXX A;  1M9G A;  3MKI A;  2F56 A;  4K90 B;  3CCJ 3;  1NDO B;  4RNY A;  3PYJ A;  3B4O A;  3OWU A;  1FUW A;  1SII A;  3U97 A;  2XFT A;  4EV2 A;  1QVG 2;  3AHW A;  3X3Z A;  2HOH A;  1M90 4;  3HI7 A;  1B2X A;  5AIH A;  1ULI B;  2GBW B;  1C7H A;  1SPU A;  2OQE A;  1W7C A;  9RNT A;  5M1A A;  2F99 A;  2XSO B;  1QJG A;  4CJN A;  3WOE B;  1NNV A;  1UUG B;  3D3L A;  4KT3 B;  4HOH A;  5BIR A;  5G2G A;  1TRP A;  2K3D A;  1N9J A;  2E2U A;  3B4P A;  2CKF B;  2CIU A;  1RTU A;  4HYZ A;  3H3H A;  5IEP A;  1ASK A;  1RMS A;  2RFR A;  3EN1 B;  3MPH A;  1V58 A;  3HZP A;  4N6M A;  2W9Q A;  3FSD A;  1YJ9 3;  3GRD A;  3MG1 A;  1RNT A;  1JB2 A;  3S29 A;  1X1U A;  2CC3 A;  5CLK A;  4GHO A;  1RGA A;  1K41 A;  3FF0 A;  1MWR A;  2KF3 A;  4MJD A;  5RNT A;  1Z1S A;  3OW2 2;  2P0M A;  3OWY A;  1TU5 A;  1JN5 B;  5CK6 A;  2OQE C;  4NRE A;  1LQG C;  4K1V A;  4BTW A;  1CEW I;  3F40 A;  1X1W A;  1MGR A;  4HM1 B;  1Q40 A;  3SOA A;  2UUG C;  5AI1 A;  1IVW A;  1B2S A;  3CU3 A;  4H3U A;  4RZM A;  3EE1 A;  3FLJ A;  1WQL B;  1TJD A;  4N6V 0;  1VQL 3;  1M1X B;  4J5K A;  3WDG B;  2FNQ A;  1BSC A;  2SBL A;  2CG1 A;  1T2H A;  1UI7 A;  1MWT A;  1RN7 A;  1GSP A;  2KF6 A;  3DUK A;  3NM7 A;  3LTD A;  5TGN A;  1GOY A;  2RSX A;  1W5Z A;  3JUM A;  1WNH A;  4R1K A;  2CWT A;  4R4K A;  4ZM8 A;  3DGN A;  4KVH A;  2HML B;  2BMR B;  2QIY A;  2XFS A;  2ZHX B;  1AQZ A;  1RGF A;  1UCK A;  1BVI A;  2V1L A;  4XBX A;  1MOL A;  3NV0 B;  2RCD A;  3F14 A;  1JB4 A;  4WP5 A;  1HU9 A;  2BU4 A;  4LGQ A;  2Y74 A;  1UUV B;  3UL6 A;  5AII A;  1UW1 A;  3NUV A;  4NPB A;  1I2E A;  4FMD A;  4XBY A;  3BND A;  3UNL A;  1BRK A;  4MMY B;  3CXC 2;  1W2B 2;  5IG4 A;  3O8Y A;  1OCV A;  1B2M A;  1AVK A;  4KFF A;  5DRV A;  1UCI A;  3A76 A;  3HOH A;  4HM6 B;  4FMA A;  1BSB A;  1YVS A;  3SVA A;  2BHM A;  3BNE A;  1RRL A;  1OGX A;  1I0X A;  2Z6B A;  4WYK A;  4LEH A;  1IDP A;  1YIT 3;  1BNF A;  1E97 A;  4EYC A;  3K0Z A;  1NB3 I;  2Z77 A;  1IQY A;  1RHL A;  3DGO A;  4MEI A;  4AEQ A;  1UCL A;  2XGN A;  1C54 A;  4CDL A;  1ROV A;  1RGG A;  1T3B A;  7RNT A;  1K73 4;  1ZO2 A;  1PYL A;  4BL3 A;  1WTH A;  1BSE A;  1DYU A;  2IYJ A;  3CCE 3;  3KCH A;  2BIR A;  3U1W A;  1DMN A;  1K28 A;  2CK3 H;  4HAA A;  2CFL A;  5KP3 A;  2A15 A;  4FR9 A;  4K1U A;  3NHX A;  1B3S A;  3EX9 A;  1FYS A;  1GMP A;  4IPB A;  1EUI C;  3F7S A;  5IG0 A;  2B24 B;  3MWZ A;  1IVU A;  1N8Q A;  2GU3 A;  3PCS A;  4GSP A;  4G1M B;  1YNV X;  2KXG A;  4ILF A;  2AAE A;  3JUN A;  2IA7 A;  3SX1 A;  1IT8 A;  1R4Y A;  1I3F A;  1FGO A;  1I8V A;  3CPO A;  3MYT A;  3EBY A;  5AEU B;  7GSP A;  1JB5 A;  1Q42 A;  2YFL B;  3FG4 A;  4LYL B;  4J9A A;  1OH0 A;  5JPP A;  4MMX B;  1AR0 A;  2C10 A;  3K5T A;  5HOH A;  1DVD A;  3CC4 3;  3LYG A;  1VQ6 3;  2JDI H;  4AKY A;  1RGH A;  2BMO B;  2ML5 A;  3DZL A;  3CCM 3;  3IPT A;  2ML6 A;  3T0U A;  3LTB A;  3MSO A;  1RCK A;  3NX0 A;  1GD4 A;  5AYR B;  4HBR A;  3NBR A;  5BU4 A;  3GZR A;  2W0Q A;  4XM4 A;  1BOX A;  3I55 3;  3EBT A;  1STD A;  3LXU X;  3FF2 A;  3KSE D;  1IVX A;  3V92 A;  3PXM A;  3T8N A;  5IW9 A;  1ZGX A;  1Q81 4;  5FGO A;  1W02 A;  5CXO A;  6STD A;  1I2F A;  4WWU C;  1UCJ A;  3RGA A;  2XEP A;  1M1K 4;  1LRA A;  3UJM A;  1CH0 A;  4ORL A;  1VQ4 3;  3H51 A;  1YJN 3;  4CPK A;  1YIJ 3;  1JKG A;  3T8U A;  3GSP A;  2CW9 A;  4XB5 A;  5IER A;  3CCV 3;  4LSO A;  4RNT A;  1VQN 3;  3GZB A;  1JNQ A;  4RBN A;  3J7Y d;  3G71 3;  3CMA 3;  2W04 A;  3K63 A;  4PEJ A;  4X2O A;  1X1X A;  5I97 A;  3G8Z A;  1B2U A;  1A2V A;  3KZT A;  2W2C A;  4HM2 B;  1JJ2 2;  3ECF A;  3BLZ A;  1BIR A;  5ELU A;  3OXA A;  1JN5 A;  2W6J H;  1BSA A;  2P0X A;  4HM7 B;  1BSD A; 
#chains in the Genus database with same CATH homology
 1GMR A;  1GOY A;  2RNT A;  1HYF A;  3AHS A;  1TRQ A;  2KF4 A;  1FZU A;  1BUJ A;  1AQZ A;  1RGF A;  1UCK A;  1BVI A;  2KF5 A;  1BRH A;  1BNS A;  1G02 A;  1A2P A;  3URP A;  3BIR A;  1JBS A;  2BU4 A;  2F4Y A;  1JBT A;  2C4B A;  1B20 A;  1I2E A;  3SYU A;  1BRK A;  1BRJ A;  6GSP A;  4BIR A;  1B2M A;  1RDS A;  1UCI A;  1LOV A;  4BU4 A;  3HOH A;  1RLS A;  1B27 A;  1JBR A;  1BSB A;  1LOY A;  1YVS A;  1BRI A;  1I0X A;  1YGW A;  1BNF A;  1RN1 A;  3DH2 A;  1BNI A;  3RNT A;  6RNT A;  1RHL A;  3A5E A;  3D5G A;  1UCL A;  3D5I A;  1C54 A;  1RGG A;  1BNR A;  3DGY A;  7RNT A;  1BGS A;  1DET A;  1PYL A;  1RGE A;  2ZA4 A;  1BRN L;  1BSE A;  1FW7 A;  3BU4 A;  3KCH A;  1Q9E A;  1RGL A;  1I2G A;  2BIR A;  1T2I A;  1GOV A;  4HAA A;  1I0V A;  2SAR A;  1FUT A;  1BRS A;  2AAD A;  1SAR A;  2F5W A;  1LOW A;  1B3S A;  2RBI A;  1FYS A;  1GMP A;  1BNG A;  2KAA A;  1DE3 A;  1RGK A;  1PY3 A;  3D4A A;  1I70 A;  1RSN A;  3AGN A;  4GSP A;  1YNV X;  2AAE A;  1RCL A;  2F56 A;  2GSP A;  1R4Y A;  2KF6 A;  1I3F A;  1I8V A;  3AHW A;  7GSP A;  2HOH A;  2F5M A;  1BNE A;  1GOU A;  1B2X A;  5HOH A;  1X1Y A;  1GMQ A;  9RNT A;  3AGO A;  1RN4 A;  1RGH A;  1BRG A;  4HOH A;  3Q3F A;  1BU4 A;  4J5G A;  5GSP A;  1TRP A;  5BIR A;  1RCK A;  8RNT A;  1MGW A;  5BU4 A;  1LNI A;  1RTU A;  1I3I A;  1BOX A;  1B21 A;  1RMS A;  1BAO A;  1RNB A;  1FUS A;  1ZGX A;  1BNJ A;  1I2F A;  3WHO A;  1UCJ A;  1HZ1 A;  1RNT A;  1AY7 A;  1LRA A;  1CH0 A;  1X1U A;  1IYY A;  4GHO A;  1RGA A;  2KF3 A;  5RNT A;  1TTO A;  3GSP A;  3WR2 A;  1BAN A;  4RNT A;  1X1W A;  1MGR A;  1B2Z A;  1X1X A;  1B2U A;  1B2S A;  1BIR A;  4J5K A;  1BSA A;  1BSC A;  1RGC A;  1T2H A;  1GSP A;  1BSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...