1RN1A

Three-dimensional structure of gln 25-ribonuclease t1 at 1.84 angstroms resolution: structural variations at the base recognition and catalytic sites
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
103
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title Three-dimensional structure of Gln25-ribonuclease T1 at 1.84-A resolution: structural variations at the base recognition and catalytic sites.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 24
structure length 103
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rn1A00
3WHOA 1UCIA 6GSPA 4HOHA 3BU4A 1B21A 1B2UA 1BUJA 3BIRA 1JBSA 3DGYA 3HOHA 3RNTA 3AHWA 1BANA 3Q3FA 1JBTA 1I2FA 1FYSA 1LOYA 2KAAA 1UCKA 1RCKA 1BSDA 1RLSA 1T2HA 2RNTA 4BIRA 1I2GA 1PYLA 3AGNA 1RDSA 1LRAA 1MGRA 1BRJA 1BNEA 1RGHA 3AHSA 2AADA 1LNIA 1RN1A 1GSPA 1FZUA 2HOHA 3WR2A 1BSBA 1I3IA 2ZA4A 1BAOA 1BNSA 1G02A 1GOVA 3DH2A 6RNTA 2KF6A 1JBRA 1DE3A 1BNIA 1I70A 1RHLA 1FUSA 3URPA 1BNRA 1SARA 3D5GA 1RMSA 1BRSA 1X1YA 1B2XA 1BSCA 1TRQA 1BSAA 1FUTA 1I0XA 1TRPA 3GSPA 1Q9EA 1BU4A 1TTOA 2F56A 1GMQA 4RNTA 1C54A 5HOHA 1BSEA 2KF3A 1BNGA 1RSNA 1GMRA 8RNTA 1B2ZA 1I2EA 1RNTA 2F5WA 4HAAA 1I3FA 1YGWA 4GSPA 3SYUA 1RGFA 5BIRA 2GSPA 2BIRA 1UCJA 2KF4A 1AQZA 3AGOA 1RGEA 4J5KA 1HYFA 5BU4A 2C4BA 1R4YA 2KF5A 7GSPA 7RNTA 5RNTA 5GSPA 1LOVA 1BGSA 4GHOA 2BU4A 1T2IA 2F5MA 1BNJA 1UCLA 1MGWA 1A2PA 1I8VA 1RTUA 4J5GA 1GMPA 3D5IA 1RN4A 1BIRA 1BRIA 1RCLA 4BU4A 1PY3A 1BRHA 1BVIA 1B2MA 1BNFA 1X1XA 3D4AA 1RGCA 1DETA 1GOYA 3KCHA 2SARA 1YVSA 1CH0A 1ZGXA 1B2SA 1RGGA 1B20A 1B3SA 1RGAA 1BRKA 3A5EA 9RNTA 1BOXA 1RNBA 1X1WA 1GOUA 1LOWA 1BRNL 1HZ1A 1BRGA 2RBIA 1X1UA 1RGKA 2AAEA 1FW7A 1AY7A 1B27A 1RGLA 1IYYA 1I0VA 2F4YA 1YNVX
chains in the Genus database with same CATH superfamily
3WHOA 3CCM3 3X40A 1F8NA 2P05A 4HOHA 3BU4A 1OUNA 2XGLA 1B2UA 4IIAA 3EE1A 4FCJA 3I553 1A90A 3X42A 5CLKA 1VQ43 1NNVA 5HGRA 1BANA 2YFIB 3Q3FA 3FGYA 4QWTA 3BNBA 3OXAA 1LOYA 3MYTA 1WMNA 2XFSA 4JRFA 1T2HA 2W9QA 4BIRA 3A76A 1PYLA 1MGRA 1Y4KA 3G8ZA 1KQS2 1MWUA 1OHSA 1IK3A 2CFLA 3LMLA 3OV4A 1R4CA 1S723 2ZHXB 1CYUA 1LNIA 1JKGA 2HOHA 4HKVB 1IV9A 3F40A 1FGTA 3WR2A 2B24B 5KP3A 2GBXB 4ZM8A 3CD63 1BAOA 3X41A 1KC84 1O7GB 2IYJA 1ZO2A 2W2CA 5TGNA 3S5CA 1GY6A 3S27A 1SARA 3N54B 4HM0B 4HM7B 1SPUA 2UGIA 2F98A 3LT9A 1CYVA 5EQLA 1BSCA 2A15A 1BSAA 1VQN3 3CNMA 4LZIA 1DYUA 2RCDA 1N8QA 2WOHA 3GSPA 1Q9EA 2CG1A 1ULIB 1BU4A 8CHOA 5JPPA 3V92A 1GMQA 4RNTA 1BSEA 4N6MA 1BNGA 5D82A 1Q40A 3CC43 3FZWA 1N9JA 5IW9A 3K0ZA 5LC7A 1YGWA 5BIRA 1GD4A 1VQP3 2GSPA 1TU5A 3DGLA 1K9M4 1IT7A 3CU3A 3J7Yd 3CCQ3 3H51A 3I0YA 4EBGA 4R1KA 5GSPA 3DMCA 3JUQA 1CEWI 2E2UA 2PZVA 3IMAB 1VQQA 2C10A 3MHEA 3FKAA 3UB1A 5IENA 1D6UA 4FR9A 4R80A 1ROAA 1NU3A 1UGHI 4MEIA 3VSYA 3D5IA 1QAFA 4AKYA 1RN4A 1Q40B 4N6LA 2F99A 2IY2A 4BU4A 4H61A 3EHCA 3NX0A 4WP5A 1IT8A 1B2MA 3LTBA 2MF7A 2P0XA 5I97A 3F14A 3CC23 1OF5B 4AKZA 1IQXA 4GB5A 5BXQA 1C7HA 3VGNA 2CK3H 2CFGA 1YHQ3 1DETA 1FGRA 1YGEA 3KFQC 4HYZA 5IG0A 2O3OA 3UJMA 1BRKA 5JPUA 1LOXA 2E2TA 3FF2A 1TFOA 1US1A 1X1WA 3E99A 4R9KA 1ZX2A 3F8XA 3GZBA 2Z7AA 1JN5A 1GOUA 1GYBA 3BNEA 4HM2B 3K7CA 3MG2A 1WMOA 2H0IA 2BHMA 2ZL8A 2Q07A 2RSXA 3DY5A 1E3RA 1B27A 4MMZB 1IYYA 1YVBI 1BUQA 3FG1A 2GEYA 1Q7Y4 3N9HA 4L7KA 4BTYA 4KFDA 3NXJA 3F8HA 1MOLA 4GL6A 5D81A 3CNXA 1B21A 2OTL3 5JBSA 3BIRA 1O7PB 3DGYA 3UNLA 3DZLA 3V99A 2GBWB 5AYSC 1MWSA 2QGUA 3DUKA 1DMQA 4U13A 5AYRB 1JN5B 4L8OA 1Q7HA 1RCKA 1RLSA 4NHFA 1PU4A 2RNTA 3STDA 3CMA3 4XDVA 3AGNA 3SLUA 2KXGA 1LRAA 1LVNA 1VZZA 3JUNA 2STDA 2LYXA 3AHSA 3S67A 4N6NB 3X3ZA 3TDGA 2IA7A 4K1UA 1YIJ3 3CCL3 2L4VA 2AADA 3OWYA 3FSDA 4IT7A 3U1WA 1KSIA 2FNQA 2Z77A 4XB5A 1QVG2 1IVXA 3DGMA 3WMDA 5D83A 3G16A 4LYLB 1G02A 1GOVA 1EUIC 3EB8A 2J8XB 2D1WA 1UUGB 2KF6A 2UX0A 2O9UX 1DE3A 3MWZA 5CF2A 3WOEB 2R4IA 2K54A 2F86B 4HZ9B 4OK0A 3T0UA 2CHCA 3CCU3 4N6UA 3D5GA 5IEOA 3O8YA 1RMSA 2C11A 4O02B 1X1YA 3LXUX 4IPBA 1JB2A 4N3VA 4NPBA 1T3BA 4WYKB 4ORLA 4CPKA 5AEUB 2CWTA 2F56A 4X2OA 5BVBA 5KP4A 2GU1A 3DGOA 2WGOA 4G1MB 5HOHA 1PFPA 2ML6A 2CH9A 2B1XB 2K3DA 3NQZA 1GMRA 3NV0A 8RNTA 4KFEA 3CCR3 4HAAA 3LTDA 1I3FA 3X3YA 3HK4A 1JNQA 1OGZA 3H3HA 1AQZA 1QAKA 2BT3A 3ALAA 5FW5A 4J5KA 5BU4A 3HZPA 3AMOA 1A2KA 3NHXA 3ZFZA 3CME3 1STFI 3DXOA 3CPW2 3SVAA 1NJI4 4BL2A 1RRLA 1WTHA 3GAXA 3PCRA 1T2IA 2P0MA 1BNJA 4BL3A 2OCTA 1TFKA 3QRDA 4HM4B 1A2PA 2CIUA 1K8A4 3CCJ3 1W7CA 1N8R4 3ZG5A 3NV0B 1J2BA 1JKGB 1BIRA 2XRXB 3PYJA 3WODG 5M18A 4OUQA 1BVIA 3MSOA 3OWUA 1QALA 3K63A 1VQM3 3EJVA 1FUWA 1ZS7A 1BNFA 5CXOA 1K734 1LQGC 1W02A 3AMOB 1O7NB 4O8SA 4HM8B 2Z76A 1RGCA 3S29A 1KWIA 2FXTA 1GOYA 1AV4A 1UDII 4XDWA 2SARA 1YVSA 3F9SA 1ZGXA 1RJOA 3PS8A 1RGGA 4FMDA 1GS3A 1VQ93 5A0OB 5IERA 4EV2A 3CC73 3DM8A 2HMLB 1VQO3 4R9LA 3JUOA 4O2HA 5AIFA 2H0HA 2M7OA 2OWPA 1YJW3 3EN1B 4K1VA 5IG3A 1LXEA 1N5HA 3RGRA 1X1UA 4PEJA 4KT3B 1AVKA 1RGKA 2AAEA 2L1SA 2QIYA 3EBTA 2K0MA 4EW5A 1YJN3 1SJWA 3VF1A 5EEOA 1MWRA 5DRVA 2YFLB 1VQ63 1A2VA 1SIHA 3I563 6GSPA 1OPYA 1STDA 3V98A 3G0KA 3B4OA 4DKIA 1IVWA 3WDGB 1W01A 4RNYA 1JBSA 3HOHA 2CC3A 1G0TA 3AHWA 4RNZA 5ELJA 3L0RA 3SOYA 1RKYA 1KD14 1NB3I 1AR0A 3NBRA 1FYSA 3WA3A 2XFTA 1VQ53 2KAAA 2OOVA 1SIIA 1BSDA 3HIGA 1I2GA 4CCVA 2OQEA 2W9PA 1RDSA 1JJ22 4RZMA 2WO0A 2W0QA 1HKXA 2XSHB 3X3XA 3GZXB 4HM3B 5G1LA 4N6TA 4LEHA 2HMOB 3FG4A 3NUVA 3RGAA 5AEWB 1BSBA 1GD3A 3EBYA 2OTJ3 1I3IA 4WWUC 4FCMA 4XBTA 1BNSA 6RNTA 4XM4A 1AVLA 5G2GA 3RDEA 3SEDA 1I70A 1FGOA 3IPTA 2SBLA 2CX1A 3NQYA 3UL6A 1Q824 3URPA 1BNRA 1BRSA 4HM6B 5ELUA 3U97A 1YJ93 1HU9A 1O7MB 1MWTA 1W6GA 2CG0A 3FG3A 1FUTA 1OH0A 4K61A 3SX1A 3NM7A 1IDPA 1EKMA 1TRPA 1JZOA 3HI7A 2XSOB 1FGMA 1LNHA 3MG1A 1O7HB 1TTOA 2P38A 2OOVC 3SOAA 1QMAA 1Q814 3BNCA 1NWWA 3MG3A 3MKIA 4J9AA 1W6YA 2CFKA 2OQEC 2FGTA 3GRDA 3B8LA 3JUMA 3GZRA 3NBBA 1B2ZA 1I2EA 1RNTA 2W03A 5M19A 5EVHA 3G4S3 2RGQA 2IUKA 1RGFA 2GXFA 2W56A 2IUJA 1QVF2 1T5YA 1UCJA 2KF4A 4WFOA 2Z6BA 2W04A 3AGOA 3SXXA 3CCV3 1VQ83 3FCSB 5STDA 5M1AA 2KF5A 4XBYA 7GSPA 7RNTA 5RNTA 3FH1A 1N5PA 1BGSA 2BU4A 1V57A 4LSOA 2CFDA 2H0GA 3CCE3 2LQVA 1UCLA 4JF8A 4HVNA 2Y74A 1I8VA 3D79A 1FGQA 3CPOA 1S5AA 1DVDA 1W6CA 1MNLA 1GMPA 4J8TA 4CDLA 2WOFA 1SQWA 2BMQB 3KIIA 3PGBA 3KN4A 3BLZA 1BRIA 3GZYB 4EC6A 3PCSA 5IEPA 1G96A 1PY3A 2W56B 1BRHA 2MC8A 4OVMA 2YFJB 2BNGA 3LOYA 3ROBA 1ISKA 4RBNA 1K41A 3D4AA 2ML5A 4FMAA 3LYGA 3F7XA 3KCHA 5AIIA 1CH0A 2CWVA 1JZDA 2E2VA 1B2SA 1EA2A 1B20A 2CW9A 1RGAA 3HIIA 4FCZA 1OHPA 1EG9B 1NDOB 3A5EA 3ER7A 4Q53A 4WHAA 3WOFB 1BOXA 2HMMB 2JQ5A 3CCS3 2CX0A 3LTCA 1BRGA 3EX9A 5IG4A 1YI23 1Q42A 3G713 3B7CA 1K28A 4N6V0 1O7WB 4FMBA 4K90B 1AY7A 2YX9A 1FW7A 2QA43 1D6ZA 1I0VA 1M9GA 1TP6A 2CWUA 2F4YA 3WA2X 1JB5A 2XEPA 2XF3A 3ZG0A 1LQMB 1UCIA 1YIT3 1IQ8A 1IVVA 1W2ZA 1QJGA 1UUVB 2KRTA 1BUJA 3HX8A 3RNTA 2D42A 4L8PA 2GU3A 2CKFB 2CFWA 5AI1A 4HM5B 1JBTA 1M904 1NB5I 1I2FA 1V74A 1ULJB 4I4KA 5DREA 3OW22 1UI8A 5FGOA 5G1KA 3UL5A 2HMJB 1UCKA 1TIJA 1NO3A 3G6E3 1UI7A 1UUWB 1U8CB 3CXC2 1BRJA 1BNEA 1RGHA 1V58A 4EXRA 2IMJA 2I9WA 1CQSA 1OGXA 4HJLB 2JDIH 4CJNA 6STDA 1TJDA 1FA3A 2XR8B 5LC6A 4LMIA 3LTAA 1W00A 1WNHA 4X2HA 1RN1A 1GSPA 1FZUA 4N6OB 2XH9A 4EV5A 1UGIA 3FLJA 4MJDA 2ZA4A 5AIHA 3S28A 3DH2A 3LH4A 3N8BA 1U5OA 1VQL3 1OF5A 1JBRA 3FF0A 1IVUA 3T8UA 1BNIA 1RHLA 2RFRA 1FUSA 1N9EA 3D3LA 1L5GB 2UUGC 3JUPA 1W5ZA 3M8CA 3MPHA 3PZWA 5CK6A 3T8NA 3ECFA 3JVCA 1A67A 3NBJA 1VQ73 3Q1CA 1EEJA 1B2XA 2GEXA 1TRQA 1GY7A 1I0XA 3LZAA 2PNCA 1JB4A 3B4PA 2KCDA 3KSED 1RN7A 1C54A 2V1LA 1DMMA 4MMYB 2KF3A 1RSNA 3DGNA 1M1XB 3GWRA 4KZ1A 2F5WA 5IG5A 1DMNA 1WQLB 4HM1B 2P09A 1D6YA 4GSPA 4KVHA 3SYUA 5KP1A 2BIRA 3K9MC 4HZBB 4BTXA 1ROVA 5IF6A 1RRHA 1RGEA 1HYFA 1UW1A 2W6JH 2C4BA 3F7SA 1R4YA 3IJEB 3KSPA 3KZTA 2WGQA 3PXMA 4I5QA 1OCVA 1ASKA 1LOVA 1WMPA 5AIGA 4GHOA 7STDA 2HMKB 1E97A 1DVCA 2QEX3 4FMCA 3OX9A 3Q2PA 1M1K4 2F5MA 4STDA 1MGWA 4H3UA 3BNDA 2BMOB 4ILFA 4O3VA 1RTUA 3KKGA 2XGNA 1IQYA 4J5GA 1W2B2 1IU7A 4EYCA 2BO9B 4HBRA 1VQK3 1TUHA 2R41A 1RCLA 2Y73A 4AEQA 3OWSA 4XBXA 1OHOA 3EN8A 2ZDJA 4R4KA 5CF1A 3K5TA 1Q864 4LGQA 1X1XA 3QK9A 3D9RA 1E3VA 1OACA 3EC9A 4MMXB 1B3SA 1W4NA 9RNTA 1RNBA 1EQKA 2BMRB 1LOWA 1JRQA 1BRNL 1HZ1A 2HMNB 2RBIA 2INXA 3EQQB 1IV7A 3Q90A 4NREA 4TX4A 3EF8A 1JV2B 3NM2A 4WYKA 3LT8A 4KFFA 1GY5A 4BTWA 3BB9A 1RGLA 1Z1SA 3KE7A 1YNVX
chains in the Genus database with same CATH topology
3WHOA 1UCIA 6GSPA 4HOHA 3BU4A 1B21A 1B2UA 1BUJA 3BIRA 1JBSA 3DGYA 3HOHA 3RNTA 3AHWA 1BANA 3Q3FA 1JBTA 1I2FA 1FYSA 1LOYA 2KAAA 1UCKA 1RCKA 1BSDA 1RLSA 1T2HA 2RNTA 4BIRA 1I2GA 1PYLA 3AGNA 1RDSA 1LRAA 1MGRA 1BRJA 1BNEA 1RGHA 3AHSA 2AADA 1LNIA 1RN1A 1GSPA 1FZUA 2HOHA 3WR2A 1BSBA 1I3IA 2ZA4A 1BAOA 1BNSA 1G02A 1GOVA 3DH2A 6RNTA 2KF6A 1JBRA 1DE3A 1BNIA 1I70A 1RHLA 1FUSA 3URPA 1BNRA 1SARA 3D5GA 1RMSA 1BRSA 1X1YA 1B2XA 1BSCA 1TRQA 1BSAA 1FUTA 1I0XA 1TRPA 3GSPA 1Q9EA 1BU4A 1TTOA 2F56A 1GMQA 4RNTA 1C54A 5HOHA 1BSEA 2KF3A 1BNGA 1RSNA 1GMRA 8RNTA 1B2ZA 1I2EA 1RNTA 2F5WA 4HAAA 1I3FA 1YGWA 4GSPA 3SYUA 1RGFA 5BIRA 2GSPA 2BIRA 1UCJA 2KF4A 1AQZA 3AGOA 1RGEA 4J5KA 1HYFA 5BU4A 2C4BA 1R4YA 2KF5A 7GSPA 7RNTA 5RNTA 5GSPA 1LOVA 1BGSA 4GHOA 2BU4A 1T2IA 2F5MA 1BNJA 1UCLA 1MGWA 1A2PA 1I8VA 1RTUA 4J5GA 1GMPA 3D5IA 1RN4A 1BIRA 1BRIA 1RCLA 4BU4A 1PY3A 1BRHA 1BVIA 1B2MA 1BNFA 1X1XA 3D4AA 1RGCA 1DETA 1GOYA 3KCHA 2SARA 1YVSA 1CH0A 1ZGXA 1B2SA 1RGGA 1B20A 1B3SA 1RGAA 1BRKA 3A5EA 9RNTA 1BOXA 1RNBA 1X1WA 1GOUA 1LOWA 1BRNL 1HZ1A 1BRGA 2RBIA 1X1UA 1RGKA 2AAEA 1FW7A 1AY7A 1B27A 1RGLA 1IYYA 1I0VA 2F4YA 1YNVX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHO A;  1UCI A;  6GSP A;  4HOH A;  3BU4 A;  1B21 A;  1B2U A;  1BUJ A;  3BIR A;  1JBS A;  3DGY A;  3HOH A;  3RNT A;  3AHW A;  1BAN A;  3Q3F A;  1JBT A;  1I2F A;  1FYS A;  1LOY A;  2KAA A;  1UCK A;  1RCK A;  1BSD A;  1RLS A;  1T2H A;  2RNT A;  4BIR A;  1I2G A;  1PYL A;  3AGN A;  1RDS A;  1LRA A;  1MGR A;  1BRJ A;  1BNE A;  1RGH A;  3AHS A;  2AAD A;  1LNI A;  1RN1 A;  1GSP A;  1FZU A;  2HOH A;  3WR2 A;  1BSB A;  1I3I A;  2ZA4 A;  1BAO A;  1BNS A;  1G02 A;  1GOV A;  3DH2 A;  6RNT A;  2KF6 A;  1JBR A;  1DE3 A;  1BNI A;  1I70 A;  1RHL A;  1FUS A;  3URP A;  1BNR A;  1SAR A;  3D5G A;  1RMS A;  1BRS A;  1X1Y A;  1B2X A;  1BSC A;  1TRQ A;  1BSA A;  1FUT A;  1I0X A;  1TRP A;  3GSP A;  1Q9E A;  1BU4 A;  1TTO A;  2F56 A;  1GMQ A;  4RNT A;  1C54 A;  5HOH A;  1BSE A;  2KF3 A;  1BNG A;  1RSN A;  1GMR A;  8RNT A;  1B2Z A;  1I2E A;  1RNT A;  2F5W A;  4HAA A;  1I3F A;  1YGW A;  4GSP A;  3SYU A;  1RGF A;  5BIR A;  2GSP A;  2BIR A;  1UCJ A;  2KF4 A;  1AQZ A;  3AGO A;  1RGE A;  4J5K A;  1HYF A;  5BU4 A;  2C4B A;  1R4Y A;  2KF5 A;  7GSP A;  7RNT A;  5RNT A;  5GSP A;  1LOV A;  1BGS A;  4GHO A;  2BU4 A;  1T2I A;  2F5M A;  1BNJ A;  1UCL A;  1MGW A;  1A2P A;  1I8V A;  1RTU A;  4J5G A;  1GMP A;  3D5I A;  1RN4 A;  1BIR A;  1BRI A;  1RCL A;  4BU4 A;  1PY3 A;  1BRH A;  1BVI A;  1B2M A;  1BNF A;  1X1X A;  3D4A A;  1RGC A;  1DET A;  1GOY A;  3KCH A;  2SAR A;  1YVS A;  1CH0 A;  1ZGX A;  1B2S A;  1RGG A;  1B20 A;  1B3S A;  1RGA A;  1BRK A;  3A5E A;  9RNT A;  1BOX A;  1RNB A;  1X1W A;  1GOU A;  1LOW A;  1BRN L;  1HZ1 A;  1BRG A;  2RBI A;  1X1U A;  1RGK A;  2AAE A;  1FW7 A;  1AY7 A;  1B27 A;  1RGL A;  1IYY A;  1I0V A;  2F4Y A;  1YNV X; 
#chains in the Genus database with same CATH topology
 3WHO A;  3CCM 3;  3X40 A;  1F8N A;  2P05 A;  4HOH A;  3BU4 A;  1OUN A;  2XGL A;  1B2U A;  4IIA A;  3EE1 A;  4FCJ A;  3I55 3;  1A90 A;  3X42 A;  5CLK A;  1VQ4 3;  1NNV A;  5HGR A;  1BAN A;  2YFI B;  3Q3F A;  3FGY A;  4QWT A;  3BNB A;  3OXA A;  1LOY A;  3MYT A;  1WMN A;  2XFS A;  4JRF A;  1T2H A;  2W9Q A;  4BIR A;  3A76 A;  1PYL A;  1MGR A;  1Y4K A;  3G8Z A;  1KQS 2;  1MWU A;  1OHS A;  1IK3 A;  2CFL A;  3LML A;  3OV4 A;  1R4C A;  1S72 3;  2ZHX B;  1CYU A;  1LNI A;  1JKG A;  2HOH A;  4HKV B;  1IV9 A;  3F40 A;  1FGT A;  3WR2 A;  2B24 B;  5KP3 A;  2GBX B;  4ZM8 A;  3CD6 3;  1BAO A;  3X41 A;  1KC8 4;  1O7G B;  2IYJ A;  1ZO2 A;  2W2C A;  5TGN A;  3S5C A;  1GY6 A;  3S27 A;  1SAR A;  3N54 B;  4HM0 B;  4HM7 B;  1SPU A;  2UGI A;  2F98 A;  3LT9 A;  1CYV A;  5EQL A;  1BSC A;  2A15 A;  1BSA A;  1VQN 3;  3CNM A;  4LZI A;  1DYU A;  2RCD A;  1N8Q A;  2WOH A;  3GSP A;  1Q9E A;  2CG1 A;  1ULI B;  1BU4 A;  8CHO A;  5JPP A;  3V92 A;  1GMQ A;  4RNT A;  1BSE A;  4N6M A;  1BNG A;  5D82 A;  1Q40 A;  3CC4 3;  3FZW A;  1N9J A;  5IW9 A;  3K0Z A;  5LC7 A;  1YGW A;  5BIR A;  1GD4 A;  1VQP 3;  2GSP A;  1TU5 A;  3DGL A;  1K9M 4;  1IT7 A;  3CU3 A;  3J7Y d;  3CCQ 3;  3H51 A;  3I0Y A;  4EBG A;  4R1K A;  5GSP A;  3DMC A;  3JUQ A;  1CEW I;  2E2U A;  2PZV A;  3IMA B;  1VQQ A;  2C10 A;  3MHE A;  3FKA A;  3UB1 A;  5IEN A;  1D6U A;  4FR9 A;  4R80 A;  1ROA A;  1NU3 A;  1UGH I;  4MEI A;  3VSY A;  3D5I A;  1QAF A;  4AKY A;  1RN4 A;  1Q40 B;  4N6L A;  2F99 A;  2IY2 A;  4BU4 A;  4H61 A;  3EHC A;  3NX0 A;  4WP5 A;  1IT8 A;  1B2M A;  3LTB A;  2MF7 A;  2P0X A;  5I97 A;  3F14 A;  3CC2 3;  1OF5 B;  4AKZ A;  1IQX A;  4GB5 A;  5BXQ A;  1C7H A;  3VGN A;  2CK3 H;  2CFG A;  1YHQ 3;  1DET A;  1FGR A;  1YGE A;  3KFQ C;  4HYZ A;  5IG0 A;  2O3O A;  3UJM A;  1BRK A;  5JPU A;  1LOX A;  2E2T A;  3FF2 A;  1TFO A;  1US1 A;  1X1W A;  3E99 A;  4R9K A;  1ZX2 A;  3F8X A;  3GZB A;  2Z7A A;  1JN5 A;  1GOU A;  1GYB A;  3BNE A;  4HM2 B;  3K7C A;  3MG2 A;  1WMO A;  2H0I A;  2BHM A;  2ZL8 A;  2Q07 A;  2RSX A;  3DY5 A;  1E3R A;  1B27 A;  4MMZ B;  1IYY A;  1YVB I;  1BUQ A;  3FG1 A;  2GEY A;  1Q7Y 4;  3N9H A;  4L7K A;  4BTY A;  4KFD A;  3NXJ A;  3F8H A;  1MOL A;  4GL6 A;  5D81 A;  3CNX A;  1B21 A;  2OTL 3;  5JBS A;  3BIR A;  1O7P B;  3DGY A;  3UNL A;  3DZL A;  3V99 A;  2GBW B;  5AYS C;  1MWS A;  2QGU A;  3DUK A;  1DMQ A;  4U13 A;  5AYR B;  1JN5 B;  4L8O A;  1Q7H A;  1RCK A;  1RLS A;  4NHF A;  1PU4 A;  2RNT A;  3STD A;  3CMA 3;  4XDV A;  3AGN A;  3SLU A;  2KXG A;  1LRA A;  1LVN A;  1VZZ A;  3JUN A;  2STD A;  2LYX A;  3AHS A;  3S67 A;  4N6N B;  3X3Z A;  3TDG A;  2IA7 A;  4K1U A;  1YIJ 3;  3CCL 3;  2L4V A;  2AAD A;  3OWY A;  3FSD A;  4IT7 A;  3U1W A;  1KSI A;  2FNQ A;  2Z77 A;  4XB5 A;  1QVG 2;  1IVX A;  3DGM A;  3WMD A;  5D83 A;  3G16 A;  4LYL B;  1G02 A;  1GOV A;  1EUI C;  3EB8 A;  2J8X B;  2D1W A;  1UUG B;  2KF6 A;  2UX0 A;  2O9U X;  1DE3 A;  3MWZ A;  5CF2 A;  3WOE B;  2R4I A;  2K54 A;  2F86 B;  4HZ9 B;  4OK0 A;  3T0U A;  2CHC A;  3CCU 3;  4N6U A;  3D5G A;  5IEO A;  3O8Y A;  1RMS A;  2C11 A;  4O02 B;  1X1Y A;  3LXU X;  4IPB A;  1JB2 A;  4N3V A;  4NPB A;  1T3B A;  4WYK B;  4ORL A;  4CPK A;  5AEU B;  2CWT A;  2F56 A;  4X2O A;  5BVB A;  5KP4 A;  2GU1 A;  3DGO A;  2WGO A;  4G1M B;  5HOH A;  1PFP A;  2ML6 A;  2CH9 A;  2B1X B;  2K3D A;  3NQZ A;  1GMR A;  3NV0 A;  8RNT A;  4KFE A;  3CCR 3;  4HAA A;  3LTD A;  1I3F A;  3X3Y A;  3HK4 A;  1JNQ A;  1OGZ A;  3H3H A;  1AQZ A;  1QAK A;  2BT3 A;  3ALA A;  5FW5 A;  4J5K A;  5BU4 A;  3HZP A;  3AMO A;  1A2K A;  3NHX A;  3ZFZ A;  3CME 3;  1STF I;  3DXO A;  3CPW 2;  3SVA A;  1NJI 4;  4BL2 A;  1RRL A;  1WTH A;  3GAX A;  3PCR A;  1T2I A;  2P0M A;  1BNJ A;  4BL3 A;  2OCT A;  1TFK A;  3QRD A;  4HM4 B;  1A2P A;  2CIU A;  1K8A 4;  3CCJ 3;  1W7C A;  1N8R 4;  3ZG5 A;  3NV0 B;  1J2B A;  1JKG B;  1BIR A;  2XRX B;  3PYJ A;  3WOD G;  5M18 A;  4OUQ A;  1BVI A;  3MSO A;  3OWU A;  1QAL A;  3K63 A;  1VQM 3;  3EJV A;  1FUW A;  1ZS7 A;  1BNF A;  5CXO A;  1K73 4;  1LQG C;  1W02 A;  3AMO B;  1O7N B;  4O8S A;  4HM8 B;  2Z76 A;  1RGC A;  3S29 A;  1KWI A;  2FXT A;  1GOY A;  1AV4 A;  1UDI I;  4XDW A;  2SAR A;  1YVS A;  3F9S A;  1ZGX A;  1RJO A;  3PS8 A;  1RGG A;  4FMD A;  1GS3 A;  1VQ9 3;  5A0O B;  5IER A;  4EV2 A;  3CC7 3;  3DM8 A;  2HML B;  1VQO 3;  4R9L A;  3JUO A;  4O2H A;  5AIF A;  2H0H A;  2M7O A;  2OWP A;  1YJW 3;  3EN1 B;  4K1V A;  5IG3 A;  1LXE A;  1N5H A;  3RGR A;  1X1U A;  4PEJ A;  4KT3 B;  1AVK A;  1RGK A;  2AAE A;  2L1S A;  2QIY A;  3EBT A;  2K0M A;  4EW5 A;  1YJN 3;  1SJW A;  3VF1 A;  5EEO A;  1MWR A;  5DRV A;  2YFL B;  1VQ6 3;  1A2V A;  1SIH A;  3I56 3;  6GSP A;  1OPY A;  1STD A;  3V98 A;  3G0K A;  3B4O A;  4DKI A;  1IVW A;  3WDG B;  1W01 A;  4RNY A;  1JBS A;  3HOH A;  2CC3 A;  1G0T A;  3AHW A;  4RNZ A;  5ELJ A;  3L0R A;  3SOY A;  1RKY A;  1KD1 4;  1NB3 I;  1AR0 A;  3NBR A;  1FYS A;  3WA3 A;  2XFT A;  1VQ5 3;  2KAA A;  2OOV A;  1SII A;  1BSD A;  3HIG A;  1I2G A;  4CCV A;  2OQE A;  2W9P A;  1RDS A;  1JJ2 2;  4RZM A;  2WO0 A;  2W0Q A;  1HKX A;  2XSH B;  3X3X A;  3GZX B;  4HM3 B;  5G1L A;  4N6T A;  4LEH A;  2HMO B;  3FG4 A;  3NUV A;  3RGA A;  5AEW B;  1BSB A;  1GD3 A;  3EBY A;  2OTJ 3;  1I3I A;  4WWU C;  4FCM A;  4XBT A;  1BNS A;  6RNT A;  4XM4 A;  1AVL A;  5G2G A;  3RDE A;  3SED A;  1I70 A;  1FGO A;  3IPT A;  2SBL A;  2CX1 A;  3NQY A;  3UL6 A;  1Q82 4;  3URP A;  1BNR A;  1BRS A;  4HM6 B;  5ELU A;  3U97 A;  1YJ9 3;  1HU9 A;  1O7M B;  1MWT A;  1W6G A;  2CG0 A;  3FG3 A;  1FUT A;  1OH0 A;  4K61 A;  3SX1 A;  3NM7 A;  1IDP A;  1EKM A;  1TRP A;  1JZO A;  3HI7 A;  2XSO B;  1FGM A;  1LNH A;  3MG1 A;  1O7H B;  1TTO A;  2P38 A;  2OOV C;  3SOA A;  1QMA A;  1Q81 4;  3BNC A;  1NWW A;  3MG3 A;  3MKI A;  4J9A A;  1W6Y A;  2CFK A;  2OQE C;  2FGT A;  3GRD A;  3B8L A;  3JUM A;  3GZR A;  3NBB A;  1B2Z A;  1I2E A;  1RNT A;  2W03 A;  5M19 A;  5EVH A;  3G4S 3;  2RGQ A;  2IUK A;  1RGF A;  2GXF A;  2W56 A;  2IUJ A;  1QVF 2;  1T5Y A;  1UCJ A;  2KF4 A;  4WFO A;  2Z6B A;  2W04 A;  3AGO A;  3SXX A;  3CCV 3;  1VQ8 3;  3FCS B;  5STD A;  5M1A A;  2KF5 A;  4XBY A;  7GSP A;  7RNT A;  5RNT A;  3FH1 A;  1N5P A;  1BGS A;  2BU4 A;  1V57 A;  4LSO A;  2CFD A;  2H0G A;  3CCE 3;  2LQV A;  1UCL A;  4JF8 A;  4HVN A;  2Y74 A;  1I8V A;  3D79 A;  1FGQ A;  3CPO A;  1S5A A;  1DVD A;  1W6C A;  1MNL A;  1GMP A;  4J8T A;  4CDL A;  2WOF A;  1SQW A;  2BMQ B;  3KII A;  3PGB A;  3KN4 A;  3BLZ A;  1BRI A;  3GZY B;  4EC6 A;  3PCS A;  5IEP A;  1G96 A;  1PY3 A;  2W56 B;  1BRH A;  2MC8 A;  4OVM A;  2YFJ B;  2BNG A;  3LOY A;  3ROB A;  1ISK A;  4RBN A;  1K41 A;  3D4A A;  2ML5 A;  4FMA A;  3LYG A;  3F7X A;  3KCH A;  5AII A;  1CH0 A;  2CWV A;  1JZD A;  2E2V A;  1B2S A;  1EA2 A;  1B20 A;  2CW9 A;  1RGA A;  3HII A;  4FCZ A;  1OHP A;  1EG9 B;  1NDO B;  3A5E A;  3ER7 A;  4Q53 A;  4WHA A;  3WOF B;  1BOX A;  2HMM B;  2JQ5 A;  3CCS 3;  2CX0 A;  3LTC A;  1BRG A;  3EX9 A;  5IG4 A;  1YI2 3;  1Q42 A;  3G71 3;  3B7C A;  1K28 A;  4N6V 0;  1O7W B;  4FMB A;  4K90 B;  1AY7 A;  2YX9 A;  1FW7 A;  2QA4 3;  1D6Z A;  1I0V A;  1M9G A;  1TP6 A;  2CWU A;  2F4Y A;  3WA2 X;  1JB5 A;  2XEP A;  2XF3 A;  3ZG0 A;  1LQM B;  1UCI A;  1YIT 3;  1IQ8 A;  1IVV A;  1W2Z A;  1QJG A;  1UUV B;  2KRT A;  1BUJ A;  3HX8 A;  3RNT A;  2D42 A;  4L8P A;  2GU3 A;  2CKF B;  2CFW A;  5AI1 A;  4HM5 B;  1JBT A;  1M90 4;  1NB5 I;  1I2F A;  1V74 A;  1ULJ B;  4I4K A;  5DRE A;  3OW2 2;  1UI8 A;  5FGO A;  5G1K A;  3UL5 A;  2HMJ B;  1UCK A;  1TIJ A;  1NO3 A;  3G6E 3;  1UI7 A;  1UUW B;  1U8C B;  3CXC 2;  1BRJ A;  1BNE A;  1RGH A;  1V58 A;  4EXR A;  2IMJ A;  2I9W A;  1CQS A;  1OGX A;  4HJL B;  2JDI H;  4CJN A;  6STD A;  1TJD A;  1FA3 A;  2XR8 B;  5LC6 A;  4LMI A;  3LTA A;  1W00 A;  1WNH A;  4X2H A;  1RN1 A;  1GSP A;  1FZU A;  4N6O B;  2XH9 A;  4EV5 A;  1UGI A;  3FLJ A;  4MJD A;  2ZA4 A;  5AIH A;  3S28 A;  3DH2 A;  3LH4 A;  3N8B A;  1U5O A;  1VQL 3;  1OF5 A;  1JBR A;  3FF0 A;  1IVU A;  3T8U A;  1BNI A;  1RHL A;  2RFR A;  1FUS A;  1N9E A;  3D3L A;  1L5G B;  2UUG C;  3JUP A;  1W5Z A;  3M8C A;  3MPH A;  3PZW A;  5CK6 A;  3T8N A;  3ECF A;  3JVC A;  1A67 A;  3NBJ A;  1VQ7 3;  3Q1C A;  1EEJ A;  1B2X A;  2GEX A;  1TRQ A;  1GY7 A;  1I0X A;  3LZA A;  2PNC A;  1JB4 A;  3B4P A;  2KCD A;  3KSE D;  1RN7 A;  1C54 A;  2V1L A;  1DMM A;  4MMY B;  2KF3 A;  1RSN A;  3DGN A;  1M1X B;  3GWR A;  4KZ1 A;  2F5W A;  5IG5 A;  1DMN A;  1WQL B;  4HM1 B;  2P09 A;  1D6Y A;  4GSP A;  4KVH A;  3SYU A;  5KP1 A;  2BIR A;  3K9M C;  4HZB B;  4BTX A;  1ROV A;  5IF6 A;  1RRH A;  1RGE A;  1HYF A;  1UW1 A;  2W6J H;  2C4B A;  3F7S A;  1R4Y A;  3IJE B;  3KSP A;  3KZT A;  2WGQ A;  3PXM A;  4I5Q A;  1OCV A;  1ASK A;  1LOV A;  1WMP A;  5AIG A;  4GHO A;  7STD A;  2HMK B;  1E97 A;  1DVC A;  2QEX 3;  4FMC A;  3OX9 A;  3Q2P A;  1M1K 4;  2F5M A;  4STD A;  1MGW A;  4H3U A;  3BND A;  2BMO B;  4ILF A;  4O3V A;  1RTU A;  3KKG A;  2XGN A;  1IQY A;  4J5G A;  1W2B 2;  1IU7 A;  4EYC A;  2BO9 B;  4HBR A;  1VQK 3;  1TUH A;  2R41 A;  1RCL A;  2Y73 A;  4AEQ A;  3OWS A;  4XBX A;  1OHO A;  3EN8 A;  2ZDJ A;  4R4K A;  5CF1 A;  3K5T A;  1Q86 4;  4LGQ A;  1X1X A;  3QK9 A;  3D9R A;  1E3V A;  1OAC A;  3EC9 A;  4MMX B;  1B3S A;  1W4N A;  9RNT A;  1RNB A;  1EQK A;  2BMR B;  1LOW A;  1JRQ A;  1BRN L;  1HZ1 A;  2HMN B;  2RBI A;  2INX A;  3EQQ B;  1IV7 A;  3Q90 A;  4NRE A;  4TX4 A;  3EF8 A;  1JV2 B;  3NM2 A;  4WYK A;  3LT8 A;  4KFF A;  1GY5 A;  4BTW A;  3BB9 A;  1RGL A;  1Z1S A;  3KE7 A;  1YNV X; 
#chains in the Genus database with same CATH homology
 3WHO A;  1UCI A;  6GSP A;  4HOH A;  3BU4 A;  1B21 A;  1B2U A;  1BUJ A;  3BIR A;  1JBS A;  3DGY A;  3HOH A;  3RNT A;  3AHW A;  1BAN A;  3Q3F A;  1JBT A;  1I2F A;  1FYS A;  1LOY A;  2KAA A;  1UCK A;  1RCK A;  1BSD A;  1RLS A;  1T2H A;  2RNT A;  4BIR A;  1I2G A;  1PYL A;  3AGN A;  1RDS A;  1LRA A;  1MGR A;  1BRJ A;  1BNE A;  1RGH A;  3AHS A;  2AAD A;  1LNI A;  1RN1 A;  1GSP A;  1FZU A;  2HOH A;  3WR2 A;  1BSB A;  1I3I A;  2ZA4 A;  1BAO A;  1BNS A;  1G02 A;  1GOV A;  3DH2 A;  6RNT A;  2KF6 A;  1JBR A;  1DE3 A;  1BNI A;  1I70 A;  1RHL A;  1FUS A;  3URP A;  1BNR A;  1SAR A;  3D5G A;  1RMS A;  1BRS A;  1X1Y A;  1B2X A;  1BSC A;  1TRQ A;  1BSA A;  1FUT A;  1I0X A;  1TRP A;  3GSP A;  1Q9E A;  1BU4 A;  1TTO A;  2F56 A;  1GMQ A;  4RNT A;  1C54 A;  5HOH A;  1BSE A;  2KF3 A;  1BNG A;  1RSN A;  1GMR A;  8RNT A;  1B2Z A;  1I2E A;  1RNT A;  2F5W A;  4HAA A;  1I3F A;  1YGW A;  4GSP A;  3SYU A;  1RGF A;  5BIR A;  2GSP A;  2BIR A;  1UCJ A;  2KF4 A;  1AQZ A;  3AGO A;  1RGE A;  4J5K A;  1HYF A;  5BU4 A;  2C4B A;  1R4Y A;  2KF5 A;  7GSP A;  7RNT A;  5RNT A;  5GSP A;  1LOV A;  1BGS A;  4GHO A;  2BU4 A;  1T2I A;  2F5M A;  1BNJ A;  1UCL A;  1MGW A;  1A2P A;  1I8V A;  1RTU A;  4J5G A;  1GMP A;  3D5I A;  1RN4 A;  1BIR A;  1BRI A;  1RCL A;  4BU4 A;  1PY3 A;  1BRH A;  1BVI A;  1B2M A;  1BNF A;  1X1X A;  3D4A A;  1RGC A;  1DET A;  1GOY A;  3KCH A;  2SAR A;  1YVS A;  1CH0 A;  1ZGX A;  1B2S A;  1RGG A;  1B20 A;  1B3S A;  1RGA A;  1BRK A;  3A5E A;  9RNT A;  1BOX A;  1RNB A;  1X1W A;  1GOU A;  1LOW A;  1BRN L;  1HZ1 A;  1BRG A;  2RBI A;  1X1U A;  1RGK A;  2AAE A;  1FW7 A;  1AY7 A;  1B27 A;  1RGL A;  1IYY A;  1I0V A;  2F4Y A;  1YNV X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...