1RN1A

Three-dimensional structure of gln 25-ribonuclease t1 at 1.84 angstroms resolution: structural variations at the base recognition and catalytic sites
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
103
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of Gln25-ribonuclease T1 at 1.84-A resolution: structural variations at the base recognition and catalytic sites.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1 ISOZYME
total genus 24
structure length 103
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rn1A00
1RHLA 1TRPA 1B2ZA 1Q9EA 1TRQA 1B2UA 9RNTA 2ZA4A 3KCHA 1LOVA 1T2IA 5RNTA 1RGAA 1I3FA 3GSPA 1G02A 1IYYA 2BU4A 3D5GA 3WR2A 7RNTA 3HOHA 1RDSA 1I2GA 4HOHA 1BNFA 1RGFA 5BIRA 1X1YA 1UCJA 1C54A 1GMPA 1FUSA 1ZGXA 5BU4A 3AGOA 1I8VA 1LOWA 2KF4A 1JBSA 2RBIA 3URPA 2SARA 7GSPA 1GOUA 1CH0A 1PYLA 1I2EA 4RNTA 1GMRA 2AAEA 1RNBA 1UCIA 2F5WA 3WHOA 1RCLA 1DE3A 1LOYA 4J5GA 3AGNA 3RNTA 1FW7A 1B3SA 1LRAA 2HOHA 1BRHA 1RLSA 1B20A 1MGWA 1BSAA 5HOHA 2F5MA 2C4BA 6GSPA 1SARA 3A5EA 3D5IA 1RNTA 1I0XA 1HZ1A 3Q3FA 4BIRA 1MGRA 3BU4A 1GSPA 1BIRA 1R4YA 4GHOA 1RGHA 1BGSA 1BAOA 1BNIA 1RMSA 1GOVA 2KF5A 4GSPA 2GSPA 1B27A 4BU4A 1BRNL 1BANA 3AHWA 1PY3A 1FUTA 1UCKA 2BIRA 3DGYA 1RGCA 1X1WA 1A2PA 1BRIA 2KF6A 1GMQA 1DETA 1I3IA 1RN4A 4HAAA 1JBRA 1RTUA 1BNSA 2F56A 2AADA 3BIRA 5GSPA 3D4AA 1BSEA 1RGLA 3DH2A 3AHSA 1I0VA 1I70A 1TTOA 1BSDA 1X1UA 1B2MA 1I2FA 1JBTA 1BRGA 3SYUA 8RNTA 1FZUA 1BVIA 1BNGA 1YVSA 1RSNA 2F4YA 4J5KA 1B2XA 1BUJA 6RNTA 1GOYA 1BRJA 1RGEA 2KF3A 1BRSA 2RNTA 1BOXA 1HYFA 1RGKA 1BSCA 1FYSA 2KAAA 1BNEA 1YGWA 1X1XA 1UCLA 1AY7A 1LNIA 1RGGA 1BU4A 1BNRA 1YNVX 1T2HA 1BSBA 1B2SA 1BNJA 1RN1A 1B21A 1BRKA 1AQZA 1RCKA
chains in the Genus database with same CATH superfamily
2CK3H 2CFWA 2STDA 4N6NB 3LH4A 1Z1SA 1IQ8A 2J8XB 4KFEA 1OCVA 1K8A4 3CU3A 1YJN3 1A2KA 3K63A 1B2UA 3DGOA 1OUNA 3X3XA 1UGHI 1ZO2A 2IY2A 3B4OA 5M19A 3DGMA 2W9PA 1T2IA 5RNTA 4KFDA 5M1AA 2W56B 3FCSB 1JB4A 1UGIA 3LXUX 2R4IA 3M8CA 3HOHA 4HM8B 1RDSA 1I2GA 1Q40A 1GY5A 1SIHA 4IIAA 2H0IA 4HBRA 1OHOA 3B7CA 1IQYA 3OWUA 5CF2A 1C54A 3BNCA 4N3VA 4GL6A 4XM4A 3AGOA 1W6GA 3HIGA 3D79A 2KF4A 5EQLA 1WQLB 1JBSA 1OGXA 1CQSA 2A15A 4FMDA 1LQGC 3F7XA 1M9GA 4LEHA 1CH0A 5BXQA 2LYXA 2ZDJA 3KFQC 4RNTA 1UI8A 4KVHA 3F14A 1WMOA 1T3BA 1IT7A 1DYUA 2INXA 1U5OA 4XB5A 1KC84 3CNXA 5FGOA 1WTHA 1OACA 3X40A 3J7Yd 5EVHA 7STDA 4EBGA 3CMA3 1FGOA 5M18A 1O7WB 1DE3A 3PXMA 3S27A 4O02B 1AV4A 3NXJA 2Z6BA 1E3VA 1EEJA 3BNBA 1PU4A 4HM7B 1B3SA 1G0TA 3FF2A 2CX0A 2HOHA 1MWUA 1JV2B 1B20A 3K9MC 1MGWA 5G1LA 2OQEA 3UL6A 4FMCA 1V58A 2C4BA 5AIHA 3EQQB 3E99A 3F40A 3V99A 2FXTA 2QGUA 3NV0A 1NO3A 1HZ1A 2L4VA 3Q90A 2CX1A 4AKYA 2CH9A 4R4KA 4RNZA 3SLUA 1NU3A 3LMLA 3NV0B 1N8R4 3KZTA 3WOEB 1LVNA 4K1VA 1J2BA 5IW9A 1VQQA 2XGNA 1VZZA 4BL2A 3LT8A 3GZYB 2CHCA 4J9AA 1FUTA 1N9JA 2BIRA 2HMMB 3VF1A 3NBBA 3S29A 1YGEA 3EBYA 3RGAA 2HMJB 4RZMA 1BRIA 3FF0A 1Q7HA 1I3IA 4Q53A 3CC73 5BVBA 3ZFZA 3ROBA 1JBRA 4H3UA 2F56A 3BIRA 1UUVB 2HMLB 5DRVA 3NX0A 3RDEA 2GU1A 3ZG5A 2V1LA 1I0VA 4BL3A 1VQ83 3D9RA 1BSDA 3GZBA 1NB5I 1K734 2ZL8A 3QK9A 5IENA 1BRGA 3SYUA 3DGNA 1JNQA 3MSOA 4RBNA 3CCJ3 1QVF2 1RRHA 3OWYA 3NM7A 4PEJA 3JUNA 3D3LA 4KT3B 1R4CA 4WP5A 1VQ63 1BRJA 4X2OA 4QWTA 1N5PA 2RNTA 1BOXA 4LZIA 3CCL3 1RGKA 3G0KA 1BSCA 2KAAA 4L8OA 2JQ5A 2C10A 3AMOB 1FGMA 3GZRA 1UCLA 1TJDA 5AYRB 1A2VA 1T2HA 1M904 4FMBA 1B2SA 5JPUA 4L8PA 1TUHA 1BRKA 2P0XA 1U8CB 2K0MA 1YIJ3 1OH0A 4H61A 5ELUA 5AYSC 1NDOB 1RHLA 3KSED 1TRPA 3UL5A 1Q814 4EXRA 1Q9EA 9RNTA 3MKIA 1K41A 5G1KA 2B24B 2ZA4A 3FLJA 3H3HA 1DMNA 3NQZA 3UNLA 3I563 1LOXA 3KE7A 1LOVA 3EX9A 3KN4A 2KXGA 3OX9A 1RGAA 4BTXA 1VQP3 1ZX2A 4R9LA 2SBLA 3GSPA 2YFIB 1IV9A 3FG4A 3MHEA 4JRFA 3D5GA 3KIIA 3OXAA 7RNTA 4NREA 4AEQA 1AVKA 1BNFA 1DVCA 1E97A 1TIJA 2M7OA 1IK3A 5EEOA 1STFI 2W2CA 4HM5B 2JDIH 2QA43 3N9HA 1FUSA 1NJI4 2OTL3 1N9EA 1OF5A 1TU5A 4LMIA 2RGQA 1OGZA 2CWVA 4J8TA 3SX1A 3FG1A 3URPA 1IT8A 3LOYA 1KSIA 3BB9A 1I2EA 2IA7A 2AAEA 2KRTA 3OV4A 1K28A 3WMDA 1VQK3 4N6V0 4MJDA 4HZBB 1UCIA 2F5WA 1YHQ3 1RCLA 4KFFA 3I553 1UUGB 1O7PB 1E3RA 1N8QA 5G2GA 2RSXA 1VQ73 1QMAA 1SIIA 2IMJA 2L1SA 3WOFB 1JZDA 1LRAA 2MF7A 2QIYA 4O2HA 1BRHA 3T8UA 1GYBA 5HOHA 3OW22 2Y73A 3A5EA 5A0OB 2BMRB 4AKZA 2GBWB 4CJNA 1GY6A 1I0XA 3ECFA 3Q3FA 4BIRA 2GBXB 2BT3A 5ELJA 5HGRA 1VQ43 3FZWA 3ALAA 1EQKA 1GSPA 1JZOA 1BIRA 1O7GB 4FR9A 1SPUA 5CLKA 4FCJA 1VQN3 4GHOA 1BGSA 3SXXA 5LC6A 2W03A 1BNIA 3JUMA 1GD4A 1OF5B 1MWSA 1GOVA 1YVBI 4K90B 5IF6A 3S67A 1RKYA 1SJWA 1V74A 1B27A 4BU4A 4NHFA 3AHWA 4FCZA 3T0UA 1W01A 1GS3A 1GD3A 1S5AA 3V92A 3BLZA 2Z76A 1X1WA 1UW1A 3HK4A 1RN4A 3PZWA 3DY5A 2XSHB 2F98A 3DZLA 3PYJA 2AADA 4HJLB 2W56A 4XDWA 4EV2A 4U13A 1HU9A 1I70A 3K5TA 1TTOA 1X1UA 1A90A 1AR0A 2P0MA 1B2MA 4EC6A 1ROVA 1BVIA 1BNGA 1T5YA 1RSNA 4J5KA 1UUWB 3DM8A 1Y4KA 3TDGA 1OHPA 4DKIA 1GOYA 5FW5A 3CCV3 3DXOA 1HKXA 1D6YA 1S723 3NBJA 5IG4A 5JPPA 1YIT3 2BMQB 3GZXB 1FYSA 3IPTA 2CKFB 3CCR3 3NBRA 3DUKA 1YJW3 1BNRA 3BNDA 2CFDA 3LTDA 2OOVC 1BNJA 2WOHA 3LYGA 3DGLA 2E2VA 4O3VA 1B2ZA 1VQM3 2CG0A 4KZ1A 4XBXA 1IDPA 1EG9B 4XDVA 1IU7A 4N6UA 4CPKA 5IG5A 3B8LA 3KKGA 3HX8A 3F9SA 3Q2PA 1IYYA 4X2HA 2PNCA 4ZM8A 2XFTA 3GAXA 3G4S3 4HOHA 3EF8A 3ER7A 4IPBA 5BIRA 1BUQA 3G713 1GMPA 2I9WA 3JUPA 1DMMA 1ZGXA 5BU4A 3CPW2 3QRDA 4HVNA 3JUQA 1FGTA 1D6UA 3FH1A 5AEUB 1VQO3 1JRQA 2D1WA 2RBIA 3BNEA 2OCTA 4CDLA 3IMAB 1GOUA 1PYLA 5AIFA 1W00A 1PFPA 2P38A 3Q1CA 2H0GA 4HKVB 4XBYA 1GMRA 1W4NA 2R41A 2B1XB 2Z7AA 3GRDA 1NB3I 1G96A 3H51A 1W02A 5AIGA 4OVMA 4FMAA 3U1WA 1QJGA 4ORLA 2CFKA 4MMYB 1EKMA 1FGQA 2WO0A 3L0RA 4CCVA 1WMNA 1LXEA 2GU3A 2XFSA 2KCDA 2GXFA 1LOYA 3AGNA 2W9QA 1Q7Y4 1QAFA 2K3DA 2XRXB 4OUQA 1VQ93 3F8HA 4XBTA 2BNGA 3U97A 3LTAA 1STDA 1FW7A 1RLSA 1JB5A 2F5MA 2UX0A 4I5QA 5AI1A 3X3YA 1NNVA 3NUVA 2IUJA 1CYUA 3O8YA 4HYZA 1LNHA 1MWRA 3AMOA 3BU4A 3LTBA 1RN7A 2Z77A 1IV7A 2P05A 1UDII 3DMCA 5IEOA 5IG0A 1R4YA 2IYJA 2OQEC 1W5ZA 4N6TA 3CCS3 4WWUC 1C7HA 1O7HB 3CCM3 4HM4B 1BAOA 3X41A 3NQYA 3EN1B 4GSPA 2KF5A 5AEWB 1JJ22 1YI23 3ZG0A 1EA2A 1CYVA 3V98A 1PY3A 5D83A 1UCKA 2CG1A 2OWPA 3FGYA 1A2PA 2KF6A 1D6ZA 4HAAA 4WYKB 3WODG 1RTUA 1BNSA 3PCRA 2Q07A 1RRLA 5GSPA 3D4AA 1BSEA 3EN8A 4BTWA 3KSPA 2UUGC 4WYKA 2ML5A 4HM3B 4G1MB 1QAKA 1I2FA 4I4KA 3EHCA 4ILFA 4K61A 2XR8B 1O7MB 2BMOB 5KP4A 1FZUA 1W2ZA 2F4YA 4HM0B 3FSDA 1B2XA 1OPYA 8CHOA 3K7CA 2CIUA 2XEPA 1IQXA 1GY7A 1RGEA 2D42A 4WFOA 4RNYA 1HYFA 3K0ZA 3MG3A 1BNEA 1YGWA 2H0HA 3S28A 1ASKA 2FNQA 1X1XA 1AY7A 1LNIA 1RGGA 3G8ZA 3LT9A 1YNVX 3F7SA 2WGQA 2XGLA 1L5GB 1TP6A 4EW5A 4OK0A 2CWUA 1IVVA 1B21A 3IJEB 1AQZA 3HZPA 3PGBA 5CF1A 2MC8A 3GWRA 2LQVA 1CEWI 5TGNA 1ZS7A 1SQWA 4FCMA 4GB5A 1KQS2 5KP1A 1ISKA 4LGQA 2F86B 3CC43 2F99A 1US1A 3NHXA 1TRQA 3NM2A 5CK6A 5D81A 4R9KA 3KCHA 3F8XA 2CC3A 2FGTA 1JKGB 2OTJ3 2WGOA 2CFGA 3VSYA 3CXC2 3WA2X 3SOAA 1I3FA 2HMNB 1VQL3 1G02A 1WNHA 2BU4A 3WR2A 1TFOA 2CWTA 3LZAA 2CW9A 4MMXB 1O7NB 1RGFA 4HM6B 1X1YA 1UCJA 1JKGA 3EB8A 2O9UX 1QALA 2ZHXB 3MWZA 5CXOA 2XH9A 3UB1A 1A67A 1Q824 1QVG2 1I8VA 3VGNA 3EBTA 1LOWA 1JB2A 3OWSA 4O8SA 2SARA 3FG3A 3CPOA 3SEDA 4N6LA 7GSPA 3WA3A 3MG2A 2CFLA 1KWIA 3CNMA 4HM1B 5DREA 5D82A 3CD63 1LQMB 2P09A 3LTCA 3CCU3 1RNBA 1W7CA 1M1XB 2RCDA 3JVCA 2E2TA 1KD14 3WHOA 2GEXA 1W2B2 1OHSA 3HI7A 4BTYA 1W6CA 3S5CA 4JF8A 2K54A 2ML6A 3EE1A 4HM2B 4J5GA 3RGRA 5IEPA 2YFJB 3RNTA 1TFKA 3X42A 1FGRA 1ULIB 3PCSA 2QEX3 2BHMA 1K9M4 1BSAA 1FA3A 6GSPA 4LYLB 1SARA 2BO9B 4TX4A 3D5IA 1MOLA 3I0YA 2Y74A 2C11A 4NPBA 1JN5A 1NWWA 1RNTA 1YJ93 1MGRA 3A76A 1Q42A 1ULJB 2HMKB 4EV5A 3CME3 5AIIA 1JN5B 3WDGB 1Q40B 1RGHA 1UI7A 1F8NA 3N8BA 1RMSA 2XSOB 3G16A 4L7KA 3T8NA 3UJMA 2GSPA 2WOFA 1AVLA 4IT7A 1BRNL 1W6YA 1BANA 4HZ9B 4WHAA 1Q864 4LSOA 5IG3A 3DGYA 4STDA 1RGCA 3STDA 1MNLA 1GMQA 1DETA 3MPHA 1RJOA 4N6OB 1V57A 3MYTA 3EJVA 2HMOB 1IVXA 1RGLA 3DH2A 1ROAA 3AHSA 2IUKA 2XF3A 3X3ZA 2RFRA 2YX9A 1MWTA 4R80A 3SOYA 1N5HA 1JBTA 2W0QA 5I97A 4R1KA 6STDA 1EUIC 8RNTA 1M1K4 1YVSA 1IVUA 4N6MA 5STDA 2OOVA 3CCQ3 1BUJA 2W6JH 6RNTA 2W04A 2KF3A 3PS8A 1BRSA 4MMZB 4EYCA 1VQ53 3CC23 2O3OA 5LC7A 3G6E3 1IVWA 4K1UA 3MG1A 3HIIA 4MEIA 1DVDA 1BU4A 3FKAA 2UGIA 3N54B 2PZVA 3EC9A 1BSBA 5JBSA 1FUWA 2GEYA 5IERA 3CCE3 1RN1A 1DMQA 3B4PA 3JUOA 1WMPA 2E2UA 3SVAA 2YFLB 5KP3A 1RCKA
chains in the Genus database with same CATH topology
1RHLA 1TRPA 1B2ZA 1Q9EA 1TRQA 1B2UA 9RNTA 2ZA4A 3KCHA 1LOVA 1T2IA 5RNTA 1RGAA 1I3FA 3GSPA 1G02A 1IYYA 2BU4A 3D5GA 3WR2A 7RNTA 3HOHA 1RDSA 1I2GA 4HOHA 1BNFA 1RGFA 5BIRA 1X1YA 1UCJA 1C54A 1GMPA 1FUSA 1ZGXA 5BU4A 3AGOA 1I8VA 1LOWA 2KF4A 1JBSA 2RBIA 3URPA 2SARA 7GSPA 1GOUA 1CH0A 1PYLA 1I2EA 4RNTA 1GMRA 2AAEA 1RNBA 1UCIA 2F5WA 3WHOA 1RCLA 1DE3A 1LOYA 4J5GA 3AGNA 3RNTA 1FW7A 1B3SA 1LRAA 2HOHA 1BRHA 1RLSA 1B20A 1MGWA 1BSAA 5HOHA 2F5MA 2C4BA 6GSPA 1SARA 3A5EA 3D5IA 1RNTA 1I0XA 1HZ1A 3Q3FA 4BIRA 1MGRA 3BU4A 1GSPA 1BIRA 1R4YA 4GHOA 1RGHA 1BGSA 1BAOA 1BNIA 1RMSA 1GOVA 2KF5A 4GSPA 2GSPA 1B27A 4BU4A 1BRNL 1BANA 3AHWA 1PY3A 1FUTA 1UCKA 2BIRA 3DGYA 1RGCA 1X1WA 1A2PA 1BRIA 2KF6A 1GMQA 1DETA 1I3IA 1RN4A 4HAAA 1JBRA 1RTUA 1BNSA 2F56A 2AADA 3BIRA 5GSPA 3D4AA 1BSEA 1RGLA 3DH2A 3AHSA 1I0VA 1I70A 1TTOA 1BSDA 1X1UA 1B2MA 1I2FA 1JBTA 1BRGA 3SYUA 8RNTA 1FZUA 1BVIA 1BNGA 1YVSA 1RSNA 2F4YA 4J5KA 1B2XA 1BUJA 6RNTA 1GOYA 1BRJA 1RGEA 2KF3A 1BRSA 2RNTA 1BOXA 1HYFA 1RGKA 1BSCA 1FYSA 2KAAA 1BNEA 1YGWA 1X1XA 1UCLA 1AY7A 1LNIA 1RGGA 1BU4A 1BNRA 1YNVX 1T2HA 1BSBA 1B2SA 1BNJA 1RN1A 1B21A 1BRKA 1AQZA 1RCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHL A;  1TRP A;  1B2Z A;  1Q9E A;  1TRQ A;  1B2U A;  9RNT A;  2ZA4 A;  3KCH A;  1LOV A;  1T2I A;  5RNT A;  1RGA A;  1I3F A;  3GSP A;  1G02 A;  1IYY A;  2BU4 A;  3D5G A;  3WR2 A;  7RNT A;  3HOH A;  1RDS A;  1I2G A;  4HOH A;  1BNF A;  1RGF A;  5BIR A;  1X1Y A;  1UCJ A;  1C54 A;  1GMP A;  1FUS A;  1ZGX A;  5BU4 A;  3AGO A;  1I8V A;  1LOW A;  2KF4 A;  1JBS A;  2RBI A;  3URP A;  2SAR A;  7GSP A;  1GOU A;  1CH0 A;  1PYL A;  1I2E A;  4RNT A;  1GMR A;  2AAE A;  1RNB A;  1UCI A;  2F5W A;  3WHO A;  1RCL A;  1DE3 A;  1LOY A;  4J5G A;  3AGN A;  3RNT A;  1FW7 A;  1B3S A;  1LRA A;  2HOH A;  1BRH A;  1RLS A;  1B20 A;  1MGW A;  1BSA A;  5HOH A;  2F5M A;  2C4B A;  6GSP A;  1SAR A;  3A5E A;  3D5I A;  1RNT A;  1I0X A;  1HZ1 A;  3Q3F A;  4BIR A;  1MGR A;  3BU4 A;  1GSP A;  1BIR A;  1R4Y A;  4GHO A;  1RGH A;  1BGS A;  1BAO A;  1BNI A;  1RMS A;  1GOV A;  2KF5 A;  4GSP A;  2GSP A;  1B27 A;  4BU4 A;  1BRN L;  1BAN A;  3AHW A;  1PY3 A;  1FUT A;  1UCK A;  2BIR A;  3DGY A;  1RGC A;  1X1W A;  1A2P A;  1BRI A;  2KF6 A;  1GMQ A;  1DET A;  1I3I A;  1RN4 A;  4HAA A;  1JBR A;  1RTU A;  1BNS A;  2F56 A;  2AAD A;  3BIR A;  5GSP A;  3D4A A;  1BSE A;  1RGL A;  3DH2 A;  3AHS A;  1I0V A;  1I70 A;  1TTO A;  1BSD A;  1X1U A;  1B2M A;  1I2F A;  1JBT A;  1BRG A;  3SYU A;  8RNT A;  1FZU A;  1BVI A;  1BNG A;  1YVS A;  1RSN A;  2F4Y A;  4J5K A;  1B2X A;  1BUJ A;  6RNT A;  1GOY A;  1BRJ A;  1RGE A;  2KF3 A;  1BRS A;  2RNT A;  1BOX A;  1HYF A;  1RGK A;  1BSC A;  1FYS A;  2KAA A;  1BNE A;  1YGW A;  1X1X A;  1UCL A;  1AY7 A;  1LNI A;  1RGG A;  1BU4 A;  1BNR A;  1YNV X;  1T2H A;  1BSB A;  1B2S A;  1BNJ A;  1RN1 A;  1B21 A;  1BRK A;  1AQZ A;  1RCK A; 
#chains in the Genus database with same CATH topology
 2CK3 H;  2CFW A;  2STD A;  4N6N B;  3LH4 A;  1Z1S A;  1IQ8 A;  2J8X B;  4KFE A;  1OCV A;  1K8A 4;  3CU3 A;  1YJN 3;  1A2K A;  3K63 A;  1B2U A;  3DGO A;  1OUN A;  3X3X A;  1UGH I;  1ZO2 A;  2IY2 A;  3B4O A;  5M19 A;  3DGM A;  2W9P A;  1T2I A;  5RNT A;  4KFD A;  5M1A A;  2W56 B;  3FCS B;  1JB4 A;  1UGI A;  3LXU X;  2R4I A;  3M8C A;  3HOH A;  4HM8 B;  1RDS A;  1I2G A;  1Q40 A;  1GY5 A;  1SIH A;  4IIA A;  2H0I A;  4HBR A;  1OHO A;  3B7C A;  1IQY A;  3OWU A;  5CF2 A;  1C54 A;  3BNC A;  4N3V A;  4GL6 A;  4XM4 A;  3AGO A;  1W6G A;  3HIG A;  3D79 A;  2KF4 A;  5EQL A;  1WQL B;  1JBS A;  1OGX A;  1CQS A;  2A15 A;  4FMD A;  1LQG C;  3F7X A;  1M9G A;  4LEH A;  1CH0 A;  5BXQ A;  2LYX A;  2ZDJ A;  3KFQ C;  4RNT A;  1UI8 A;  4KVH A;  3F14 A;  1WMO A;  1T3B A;  1IT7 A;  1DYU A;  2INX A;  1U5O A;  4XB5 A;  1KC8 4;  3CNX A;  5FGO A;  1WTH A;  1OAC A;  3X40 A;  3J7Y d;  5EVH A;  7STD A;  4EBG A;  3CMA 3;  1FGO A;  5M18 A;  1O7W B;  1DE3 A;  3PXM A;  3S27 A;  4O02 B;  1AV4 A;  3NXJ A;  2Z6B A;  1E3V A;  1EEJ A;  3BNB A;  1PU4 A;  4HM7 B;  1B3S A;  1G0T A;  3FF2 A;  2CX0 A;  2HOH A;  1MWU A;  1JV2 B;  1B20 A;  3K9M C;  1MGW A;  5G1L A;  2OQE A;  3UL6 A;  4FMC A;  1V58 A;  2C4B A;  5AIH A;  3EQQ B;  3E99 A;  3F40 A;  3V99 A;  2FXT A;  2QGU A;  3NV0 A;  1NO3 A;  1HZ1 A;  2L4V A;  3Q90 A;  2CX1 A;  4AKY A;  2CH9 A;  4R4K A;  4RNZ A;  3SLU A;  1NU3 A;  3LML A;  3NV0 B;  1N8R 4;  3KZT A;  3WOE B;  1LVN A;  4K1V A;  1J2B A;  5IW9 A;  1VQQ A;  2XGN A;  1VZZ A;  4BL2 A;  3LT8 A;  3GZY B;  2CHC A;  4J9A A;  1FUT A;  1N9J A;  2BIR A;  2HMM B;  3VF1 A;  3NBB A;  3S29 A;  1YGE A;  3EBY A;  3RGA A;  2HMJ B;  4RZM A;  1BRI A;  3FF0 A;  1Q7H A;  1I3I A;  4Q53 A;  3CC7 3;  5BVB A;  3ZFZ A;  3ROB A;  1JBR A;  4H3U A;  2F56 A;  3BIR A;  1UUV B;  2HML B;  5DRV A;  3NX0 A;  3RDE A;  2GU1 A;  3ZG5 A;  2V1L A;  1I0V A;  4BL3 A;  1VQ8 3;  3D9R A;  1BSD A;  3GZB A;  1NB5 I;  1K73 4;  2ZL8 A;  3QK9 A;  5IEN A;  1BRG A;  3SYU A;  3DGN A;  1JNQ A;  3MSO A;  4RBN A;  3CCJ 3;  1QVF 2;  1RRH A;  3OWY A;  3NM7 A;  4PEJ A;  3JUN A;  3D3L A;  4KT3 B;  1R4C A;  4WP5 A;  1VQ6 3;  1BRJ A;  4X2O A;  4QWT A;  1N5P A;  2RNT A;  1BOX A;  4LZI A;  3CCL 3;  1RGK A;  3G0K A;  1BSC A;  2KAA A;  4L8O A;  2JQ5 A;  2C10 A;  3AMO B;  1FGM A;  3GZR A;  1UCL A;  1TJD A;  5AYR B;  1A2V A;  1T2H A;  1M90 4;  4FMB A;  1B2S A;  5JPU A;  4L8P A;  1TUH A;  1BRK A;  2P0X A;  1U8C B;  2K0M A;  1YIJ 3;  1OH0 A;  4H61 A;  5ELU A;  5AYS C;  1NDO B;  1RHL A;  3KSE D;  1TRP A;  3UL5 A;  1Q81 4;  4EXR A;  1Q9E A;  9RNT A;  3MKI A;  1K41 A;  5G1K A;  2B24 B;  2ZA4 A;  3FLJ A;  3H3H A;  1DMN A;  3NQZ A;  3UNL A;  3I56 3;  1LOX A;  3KE7 A;  1LOV A;  3EX9 A;  3KN4 A;  2KXG A;  3OX9 A;  1RGA A;  4BTX A;  1VQP 3;  1ZX2 A;  4R9L A;  2SBL A;  3GSP A;  2YFI B;  1IV9 A;  3FG4 A;  3MHE A;  4JRF A;  3D5G A;  3KII A;  3OXA A;  7RNT A;  4NRE A;  4AEQ A;  1AVK A;  1BNF A;  1DVC A;  1E97 A;  1TIJ A;  2M7O A;  1IK3 A;  5EEO A;  1STF I;  2W2C A;  4HM5 B;  2JDI H;  2QA4 3;  3N9H A;  1FUS A;  1NJI 4;  2OTL 3;  1N9E A;  1OF5 A;  1TU5 A;  4LMI A;  2RGQ A;  1OGZ A;  2CWV A;  4J8T A;  3SX1 A;  3FG1 A;  3URP A;  1IT8 A;  3LOY A;  1KSI A;  3BB9 A;  1I2E A;  2IA7 A;  2AAE A;  2KRT A;  3OV4 A;  1K28 A;  3WMD A;  1VQK 3;  4N6V 0;  4MJD A;  4HZB B;  1UCI A;  2F5W A;  1YHQ 3;  1RCL A;  4KFF A;  3I55 3;  1UUG B;  1O7P B;  1E3R A;  1N8Q A;  5G2G A;  2RSX A;  1VQ7 3;  1QMA A;  1SII A;  2IMJ A;  2L1S A;  3WOF B;  1JZD A;  1LRA A;  2MF7 A;  2QIY A;  4O2H A;  1BRH A;  3T8U A;  1GYB A;  5HOH A;  3OW2 2;  2Y73 A;  3A5E A;  5A0O B;  2BMR B;  4AKZ A;  2GBW B;  4CJN A;  1GY6 A;  1I0X A;  3ECF A;  3Q3F A;  4BIR A;  2GBX B;  2BT3 A;  5ELJ A;  5HGR A;  1VQ4 3;  3FZW A;  3ALA A;  1EQK A;  1GSP A;  1JZO A;  1BIR A;  1O7G B;  4FR9 A;  1SPU A;  5CLK A;  4FCJ A;  1VQN 3;  4GHO A;  1BGS A;  3SXX A;  5LC6 A;  2W03 A;  1BNI A;  3JUM A;  1GD4 A;  1OF5 B;  1MWS A;  1GOV A;  1YVB I;  4K90 B;  5IF6 A;  3S67 A;  1RKY A;  1SJW A;  1V74 A;  1B27 A;  4BU4 A;  4NHF A;  3AHW A;  4FCZ A;  3T0U A;  1W01 A;  1GS3 A;  1GD3 A;  1S5A A;  3V92 A;  3BLZ A;  2Z76 A;  1X1W A;  1UW1 A;  3HK4 A;  1RN4 A;  3PZW A;  3DY5 A;  2XSH B;  2F98 A;  3DZL A;  3PYJ A;  2AAD A;  4HJL B;  2W56 A;  4XDW A;  4EV2 A;  4U13 A;  1HU9 A;  1I70 A;  3K5T A;  1TTO A;  1X1U A;  1A90 A;  1AR0 A;  2P0M A;  1B2M A;  4EC6 A;  1ROV A;  1BVI A;  1BNG A;  1T5Y A;  1RSN A;  4J5K A;  1UUW B;  3DM8 A;  1Y4K A;  3TDG A;  1OHP A;  4DKI A;  1GOY A;  5FW5 A;  3CCV 3;  3DXO A;  1HKX A;  1D6Y A;  1S72 3;  3NBJ A;  5IG4 A;  5JPP A;  1YIT 3;  2BMQ B;  3GZX B;  1FYS A;  3IPT A;  2CKF B;  3CCR 3;  3NBR A;  3DUK A;  1YJW 3;  1BNR A;  3BND A;  2CFD A;  3LTD A;  2OOV C;  1BNJ A;  2WOH A;  3LYG A;  3DGL A;  2E2V A;  4O3V A;  1B2Z A;  1VQM 3;  2CG0 A;  4KZ1 A;  4XBX A;  1IDP A;  1EG9 B;  4XDV A;  1IU7 A;  4N6U A;  4CPK A;  5IG5 A;  3B8L A;  3KKG A;  3HX8 A;  3F9S A;  3Q2P A;  1IYY A;  4X2H A;  2PNC A;  4ZM8 A;  2XFT A;  3GAX A;  3G4S 3;  4HOH A;  3EF8 A;  3ER7 A;  4IPB A;  5BIR A;  1BUQ A;  3G71 3;  1GMP A;  2I9W A;  3JUP A;  1DMM A;  1ZGX A;  5BU4 A;  3CPW 2;  3QRD A;  4HVN A;  3JUQ A;  1FGT A;  1D6U A;  3FH1 A;  5AEU B;  1VQO 3;  1JRQ A;  2D1W A;  2RBI A;  3BNE A;  2OCT A;  4CDL A;  3IMA B;  1GOU A;  1PYL A;  5AIF A;  1W00 A;  1PFP A;  2P38 A;  3Q1C A;  2H0G A;  4HKV B;  4XBY A;  1GMR A;  1W4N A;  2R41 A;  2B1X B;  2Z7A A;  3GRD A;  1NB3 I;  1G96 A;  3H51 A;  1W02 A;  5AIG A;  4OVM A;  4FMA A;  3U1W A;  1QJG A;  4ORL A;  2CFK A;  4MMY B;  1EKM A;  1FGQ A;  2WO0 A;  3L0R A;  4CCV A;  1WMN A;  1LXE A;  2GU3 A;  2XFS A;  2KCD A;  2GXF A;  1LOY A;  3AGN A;  2W9Q A;  1Q7Y 4;  1QAF A;  2K3D A;  2XRX B;  4OUQ A;  1VQ9 3;  3F8H A;  4XBT A;  2BNG A;  3U97 A;  3LTA A;  1STD A;  1FW7 A;  1RLS A;  1JB5 A;  2F5M A;  2UX0 A;  4I5Q A;  5AI1 A;  3X3Y A;  1NNV A;  3NUV A;  2IUJ A;  1CYU A;  3O8Y A;  4HYZ A;  1LNH A;  1MWR A;  3AMO A;  3BU4 A;  3LTB A;  1RN7 A;  2Z77 A;  1IV7 A;  2P05 A;  1UDI I;  3DMC A;  5IEO A;  5IG0 A;  1R4Y A;  2IYJ A;  2OQE C;  1W5Z A;  4N6T A;  3CCS 3;  4WWU C;  1C7H A;  1O7H B;  3CCM 3;  4HM4 B;  1BAO A;  3X41 A;  3NQY A;  3EN1 B;  4GSP A;  2KF5 A;  5AEW B;  1JJ2 2;  1YI2 3;  3ZG0 A;  1EA2 A;  1CYV A;  3V98 A;  1PY3 A;  5D83 A;  1UCK A;  2CG1 A;  2OWP A;  3FGY A;  1A2P A;  2KF6 A;  1D6Z A;  4HAA A;  4WYK B;  3WOD G;  1RTU A;  1BNS A;  3PCR A;  2Q07 A;  1RRL A;  5GSP A;  3D4A A;  1BSE A;  3EN8 A;  4BTW A;  3KSP A;  2UUG C;  4WYK A;  2ML5 A;  4HM3 B;  4G1M B;  1QAK A;  1I2F A;  4I4K A;  3EHC A;  4ILF A;  4K61 A;  2XR8 B;  1O7M B;  2BMO B;  5KP4 A;  1FZU A;  1W2Z A;  2F4Y A;  4HM0 B;  3FSD A;  1B2X A;  1OPY A;  8CHO A;  3K7C A;  2CIU A;  2XEP A;  1IQX A;  1GY7 A;  1RGE A;  2D42 A;  4WFO A;  4RNY A;  1HYF A;  3K0Z A;  3MG3 A;  1BNE A;  1YGW A;  2H0H A;  3S28 A;  1ASK A;  2FNQ A;  1X1X A;  1AY7 A;  1LNI A;  1RGG A;  3G8Z A;  3LT9 A;  1YNV X;  3F7S A;  2WGQ A;  2XGL A;  1L5G B;  1TP6 A;  4EW5 A;  4OK0 A;  2CWU A;  1IVV A;  1B21 A;  3IJE B;  1AQZ A;  3HZP A;  3PGB A;  5CF1 A;  2MC8 A;  3GWR A;  2LQV A;  1CEW I;  5TGN A;  1ZS7 A;  1SQW A;  4FCM A;  4GB5 A;  1KQS 2;  5KP1 A;  1ISK A;  4LGQ A;  2F86 B;  3CC4 3;  2F99 A;  1US1 A;  3NHX A;  1TRQ A;  3NM2 A;  5CK6 A;  5D81 A;  4R9K A;  3KCH A;  3F8X A;  2CC3 A;  2FGT A;  1JKG B;  2OTJ 3;  2WGO A;  2CFG A;  3VSY A;  3CXC 2;  3WA2 X;  3SOA A;  1I3F A;  2HMN B;  1VQL 3;  1G02 A;  1WNH A;  2BU4 A;  3WR2 A;  1TFO A;  2CWT A;  3LZA A;  2CW9 A;  4MMX B;  1O7N B;  1RGF A;  4HM6 B;  1X1Y A;  1UCJ A;  1JKG A;  3EB8 A;  2O9U X;  1QAL A;  2ZHX B;  3MWZ A;  5CXO A;  2XH9 A;  3UB1 A;  1A67 A;  1Q82 4;  1QVG 2;  1I8V A;  3VGN A;  3EBT A;  1LOW A;  1JB2 A;  3OWS A;  4O8S A;  2SAR A;  3FG3 A;  3CPO A;  3SED A;  4N6L A;  7GSP A;  3WA3 A;  3MG2 A;  2CFL A;  1KWI A;  3CNM A;  4HM1 B;  5DRE A;  5D82 A;  3CD6 3;  1LQM B;  2P09 A;  3LTC A;  3CCU 3;  1RNB A;  1W7C A;  1M1X B;  2RCD A;  3JVC A;  2E2T A;  1KD1 4;  3WHO A;  2GEX A;  1W2B 2;  1OHS A;  3HI7 A;  4BTY A;  1W6C A;  3S5C A;  4JF8 A;  2K54 A;  2ML6 A;  3EE1 A;  4HM2 B;  4J5G A;  3RGR A;  5IEP A;  2YFJ B;  3RNT A;  1TFK A;  3X42 A;  1FGR A;  1ULI B;  3PCS A;  2QEX 3;  2BHM A;  1K9M 4;  1BSA A;  1FA3 A;  6GSP A;  4LYL B;  1SAR A;  2BO9 B;  4TX4 A;  3D5I A;  1MOL A;  3I0Y A;  2Y74 A;  2C11 A;  4NPB A;  1JN5 A;  1NWW A;  1RNT A;  1YJ9 3;  1MGR A;  3A76 A;  1Q42 A;  1ULJ B;  2HMK B;  4EV5 A;  3CME 3;  5AII A;  1JN5 B;  3WDG B;  1Q40 B;  1RGH A;  1UI7 A;  1F8N A;  3N8B A;  1RMS A;  2XSO B;  3G16 A;  4L7K A;  3T8N A;  3UJM A;  2GSP A;  2WOF A;  1AVL A;  4IT7 A;  1BRN L;  1W6Y A;  1BAN A;  4HZ9 B;  4WHA A;  1Q86 4;  4LSO A;  5IG3 A;  3DGY A;  4STD A;  1RGC A;  3STD A;  1MNL A;  1GMQ A;  1DET A;  3MPH A;  1RJO A;  4N6O B;  1V57 A;  3MYT A;  3EJV A;  2HMO B;  1IVX A;  1RGL A;  3DH2 A;  1ROA A;  3AHS A;  2IUK A;  2XF3 A;  3X3Z A;  2RFR A;  2YX9 A;  1MWT A;  4R80 A;  3SOY A;  1N5H A;  1JBT A;  2W0Q A;  5I97 A;  4R1K A;  6STD A;  1EUI C;  8RNT A;  1M1K 4;  1YVS A;  1IVU A;  4N6M A;  5STD A;  2OOV A;  3CCQ 3;  1BUJ A;  2W6J H;  6RNT A;  2W04 A;  2KF3 A;  3PS8 A;  1BRS A;  4MMZ B;  4EYC A;  1VQ5 3;  3CC2 3;  2O3O A;  5LC7 A;  3G6E 3;  1IVW A;  4K1U A;  3MG1 A;  3HII A;  4MEI A;  1DVD A;  1BU4 A;  3FKA A;  2UGI A;  3N54 B;  2PZV A;  3EC9 A;  1BSB A;  5JBS A;  1FUW A;  2GEY A;  5IER A;  3CCE 3;  1RN1 A;  1DMQ A;  3B4P A;  3JUO A;  1WMP A;  2E2U A;  3SVA A;  2YFL B;  5KP3 A;  1RCK A; 
#chains in the Genus database with same CATH homology
 1RHL A;  1TRP A;  1B2Z A;  1Q9E A;  1TRQ A;  1B2U A;  9RNT A;  2ZA4 A;  3KCH A;  1LOV A;  1T2I A;  5RNT A;  1RGA A;  1I3F A;  3GSP A;  1G02 A;  1IYY A;  2BU4 A;  3D5G A;  3WR2 A;  7RNT A;  3HOH A;  1RDS A;  1I2G A;  4HOH A;  1BNF A;  1RGF A;  5BIR A;  1X1Y A;  1UCJ A;  1C54 A;  1GMP A;  1FUS A;  1ZGX A;  5BU4 A;  3AGO A;  1I8V A;  1LOW A;  2KF4 A;  1JBS A;  2RBI A;  3URP A;  2SAR A;  7GSP A;  1GOU A;  1CH0 A;  1PYL A;  1I2E A;  4RNT A;  1GMR A;  2AAE A;  1RNB A;  1UCI A;  2F5W A;  3WHO A;  1RCL A;  1DE3 A;  1LOY A;  4J5G A;  3AGN A;  3RNT A;  1FW7 A;  1B3S A;  1LRA A;  2HOH A;  1BRH A;  1RLS A;  1B20 A;  1MGW A;  1BSA A;  5HOH A;  2F5M A;  2C4B A;  6GSP A;  1SAR A;  3A5E A;  3D5I A;  1RNT A;  1I0X A;  1HZ1 A;  3Q3F A;  4BIR A;  1MGR A;  3BU4 A;  1GSP A;  1BIR A;  1R4Y A;  4GHO A;  1RGH A;  1BGS A;  1BAO A;  1BNI A;  1RMS A;  1GOV A;  2KF5 A;  4GSP A;  2GSP A;  1B27 A;  4BU4 A;  1BRN L;  1BAN A;  3AHW A;  1PY3 A;  1FUT A;  1UCK A;  2BIR A;  3DGY A;  1RGC A;  1X1W A;  1A2P A;  1BRI A;  2KF6 A;  1GMQ A;  1DET A;  1I3I A;  1RN4 A;  4HAA A;  1JBR A;  1RTU A;  1BNS A;  2F56 A;  2AAD A;  3BIR A;  5GSP A;  3D4A A;  1BSE A;  1RGL A;  3DH2 A;  3AHS A;  1I0V A;  1I70 A;  1TTO A;  1BSD A;  1X1U A;  1B2M A;  1I2F A;  1JBT A;  1BRG A;  3SYU A;  8RNT A;  1FZU A;  1BVI A;  1BNG A;  1YVS A;  1RSN A;  2F4Y A;  4J5K A;  1B2X A;  1BUJ A;  6RNT A;  1GOY A;  1BRJ A;  1RGE A;  2KF3 A;  1BRS A;  2RNT A;  1BOX A;  1HYF A;  1RGK A;  1BSC A;  1FYS A;  2KAA A;  1BNE A;  1YGW A;  1X1X A;  1UCL A;  1AY7 A;  1LNI A;  1RGG A;  1BU4 A;  1BNR A;  1YNV X;  1T2H A;  1BSB A;  1B2S A;  1BNJ A;  1RN1 A;  1B21 A;  1BRK A;  1AQZ A;  1RCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...