1RN1A

Three-dimensional structure of gln 25-ribonuclease t1 at 1.84 angstroms resolution: structural variations at the base recognition and catalytic sites
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
103
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title Three-dimensional structure of Gln25-ribonuclease T1 at 1.84-A resolution: structural variations at the base recognition and catalytic sites.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 24
structure length 103
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rn1A00
3D5IA 1BIRA 1BNEA 4J5GA 5BU4A 4J5KA 1BUJA 9RNTA 2BU4A 1JBSA 1RGKA 1B27A 3DH2A 1GMRA 3KCHA 1BRGA 1ZGXA 1GMPA 3AGOA 1BNSA 1LNIA 1RGLA 3BIRA 6GSPA 1RTUA 1BRJA 1RGAA 3A5EA 1LRAA 1BNGA 1RN1A 1B21A 1BRIA 1B2MA 1I70A 4BIRA 1YGWA 1B3SA 1BSAA 1I3FA 2KAAA 3URPA 3AGNA 1B2ZA 1LOWA 1RN4A 2KF5A 1DE3A 1PY3A 1RCKA 2BIRA 2ZA4A 2SARA 1C54A 1X1XA 4GHOA 1RNTA 1FUTA 2AADA 3BU4A 1RNBA 1HZ1A 1BSBA 1I2GA 1LOVA 1UCKA 1BGSA 1X1WA 3D5GA 1LOYA 7GSPA 1B2UA 1FZUA 2HOHA 2GSPA 1X1UA 1BNFA 1I3IA 5RNTA 1IYYA 3Q3FA 1PYLA 1BRSA 1DETA 1FYSA 1T2IA 1Q9EA 1BAOA 3SYUA 1A2PA 4HAAA 8RNTA 3HOHA 1BNRA 1RGFA 5BIRA 1I0XA 1X1YA 1SARA 1UCJA 1BVIA 1B2SA 1BRHA 1AY7A 1BU4A 4BU4A 1R4YA 4GSPA 1JBRA 1BSDA 2F5MA 1GOUA 1TTOA 1HYFA 1BSEA 1B2XA 3WR2A 7RNTA 3GSPA 1BOXA 2KF3A 1TRPA 1RCLA 1BSCA 1BANA 3D4AA 2F4YA 1JBTA 1RLSA 1UCIA 1MGWA 1TRQA 3DGYA 2C4BA 3WHOA 1BNIA 4HOHA 3RNTA 1FW7A 1B20A 1GOVA 1I0VA 2RBIA 1RGGA 2F5WA 2KF6A 1YVSA 1I2EA 1BRNL 1CH0A 1BNJA 1UCLA 1YNVX 3AHSA 2F56A 1T2HA 1RSNA 2KF4A 2AAEA 4RNTA 1RHLA 5HOHA 1G02A 1RGEA 1RGCA 1RMSA 1MGRA 1FUSA 1I2FA 1GSPA 5GSPA 2RNTA 1I8VA 1BRKA 1GOYA 1RDSA 1RGHA 3AHWA 1GMQA 1AQZA 6RNTA
chains in the Genus database with same CATH superfamily
2CFKA 4WFOA 1WMOA 1BIRA 4J5GA 1EUIC 2BHMA 2P0MA 1JJ22 2UUGC 1W4NA 1ZX2A 3NUVA 3ZG5A 1OGXA 1N8QA 2IY2A 1YIJ3 1DVDA 1EEJA 3MYTA 1B27A 3BNDA 5BVBA 5IF6A 4ORLA 1GMRA 3BLZA 1QALA 3RGAA 1ZGXA 3CME3 1M904 2BMRB 1GMPA 3G4S3 2XGNA 1V74A 3ALAA 1W00A 3LZAA 1RGAA 3M8CA 2OTJ3 1LRAA 2PNCA 3IPTA 1RN1A 1B21A 2E2TA 3N8BA 3TDGA 3G713 3CXC2 1VQ63 1I70A 4BIRA 1ULIB 5CXOA 2W56B 2W6JH 1I3FA 4N3VA 4MJDA 2KAAA 1SIIA 2WOHA 3HX8A 3OXAA 1DVCA 3LTBA 2W56A 1MNLA 1LOWA 2P38A 3JUQA 7STDA 1W6YA 1DE3A 1UDII 1E97A 1RCKA 2BIRA 1C54A 2HMJB 1X1XA 4HM5B 3MG2A 1VQK3 2INXA 1RNTA 1M1K4 1FUTA 4HVNA 4ILFA 1RNBA 2IMJA 4PEJA 2E2UA 3PGBA 1UCKA 1BGSA 3GZRA 1STDA 2OOVA 7GSPA 1B2UA 2CHCA 1OACA 4LSOA 3EQQB 1QAKA 3AMOB 2GSPA 1G96A 1O7NB 4KFFA 4CPKA 1MWSA 3F40A 1PYLA 1U5OA 2W03A 1O7HB 4XBTA 2WGOA 2STDA 3LH4A 1VQL3 2OOVC 5DREA 1OHPA 2GEYA 3LYGA 3PZWA 4OVMA 1N9EA 1AVKA 2RCDA 1V57A 1JZDA 1Q7Y4 1IV9A 1KSIA 1BUQA 3FCSB 4EBGA 2R4IA 3DGNA 1SARA 3SOAA 1BVIA 2K0MA 1BRHA 1IT8A 4N6UA 3CCV3 2GU3A 1T3BA 2CFWA 3B8LA 1ROVA 4GSPA 2F5MA 3MKIA 4XDVA 1GOUA 1TTOA 4O02B 3SEDA 1BSEA 4LYLB 2FXTA 2GBXB 1O7WB 2KF3A 4CDLA 1NU3A 1WMPA 3NBRA 3CC73 1IQYA 1O7GB 3WDGB 3LXUX 3X40A 1AVLA 3MG1A 4BTWA 4Q53A 2XGLA 4HM4B 3WHOA 1ROAA 4HJLB 3X3XA 2XEPA 2D42A 5G1KA 1TFOA 2KXGA 1JB2A 2WGQA 5FGOA 1EG9B 3NXJA 4KT3B 4LZIA 2HMLB 2MF7A 1YVSA 3MG3A 1I2EA 1VQ53 2CWUA 1VQQA 3PS8A 4FCMA 1LQMB 1BRNL 3S27A 5IW9A 1CH0A 2H0GA 1UCLA 2FGTA 5CK6A 4WWUC 5KP1A 1RSNA 1VQP3 3CMA3 2KF4A 1QMAA 3JVCA 4FR9A 4O8SA 4XBXA 5LC7A 1Z1SA 1ZO2A 3NBBA 1NDOB 2YX9A 1IK3A 2C10A 1SPUA 1IT7A 1I2FA 3WA2X 1GSPA 3LOYA 3PYJA 2RNTA 3N54B 5AEWB 2CFLA 3SOYA 3CCU3 2W04A 5HGRA 3EN1B 3LTCA 1UUGB 2I9WA 3STDA 1IQ8A 3LTDA 3D5IA 3LT8A 1RN7A 3N9HA 3PCSA 1KC84 3FKAA 2IUKA 3GZXB 1BNEA 1O7MB 4TX4A 1D6YA 1TIJA 2OCTA 3OWUA 2YFJB 3F7SA 3FGYA 2J8XB 1JKGB 1VQ93 4X2OA 2V1LA 4HM7B 5AYRB 1LQGC 3CNXA 1W5ZA 2FNQA 1RGLA 1D6ZA 3E99A 3RGRA 2Y74A 3BIRA 4FMAA 3VSYA 1T5YA 2F86B 2ZHXB 2D1WA 1W7CA 2CH9A 2BMQB 3GZBA 1OHOA 1DMQA 1KQS2 3BNBA 1FGRA 1B3SA 1BSAA 1RRHA 1W02A 5ELUA 1UUVB 5M19A 1VQO3 1A2VA 3SXXA 2Z77A 3KN4A 3CCL3 3BB9A 3AGNA 1A67A 4K90B 1B2ZA 5G1LA 3PXMA 2CG1A 3NM7A 1Q814 2KF5A 1OF5A 1UI7A 3KSPA 4MMZB 1PY3A 2W9PA 4XB5A 3B7CA 5M1AA 2MC8A 3WA3A 4GHOA 3D79A 4EV2A 4O2HA 3HZPA 4KFDA 1BSBA 2XFSA 4BL2A 3O8YA 1D6UA 5IEPA 1IVVA 1PFPA 1BNFA 1I3IA 3S5CA 5RNTA 2QGUA 2QEX3 1DETA 1NWWA 3FSDA 3DZLA 2RFRA 3MWZA 1A2PA 1MWUA 3NQZA 4HAAA 1AV4A 3A76A 3DUKA 5KP3A 3WODG 1JZOA 2R41A 4HZBB 1BNRA 2E2VA 1Y4KA 1RGFA 2B1XB 1OPYA 2XSHB 5AYSC 5I97A 3G16A 1I0XA 2W0QA 5IERA 1X1YA 2YFLB 3JUNA 5BXQA 4N6LA 4HM1B 1Q7HA 2RGQA 1VQ73 2XF3A 2Z76A 1HKXA 4WYKA 1W2ZA 3HIGA 3ROBA 2ML5A 4X2HA 1R4YA 3CD63 3H3HA 4STDA 3FLJA 4HM2B 4JF8A 3U1WA 4I4KA 1B2XA 4HM3B 1K734 2IA7A 3CCE3 1W01A 3F8HA 3GSPA 2Q07A 5G2GA 1UW1A 3EC9A 2UGIA 3BNCA 2C11A 1E3RA 2F4YA 1JBTA 1RLSA 3LTAA 3S67A 1MGWA 3DY5A 1TRQA 1GYBA 3B4OA 1CYVA 3GAXA 4RBNA 3MSOA 1S723 5A0OB 2C4BA 3EJVA 2GU1A 3JUMA 4XDWA 1GOVA 3Q1CA 1YJW3 2RSXA 1K8A4 3ER7A 2F5WA 3X3ZA 2KF6A 3CCM3 3GRDA 3ECFA 4BTXA 1BNJA 1JNQA 1YNVX 3OW22 3FZWA 2YFIB 5M18A 3CCQ3 1A2KA 2AAEA 4RNTA 1V58A 1RHLA 1RGEA 1Q824 3NM2A 1VQ83 4I5QA 1W2B2 4LGQA 2CIUA 2F99A 3QRDA 1BRKA 1GOYA 1RDSA 1RGHA 1YGEA 1WMNA 1VQ43 3OWYA 3WOEB 4LMIA 2XH9A 1VQN3 1AQZA 1DYUA 1IVWA 3LT9A 3VF1A 2PZVA 1O7PB 5BU4A 1M9GA 9RNTA 4MEIA 3F8XA 5FW5A 1JBSA 3DMCA 4HKVB 1EA2A 1N5HA 4H61A 3K0ZA 3DH2A 3FG4A 2CX1A 5ELJA 3LMLA 3KCHA 1OH0A 5IENA 1EKMA 3UL5A 1NB3I 1LNIA 2W2CA 3CU3A 5IG4A 4RZMA 1N8R4 6GSPA 5D81A 1RTUA 1BRJA 1KD14 4ZM8A 4WP5A 2ZDJA 1B2MA 1BRIA 5CLKA 1W6GA 1RRLA 1RJOA 1STFI 4HM8B 4K61A 4N6NB 4EXRA 4JRFA 1YGWA 2GEXA 4GB5A 3D3LA 3Q90A 1ASKA 2O3OA 3URPA 4N6V0 2LYXA 1RN4A 1IVXA 1GD4A 1G0TA 1UGIA 1PU4A 1UI8A 2JQ5A 3IJEB 3Q2PA 2SARA 3G6E3 4OK0A 5IG0A 4DKIA 5JBSA 2QA43 2B24B 4XM4A 4K1VA 3X42A 3MPHA 3T0UA 1I2GA 5D83A 1LOVA 2K3DA 4R80A 1JB5A 2KCDA 3OX9A 5AIFA 1X1WA 3DGOA 3L0RA 3KFQC 3D5GA 1RKYA 4NREA 1FZUA 2P09A 2HOHA 5IG3A 2Z6BA 4LEHA 2CX0A 1FGOA 4QWTA 1WTHA 1TUHA 2CKFB 3Q3FA 4K1UA 1FYSA 4H3UA 1LOXA 3F7XA 1QJGA 4BTYA 4EW5A 1Q40A 1T2IA 1Q9EA 1JN5B 1BAOA 3JUOA 1YVBI 8RNTA 1WQLB 3HOHA 1JN5A 1OF5B 1TFKA 1IVUA 2HMMB 2GBWB 1YIT3 1MWTA 4KZ1A 3CCR3 4L8PA 3K63A 3J7Yd 1B2SA 1BU4A 3DGMA 1FGQA 2IYJA 3EX9A 1FA3A 3KKGA 1JBRA 2CW9A 3V92A 1L5GB 4R9KA 2JDIH 3UJMA 1C7HA 3EBYA 3WR2A 2QIYA 1VZZA 1YHQ3 1BOXA 5KP4A 1AR0A 3S28A 1CEWI 4GL6A 3EE1A 1GY6A 2OTL3 1RCLA 1GS3A 2WOFA 3PCRA 3V99A 3OV4A 1UCIA 2BO9B 3UL6A 1HU9A 3I563 3GWRA 3NX0A 4HOHA 3RNTA 1B20A 1I0VA 2RBIA 3OWSA 5JPUA 4FMBA 1ZS7A 3G0KA 3EHCA 1JRQA 5EQLA 4WYKB 3EB8A 1MOLA 3FF0A 4WHAA 2XFTA 2F98A 3H51A 1JB4A 2Z7AA 2K54A 3HIIA 1N9JA 4NPBA 2IUJA 3SLUA 1T2HA 3T8NA 3CCJ3 3BNEA 1QAFA 3NHXA 2ZL8A 4J9AA 5HOHA 1G02A 2L4VA 4IPBA 1RGCA 1RMSA 3V98A 4R1KA 1MGRA 4R9LA 5GSPA 2OQEA 1I8VA 1K28A 4IT7A 3KE7A 3AHWA 3GZYB 4KVHA 4AEQA 2O9UX 5IEOA 5TGNA 4L7KA 4N6OB 2M7OA 5EEOA 4J5KA 1Q864 3NBJA 1BUJA 2OQEC 2BU4A 1LXEA 1RGKA 3UB1A 1EQKA 3B4PA 2UX0A 4KFEA 3CC43 4HM6B 1US1A 1BRGA 4HBRA 2CWTA 1OCVA 3AGOA 3EF8A 1BNSA 2P0XA 4RNYA 4U13A 2ML6A 2CC3A 4G1MB 4FMDA 3S29A 1TP6A 3IMAB 1A90A 1ISKA 3QK9A 3AMOA 3A5EA 3CNMA 1BNGA 2BT3A 1YJ93 4XBYA 5CF1A 1CQSA 4EC6A 3HK4A 2CFDA 3WMDA 3ZFZA 8CHOA 2BMOB 5STDA 1U8CB 1DMMA 3EBTA 4FMCA 2SBLA 3UNLA 6STDA 4CJNA 4CCVA 3ZG0A 1R4CA 2ZA4A 3U97A 4EV5A 3SVAA 3DXOA 5LC6A 1N5PA 2XRXB 2KRTA 2AADA 3BU4A 1LVNA 1HZ1A 1YI23 5AIIA 3MHEA 4NHFA 2BNGA 3EN8A 4L8OA 1LOYA 4N6MA 3I553 2H0HA 3JUPA 4HM0B 1X1UA 2L1SA 1IYYA 5JPPA 1FUWA 1S5AA 1FGMA 1BRSA 2P05A 3F9SA 1F8NA 1JV2B 3KZTA 3T8UA 2A15A 3D9RA 5AI1A 3WOFB 4RNZA 5AIHA 3SYUA 1KWIA 1J2BA 3VGNA 4R4KA 2OWPA 2LQVA 4MMYB 3K5TA 4EYCA 5BIRA 3G8ZA 1SQWA 1VQM3 1W6CA 1UCJA 3FG3A 1MWRA 3SX1A 1AY7A 2HMKB 4O3VA 3X3YA 3X41A 3I0YA 4BU4A 1WNHA 5DRVA 3KIIA 1OHSA 2H0IA 1BSDA 4MMXB 2CFGA 1HYFA 1DMNA 4BL3A 4FCZA 1K41A 7RNTA 1QVG2 5EVHA 1GD3A 1TRPA 1CYUA 3CC23 4FCJA 1SIHA 1Q40B 1BSCA 1BANA 2HMOB 2Y73A 3D4AA 3CPOA 3K7CA 3K9MC 1ULJB 4AKYA 3CCS3 3DGYA 1Q42A 5IG5A 1NNVA 1FW7A 1BNIA 1E3VA 4HZ9B 1QVF2 1K9M4 2CWVA 2CK3H 1NO3A 3FF2A 4J8TA 1IV7A 2GXFA 2CG0A 1RGGA 3CPW2 1IDPA 1NB5I 3KSED 5CF2A 1YJN3 1M1XB 1NJI4 3AHSA 1JKGA 5AIGA 2F56A 5AEUB 1SJWA 1GY7A 4HYZA 1UUWB 4OUQA 3DGLA 2XSOB 1LNHA 3DM8A 3NQYA 1OGZA 3NV0B 1UGHI 3F14A 1TJDA 3FH1A 4AKZA 3FG1A 1TU5A 1IU7A 3HI7A 1FUSA 3NV0A 3RDEA 2WO0A 2HMNB 5D82A 1IQXA 4IIAA 2XR8B 2W9QA 1OUNA 4N6TA 1FGTA 1GMQA 1GY5A 6RNTA
chains in the Genus database with same CATH topology
3D5IA 1BIRA 1BNEA 4J5GA 5BU4A 4J5KA 1BUJA 9RNTA 2BU4A 1JBSA 1RGKA 1B27A 3DH2A 1GMRA 3KCHA 1BRGA 1ZGXA 1GMPA 3AGOA 1BNSA 1LNIA 1RGLA 3BIRA 6GSPA 1RTUA 1BRJA 1RGAA 3A5EA 1LRAA 1BNGA 1RN1A 1B21A 1BRIA 1B2MA 1I70A 4BIRA 1YGWA 1B3SA 1BSAA 1I3FA 2KAAA 3URPA 3AGNA 1B2ZA 1LOWA 1RN4A 2KF5A 1DE3A 1PY3A 1RCKA 2BIRA 2ZA4A 2SARA 1C54A 1X1XA 4GHOA 1RNTA 1FUTA 2AADA 3BU4A 1RNBA 1HZ1A 1BSBA 1I2GA 1LOVA 1UCKA 1BGSA 1X1WA 3D5GA 1LOYA 7GSPA 1B2UA 1FZUA 2HOHA 2GSPA 1X1UA 1BNFA 1I3IA 5RNTA 1IYYA 3Q3FA 1PYLA 1BRSA 1DETA 1FYSA 1T2IA 1Q9EA 1BAOA 3SYUA 1A2PA 4HAAA 8RNTA 3HOHA 1BNRA 1RGFA 5BIRA 1I0XA 1X1YA 1SARA 1UCJA 1BVIA 1B2SA 1BRHA 1AY7A 1BU4A 4BU4A 1R4YA 4GSPA 1JBRA 1BSDA 2F5MA 1GOUA 1TTOA 1HYFA 1BSEA 1B2XA 3WR2A 7RNTA 3GSPA 1BOXA 2KF3A 1TRPA 1RCLA 1BSCA 1BANA 3D4AA 2F4YA 1JBTA 1RLSA 1UCIA 1MGWA 1TRQA 3DGYA 2C4BA 3WHOA 1BNIA 4HOHA 3RNTA 1FW7A 1B20A 1GOVA 1I0VA 2RBIA 1RGGA 2F5WA 2KF6A 1YVSA 1I2EA 1BRNL 1CH0A 1BNJA 1UCLA 1YNVX 3AHSA 2F56A 1T2HA 1RSNA 2KF4A 2AAEA 4RNTA 1RHLA 5HOHA 1G02A 1RGEA 1RGCA 1RMSA 1MGRA 1FUSA 1I2FA 1GSPA 5GSPA 2RNTA 1I8VA 1BRKA 1GOYA 1RDSA 1RGHA 3AHWA 1GMQA 1AQZA 6RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5I A;  1BIR A;  1BNE A;  4J5G A;  5BU4 A;  4J5K A;  1BUJ A;  9RNT A;  2BU4 A;  1JBS A;  1RGK A;  1B27 A;  3DH2 A;  1GMR A;  3KCH A;  1BRG A;  1ZGX A;  1GMP A;  3AGO A;  1BNS A;  1LNI A;  1RGL A;  3BIR A;  6GSP A;  1RTU A;  1BRJ A;  1RGA A;  3A5E A;  1LRA A;  1BNG A;  1RN1 A;  1B21 A;  1BRI A;  1B2M A;  1I70 A;  4BIR A;  1YGW A;  1B3S A;  1BSA A;  1I3F A;  2KAA A;  3URP A;  3AGN A;  1B2Z A;  1LOW A;  1RN4 A;  2KF5 A;  1DE3 A;  1PY3 A;  1RCK A;  2BIR A;  2ZA4 A;  2SAR A;  1C54 A;  1X1X A;  4GHO A;  1RNT A;  1FUT A;  2AAD A;  3BU4 A;  1RNB A;  1HZ1 A;  1BSB A;  1I2G A;  1LOV A;  1UCK A;  1BGS A;  1X1W A;  3D5G A;  1LOY A;  7GSP A;  1B2U A;  1FZU A;  2HOH A;  2GSP A;  1X1U A;  1BNF A;  1I3I A;  5RNT A;  1IYY A;  3Q3F A;  1PYL A;  1BRS A;  1DET A;  1FYS A;  1T2I A;  1Q9E A;  1BAO A;  3SYU A;  1A2P A;  4HAA A;  8RNT A;  3HOH A;  1BNR A;  1RGF A;  5BIR A;  1I0X A;  1X1Y A;  1SAR A;  1UCJ A;  1BVI A;  1B2S A;  1BRH A;  1AY7 A;  1BU4 A;  4BU4 A;  1R4Y A;  4GSP A;  1JBR A;  1BSD A;  2F5M A;  1GOU A;  1TTO A;  1HYF A;  1BSE A;  1B2X A;  3WR2 A;  7RNT A;  3GSP A;  1BOX A;  2KF3 A;  1TRP A;  1RCL A;  1BSC A;  1BAN A;  3D4A A;  2F4Y A;  1JBT A;  1RLS A;  1UCI A;  1MGW A;  1TRQ A;  3DGY A;  2C4B A;  3WHO A;  1BNI A;  4HOH A;  3RNT A;  1FW7 A;  1B20 A;  1GOV A;  1I0V A;  2RBI A;  1RGG A;  2F5W A;  2KF6 A;  1YVS A;  1I2E A;  1BRN L;  1CH0 A;  1BNJ A;  1UCL A;  1YNV X;  3AHS A;  2F56 A;  1T2H A;  1RSN A;  2KF4 A;  2AAE A;  4RNT A;  1RHL A;  5HOH A;  1G02 A;  1RGE A;  1RGC A;  1RMS A;  1MGR A;  1FUS A;  1I2F A;  1GSP A;  5GSP A;  2RNT A;  1I8V A;  1BRK A;  1GOY A;  1RDS A;  1RGH A;  3AHW A;  1GMQ A;  1AQZ A;  6RNT A; 
#chains in the Genus database with same CATH topology
 2CFK A;  4WFO A;  1WMO A;  1BIR A;  4J5G A;  1EUI C;  2BHM A;  2P0M A;  1JJ2 2;  2UUG C;  1W4N A;  1ZX2 A;  3NUV A;  3ZG5 A;  1OGX A;  1N8Q A;  2IY2 A;  1YIJ 3;  1DVD A;  1EEJ A;  3MYT A;  1B27 A;  3BND A;  5BVB A;  5IF6 A;  4ORL A;  1GMR A;  3BLZ A;  1QAL A;  3RGA A;  1ZGX A;  3CME 3;  1M90 4;  2BMR B;  1GMP A;  3G4S 3;  2XGN A;  1V74 A;  3ALA A;  1W00 A;  3LZA A;  1RGA A;  3M8C A;  2OTJ 3;  1LRA A;  2PNC A;  3IPT A;  1RN1 A;  1B21 A;  2E2T A;  3N8B A;  3TDG A;  3G71 3;  3CXC 2;  1VQ6 3;  1I70 A;  4BIR A;  1ULI B;  5CXO A;  2W56 B;  2W6J H;  1I3F A;  4N3V A;  4MJD A;  2KAA A;  1SII A;  2WOH A;  3HX8 A;  3OXA A;  1DVC A;  3LTB A;  2W56 A;  1MNL A;  1LOW A;  2P38 A;  3JUQ A;  7STD A;  1W6Y A;  1DE3 A;  1UDI I;  1E97 A;  1RCK A;  2BIR A;  1C54 A;  2HMJ B;  1X1X A;  4HM5 B;  3MG2 A;  1VQK 3;  2INX A;  1RNT A;  1M1K 4;  1FUT A;  4HVN A;  4ILF A;  1RNB A;  2IMJ A;  4PEJ A;  2E2U A;  3PGB A;  1UCK A;  1BGS A;  3GZR A;  1STD A;  2OOV A;  7GSP A;  1B2U A;  2CHC A;  1OAC A;  4LSO A;  3EQQ B;  1QAK A;  3AMO B;  2GSP A;  1G96 A;  1O7N B;  4KFF A;  4CPK A;  1MWS A;  3F40 A;  1PYL A;  1U5O A;  2W03 A;  1O7H B;  4XBT A;  2WGO A;  2STD A;  3LH4 A;  1VQL 3;  2OOV C;  5DRE A;  1OHP A;  2GEY A;  3LYG A;  3PZW A;  4OVM A;  1N9E A;  1AVK A;  2RCD A;  1V57 A;  1JZD A;  1Q7Y 4;  1IV9 A;  1KSI A;  1BUQ A;  3FCS B;  4EBG A;  2R4I A;  3DGN A;  1SAR A;  3SOA A;  1BVI A;  2K0M A;  1BRH A;  1IT8 A;  4N6U A;  3CCV 3;  2GU3 A;  1T3B A;  2CFW A;  3B8L A;  1ROV A;  4GSP A;  2F5M A;  3MKI A;  4XDV A;  1GOU A;  1TTO A;  4O02 B;  3SED A;  1BSE A;  4LYL B;  2FXT A;  2GBX B;  1O7W B;  2KF3 A;  4CDL A;  1NU3 A;  1WMP A;  3NBR A;  3CC7 3;  1IQY A;  1O7G B;  3WDG B;  3LXU X;  3X40 A;  1AVL A;  3MG1 A;  4BTW A;  4Q53 A;  2XGL A;  4HM4 B;  3WHO A;  1ROA A;  4HJL B;  3X3X A;  2XEP A;  2D42 A;  5G1K A;  1TFO A;  2KXG A;  1JB2 A;  2WGQ A;  5FGO A;  1EG9 B;  3NXJ A;  4KT3 B;  4LZI A;  2HML B;  2MF7 A;  1YVS A;  3MG3 A;  1I2E A;  1VQ5 3;  2CWU A;  1VQQ A;  3PS8 A;  4FCM A;  1LQM B;  1BRN L;  3S27 A;  5IW9 A;  1CH0 A;  2H0G A;  1UCL A;  2FGT A;  5CK6 A;  4WWU C;  5KP1 A;  1RSN A;  1VQP 3;  3CMA 3;  2KF4 A;  1QMA A;  3JVC A;  4FR9 A;  4O8S A;  4XBX A;  5LC7 A;  1Z1S A;  1ZO2 A;  3NBB A;  1NDO B;  2YX9 A;  1IK3 A;  2C10 A;  1SPU A;  1IT7 A;  1I2F A;  3WA2 X;  1GSP A;  3LOY A;  3PYJ A;  2RNT A;  3N54 B;  5AEW B;  2CFL A;  3SOY A;  3CCU 3;  2W04 A;  5HGR A;  3EN1 B;  3LTC A;  1UUG B;  2I9W A;  3STD A;  1IQ8 A;  3LTD A;  3D5I A;  3LT8 A;  1RN7 A;  3N9H A;  3PCS A;  1KC8 4;  3FKA A;  2IUK A;  3GZX B;  1BNE A;  1O7M B;  4TX4 A;  1D6Y A;  1TIJ A;  2OCT A;  3OWU A;  2YFJ B;  3F7S A;  3FGY A;  2J8X B;  1JKG B;  1VQ9 3;  4X2O A;  2V1L A;  4HM7 B;  5AYR B;  1LQG C;  3CNX A;  1W5Z A;  2FNQ A;  1RGL A;  1D6Z A;  3E99 A;  3RGR A;  2Y74 A;  3BIR A;  4FMA A;  3VSY A;  1T5Y A;  2F86 B;  2ZHX B;  2D1W A;  1W7C A;  2CH9 A;  2BMQ B;  3GZB A;  1OHO A;  1DMQ A;  1KQS 2;  3BNB A;  1FGR A;  1B3S A;  1BSA A;  1RRH A;  1W02 A;  5ELU A;  1UUV B;  5M19 A;  1VQO 3;  1A2V A;  3SXX A;  2Z77 A;  3KN4 A;  3CCL 3;  3BB9 A;  3AGN A;  1A67 A;  4K90 B;  1B2Z A;  5G1L A;  3PXM A;  2CG1 A;  3NM7 A;  1Q81 4;  2KF5 A;  1OF5 A;  1UI7 A;  3KSP A;  4MMZ B;  1PY3 A;  2W9P A;  4XB5 A;  3B7C A;  5M1A A;  2MC8 A;  3WA3 A;  4GHO A;  3D79 A;  4EV2 A;  4O2H A;  3HZP A;  4KFD A;  1BSB A;  2XFS A;  4BL2 A;  3O8Y A;  1D6U A;  5IEP A;  1IVV A;  1PFP A;  1BNF A;  1I3I A;  3S5C A;  5RNT A;  2QGU A;  2QEX 3;  1DET A;  1NWW A;  3FSD A;  3DZL A;  2RFR A;  3MWZ A;  1A2P A;  1MWU A;  3NQZ A;  4HAA A;  1AV4 A;  3A76 A;  3DUK A;  5KP3 A;  3WOD G;  1JZO A;  2R41 A;  4HZB B;  1BNR A;  2E2V A;  1Y4K A;  1RGF A;  2B1X B;  1OPY A;  2XSH B;  5AYS C;  5I97 A;  3G16 A;  1I0X A;  2W0Q A;  5IER A;  1X1Y A;  2YFL B;  3JUN A;  5BXQ A;  4N6L A;  4HM1 B;  1Q7H A;  2RGQ A;  1VQ7 3;  2XF3 A;  2Z76 A;  1HKX A;  4WYK A;  1W2Z A;  3HIG A;  3ROB A;  2ML5 A;  4X2H A;  1R4Y A;  3CD6 3;  3H3H A;  4STD A;  3FLJ A;  4HM2 B;  4JF8 A;  3U1W A;  4I4K A;  1B2X A;  4HM3 B;  1K73 4;  2IA7 A;  3CCE 3;  1W01 A;  3F8H A;  3GSP A;  2Q07 A;  5G2G A;  1UW1 A;  3EC9 A;  2UGI A;  3BNC A;  2C11 A;  1E3R A;  2F4Y A;  1JBT A;  1RLS A;  3LTA A;  3S67 A;  1MGW A;  3DY5 A;  1TRQ A;  1GYB A;  3B4O A;  1CYV A;  3GAX A;  4RBN A;  3MSO A;  1S72 3;  5A0O B;  2C4B A;  3EJV A;  2GU1 A;  3JUM A;  4XDW A;  1GOV A;  3Q1C A;  1YJW 3;  2RSX A;  1K8A 4;  3ER7 A;  2F5W A;  3X3Z A;  2KF6 A;  3CCM 3;  3GRD A;  3ECF A;  4BTX A;  1BNJ A;  1JNQ A;  1YNV X;  3OW2 2;  3FZW A;  2YFI B;  5M18 A;  3CCQ 3;  1A2K A;  2AAE A;  4RNT A;  1V58 A;  1RHL A;  1RGE A;  1Q82 4;  3NM2 A;  1VQ8 3;  4I5Q A;  1W2B 2;  4LGQ A;  2CIU A;  2F99 A;  3QRD A;  1BRK A;  1GOY A;  1RDS A;  1RGH A;  1YGE A;  1WMN A;  1VQ4 3;  3OWY A;  3WOE B;  4LMI A;  2XH9 A;  1VQN 3;  1AQZ A;  1DYU A;  1IVW A;  3LT9 A;  3VF1 A;  2PZV A;  1O7P B;  5BU4 A;  1M9G A;  9RNT A;  4MEI A;  3F8X A;  5FW5 A;  1JBS A;  3DMC A;  4HKV B;  1EA2 A;  1N5H A;  4H61 A;  3K0Z A;  3DH2 A;  3FG4 A;  2CX1 A;  5ELJ A;  3LML A;  3KCH A;  1OH0 A;  5IEN A;  1EKM A;  3UL5 A;  1NB3 I;  1LNI A;  2W2C A;  3CU3 A;  5IG4 A;  4RZM A;  1N8R 4;  6GSP A;  5D81 A;  1RTU A;  1BRJ A;  1KD1 4;  4ZM8 A;  4WP5 A;  2ZDJ A;  1B2M A;  1BRI A;  5CLK A;  1W6G A;  1RRL A;  1RJO A;  1STF I;  4HM8 B;  4K61 A;  4N6N B;  4EXR A;  4JRF A;  1YGW A;  2GEX A;  4GB5 A;  3D3L A;  3Q90 A;  1ASK A;  2O3O A;  3URP A;  4N6V 0;  2LYX A;  1RN4 A;  1IVX A;  1GD4 A;  1G0T A;  1UGI A;  1PU4 A;  1UI8 A;  2JQ5 A;  3IJE B;  3Q2P A;  2SAR A;  3G6E 3;  4OK0 A;  5IG0 A;  4DKI A;  5JBS A;  2QA4 3;  2B24 B;  4XM4 A;  4K1V A;  3X42 A;  3MPH A;  3T0U A;  1I2G A;  5D83 A;  1LOV A;  2K3D A;  4R80 A;  1JB5 A;  2KCD A;  3OX9 A;  5AIF A;  1X1W A;  3DGO A;  3L0R A;  3KFQ C;  3D5G A;  1RKY A;  4NRE A;  1FZU A;  2P09 A;  2HOH A;  5IG3 A;  2Z6B A;  4LEH A;  2CX0 A;  1FGO A;  4QWT A;  1WTH A;  1TUH A;  2CKF B;  3Q3F A;  4K1U A;  1FYS A;  4H3U A;  1LOX A;  3F7X A;  1QJG A;  4BTY A;  4EW5 A;  1Q40 A;  1T2I A;  1Q9E A;  1JN5 B;  1BAO A;  3JUO A;  1YVB I;  8RNT A;  1WQL B;  3HOH A;  1JN5 A;  1OF5 B;  1TFK A;  1IVU A;  2HMM B;  2GBW B;  1YIT 3;  1MWT A;  4KZ1 A;  3CCR 3;  4L8P A;  3K63 A;  3J7Y d;  1B2S A;  1BU4 A;  3DGM A;  1FGQ A;  2IYJ A;  3EX9 A;  1FA3 A;  3KKG A;  1JBR A;  2CW9 A;  3V92 A;  1L5G B;  4R9K A;  2JDI H;  3UJM A;  1C7H A;  3EBY A;  3WR2 A;  2QIY A;  1VZZ A;  1YHQ 3;  1BOX A;  5KP4 A;  1AR0 A;  3S28 A;  1CEW I;  4GL6 A;  3EE1 A;  1GY6 A;  2OTL 3;  1RCL A;  1GS3 A;  2WOF A;  3PCR A;  3V99 A;  3OV4 A;  1UCI A;  2BO9 B;  3UL6 A;  1HU9 A;  3I56 3;  3GWR A;  3NX0 A;  4HOH A;  3RNT A;  1B20 A;  1I0V A;  2RBI A;  3OWS A;  5JPU A;  4FMB A;  1ZS7 A;  3G0K A;  3EHC A;  1JRQ A;  5EQL A;  4WYK B;  3EB8 A;  1MOL A;  3FF0 A;  4WHA A;  2XFT A;  2F98 A;  3H51 A;  1JB4 A;  2Z7A A;  2K54 A;  3HII A;  1N9J A;  4NPB A;  2IUJ A;  3SLU A;  1T2H A;  3T8N A;  3CCJ 3;  3BNE A;  1QAF A;  3NHX A;  2ZL8 A;  4J9A A;  5HOH A;  1G02 A;  2L4V A;  4IPB A;  1RGC A;  1RMS A;  3V98 A;  4R1K A;  1MGR A;  4R9L A;  5GSP A;  2OQE A;  1I8V A;  1K28 A;  4IT7 A;  3KE7 A;  3AHW A;  3GZY B;  4KVH A;  4AEQ A;  2O9U X;  5IEO A;  5TGN A;  4L7K A;  4N6O B;  2M7O A;  5EEO A;  4J5K A;  1Q86 4;  3NBJ A;  1BUJ A;  2OQE C;  2BU4 A;  1LXE A;  1RGK A;  3UB1 A;  1EQK A;  3B4P A;  2UX0 A;  4KFE A;  3CC4 3;  4HM6 B;  1US1 A;  1BRG A;  4HBR A;  2CWT A;  1OCV A;  3AGO A;  3EF8 A;  1BNS A;  2P0X A;  4RNY A;  4U13 A;  2ML6 A;  2CC3 A;  4G1M B;  4FMD A;  3S29 A;  1TP6 A;  3IMA B;  1A90 A;  1ISK A;  3QK9 A;  3AMO A;  3A5E A;  3CNM A;  1BNG A;  2BT3 A;  1YJ9 3;  4XBY A;  5CF1 A;  1CQS A;  4EC6 A;  3HK4 A;  2CFD A;  3WMD A;  3ZFZ A;  8CHO A;  2BMO B;  5STD A;  1U8C B;  1DMM A;  3EBT A;  4FMC A;  2SBL A;  3UNL A;  6STD A;  4CJN A;  4CCV A;  3ZG0 A;  1R4C A;  2ZA4 A;  3U97 A;  4EV5 A;  3SVA A;  3DXO A;  5LC6 A;  1N5P A;  2XRX B;  2KRT A;  2AAD A;  3BU4 A;  1LVN A;  1HZ1 A;  1YI2 3;  5AII A;  3MHE A;  4NHF A;  2BNG A;  3EN8 A;  4L8O A;  1LOY A;  4N6M A;  3I55 3;  2H0H A;  3JUP A;  4HM0 B;  1X1U A;  2L1S A;  1IYY A;  5JPP A;  1FUW A;  1S5A A;  1FGM A;  1BRS A;  2P05 A;  3F9S A;  1F8N A;  1JV2 B;  3KZT A;  3T8U A;  2A15 A;  3D9R A;  5AI1 A;  3WOF B;  4RNZ A;  5AIH A;  3SYU A;  1KWI A;  1J2B A;  3VGN A;  4R4K A;  2OWP A;  2LQV A;  4MMY B;  3K5T A;  4EYC A;  5BIR A;  3G8Z A;  1SQW A;  1VQM 3;  1W6C A;  1UCJ A;  3FG3 A;  1MWR A;  3SX1 A;  1AY7 A;  2HMK B;  4O3V A;  3X3Y A;  3X41 A;  3I0Y A;  4BU4 A;  1WNH A;  5DRV A;  3KII A;  1OHS A;  2H0I A;  1BSD A;  4MMX B;  2CFG A;  1HYF A;  1DMN A;  4BL3 A;  4FCZ A;  1K41 A;  7RNT A;  1QVG 2;  5EVH A;  1GD3 A;  1TRP A;  1CYU A;  3CC2 3;  4FCJ A;  1SIH A;  1Q40 B;  1BSC A;  1BAN A;  2HMO B;  2Y73 A;  3D4A A;  3CPO A;  3K7C A;  3K9M C;  1ULJ B;  4AKY A;  3CCS 3;  3DGY A;  1Q42 A;  5IG5 A;  1NNV A;  1FW7 A;  1BNI A;  1E3V A;  4HZ9 B;  1QVF 2;  1K9M 4;  2CWV A;  2CK3 H;  1NO3 A;  3FF2 A;  4J8T A;  1IV7 A;  2GXF A;  2CG0 A;  1RGG A;  3CPW 2;  1IDP A;  1NB5 I;  3KSE D;  5CF2 A;  1YJN 3;  1M1X B;  1NJI 4;  3AHS A;  1JKG A;  5AIG A;  2F56 A;  5AEU B;  1SJW A;  1GY7 A;  4HYZ A;  1UUW B;  4OUQ A;  3DGL A;  2XSO B;  1LNH A;  3DM8 A;  3NQY A;  1OGZ A;  3NV0 B;  1UGH I;  3F14 A;  1TJD A;  3FH1 A;  4AKZ A;  3FG1 A;  1TU5 A;  1IU7 A;  3HI7 A;  1FUS A;  3NV0 A;  3RDE A;  2WO0 A;  2HMN B;  5D82 A;  1IQX A;  4IIA A;  2XR8 B;  2W9Q A;  1OUN A;  4N6T A;  1FGT A;  1GMQ A;  1GY5 A;  6RNT A; 
#chains in the Genus database with same CATH homology
 3D5I A;  1BIR A;  1BNE A;  4J5G A;  5BU4 A;  4J5K A;  1BUJ A;  9RNT A;  2BU4 A;  1JBS A;  1RGK A;  1B27 A;  3DH2 A;  1GMR A;  3KCH A;  1BRG A;  1ZGX A;  1GMP A;  3AGO A;  1BNS A;  1LNI A;  1RGL A;  3BIR A;  6GSP A;  1RTU A;  1BRJ A;  1RGA A;  3A5E A;  1LRA A;  1BNG A;  1RN1 A;  1B21 A;  1BRI A;  1B2M A;  1I70 A;  4BIR A;  1YGW A;  1B3S A;  1BSA A;  1I3F A;  2KAA A;  3URP A;  3AGN A;  1B2Z A;  1LOW A;  1RN4 A;  2KF5 A;  1DE3 A;  1PY3 A;  1RCK A;  2BIR A;  2ZA4 A;  2SAR A;  1C54 A;  1X1X A;  4GHO A;  1RNT A;  1FUT A;  2AAD A;  3BU4 A;  1RNB A;  1HZ1 A;  1BSB A;  1I2G A;  1LOV A;  1UCK A;  1BGS A;  1X1W A;  3D5G A;  1LOY A;  7GSP A;  1B2U A;  1FZU A;  2HOH A;  2GSP A;  1X1U A;  1BNF A;  1I3I A;  5RNT A;  1IYY A;  3Q3F A;  1PYL A;  1BRS A;  1DET A;  1FYS A;  1T2I A;  1Q9E A;  1BAO A;  3SYU A;  1A2P A;  4HAA A;  8RNT A;  3HOH A;  1BNR A;  1RGF A;  5BIR A;  1I0X A;  1X1Y A;  1SAR A;  1UCJ A;  1BVI A;  1B2S A;  1BRH A;  1AY7 A;  1BU4 A;  4BU4 A;  1R4Y A;  4GSP A;  1JBR A;  1BSD A;  2F5M A;  1GOU A;  1TTO A;  1HYF A;  1BSE A;  1B2X A;  3WR2 A;  7RNT A;  3GSP A;  1BOX A;  2KF3 A;  1TRP A;  1RCL A;  1BSC A;  1BAN A;  3D4A A;  2F4Y A;  1JBT A;  1RLS A;  1UCI A;  1MGW A;  1TRQ A;  3DGY A;  2C4B A;  3WHO A;  1BNI A;  4HOH A;  3RNT A;  1FW7 A;  1B20 A;  1GOV A;  1I0V A;  2RBI A;  1RGG A;  2F5W A;  2KF6 A;  1YVS A;  1I2E A;  1BRN L;  1CH0 A;  1BNJ A;  1UCL A;  1YNV X;  3AHS A;  2F56 A;  1T2H A;  1RSN A;  2KF4 A;  2AAE A;  4RNT A;  1RHL A;  5HOH A;  1G02 A;  1RGE A;  1RGC A;  1RMS A;  1MGR A;  1FUS A;  1I2F A;  1GSP A;  5GSP A;  2RNT A;  1I8V A;  1BRK A;  1GOY A;  1RDS A;  1RGH A;  3AHW A;  1GMQ A;  1AQZ A;  6RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...