1O7WB

Naphthalene 1,2-dioxygenase, fully reduced form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 52
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7wB00
1IDPA 1Q42A 4XB5A 3FH1A 5JPPA 1EG9B 1O7MB 5CK6A 1W01A 4J9AA 3KSPA 3SOYA 4OUQA 1GY7A 2OWPA 1GYBA 3HX8A 5IF6A 3FF2A 5AIGA 3ECFA 3D9RA 4X2OA 1Q40B 1O7GB 5KP4A 2F98A 1JB5A 1JB4A 4XDWA 4R9LA 1EA2A 3JUQA 4N3VA 1ULIB 2BNGA 2QGUA 1E3RA 4FCMA 1QMAA 1K41A 1UUWB 2W2CA 3OWSA 2GEXA 4HM8B 3JUNA 5IEPA 3OV4A 4XDVA 1TP6A 3GZBA 3G8ZA 1W02A 1Q40A 3NM2A 3F7SA 4WYKA 1OPYA 1O7PB 1HKXA 5IG5A 4WWUC 5FW5A 4HM6B 2HMJB 5IERA 3Q90A 5IG3A 3F8XA 3S5CA 3K0ZA 3NUVA 3NV0A 1SJWA 1QJGA 3I0YA 4X2HA 2PZVA 3NBRA 5AIIA 2YFLB 4K1VA 1GS3A 5G2GA 4J8TA 4HM5B 4I4KA 3KE7A 1OGXA 3F40A 1DMQA 2Z77A 1CQSA 3STDA 1ULJB 3H3HA 2R4IA 1O7WB 3F8HA 1GY5A 3BB9A 3KZTA 2BMQB 3GRDA 1JN5A 1VZZA 5DREA 1U5OA 1ISKA 4LEHA 2Z7AA 3CNMA 5IENA 3SOAA 4L7KA 4XBYA 5IG4A 1BUQA 4MJDA 3EQQB 2XR8B 1OH0A 1GY6A 5EVHA 3RGRA 4HM7B 5CXOA 5STDA 1S5AA 1TUHA 4K1UA 3EBTA 1A2KA 3CPOA 2YFIB 3B7CA 2RGQA 4RZMA 3FLJA 1WQLB 1ASKA 2HMKB 4WYKB 3NHXA 3WMDA 2F86B 3GWRA 3EN1B 3DXOA 3OWUA 5BVBA 3NV0B 3HK4A 4XBXA 3BLZA 2HMMB 1OF5A 3VGNA 4HM0B 3SEDA 5AEWB 4HZBB 1UUVB 3DUKA 3F7XA 3GZYB 3FZWA 4HM1B 4PEJA 3FGYA 2IMJA 1NWWA 5AIFA 1JN5B 1DMMA 3F9SA 4L8PA 2YFJB 1OHOA 5D82A 3E99A 2JQ5A 3ER7A 4HZ9B 3K7CA 1O7NB 3EX9A 2XRXB 2RFRA 3GZXB 3VSYA 2F99A 3B4OA 3MSOA 2B1XB 2HMLB 1OCVA 4STDA 1E97A 3JUOA 3CU3A 4KVHA 3OXAA 4GB5A 3F14A 3OWYA 3UNLA 3B8LA 3T8NA 1W00A 3JUPA 5CF1A 4HM3B 1OUNA 5TGNA 5KP3A 3KKGA 1JKGA 4R9KA 3M8CA 2B24B 4HM2B 4HM4B 3OX9A 2UX0A 2I9WA 1ZO2A 2CKFB 3DZLA 3B4PA 5AEUB 2RCDA 3EC9A 5KP1A 2BMOB 3EN8A 2HMNB 3MHEA 2XSOB 4HVNA 2K54A 1STDA 4FCJA 1C7HA 3LYGA 3EF8A 3EJVA 3FF0A 3GZRA 3A76A 4LGQA 2A15A 1OF5B 3G0KA 3T8UA 4ORLA 3JUMA 2QIYA 3MKIA 2STDA 5DRVA 4WP5A 3FKAA 3RGAA 3DM8A 5CF2A 4LMIA 5CLKA 2GEYA 3UJMA 3CNXA 1OHSA 4HKVB 1AR0A 1O7HB 4H3UA 1JB2A 3LZAA 3H51A 4XM4A 2CHCA 1DMNA 6STDA 3HZPA 2GBWB 1W6YA 5IG0A 3EHCA 8CHOA 2XSHB 4Q53A 7STDA 2BMRB 3ROBA 5JPUA 5AIHA 2GBXB 3IPTA 3NXJA 1JKGB 3DMCA 1OGZA 3FSDA 3MG1A 3MG2A 1Z1SA 5AI1A 5HGRA 4U13A 4OVMA 4XBTA 1E3VA 3G16A 5BXQA 2GXFA 5D83A 5IEOA 4IIAA 4CDLA 4R1KA 3MG3A 1NDOB 4L8OA 2INXA 1OHPA 3EBYA 1NU3A 3MYTA 1ZX2A 4HJLB 2HMOB 2Z76A 5D81A
chains in the Genus database with same CATH superfamily
1FUSA 1BNIA 2CFGA 1IDPA 3SYUA 3WODG 5M18A 1RMSA 1Q42A 4FMBA 2ZL8A 3CD63 1QAKA 2BO9B 3FH1A 2K0MA 4XB5A 1RGHA 2KCDA 5JPPA 1JBTA 1ZGXA 4GL6A 5GSPA 1EG9B 1O7MB 9RNTA 1F8NA 1I3FA 1JJ22 1BVIA 4RNZA 5CK6A 3SXXA 1W01A 3FG3A 4G1MB 4J9AA 3CXC2 3NX0A 1UCKA 3KSPA 2W56B 3SOYA 1RTUA 1UGIA 1BNEA 3N54B 3WA2X 1Q864 2CWVA 3U1WA 2SBLA 4O8SA 4OUQA 1GY7A 2OWPA 1GYBA 1X1YA 2XGNA 3HX8A 5IF6A 2K3DA 3JVCA 2FNQA 1AVLA 4N6LA 1PFPA 3FF2A 5EQLA 4MEIA 3RDEA 5AIGA 3BNEA 1NB3I 2R41A 3ECFA 3D9RA 4H61A 4X2OA 1Q40B 1SIHA 4O2HA 1O7GB 5KP4A 3AGNA 2BHMA 4BTWA 2F4YA 3K9MC 2F98A 1KQS2 2CWTA 1RJOA 1MWSA 1BIRA 1JB5A 1JB4A 4XDWA 4R9LA 1EA2A 3JUQA 4N3VA 1ZS7A 1ULIB 4J5GA 1TU5A 1N5HA 2BNGA 3CCQ3 2QGUA 1J2BA 1VQQA 2KAAA 1E3RA 1Q9EA 1GSPA 3BNCA 4MMYB 2CC3A 1R4CA 4FCMA 1QMAA 1BSEA 1K41A 1UUWB 2W2CA 3OWSA 2AAEA 4BTYA 2GEXA 2BU4A 2BT3A 2CW9A 4HM8B 3S27A 3JUNA 5IEPA 3OV4A 4XDVA 1S723 2ZDJA 1TP6A 1HZ1A 2OTL3 1SIIA 2WGQA 3GZBA 1YIJ3 1KD14 2P0MA 3G8ZA 1RNTA 1W02A 3FCSB 1BRGA 2ML5A 3X3ZA 1Q40A 3CCE3 1LOXA 3NM2A 2KF5A 3QRDA 4N6UA 3AMOB 2Y73A 1UI8A 2IUKA 3WHOA 1BGSA 1OACA 1TIJA 5IW9A 3N9HA 3F7SA 1GD3A 1VQ63 4KFEA 4WYKA 1BANA 1OPYA 3O8YA 1N5PA 1HKXA 1O7PB 3RNTA 4BTXA 4R4KA 1MGRA 1FGOA 6RNTA 1IV7A 4WWUC 5IG5A 1JBSA 5FW5A 4HM6B 2L4VA 4HBRA 2P38A 1UDII 2HMJB 1MWTA 2ZHXB 2J8XB 2MC8A 3DGLA 3Q90A 3IJEB 5IERA 1YJW3 1Q7HA 1I0VA 4RNYA 5IG3A 1IQYA 4EXRA 1VQM3 1JZDA 1A2PA 2RBIA 2XH9A 3F8XA 4EYCA 3S5CA 3K0ZA 3NUVA 3NV0A 4JRFA 1SJWA 1IVUA 1QJGA 3I0YA 1UI7A 4X2HA 1BRJA 2PZVA 2UGIA 3NBRA 3BNBA 4N6V0 1EEJA 1AV4A 5AIIA 2IUJA 3CCS3 1YHQ3 5I97A 1I3IA 1PY3A 1T2HA 1UCJA 2YFLB 4J5KA 4K1VA 4DKIA 3ZG5A 1EQKA 2XF3A 1GS3A 1BNJA 1UCLA 2H0IA 4J8TA 1FGRA 5G2GA 4HM5B 4K90B 4I4KA 3BNDA 3KE7A 3KIIA 3Q1CA 1N9EA 1I70A 1A2VA 1OGXA 3F40A 4BL2A 1RGEA 2KF4A 1DMQA 4IT7A 2Z77A 1CQSA 1K8A4 3DY5A 1ROVA 7RNTA 3STDA 3G6E3 1V58A 1RKYA 2CK3H 1YJ93 1ULJB 3H3HA 4CJNA 2R4IA 1O7WB 4ZM8A 3Q3FA 3DGMA 3F8HA 1GY5A 3BB9A 1BSDA 1KSIA 2W04A 3KZTA 2BMQB 3GRDA 1JN5A 2D1WA 1C54A 3CCJ3 1W5ZA 3NBBA 1VZZA 5DREA 2W9PA 1B3SA 1I2FA 1U5OA 2HOHA 2P0XA 3X3YA 1ISKA 4LEHA 1MGWA 2Z7AA 3S28A 1DE3A 3CNMA 5IENA 1JBRA 1D6ZA 3N8BA 1SPUA 4GSPA 5AYRB 3SOAA 4L7KA 2OTJ3 4LYLB 1PYLA 1RRLA 1UW1A 4XBYA 1BRHA 1BSAA 5IG4A 1RGGA 1BUQA 4MJDA 2W6JH 3MWZA 1IT7A 3K5TA 3EQQB 2C4BA 2XR8B 1BSCA 1LOWA 1CYVA 1YGWA 2CFKA 3UL5A 1GOVA 2V1LA 1OH0A 1FGTA 2GU3A 2Z6BA 1RGFA 1LXEA 1B21A 3NM7A 4HYZA 1IV9A 2CH9A 1IQ8A 3GAXA 1W2ZA 2IYJA 5FGOA 3U97A 1GY6A 4JF8A 5EVHA 1BRNL 5BIRA 2OOVC 1TFOA 1WMPA 4HM7B 5CXOA 3RGRA 1AY7A 1D6UA 5STDA 4AKYA 1MWUA 3PS8A 1VQ93 2PNCA 1B2ZA 1S5AA 3V92A 5BU4A 3PXMA 1T2IA 1TUHA 4R80A 4K1UA 3EBTA 3V98A 3WA3A 1Y4KA 4CPKA 4NPBA 1T5YA 3K63A 4ILFA 1A2KA 3CPOA 3HIGA 2YFIB 3B7CA 3LT9A 2RGQA 1G02A 4KFFA 5EEOA 1WTHA 1G0TA 4RZMA 1L5GB 2Y74A 3FLJA 1WQLB 3G713 1ASKA 2HMKB 4WYKB 3NHXA 3WR2A 1VQ43 3WMDA 2CIUA 3PCSA 1GOYA 2F86B 3GWRA 5M19A 2GSPA 1VQP3 3VF1A 4WFOA 1NO3A 1NB5I 1SARA 3EN1B 2LQVA 2E2VA 3DGNA 3DXOA 5RNTA 2WOFA 1V57A 2CFWA 3OWUA 1X1WA 5BVBA 5ELUA 1AVKA 3HOHA 3NV0B 3LH4A 3D3LA 1HU9A 4KZ1A 3HK4A 3G4S3 2P09A 1TFKA 2FGTA 4MMZB 4XBXA 1UCIA 2XEPA 1Q824 3Q2PA 1TRQA 3BLZA 1W6GA 4LSOA 1B27A 3SVAA 1I8VA 3X40A 2HMMB 4N6TA 1OF5A 1FW7A 1BRSA 2YX9A 3AHSA 3VGNA 4HM0B 1M9GA 1MNLA 2OOVA 3SEDA 2C10A 3AGOA 3NQZA 1VQ73 3CMA3 3DGYA 2H0HA 2FXTA 1QALA 5AEWB 1Q7Y4 1JV2B 4HZBB 1UUVB 3DUKA 1A90A 1UGHI 1TTOA 5JBSA 3F7XA 1QVF2 3GZYB 3FZWA 1KWIA 3LTBA 4HM1B 4PEJA 3WDGB 1GMPA 1X1XA 3FGYA 1NJI4 1LVNA 3HIIA 2IMJA 1NWWA 1JNQA 5AIFA 1JN5B 1DMMA 3F9SA 4L8PA 2CX0A 2YFJB 1M1K4 1LRAA 3L0RA 1LQGC 1RRHA 1OHOA 1N8QA 5D82A 3E99A 2JQ5A 3V99A 3ER7A 4RBNA 3A5EA 4HZ9B 3IMAB 3K7CA 2WO0A 1O7NB 3EX9A 4EV2A 1HYFA 2XRXB 2RFRA 3GZXB 3CME3 3SX1A 4FCZA 3VSYA 1VQ83 1LNIA 1BNFA 1D6YA 1IK3A 1RN4A 2F99A 4O3VA 3B4OA 3MSOA 2B1XB 2BIRA 2HMLB 1OCVA 1AQZA 4STDA 1E97A 4RNTA 2F56A 3JUOA 3CU3A 4FMCA 4KVHA 3OXAA 4GB5A 4BU4A 2D42A 1IVWA 2AADA 3F14A 2CWUA 2OQEA 1I2GA 3OWYA 3PCRA 1U8CB 4HOHA 3UNLA 1EKMA 2RSXA 3B8LA 3X41A 2E2TA 3T8NA 2KRTA 1W00A 3JUPA 2ML6A 3OW22 1BNGA 3DGOA 5CF1A 4HM3B 5ELJA 8RNTA 1DETA 1OUNA 2IY2A 2KF3A 5KP3A 5TGNA 3KKGA 1JKGA 1RNBA 1RGLA 3AHWA 1IYYA 1B2MA 4R9KA 3M8CA 2B24B 4HM2B 3CC43 4HM4B 3OX9A 1FZUA 1QAFA 1NNVA 2I9WA 2UX0A 2QA43 3QK9A 1W2B2 1V74A 1VQ53 3T0UA 1ZO2A 1STFI 2CKFB 3DZLA 2P05A 3S67A 1RGCA 3B4PA 2O3OA 4HAAA 1EUIC 3D5IA 2O9UX 4N6OB 5AEUB 2RCDA 3HI7A 3EC9A 1FGQA 5KP1A 2BMOB 2C11A 2HMNB 3EN8A 3MHEA 3CC73 2OCTA 1B2XA 4NREA 1CYUA 1T3BA 2WGOA 3LOYA 2XSOB 4HVNA 2K54A 1B2UA 3LTCA 3CCM3 1DYUA 1LQMB 1TJDA 1STDA 3BIRA 4OK0A 4EC6A 4FCJA 1C7HA 1R4YA 2CFLA 1BNSA 4IPBA 1DVDA 3CPW2 3LYGA 3URPA 3EF8A 3EJVA 3FF0A 3GZRA 1K28A 1GOUA 4FMDA 3A76A 1M1XB 1X1UA 1RSNA 2WOHA 1VQL3 4LGQA 3NQYA 4EV5A 3SLUA 4K61A 3PYJA 2A15A 1OF5B 3CCU3 1VQO3 1K9M4 1FUTA 3WOFB 1YJN3 2E2UA 1RCLA 5A0OB 2ZA4A 2RNTA 1B20A 1WNHA 2M7OA 3NBJA 1Q814 1LOYA 3G0KA 3LTAA 2SARA 3T8UA 4ORLA 1YVSA 1BU4A 3JUMA 2QIYA 3MKIA 4FR9A 2STDA 5DRVA 1IU7A 2XFTA 1GMRA 4WP5A 1BRIA 3DH2A 3S29A 3FKAA 1LOVA 4FMAA 1RN1A 1W6CA 4AEQA 2QEX3 2H0GA 1N9JA 1RDSA 4MMXB 3LXUX 3ZFZA 3RGAA 1GD4A 2CX1A 4AKZA 3DM8A 4KFDA 4TX4A 3D79A 5LC6A 1I0XA 1FGMA 2W03A 4BL3A 5CF2A 2W0QA 2XGLA 3KFQC 4LMIA 2IA7A 2OQEC 4EBGA 1IVXA 2JDIH 5CLKA 2CG1A 2GEYA 2L1SA 2W56A 3ALAA 3UJMA 3KN4A 1BUJA 2CFDA 3CNXA 4QWTA 3J7Yd 1OHSA 1RGAA 4HKVB 3X3XA 1N8R4 1AR0A 1O7HB 4H3UA 1JB2A 3LZAA 3BU4A 1BSBA 3H51A 1BOXA 4XM4A 3UL6A 2LYXA 2CHCA 3D5GA 5HOHA 1DMNA 4EW5A 6STDA 1YIT3 2MF7A 5G1KA 3HZPA 5M1AA 1G96A 2GBWB 1W6YA 1JRQA 1K734 5IG0A 3EHCA 8CHOA 2KF6A 3LT8A 1GMQA 2XSHB 4Q53A 7STDA 2BMRB 1W4NA 1CEWI 3ROBA 5AIHA 5JPUA 2GBXB 3IPTA 1VQN3 3CCL3 4KT3B 3NXJA 3UB1A 1JKGB 5AYSC 1IT8A 1BRKA 1WMNA 3DMCA 1IVVA 1OGZA 1RGKA 3FSDA 4N6MA 3MG1A 4I5QA 5LC7A 1MOLA 1RCKA 3MG2A 1WMOA 1US1A 1RHLA 3FG1A 1RLSA 1SQWA 2CG0A 1FUWA 2F5MA 4GHOA 1Z1SA 1VQK3 1FYSA 2W9QA 1BAOA 4NHFA 1UUGB 1YVBI 5AI1A 3TDGA 4N6NB 1PU4A 1QVG2 1W7CA 3PZWA 5G1LA 5HGRA 4U13A 4OVMA 1MWRA 4O02B 4XBTA 4CCVA 3CCR3 2KXGA 3KCHA 1E3VA 3G16A 4WHAA 5BXQA 3AMOA 2XFSA 2GXFA 3LMLA 5D83A 3I563 1B2SA 1RN7A 3GSPA 1BNRA 1LNHA 5IEOA 1CH0A 4IIAA 4LZIA 4CDLA 3I553 3ZG0A 2UUGC 4R1KA 1A67A 4BIRA 3PGBA 3MG3A 2GU1A 1NDOB 1IQXA 3WOEB 1JZOA 1FA3A 3FG4A 4L8OA 1YNVX 1OHPA 2INXA 1KC84 3D4AA 3EBYA 3X42A 3CC23 1NU3A 1YI23 1DVCA 3MYTA 1ZX2A 4HJLB 1ROAA 2HMOB 3EB8A 3CCV3 3MPHA 1YGEA 2Z76A 1I2EA 5D81A 2F5WA 3EE1A 3LTDA 3KSED 6GSPA 7GSPA 2Q07A 1TRPA 1M904
chains in the Genus database with same CATH topology
2CFGA 1IDPA 3WODG 1Q42A 4FMBA 2ZL8A 3CD63 1QAKA 3FH1A 4XB5A 2K0MA 5JPPA 2KCDA 4GL6A 1EG9B 1O7MB 1F8NA 1JJ22 4RNZA 3CXC2 5CK6A 3SXXA 1W01A 3FG3A 4G1MB 4J9AA 3NX0A 3KSPA 2W56B 3SOYA 3N54B 3WA2X 1Q864 2CWVA 3U1WA 2SBLA 4O8SA 4OUQA 1GY7A 2OWPA 1GYBA 2XGNA 3HX8A 5IF6A 3JVCA 2FNQA 1AVLA 4N6LA 1PFPA 3FF2A 5EQLA 4MEIA 3RDEA 5AIGA 3BNEA 1NB3I 3ECFA 3D9RA 4H61A 4X2OA 1Q40B 1SIHA 4O2HA 1O7GB 5KP4A 2BHMA 4BTWA 3K9MC 2F98A 1KQS2 2CWTA 1RJOA 1JB5A 1JB4A 4XDWA 4R9LA 1EA2A 3JUQA 4N3VA 1ULIB 1TU5A 1N5HA 2BNGA 3CCQ3 2QGUA 1J2BA 1E3RA 3BNCA 4MMYB 2CC3A 1R4CA 4FCMA 1QMAA 1K41A 1UUWB 2W2CA 3OWSA 4BTYA 2GEXA 2BT3A 2CW9A 4HM8B 3S27A 3JUNA 5IEPA 3OV4A 4XDVA 1S723 2ZDJA 1TP6A 2OTL3 1SIIA 2WGQA 3GZBA 1YIJ3 1KD14 2P0MA 3G8ZA 1W02A 3FCSB 2ML5A 3X3ZA 1Q40A 3CCE3 1LOXA 3NM2A 3QRDA 4N6UA 3AMOB 2Y73A 1UI8A 2IUKA 1OACA 1TIJA 5IW9A 3N9HA 3F7SA 1GD3A 1VQ63 4KFEA 4WYKA 1OPYA 3O8YA 1N5PA 1HKXA 1O7PB 4BTXA 4R4KA 5IG5A 1FGOA 1IV7A 4WWUC 5FW5A 4HM6B 2L4VA 4HBRA 2P38A 2HMJB 2MC8A 3DGLA 3Q90A 3IJEB 5IERA 1YJW3 4RNYA 5IG3A 1IQYA 4EXRA 1VQM3 2XH9A 3F8XA 4EYCA 3S5CA 3K0ZA 3NUVA 3NV0A 4JRFA 1SJWA 1IVUA 1QJGA 3I0YA 1UI7A 4X2HA 2PZVA 3NBRA 5AIIA 2IUJA 3BNBA 4N6V0 3CCS3 1AV4A 1YHQ3 5I97A 2YFLB 4K1VA 1EQKA 2XF3A 1GS3A 5G2GA 4J8TA 1FGRA 4HM5B 4K90B 4I4KA 3BNDA 3KE7A 3KIIA 3Q1CA 1N9EA 1A2VA 1OGXA 3F40A 1DMQA 4IT7A 2Z77A 1CQSA 1K8A4 3DY5A 1ROVA 3STDA 3G6E3 1RKYA 2CK3H 1YJ93 1ULJB 3H3HA 2R4IA 1O7WB 4ZM8A 3DGMA 3F8HA 1GY5A 3BB9A 1KSIA 2W04A 3KZTA 2BMQB 3GRDA 1JN5A 2D1WA 3CCJ3 1W5ZA 3NBBA 1VZZA 5DREA 2W9PA 1U5OA 2P0XA 3X3YA 1ISKA 4LEHA 2Z7AA 3S28A 3CNMA 5IENA 1D6ZA 3N8BA 1SPUA 5AYRB 3SOAA 2OTJ3 4L7KA 1RRLA 1UW1A 4XBYA 5IG4A 1BUQA 4MJDA 2W6JH 3MWZA 1IT7A 3K5TA 3EQQB 2XR8B 1CYVA 2CFKA 3UL5A 2V1LA 1OH0A 1FGTA 2GU3A 2Z6BA 3NM7A 1LXEA 4HYZA 1IV9A 2CH9A 1IQ8A 3GAXA 1W2ZA 5FGOA 3U97A 1GY6A 4JF8A 5EVHA 2OOVC 1TFOA 1WMPA 4HM7B 5CXOA 3RGRA 4AKYA 1D6UA 5STDA 3PS8A 1VQ93 2PNCA 1S5AA 3V92A 3PXMA 1TUHA 4R80A 4K1UA 3EBTA 3V98A 3WA3A 1Y4KA 1T5YA 3K63A 1A2KA 3CPOA 3HIGA 2YFIB 3B7CA 3LT9A 2RGQA 4KFFA 5EEOA 1WTHA 4RZMA 1L5GB 2Y74A 3FLJA 1WQLB 3G713 1ASKA 2HMKB 4WYKB 3NHXA 1VQ43 3WMDA 2CIUA 3PCSA 2F86B 3GWRA 1VQP3 3VF1A 4WFOA 1NO3A 1NB5I 3EN1B 2LQVA 2E2VA 3DGNA 3DXOA 2WOFA 2CFWA 3OWUA 5BVBA 5ELUA 1AVKA 3NV0B 3LH4A 3D3LA 1HU9A 4KZ1A 3HK4A 3G4S3 2P09A 1TFKA 2FGTA 4MMZB 4XBXA 2XEPA 1Q824 3Q2PA 3BLZA 1W6GA 4LSOA 3SVAA 3X40A 2HMMB 4N6TA 1OF5A 2YX9A 3VGNA 4HM0B 1M9GA 1MNLA 2OOVA 3SEDA 2C10A 1VQ73 3NQZA 3CMA3 2FXTA 1QALA 5AEWB 1Q7Y4 1JV2B 4HZBB 1UUVB 3DUKA 1A90A 5JBSA 3F7XA 1QVF2 3GZYB 3FZWA 1KWIA 3LTBA 4HM1B 4PEJA 3WDGB 1NJI4 3FGYA 1LVNA 3HIIA 2IMJA 1NWWA 1JNQA 5AIFA 1JN5B 1DMMA 3F9SA 4L8PA 2YFJB 1M1K4 3L0RA 1RRHA 1OHOA 1N8QA 5D82A 3E99A 2JQ5A 3V99A 3ER7A 4RBNA 4HZ9B 3IMAB 3K7CA 2WO0A 1O7NB 3EX9A 4EV2A 2XRXB 2RFRA 3GZXB 3CME3 3SX1A 4FCZA 3VSYA 1VQ83 1D6YA 1IK3A 2F99A 4O3VA 3B4OA 3MSOA 2B1XB 2HMLB 1OCVA 4STDA 1E97A 3JUOA 3CU3A 4FMCA 4KVHA 3OXAA 4GB5A 2D42A 1IVWA 3F14A 2CWUA 2OQEA 3PCRA 3OWYA 1U8CB 3UNLA 1EKMA 2RSXA 3B8LA 3X41A 2E2TA 3T8NA 2KRTA 1W00A 3JUPA 2ML6A 3OW22 3DGOA 5CF1A 4HM3B 5ELJA 1OUNA 5TGNA 5KP3A 3KKGA 1JKGA 4R9KA 3M8CA 2B24B 4HM2B 3CC43 4HM4B 3OX9A 1QAFA 2UX0A 2I9WA 2QA43 3QK9A 1W2B2 1V74A 1VQ53 3T0UA 1ZO2A 1STFI 2CKFB 3DZLA 2P05A 3S67A 3B4PA 2O3OA 4N6OB 5AEUB 2O9UX 2RCDA 3HI7A 3EC9A 1FGQA 5KP1A 2BMOB 2C11A 2HMNB 3EN8A 3MHEA 3CC73 2OCTA 4NREA 1CYUA 2WGOA 3LOYA 2XSOB 4HVNA 2K54A 3LTCA 3CCM3 1DYUA 4OK0A 1STDA 4EC6A 4FCJA 1C7HA 2CFLA 4IPBA 1DVDA 3CPW2 3LYGA 3EF8A 3EJVA 3FF0A 3GZRA 1K28A 4FMDA 3A76A 1M1XB 2WOHA 1VQL3 4LGQA 3NQYA 4EV5A 3SLUA 4K61A 3PYJA 2A15A 1OF5B 3CCU3 1VQO3 1K9M4 3WOFB 1YJN3 2E2UA 5A0OB 1WNHA 3NBJA 2M7OA 1Q814 3LTAA 3G0KA 3T8UA 4ORLA 3JUMA 4FR9A 2QIYA 3MKIA 2STDA 5DRVA 1IU7A 2XFTA 4WP5A 3S29A 3FKAA 4FMAA 1W6CA 2QEX3 4AEQA 1N9JA 4MMXB 3LXUX 3RGAA 1GD4A 4AKZA 3DM8A 4KFDA 4TX4A 5LC6A 1FGMA 2W03A 5CF2A 2W0QA 2XGLA 3KFQC 4LMIA 2IA7A 2OQEC 4EBGA 1IVXA 2JDIH 5CLKA 2CG1A 2GEYA 2W56A 3ALAA 3UJMA 3KN4A 2CFDA 3CNXA 4QWTA 3J7Yd 1OHSA 4HKVB 3X3XA 1N8R4 1AR0A 1O7HB 4H3UA 1JB2A 3LZAA 3H51A 3UL6A 4XM4A 2LYXA 2CHCA 1DMNA 6STDA 1YIT3 2MF7A 3HZPA 1G96A 2GBWB 1W6YA 1JRQA 1K734 5IG0A 3EHCA 8CHOA 3LT8A 2XSHB 4Q53A 7STDA 2BMRB 1W4NA 1CEWI 3ROBA 5AIHA 5JPUA 2GBXB 3IPTA 1VQN3 3CCL3 3NXJA 3UB1A 1JKGB 5AYSC 1IT8A 1WMNA 3DMCA 1IVVA 1OGZA 3FSDA 4N6MA 3MG1A 5LC7A 1MOLA 3MG2A 1WMOA 1US1A 3FG1A 1SQWA 2CG0A 1FUWA 1Z1SA 1VQK3 2W9QA 4NHFA 1YVBI 5AI1A 3TDGA 4N6NB 1PU4A 1QVG2 1W7CA 3PZWA 5HGRA 4U13A 4OVMA 4XBTA 4O02B 4CCVA 3CCR3 2KXGA 1E3VA 3G16A 4WHAA 5BXQA 3AMOA 2XFSA 2GXFA 3LMLA 5D83A 3I563 1RN7A 1LNHA 5IEOA 4IIAA 4LZIA 4CDLA 3I553 4R1KA 1A67A 3PGBA 3MG3A 2GU1A 1NDOB 1IQXA 3WOEB 1FA3A 3FG4A 4L8OA 2INXA 1OHPA 1KC84 3EBYA 3X42A 3CC23 1NU3A 1YI23 1DVCA 3MYTA 1ZX2A 4HJLB 1ROAA 2HMOB 3EB8A 3CCV3 3MPHA 1YGEA 2Z76A 5D81A 3EE1A 3LTDA 3KSED 2Q07A 2BO9B 1M904
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDP A;  1Q42 A;  4XB5 A;  3FH1 A;  5JPP A;  1EG9 B;  1O7M B;  5CK6 A;  1W01 A;  4J9A A;  3KSP A;  3SOY A;  4OUQ A;  1GY7 A;  2OWP A;  1GYB A;  3HX8 A;  5IF6 A;  3FF2 A;  5AIG A;  3ECF A;  3D9R A;  4X2O A;  1Q40 B;  1O7G B;  5KP4 A;  2F98 A;  1JB5 A;  1JB4 A;  4XDW A;  4R9L A;  1EA2 A;  3JUQ A;  4N3V A;  1ULI B;  2BNG A;  2QGU A;  1E3R A;  4FCM A;  1QMA A;  1K41 A;  1UUW B;  2W2C A;  3OWS A;  2GEX A;  4HM8 B;  3JUN A;  5IEP A;  3OV4 A;  4XDV A;  1TP6 A;  3GZB A;  3G8Z A;  1W02 A;  1Q40 A;  3NM2 A;  3F7S A;  4WYK A;  1OPY A;  1O7P B;  1HKX A;  5IG5 A;  4WWU C;  5FW5 A;  4HM6 B;  2HMJ B;  5IER A;  3Q90 A;  5IG3 A;  3F8X A;  3S5C A;  3K0Z A;  3NUV A;  3NV0 A;  1SJW A;  1QJG A;  3I0Y A;  4X2H A;  2PZV A;  3NBR A;  5AII A;  2YFL B;  4K1V A;  1GS3 A;  5G2G A;  4J8T A;  4HM5 B;  4I4K A;  3KE7 A;  1OGX A;  3F40 A;  1DMQ A;  2Z77 A;  1CQS A;  3STD A;  1ULJ B;  3H3H A;  2R4I A;  1O7W B;  3F8H A;  1GY5 A;  3BB9 A;  3KZT A;  2BMQ B;  3GRD A;  1JN5 A;  1VZZ A;  5DRE A;  1U5O A;  1ISK A;  4LEH A;  2Z7A A;  3CNM A;  5IEN A;  3SOA A;  4L7K A;  4XBY A;  5IG4 A;  1BUQ A;  4MJD A;  3EQQ B;  2XR8 B;  1OH0 A;  1GY6 A;  5EVH A;  3RGR A;  4HM7 B;  5CXO A;  5STD A;  1S5A A;  1TUH A;  4K1U A;  3EBT A;  1A2K A;  3CPO A;  2YFI B;  3B7C A;  2RGQ A;  4RZM A;  3FLJ A;  1WQL B;  1ASK A;  2HMK B;  4WYK B;  3NHX A;  3WMD A;  2F86 B;  3GWR A;  3EN1 B;  3DXO A;  3OWU A;  5BVB A;  3NV0 B;  3HK4 A;  4XBX A;  3BLZ A;  2HMM B;  1OF5 A;  3VGN A;  4HM0 B;  3SED A;  5AEW B;  4HZB B;  1UUV B;  3DUK A;  3F7X A;  3GZY B;  3FZW A;  4HM1 B;  4PEJ A;  3FGY A;  2IMJ A;  1NWW A;  5AIF A;  1JN5 B;  1DMM A;  3F9S A;  4L8P A;  2YFJ B;  1OHO A;  5D82 A;  3E99 A;  2JQ5 A;  3ER7 A;  4HZ9 B;  3K7C A;  1O7N B;  3EX9 A;  2XRX B;  2RFR A;  3GZX B;  3VSY A;  2F99 A;  3B4O A;  3MSO A;  2B1X B;  2HML B;  1OCV A;  4STD A;  1E97 A;  3JUO A;  3CU3 A;  4KVH A;  3OXA A;  4GB5 A;  3F14 A;  3OWY A;  3UNL A;  3B8L A;  3T8N A;  1W00 A;  3JUP A;  5CF1 A;  4HM3 B;  1OUN A;  5TGN A;  5KP3 A;  3KKG A;  1JKG A;  4R9K A;  3M8C A;  2B24 B;  4HM2 B;  4HM4 B;  3OX9 A;  2UX0 A;  2I9W A;  1ZO2 A;  2CKF B;  3DZL A;  3B4P A;  5AEU B;  2RCD A;  3EC9 A;  5KP1 A;  2BMO B;  3EN8 A;  2HMN B;  3MHE A;  2XSO B;  4HVN A;  2K54 A;  1STD A;  4FCJ A;  1C7H A;  3LYG A;  3EF8 A;  3EJV A;  3FF0 A;  3GZR A;  3A76 A;  4LGQ A;  2A15 A;  1OF5 B;  3G0K A;  3T8U A;  4ORL A;  3JUM A;  2QIY A;  3MKI A;  2STD A;  5DRV A;  4WP5 A;  3FKA A;  3RGA A;  3DM8 A;  5CF2 A;  4LMI A;  5CLK A;  2GEY A;  3UJM A;  3CNX A;  1OHS A;  4HKV B;  1AR0 A;  1O7H B;  4H3U A;  1JB2 A;  3LZA A;  3H51 A;  4XM4 A;  2CHC A;  1DMN A;  6STD A;  3HZP A;  2GBW B;  1W6Y A;  5IG0 A;  3EHC A;  8CHO A;  2XSH B;  4Q53 A;  7STD A;  2BMR B;  3ROB A;  5JPU A;  5AIH A;  2GBX B;  3IPT A;  3NXJ A;  1JKG B;  3DMC A;  1OGZ A;  3FSD A;  3MG1 A;  3MG2 A;  1Z1S A;  5AI1 A;  5HGR A;  4U13 A;  4OVM A;  4XBT A;  1E3V A;  3G16 A;  5BXQ A;  2GXF A;  5D83 A;  5IEO A;  4IIA A;  4CDL A;  4R1K A;  3MG3 A;  1NDO B;  4L8O A;  2INX A;  1OHP A;  3EBY A;  1NU3 A;  3MYT A;  1ZX2 A;  4HJL B;  2HMO B;  2Z76 A;  5D81 A; 
#chains in the Genus database with same CATH topology
 1FUS A;  1BNI A;  2CFG A;  1IDP A;  3SYU A;  3WOD G;  5M18 A;  1RMS A;  1Q42 A;  4FMB A;  2ZL8 A;  3CD6 3;  1QAK A;  2BO9 B;  3FH1 A;  2K0M A;  4XB5 A;  1RGH A;  2KCD A;  5JPP A;  1JBT A;  1ZGX A;  4GL6 A;  5GSP A;  1EG9 B;  1O7M B;  9RNT A;  1F8N A;  1I3F A;  1JJ2 2;  1BVI A;  4RNZ A;  5CK6 A;  3SXX A;  1W01 A;  3FG3 A;  4G1M B;  4J9A A;  3CXC 2;  3NX0 A;  1UCK A;  3KSP A;  2W56 B;  3SOY A;  1RTU A;  1UGI A;  1BNE A;  3N54 B;  3WA2 X;  1Q86 4;  2CWV A;  3U1W A;  2SBL A;  4O8S A;  4OUQ A;  1GY7 A;  2OWP A;  1GYB A;  1X1Y A;  2XGN A;  3HX8 A;  5IF6 A;  2K3D A;  3JVC A;  2FNQ A;  1AVL A;  4N6L A;  1PFP A;  3FF2 A;  5EQL A;  4MEI A;  3RDE A;  5AIG A;  3BNE A;  1NB3 I;  2R41 A;  3ECF A;  3D9R A;  4H61 A;  4X2O A;  1Q40 B;  1SIH A;  4O2H A;  1O7G B;  5KP4 A;  3AGN A;  2BHM A;  4BTW A;  2F4Y A;  3K9M C;  2F98 A;  1KQS 2;  2CWT A;  1RJO A;  1MWS A;  1BIR A;  1JB5 A;  1JB4 A;  4XDW A;  4R9L A;  1EA2 A;  3JUQ A;  4N3V A;  1ZS7 A;  1ULI B;  4J5G A;  1TU5 A;  1N5H A;  2BNG A;  3CCQ 3;  2QGU A;  1J2B A;  1VQQ A;  2KAA A;  1E3R A;  1Q9E A;  1GSP A;  3BNC A;  4MMY B;  2CC3 A;  1R4C A;  4FCM A;  1QMA A;  1BSE A;  1K41 A;  1UUW B;  2W2C A;  3OWS A;  2AAE A;  4BTY A;  2GEX A;  2BU4 A;  2BT3 A;  2CW9 A;  4HM8 B;  3S27 A;  3JUN A;  5IEP A;  3OV4 A;  4XDV A;  1S72 3;  2ZDJ A;  1TP6 A;  1HZ1 A;  2OTL 3;  1SII A;  2WGQ A;  3GZB A;  1YIJ 3;  1KD1 4;  2P0M A;  3G8Z A;  1RNT A;  1W02 A;  3FCS B;  1BRG A;  2ML5 A;  3X3Z A;  1Q40 A;  3CCE 3;  1LOX A;  3NM2 A;  2KF5 A;  3QRD A;  4N6U A;  3AMO B;  2Y73 A;  1UI8 A;  2IUK A;  3WHO A;  1BGS A;  1OAC A;  1TIJ A;  5IW9 A;  3N9H A;  3F7S A;  1GD3 A;  1VQ6 3;  4KFE A;  4WYK A;  1BAN A;  1OPY A;  3O8Y A;  1N5P A;  1HKX A;  1O7P B;  3RNT A;  4BTX A;  4R4K A;  1MGR A;  1FGO A;  6RNT A;  1IV7 A;  4WWU C;  5IG5 A;  1JBS A;  5FW5 A;  4HM6 B;  2L4V A;  4HBR A;  2P38 A;  1UDI I;  2HMJ B;  1MWT A;  2ZHX B;  2J8X B;  2MC8 A;  3DGL A;  3Q90 A;  3IJE B;  5IER A;  1YJW 3;  1Q7H A;  1I0V A;  4RNY A;  5IG3 A;  1IQY A;  4EXR A;  1VQM 3;  1JZD A;  1A2P A;  2RBI A;  2XH9 A;  3F8X A;  4EYC A;  3S5C A;  3K0Z A;  3NUV A;  3NV0 A;  4JRF A;  1SJW A;  1IVU A;  1QJG A;  3I0Y A;  1UI7 A;  4X2H A;  1BRJ A;  2PZV A;  2UGI A;  3NBR A;  3BNB A;  4N6V 0;  1EEJ A;  1AV4 A;  5AII A;  2IUJ A;  3CCS 3;  1YHQ 3;  5I97 A;  1I3I A;  1PY3 A;  1T2H A;  1UCJ A;  2YFL B;  4J5K A;  4K1V A;  4DKI A;  3ZG5 A;  1EQK A;  2XF3 A;  1GS3 A;  1BNJ A;  1UCL A;  2H0I A;  4J8T A;  1FGR A;  5G2G A;  4HM5 B;  4K90 B;  4I4K A;  3BND A;  3KE7 A;  3KII A;  3Q1C A;  1N9E A;  1I70 A;  1A2V A;  1OGX A;  3F40 A;  4BL2 A;  1RGE A;  2KF4 A;  1DMQ A;  4IT7 A;  2Z77 A;  1CQS A;  1K8A 4;  3DY5 A;  1ROV A;  7RNT A;  3STD A;  3G6E 3;  1V58 A;  1RKY A;  2CK3 H;  1YJ9 3;  1ULJ B;  3H3H A;  4CJN A;  2R4I A;  1O7W B;  4ZM8 A;  3Q3F A;  3DGM A;  3F8H A;  1GY5 A;  3BB9 A;  1BSD A;  1KSI A;  2W04 A;  3KZT A;  2BMQ B;  3GRD A;  1JN5 A;  2D1W A;  1C54 A;  3CCJ 3;  1W5Z A;  3NBB A;  1VZZ A;  5DRE A;  2W9P A;  1B3S A;  1I2F A;  1U5O A;  2HOH A;  2P0X A;  3X3Y A;  1ISK A;  4LEH A;  1MGW A;  2Z7A A;  3S28 A;  1DE3 A;  3CNM A;  5IEN A;  1JBR A;  1D6Z A;  3N8B A;  1SPU A;  4GSP A;  5AYR B;  3SOA A;  4L7K A;  2OTJ 3;  4LYL B;  1PYL A;  1RRL A;  1UW1 A;  4XBY A;  1BRH A;  1BSA A;  5IG4 A;  1RGG A;  1BUQ A;  4MJD A;  2W6J H;  3MWZ A;  1IT7 A;  3K5T A;  3EQQ B;  2C4B A;  2XR8 B;  1BSC A;  1LOW A;  1CYV A;  1YGW A;  2CFK A;  3UL5 A;  1GOV A;  2V1L A;  1OH0 A;  1FGT A;  2GU3 A;  2Z6B A;  1RGF A;  1LXE A;  1B21 A;  3NM7 A;  4HYZ A;  1IV9 A;  2CH9 A;  1IQ8 A;  3GAX A;  1W2Z A;  2IYJ A;  5FGO A;  3U97 A;  1GY6 A;  4JF8 A;  5EVH A;  1BRN L;  5BIR A;  2OOV C;  1TFO A;  1WMP A;  4HM7 B;  5CXO A;  3RGR A;  1AY7 A;  1D6U A;  5STD A;  4AKY A;  1MWU A;  3PS8 A;  1VQ9 3;  2PNC A;  1B2Z A;  1S5A A;  3V92 A;  5BU4 A;  3PXM A;  1T2I A;  1TUH A;  4R80 A;  4K1U A;  3EBT A;  3V98 A;  3WA3 A;  1Y4K A;  4CPK A;  4NPB A;  1T5Y A;  3K63 A;  4ILF A;  1A2K A;  3CPO A;  3HIG A;  2YFI B;  3B7C A;  3LT9 A;  2RGQ A;  1G02 A;  4KFF A;  5EEO A;  1WTH A;  1G0T A;  4RZM A;  1L5G B;  2Y74 A;  3FLJ A;  1WQL B;  3G71 3;  1ASK A;  2HMK B;  4WYK B;  3NHX A;  3WR2 A;  1VQ4 3;  3WMD A;  2CIU A;  3PCS A;  1GOY A;  2F86 B;  3GWR A;  5M19 A;  2GSP A;  1VQP 3;  3VF1 A;  4WFO A;  1NO3 A;  1NB5 I;  1SAR A;  3EN1 B;  2LQV A;  2E2V A;  3DGN A;  3DXO A;  5RNT A;  2WOF A;  1V57 A;  2CFW A;  3OWU A;  1X1W A;  5BVB A;  5ELU A;  1AVK A;  3HOH A;  3NV0 B;  3LH4 A;  3D3L A;  1HU9 A;  4KZ1 A;  3HK4 A;  3G4S 3;  2P09 A;  1TFK A;  2FGT A;  4MMZ B;  4XBX A;  1UCI A;  2XEP A;  1Q82 4;  3Q2P A;  1TRQ A;  3BLZ A;  1W6G A;  4LSO A;  1B27 A;  3SVA A;  1I8V A;  3X40 A;  2HMM B;  4N6T A;  1OF5 A;  1FW7 A;  1BRS A;  2YX9 A;  3AHS A;  3VGN A;  4HM0 B;  1M9G A;  1MNL A;  2OOV A;  3SED A;  2C10 A;  3AGO A;  3NQZ A;  1VQ7 3;  3CMA 3;  3DGY A;  2H0H A;  2FXT A;  1QAL A;  5AEW B;  1Q7Y 4;  1JV2 B;  4HZB B;  1UUV B;  3DUK A;  1A90 A;  1UGH I;  1TTO A;  5JBS A;  3F7X A;  1QVF 2;  3GZY B;  3FZW A;  1KWI A;  3LTB A;  4HM1 B;  4PEJ A;  3WDG B;  1GMP A;  1X1X A;  3FGY A;  1NJI 4;  1LVN A;  3HII A;  2IMJ A;  1NWW A;  1JNQ A;  5AIF A;  1JN5 B;  1DMM A;  3F9S A;  4L8P A;  2CX0 A;  2YFJ B;  1M1K 4;  1LRA A;  3L0R A;  1LQG C;  1RRH A;  1OHO A;  1N8Q A;  5D82 A;  3E99 A;  2JQ5 A;  3V99 A;  3ER7 A;  4RBN A;  3A5E A;  4HZ9 B;  3IMA B;  3K7C A;  2WO0 A;  1O7N B;  3EX9 A;  4EV2 A;  1HYF A;  2XRX B;  2RFR A;  3GZX B;  3CME 3;  3SX1 A;  4FCZ A;  3VSY A;  1VQ8 3;  1LNI A;  1BNF A;  1D6Y A;  1IK3 A;  1RN4 A;  2F99 A;  4O3V A;  3B4O A;  3MSO A;  2B1X B;  2BIR A;  2HML B;  1OCV A;  1AQZ A;  4STD A;  1E97 A;  4RNT A;  2F56 A;  3JUO A;  3CU3 A;  4FMC A;  4KVH A;  3OXA A;  4GB5 A;  4BU4 A;  2D42 A;  1IVW A;  2AAD A;  3F14 A;  2CWU A;  2OQE A;  1I2G A;  3OWY A;  3PCR A;  1U8C B;  4HOH A;  3UNL A;  1EKM A;  2RSX A;  3B8L A;  3X41 A;  2E2T A;  3T8N A;  2KRT A;  1W00 A;  3JUP A;  2ML6 A;  3OW2 2;  1BNG A;  3DGO A;  5CF1 A;  4HM3 B;  5ELJ A;  8RNT A;  1DET A;  1OUN A;  2IY2 A;  2KF3 A;  5KP3 A;  5TGN A;  3KKG A;  1JKG A;  1RNB A;  1RGL A;  3AHW A;  1IYY A;  1B2M A;  4R9K A;  3M8C A;  2B24 B;  4HM2 B;  3CC4 3;  4HM4 B;  3OX9 A;  1FZU A;  1QAF A;  1NNV A;  2I9W A;  2UX0 A;  2QA4 3;  3QK9 A;  1W2B 2;  1V74 A;  1VQ5 3;  3T0U A;  1ZO2 A;  1STF I;  2CKF B;  3DZL A;  2P05 A;  3S67 A;  1RGC A;  3B4P A;  2O3O A;  4HAA A;  1EUI C;  3D5I A;  2O9U X;  4N6O B;  5AEU B;  2RCD A;  3HI7 A;  3EC9 A;  1FGQ A;  5KP1 A;  2BMO B;  2C11 A;  2HMN B;  3EN8 A;  3MHE A;  3CC7 3;  2OCT A;  1B2X A;  4NRE A;  1CYU A;  1T3B A;  2WGO A;  3LOY A;  2XSO B;  4HVN A;  2K54 A;  1B2U A;  3LTC A;  3CCM 3;  1DYU A;  1LQM B;  1TJD A;  1STD A;  3BIR A;  4OK0 A;  4EC6 A;  4FCJ A;  1C7H A;  1R4Y A;  2CFL A;  1BNS A;  4IPB A;  1DVD A;  3CPW 2;  3LYG A;  3URP A;  3EF8 A;  3EJV A;  3FF0 A;  3GZR A;  1K28 A;  1GOU A;  4FMD A;  3A76 A;  1M1X B;  1X1U A;  1RSN A;  2WOH A;  1VQL 3;  4LGQ A;  3NQY A;  4EV5 A;  3SLU A;  4K61 A;  3PYJ A;  2A15 A;  1OF5 B;  3CCU 3;  1VQO 3;  1K9M 4;  1FUT A;  3WOF B;  1YJN 3;  2E2U A;  1RCL A;  5A0O B;  2ZA4 A;  2RNT A;  1B20 A;  1WNH A;  2M7O A;  3NBJ A;  1Q81 4;  1LOY A;  3G0K A;  3LTA A;  2SAR A;  3T8U A;  4ORL A;  1YVS A;  1BU4 A;  3JUM A;  2QIY A;  3MKI A;  4FR9 A;  2STD A;  5DRV A;  1IU7 A;  2XFT A;  1GMR A;  4WP5 A;  1BRI A;  3DH2 A;  3S29 A;  3FKA A;  1LOV A;  4FMA A;  1RN1 A;  1W6C A;  4AEQ A;  2QEX 3;  2H0G A;  1N9J A;  1RDS A;  4MMX B;  3LXU X;  3ZFZ A;  3RGA A;  1GD4 A;  2CX1 A;  4AKZ A;  3DM8 A;  4KFD A;  4TX4 A;  3D79 A;  5LC6 A;  1I0X A;  1FGM A;  2W03 A;  4BL3 A;  5CF2 A;  2W0Q A;  2XGL A;  3KFQ C;  4LMI A;  2IA7 A;  2OQE C;  4EBG A;  1IVX A;  2JDI H;  5CLK A;  2CG1 A;  2GEY A;  2L1S A;  2W56 A;  3ALA A;  3UJM A;  3KN4 A;  1BUJ A;  2CFD A;  3CNX A;  4QWT A;  3J7Y d;  1OHS A;  1RGA A;  4HKV B;  3X3X A;  1N8R 4;  1AR0 A;  1O7H B;  4H3U A;  1JB2 A;  3LZA A;  3BU4 A;  1BSB A;  3H51 A;  1BOX A;  4XM4 A;  3UL6 A;  2LYX A;  2CHC A;  3D5G A;  5HOH A;  1DMN A;  4EW5 A;  6STD A;  1YIT 3;  2MF7 A;  5G1K A;  3HZP A;  5M1A A;  1G96 A;  2GBW B;  1W6Y A;  1JRQ A;  1K73 4;  5IG0 A;  3EHC A;  8CHO A;  2KF6 A;  3LT8 A;  1GMQ A;  2XSH B;  4Q53 A;  7STD A;  2BMR B;  1W4N A;  1CEW I;  3ROB A;  5AIH A;  5JPU A;  2GBX B;  3IPT A;  1VQN 3;  3CCL 3;  4KT3 B;  3NXJ A;  3UB1 A;  1JKG B;  5AYS C;  1IT8 A;  1BRK A;  1WMN A;  3DMC A;  1IVV A;  1OGZ A;  1RGK A;  3FSD A;  4N6M A;  3MG1 A;  4I5Q A;  5LC7 A;  1MOL A;  1RCK A;  3MG2 A;  1WMO A;  1US1 A;  1RHL A;  3FG1 A;  1RLS A;  1SQW A;  2CG0 A;  1FUW A;  2F5M A;  4GHO A;  1Z1S A;  1VQK 3;  1FYS A;  2W9Q A;  1BAO A;  4NHF A;  1UUG B;  1YVB I;  5AI1 A;  3TDG A;  4N6N B;  1PU4 A;  1QVG 2;  1W7C A;  3PZW A;  5G1L A;  5HGR A;  4U13 A;  4OVM A;  1MWR A;  4O02 B;  4XBT A;  4CCV A;  3CCR 3;  2KXG A;  3KCH A;  1E3V A;  3G16 A;  4WHA A;  5BXQ A;  3AMO A;  2XFS A;  2GXF A;  3LML A;  5D83 A;  3I56 3;  1B2S A;  1RN7 A;  3GSP A;  1BNR A;  1LNH A;  5IEO A;  1CH0 A;  4IIA A;  4LZI A;  4CDL A;  3I55 3;  3ZG0 A;  2UUG C;  4R1K A;  1A67 A;  4BIR A;  3PGB A;  3MG3 A;  2GU1 A;  1NDO B;  1IQX A;  3WOE B;  1JZO A;  1FA3 A;  3FG4 A;  4L8O A;  1YNV X;  1OHP A;  2INX A;  1KC8 4;  3D4A A;  3EBY A;  3X42 A;  3CC2 3;  1NU3 A;  1YI2 3;  1DVC A;  3MYT A;  1ZX2 A;  4HJL B;  1ROA A;  2HMO B;  3EB8 A;  3CCV 3;  3MPH A;  1YGE A;  2Z76 A;  1I2E A;  5D81 A;  2F5W A;  3EE1 A;  3LTD A;  3KSE D;  6GSP A;  7GSP A;  2Q07 A;  1TRP A;  1M90 4; 
#chains in the Genus database with same CATH homology
 2CFG A;  1IDP A;  3WOD G;  1Q42 A;  4FMB A;  2ZL8 A;  3CD6 3;  1QAK A;  3FH1 A;  4XB5 A;  2K0M A;  5JPP A;  2KCD A;  4GL6 A;  1EG9 B;  1O7M B;  1F8N A;  1JJ2 2;  4RNZ A;  3CXC 2;  5CK6 A;  3SXX A;  1W01 A;  3FG3 A;  4G1M B;  4J9A A;  3NX0 A;  3KSP A;  2W56 B;  3SOY A;  3N54 B;  3WA2 X;  1Q86 4;  2CWV A;  3U1W A;  2SBL A;  4O8S A;  4OUQ A;  1GY7 A;  2OWP A;  1GYB A;  2XGN A;  3HX8 A;  5IF6 A;  3JVC A;  2FNQ A;  1AVL A;  4N6L A;  1PFP A;  3FF2 A;  5EQL A;  4MEI A;  3RDE A;  5AIG A;  3BNE A;  1NB3 I;  3ECF A;  3D9R A;  4H61 A;  4X2O A;  1Q40 B;  1SIH A;  4O2H A;  1O7G B;  5KP4 A;  2BHM A;  4BTW A;  3K9M C;  2F98 A;  1KQS 2;  2CWT A;  1RJO A;  1JB5 A;  1JB4 A;  4XDW A;  4R9L A;  1EA2 A;  3JUQ A;  4N3V A;  1ULI B;  1TU5 A;  1N5H A;  2BNG A;  3CCQ 3;  2QGU A;  1J2B A;  1E3R A;  3BNC A;  4MMY B;  2CC3 A;  1R4C A;  4FCM A;  1QMA A;  1K41 A;  1UUW B;  2W2C A;  3OWS A;  4BTY A;  2GEX A;  2BT3 A;  2CW9 A;  4HM8 B;  3S27 A;  3JUN A;  5IEP A;  3OV4 A;  4XDV A;  1S72 3;  2ZDJ A;  1TP6 A;  2OTL 3;  1SII A;  2WGQ A;  3GZB A;  1YIJ 3;  1KD1 4;  2P0M A;  3G8Z A;  1W02 A;  3FCS B;  2ML5 A;  3X3Z A;  1Q40 A;  3CCE 3;  1LOX A;  3NM2 A;  3QRD A;  4N6U A;  3AMO B;  2Y73 A;  1UI8 A;  2IUK A;  1OAC A;  1TIJ A;  5IW9 A;  3N9H A;  3F7S A;  1GD3 A;  1VQ6 3;  4KFE A;  4WYK A;  1OPY A;  3O8Y A;  1N5P A;  1HKX A;  1O7P B;  4BTX A;  4R4K A;  5IG5 A;  1FGO A;  1IV7 A;  4WWU C;  5FW5 A;  4HM6 B;  2L4V A;  4HBR A;  2P38 A;  2HMJ B;  2MC8 A;  3DGL A;  3Q90 A;  3IJE B;  5IER A;  1YJW 3;  4RNY A;  5IG3 A;  1IQY A;  4EXR A;  1VQM 3;  2XH9 A;  3F8X A;  4EYC A;  3S5C A;  3K0Z A;  3NUV A;  3NV0 A;  4JRF A;  1SJW A;  1IVU A;  1QJG A;  3I0Y A;  1UI7 A;  4X2H A;  2PZV A;  3NBR A;  5AII A;  2IUJ A;  3BNB A;  4N6V 0;  3CCS 3;  1AV4 A;  1YHQ 3;  5I97 A;  2YFL B;  4K1V A;  1EQK A;  2XF3 A;  1GS3 A;  5G2G A;  4J8T A;  1FGR A;  4HM5 B;  4K90 B;  4I4K A;  3BND A;  3KE7 A;  3KII A;  3Q1C A;  1N9E A;  1A2V A;  1OGX A;  3F40 A;  1DMQ A;  4IT7 A;  2Z77 A;  1CQS A;  1K8A 4;  3DY5 A;  1ROV A;  3STD A;  3G6E 3;  1RKY A;  2CK3 H;  1YJ9 3;  1ULJ B;  3H3H A;  2R4I A;  1O7W B;  4ZM8 A;  3DGM A;  3F8H A;  1GY5 A;  3BB9 A;  1KSI A;  2W04 A;  3KZT A;  2BMQ B;  3GRD A;  1JN5 A;  2D1W A;  3CCJ 3;  1W5Z A;  3NBB A;  1VZZ A;  5DRE A;  2W9P A;  1U5O A;  2P0X A;  3X3Y A;  1ISK A;  4LEH A;  2Z7A A;  3S28 A;  3CNM A;  5IEN A;  1D6Z A;  3N8B A;  1SPU A;  5AYR B;  3SOA A;  2OTJ 3;  4L7K A;  1RRL A;  1UW1 A;  4XBY A;  5IG4 A;  1BUQ A;  4MJD A;  2W6J H;  3MWZ A;  1IT7 A;  3K5T A;  3EQQ B;  2XR8 B;  1CYV A;  2CFK A;  3UL5 A;  2V1L A;  1OH0 A;  1FGT A;  2GU3 A;  2Z6B A;  3NM7 A;  1LXE A;  4HYZ A;  1IV9 A;  2CH9 A;  1IQ8 A;  3GAX A;  1W2Z A;  5FGO A;  3U97 A;  1GY6 A;  4JF8 A;  5EVH A;  2OOV C;  1TFO A;  1WMP A;  4HM7 B;  5CXO A;  3RGR A;  4AKY A;  1D6U A;  5STD A;  3PS8 A;  1VQ9 3;  2PNC A;  1S5A A;  3V92 A;  3PXM A;  1TUH A;  4R80 A;  4K1U A;  3EBT A;  3V98 A;  3WA3 A;  1Y4K A;  1T5Y A;  3K63 A;  1A2K A;  3CPO A;  3HIG A;  2YFI B;  3B7C A;  3LT9 A;  2RGQ A;  4KFF A;  5EEO A;  1WTH A;  4RZM A;  1L5G B;  2Y74 A;  3FLJ A;  1WQL B;  3G71 3;  1ASK A;  2HMK B;  4WYK B;  3NHX A;  1VQ4 3;  3WMD A;  2CIU A;  3PCS A;  2F86 B;  3GWR A;  1VQP 3;  3VF1 A;  4WFO A;  1NO3 A;  1NB5 I;  3EN1 B;  2LQV A;  2E2V A;  3DGN A;  3DXO A;  2WOF A;  2CFW A;  3OWU A;  5BVB A;  5ELU A;  1AVK A;  3NV0 B;  3LH4 A;  3D3L A;  1HU9 A;  4KZ1 A;  3HK4 A;  3G4S 3;  2P09 A;  1TFK A;  2FGT A;  4MMZ B;  4XBX A;  2XEP A;  1Q82 4;  3Q2P A;  3BLZ A;  1W6G A;  4LSO A;  3SVA A;  3X40 A;  2HMM B;  4N6T A;  1OF5 A;  2YX9 A;  3VGN A;  4HM0 B;  1M9G A;  1MNL A;  2OOV A;  3SED A;  2C10 A;  1VQ7 3;  3NQZ A;  3CMA 3;  2FXT A;  1QAL A;  5AEW B;  1Q7Y 4;  1JV2 B;  4HZB B;  1UUV B;  3DUK A;  1A90 A;  5JBS A;  3F7X A;  1QVF 2;  3GZY B;  3FZW A;  1KWI A;  3LTB A;  4HM1 B;  4PEJ A;  3WDG B;  1NJI 4;  3FGY A;  1LVN A;  3HII A;  2IMJ A;  1NWW A;  1JNQ A;  5AIF A;  1JN5 B;  1DMM A;  3F9S A;  4L8P A;  2YFJ B;  1M1K 4;  3L0R A;  1RRH A;  1OHO A;  1N8Q A;  5D82 A;  3E99 A;  2JQ5 A;  3V99 A;  3ER7 A;  4RBN A;  4HZ9 B;  3IMA B;  3K7C A;  2WO0 A;  1O7N B;  3EX9 A;  4EV2 A;  2XRX B;  2RFR A;  3GZX B;  3CME 3;  3SX1 A;  4FCZ A;  3VSY A;  1VQ8 3;  1D6Y A;  1IK3 A;  2F99 A;  4O3V A;  3B4O A;  3MSO A;  2B1X B;  2HML B;  1OCV A;  4STD A;  1E97 A;  3JUO A;  3CU3 A;  4FMC A;  4KVH A;  3OXA A;  4GB5 A;  2D42 A;  1IVW A;  3F14 A;  2CWU A;  2OQE A;  3PCR A;  3OWY A;  1U8C B;  3UNL A;  1EKM A;  2RSX A;  3B8L A;  3X41 A;  2E2T A;  3T8N A;  2KRT A;  1W00 A;  3JUP A;  2ML6 A;  3OW2 2;  3DGO A;  5CF1 A;  4HM3 B;  5ELJ A;  1OUN A;  5TGN A;  5KP3 A;  3KKG A;  1JKG A;  4R9K A;  3M8C A;  2B24 B;  4HM2 B;  3CC4 3;  4HM4 B;  3OX9 A;  1QAF A;  2UX0 A;  2I9W A;  2QA4 3;  3QK9 A;  1W2B 2;  1V74 A;  1VQ5 3;  3T0U A;  1ZO2 A;  1STF I;  2CKF B;  3DZL A;  2P05 A;  3S67 A;  3B4P A;  2O3O A;  4N6O B;  5AEU B;  2O9U X;  2RCD A;  3HI7 A;  3EC9 A;  1FGQ A;  5KP1 A;  2BMO B;  2C11 A;  2HMN B;  3EN8 A;  3MHE A;  3CC7 3;  2OCT A;  4NRE A;  1CYU A;  2WGO A;  3LOY A;  2XSO B;  4HVN A;  2K54 A;  3LTC A;  3CCM 3;  1DYU A;  4OK0 A;  1STD A;  4EC6 A;  4FCJ A;  1C7H A;  2CFL A;  4IPB A;  1DVD A;  3CPW 2;  3LYG A;  3EF8 A;  3EJV A;  3FF0 A;  3GZR A;  1K28 A;  4FMD A;  3A76 A;  1M1X B;  2WOH A;  1VQL 3;  4LGQ A;  3NQY A;  4EV5 A;  3SLU A;  4K61 A;  3PYJ A;  2A15 A;  1OF5 B;  3CCU 3;  1VQO 3;  1K9M 4;  3WOF B;  1YJN 3;  2E2U A;  5A0O B;  1WNH A;  3NBJ A;  2M7O A;  1Q81 4;  3LTA A;  3G0K A;  3T8U A;  4ORL A;  3JUM A;  4FR9 A;  2QIY A;  3MKI A;  2STD A;  5DRV A;  1IU7 A;  2XFT A;  4WP5 A;  3S29 A;  3FKA A;  4FMA A;  1W6C A;  2QEX 3;  4AEQ A;  1N9J A;  4MMX B;  3LXU X;  3RGA A;  1GD4 A;  4AKZ A;  3DM8 A;  4KFD A;  4TX4 A;  5LC6 A;  1FGM A;  2W03 A;  5CF2 A;  2W0Q A;  2XGL A;  3KFQ C;  4LMI A;  2IA7 A;  2OQE C;  4EBG A;  1IVX A;  2JDI H;  5CLK A;  2CG1 A;  2GEY A;  2W56 A;  3ALA A;  3UJM A;  3KN4 A;  2CFD A;  3CNX A;  4QWT A;  3J7Y d;  1OHS A;  4HKV B;  3X3X A;  1N8R 4;  1AR0 A;  1O7H B;  4H3U A;  1JB2 A;  3LZA A;  3H51 A;  3UL6 A;  4XM4 A;  2LYX A;  2CHC A;  1DMN A;  6STD A;  1YIT 3;  2MF7 A;  3HZP A;  1G96 A;  2GBW B;  1W6Y A;  1JRQ A;  1K73 4;  5IG0 A;  3EHC A;  8CHO A;  3LT8 A;  2XSH B;  4Q53 A;  7STD A;  2BMR B;  1W4N A;  1CEW I;  3ROB A;  5AIH A;  5JPU A;  2GBX B;  3IPT A;  1VQN 3;  3CCL 3;  3NXJ A;  3UB1 A;  1JKG B;  5AYS C;  1IT8 A;  1WMN A;  3DMC A;  1IVV A;  1OGZ A;  3FSD A;  4N6M A;  3MG1 A;  5LC7 A;  1MOL A;  3MG2 A;  1WMO A;  1US1 A;  3FG1 A;  1SQW A;  2CG0 A;  1FUW A;  1Z1S A;  1VQK 3;  2W9Q A;  4NHF A;  1YVB I;  5AI1 A;  3TDG A;  4N6N B;  1PU4 A;  1QVG 2;  1W7C A;  3PZW A;  5HGR A;  4U13 A;  4OVM A;  4XBT A;  4O02 B;  4CCV A;  3CCR 3;  2KXG A;  1E3V A;  3G16 A;  4WHA A;  5BXQ A;  3AMO A;  2XFS A;  2GXF A;  3LML A;  5D83 A;  3I56 3;  1RN7 A;  1LNH A;  5IEO A;  4IIA A;  4LZI A;  4CDL A;  3I55 3;  4R1K A;  1A67 A;  3PGB A;  3MG3 A;  2GU1 A;  1NDO B;  1IQX A;  3WOE B;  1FA3 A;  3FG4 A;  4L8O A;  2INX A;  1OHP A;  1KC8 4;  3EBY A;  3X42 A;  3CC2 3;  1NU3 A;  1YI2 3;  1DVC A;  3MYT A;  1ZX2 A;  4HJL B;  1ROA A;  2HMO B;  3EB8 A;  3CCV 3;  3MPH A;  1YGE A;  2Z76 A;  5D81 A;  3EE1 A;  3LTD A;  3KSE D;  2Q07 A;  2BO9 B;  1M90 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...