1O7WB

Naphthalene 1,2-dioxygenase, fully reduced form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
total genus 52
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7wB00
1OGZA 3EBYA 3MKIA 2F98A 3GWRA 3MG1A 3WMDA 4XBXA 2Z76A 5IG4A 2HMJB 4Q53A 2GBXB 2F99A 4J9AA 2F86B 1JKGB 2BMOB 3DMCA 5KP4A 1JN5B 3BB9A 3EN1B 1C7HA 5D82A 3D9RA 3GZYB 3FH1A 1W6YA 4KVHA 1TUHA 5IEPA 3KE7A 2QGUA 2YFJB 3STDA 3OWUA 4WWUC 5DREA 3FZWA 2XRXB 2GBWB 2GXFA 4L8OA 5IG3A 3MG2A 3H51A 4PEJA 1JB5A 5D81A 3G16A 3G8ZA 4K1UA 1ULJB 3NXJA 2YFLB 3HX8A 3NBRA 4R1KA 5AIIA 1GYBA 3F40A 2R4IA 2RCDA 1Q40A 3F7SA 2W2CA 1OF5B 1O7PB 1VZZA 2UX0A 3SEDA 3CU3A 1QMAA 3EQQB 3JUQA 4L8PA 2HMNB 2OWPA 3UNLA 3FF2A 4ORLA 1QJGA 3JUNA 5CF2A 4H3UA 1E3VA 2BMQB 3DZLA 1DMMA 3RGRA 4OUQA 4XDWA 5AEUB 5AI1A 5EVHA 5JPPA 3F7XA 3EN8A 3NHXA 3H3HA 1O7MB 3K7CA 5IENA 1Z1SA 1Q42A 2RGQA 2BMRB 4HZBB 5CXOA 4XM4A 1OHOA 4HM6B 5JPUA 1E97A 1OHPA 3GZBA 2INXA 1DMQA 3EC9A 3T8UA 1EG9B 3K0ZA 5IG5A 1OGXA 1ULIB 4XBTA 1IDPA 3F9SA 3OX9A 2K54A 1CQSA 1GY7A 3BLZA 1STDA 3FF0A 4GB5A 1O7GB 4HM5B 3GZXB 1UUWB 4HM3B 3GRDA 2BNGA 2STDA 1TP6A 5AIFA 4XBYA 3T8NA 4CDLA 2JQ5A 2HMKB 3NM2A 1JKGA 1JN5A 1O7NB 3OWYA 4RZMA 4LEHA 3MYTA 5CK6A 3ROBA 3DXOA 5G2GA 5CF1A 3FKAA 3MHEA 3F14A 4XB5A 3FSDA 4HM0B 1GS3A 1GY5A 2XSHB 3OXAA 3KSPA 4R9LA 3CNXA 3JUPA 3NV0B 3SOYA 4K1VA 3CNMA 1OH0A 3IPTA 4U13A 4R9KA 5CLKA 4LGQA 4X2HA 1ZX2A 2B24B 4WYKB 5D83A 4FCMA 4HM1B 3B4OA 3MG3A 4IIAA 3EX9A 3EJVA 3ER7A 1JB4A 3LZAA 5KP1A 1OF5A 1ASKA 4HM7B 2XR8B 3JUOA 3KKGA 3VGNA 1SJWA 1W00A 4FCJA 1WQLB 5HGRA 3CPOA 2Z77A 1UUVB 4I4KA 3B7CA 1U5OA 3SOAA 2CHCA 3I0YA 1W02A 4STDA 2HMMB 2Z7AA 3Q90A 4HZ9B 3VSYA 1BUQA 5IEOA 1O7WB 2XSOB 5AIGA 1GY6A 4HM4B 5TGNA 4N3VA 1OPYA 1DMNA 2RFRA 3G0KA 4HKVB 3HZPA 4HM2B 2GEXA 3GZRA 2I9WA 1NWWA 2HMLB 8CHOA 3FGYA 2QIYA 5IF6A 1EA2A 5FW5A 3EHCA 1Q40B 3MSOA 2B1XB 1S5AA 4HVNA 3A76A 3LYGA 3RGAA 2CKFB 2IMJA 3B4PA 5KP3A 4J8TA 3FLJA 3KZTA 2HMOB 3UJMA 5BXQA 3EBTA 5STDA 3NUVA 1K41A 5DRVA 1NU3A 5IERA 4X2OA 7STDA 3DUKA 4L7KA 4XDVA 3F8XA 1OUNA 4LMIA 3DM8A 1ZO2A 4OVMA 3E99A 1ISKA 1W01A 1OCVA 3M8CA 2PZVA 3F8HA 3NV0A 1A2KA 4HJLB 1HKXA 3JUMA 1AR0A 4WP5A 3B8LA 2A15A 1E3RA 5AIHA 5AEWB 2YFIB 3EF8A 4HM8B 1OHSA 5IG0A 1NDOB 3OWSA 4WYKA 3HK4A 1JB2A 1O7HB 4MJDA 5BVBA 3OV4A 3ECFA 3S5CA 6STDA 2GEYA
chains in the Genus database with same CATH superfamily
1OGZA 1CYVA 3EBYA 1BRKA 3MKIA 3I553 2QEX3 1S723 2F98A 1BNRA 3N54B 3GWRA 3MG1A 4TX4A 3LOYA 4WFOA 3WMDA 4XBXA 1BUJA 2E2TA 2Z76A 3A5EA 4NHFA 1DVCA 5IG4A 2HMJB 4JF8A 2AADA 4Q53A 2GBXB 2F99A 4J9AA 1RN1A 4IT7A 1VQL3 2F86B 1SIIA 1FW7A 1W6GA 2Y74A 1SQWA 1U8CB 3G713 1Q814 1JKGB 2BMOB 3DMCA 5KP4A 1VQP3 1JN5B 1T2HA 1D6ZA 5G1KA 1I0XA 4EW5A 2CW9A 3BB9A 3BNDA 1I2GA 4AKYA 3EN1B 1UGHI 4CJNA 1C7HA 5AYRB 2GU3A 5D82A 3D9RA 3GZYB 4BTXA 4N6UA 2CK3H 1W6YA 3DGYA 2CWTA 3FH1A 3PXMA 4KVHA 2P0XA 2YX9A 1GOVA 4LSOA 2CFWA 2WOFA 1I70A 1TUHA 1YVSA 5IEPA 3KE7A 2QGUA 1UUGB 2YFJB 1MWSA 2C4BA 3STDA 5JBSA 3EB8A 3GAXA 1X1UA 3OWUA 5ELUA 4WWUC 5DREA 2F5MA 3FZWA 2XRXB 2GBWB 5AYSC 1F8NA 3CCQ3 1LQGC 2GXFA 1YHQ3 1A2VA 4L8OA 4KFDA 4EV2A 5IG3A 1IQXA 5A0OB 3JVCA 3CC43 3WHOA 1KD14 1EQKA 3MG2A 1KSIA 1TRQA 1K734 2CFGA 3H51A 2LYXA 1NJI4 1RGHA 4PEJA 1JB5A 1BSBA 3X40A 4BTYA 5D81A 3G16A 3G8ZA 4K1UA 4N6NB 1ULJB 3NXJA 2YFLB 9RNTA 1N9JA 4KZ1A 1GMQA 3DGOA 4BTWA 3LT9A 1G96A 3LMLA 3UL6A 1RGFA 3RDEA 3HX8A 3NBRA 4R1KA 1JBRA 5AIIA 2L1SA 1BRHA 1GYBA 3F40A 2R4IA 2RCDA 2SBLA 1Q40A 4MMXB 2E2UA 1RLSA 1IVWA 1V74A 1I3FA 1RKYA 1BU4A 1BAOA 3F7SA 2W2CA 3LTAA 1OF5B 4KFEA 1O7PB 3WR2A 1VZZA 2UX0A 3BNBA 3SEDA 1GD3A 3CU3A 4G1MB 1QMAA 3EQQB 4MEIA 1TFOA 4N6OB 1BUQA 1W5ZA 3JUQA 1BOXA 3PCRA 4MMYB 1LNHA 1RMSA 6GSPA 3BU4A 1VQM3 1G0TA 1YNVX 4L8PA 1ZS7A 2HMNB 1IVXA 2OWPA 3UNLA 1IQYA 3FF2A 1PU4A 4ORLA 1MNLA 1QJGA 1RRLA 2CG0A 1PY3A 1YGWA 4BU4A 3X3YA 4NREA 1VQ53 3JUNA 3FG4A 2KAAA 1Q7Y4 3WOFB 5CF2A 2ZA4A 1HYFA 3BIRA 5LC7A 7RNTA 3HIGA 4H3UA 1RCLA 3ZG0A 2CH9A 1E3VA 2BMQB 3WA3A 3DZLA 1DMMA 3RGRA 2M7OA 4OUQA 3X3ZA 3WDGB 4XDWA 2Y73A 1TFKA 3KFQC 5AEUB 1N9EA 4FCZA 1K9M4 1VQ63 1FGOA 5AI1A 1WTHA 1Q7HA 4RNYA 1B2UA 1MGWA 5EVHA 5JPPA 3LTDA 2HOHA 2CFDA 3F7XA 3EN8A 3NHXA 4EYCA 2OQEA 3H3HA 3CCV3 2W9PA 2P0MA 1FUWA 1I3IA 3FCSB 1M1K4 2W56B 2J8XB 1GMPA 1O7MB 1BSCA 1HU9A 3AMOA 3K7CA 1V57A 1GD4A 3AHSA 5I97A 3N8BA 1BNFA 1Z1SA 1W7CA 3PS8A 4N6V0 4O02B 5IENA 1EUIC 4BL3A 3BNCA 3DH2A 1Q42A 4K90B 2RGQA 1BNSA 3MPHA 2BMRB 4FMCA 3V98A 3AGNA 4HZBB 5CXOA 4XM4A 3PYJA 1OHOA 4HM6B 3Q3FA 1E97A 1QAKA 4DKIA 5JPUA 1OHPA 3GZBA 2INXA 2MF7A 3L0RA 4ILFA 1DMQA 3EC9A 1AV4A 2W6JH 3HI7A 2LQVA 1WMOA 3S27A 3T8UA 1IVVA 1CH0A 1EG9B 3K0ZA 5IG5A 2CWVA 1OGXA 3AHWA 4GSPA 2W0QA 1ULIB 1A2PA 3CCM3 4XBTA 2KF6A 1IDPA 3F9SA 1RN4A 2CC3A 3D5IA 3DY5A 5GSPA 1YJN3 2GSPA 4EC6A 1YGEA 2BO9B 2CX1A 3ZFZA 1UI7A 3OX9A 3MWZA 2K54A 1CQSA 1GY7A 3BLZA 1STDA 1YJW3 1LOXA 1W6CA 1LXEA 1M904 1LVNA 1YI23 3FF0A 4BL2A 1BRSA 4GB5A 1RDSA 4N6LA 1W4NA 5IW9A 1W2B2 1O7GB 2F5WA 4HM5B 1VQ73 2FGTA 5FGOA 2R41A 3KN4A 3GZXB 5EQLA 1UUWB 3HIIA 4HM3B 3GRDA 3SLUA 2C10A 2OQEC 4KT3B 2BNGA 2STDA 1EEJA 1A90A 1TP6A 3WOEB 4I5QA 5AIFA 4XBYA 3SVAA 4OK0A 3T8NA 1B2SA 4CDLA 2JQ5A 2HMKB 3S28A 3WODG 3G4S3 3NM2A 1JKGA 2ML5A 1JN5A 1O7NB 3NBJA 1Q864 3OWYA 4RZMA 4CCVA 2ML6A 1X1YA 4LEHA 3MYTA 1JZDA 3URPA 1FGMA 1NNVA 3Q2PA 3FG3A 4GL6A 5CK6A 1BSEA 1UCJA 3ROBA 2C11A 3DXOA 5M18A 5G2GA 2XFSA 2W03A 5CF1A 1RGKA 3FKAA 3MHEA 1YIT3 1IT8A 4RNZA 3V92A 3F14A 4XB5A 3FSDA 4K61A 5BIRA 4HM0B 1B20A 1GS3A 1GY5A 1AY7A 1BRGA 2CFKA 2KXGA 3X42A 1FGRA 4RBNA 1IVUA 2XSHB 3OXAA 1UCIA 3KSPA 3NBBA 4AEQA 1R4CA 4R9LA 3GSPA 4H61A 3U1WA 1FGQA 3CNXA 2D1WA 4LZIA 4N6MA 2P38A 3JUPA 2Z6BA 3NV0B 1DE3A 3SOYA 4K1VA 3CNMA 1OH0A 1AQZA 2IUKA 3IPTA 4U13A 4HBRA 1OACA 1RGGA 2WGQA 4R9KA 1VQN3 5CLKA 3VF1A 4JRFA 3NX0A 1KQS2 1MWTA 4LGQA 1UCLA 1ROAA 1UDII 2W9QA 3RNTA 4X2HA 3NQYA 1YVBI 1B27A 3LXUX 1B21A 1N8R4 2XGLA 2XF3A 1ZX2A 1GMRA 4GHOA 1TJDA 4EV5A 1VQQA 4FMBA 4O3VA 2B24B 4WYKB 4LYLB 5D83A 1I2EA 4FCMA 1VQ43 4HM1B 3B4OA 3UB1A 2P09A 3MG3A 3IMAB 1RGLA 4IIAA 1YIJ3 1W2ZA 1AVLA 4N6TA 2BIRA 3Q1CA 3EX9A 3EJVA 3ER7A 1JB4A 3LZAA 5KP1A 1BSAA 2UUGC 1OF5A 3N9HA 2CFLA 1ASKA 1TU5A 3PZWA 4HM7B 1BGSA 2BT3A 2XR8B 3JUOA 5ELJA 3G6E3 1RJOA 1RNBA 4O2HA 1IQ8A 1VQ83 5G1LA 3D5GA 1JZOA 3KKGA 3VGNA 1RSNA 1TRPA 1IV9A 1SJWA 3WA2X 3J7Yd 1W00A 4FCJA 1MWRA 1MOLA 1B2MA 1BIRA 1WQLB 1US1A 2XH9A 1BNGA 1HZ1A 1DVDA 2H0IA 5HGRA 4BIRA 2IUJA 1N5HA 1B2XA 1RHLA 2UGIA 3D4AA 3CPOA 2Z77A 1UUVB 1FGTA 1LOVA 4I4KA 1A67A 1JRQA 3B7CA 1U5OA 4CPKA 3SOAA 1VQ93 1PYLA 2V1LA 2CHCA 3X3XA 1KWIA 3I0YA 2XFTA 2O9UX 1W02A 1B3SA 2HMMB 4STDA 3K9MC 2CWUA 2Z7AA 3Q90A 3CME3 2IY2A 4HZ9B 2WOHA 1BANA 1BNIA 2F4YA 1Q9EA 1O7WB 2XSOB 5IEOA 3VSYA 1LQMB 3CMA3 3FG1A 5AIGA 1GY6A 2ZL8A 2W04A 3DGLA 2XEPA 3DGNA 3HOHA 1ROVA 4HM4B 4MMZB 3CCU3 1DETA 1B2ZA 5TGNA 2KF3A 4FMDA 4FMAA 2W56A 4N3VA 2BU4A 2OCTA 2KCDA 1OPYA 3O8YA 3D79A 1DMNA 1D6UA 4AKZA 2RFRA 1I8VA 3BNEA 3G0KA 3CCJ3 1RGCA 1PFPA 4HKVB 3T0UA 1TIJA 2KRTA 2PNCA 3HZPA 4HM2B 1QAFA 2GEXA 3NM7A 2KF4A 1JNQA 3K63A 2RBIA 3GZRA 4IPBA 1T5YA 3U97A 1GSPA 2I9WA 1X1WA 1NWWA 1WMPA 3KCHA 1I2FA 2ZDJA 3SX1A 2HMLB 3ALAA 1LNIA 8CHOA 3FGYA 1JV2B 2QIYA 3CCS3 2ZHXB 3SYUA 5IF6A 1WMNA 3CCL3 1EA2A 1BNEA 1M9GA 1JBTA 1AVKA 5FW5A 4HAAA 4R4KA 1RGAA 1FUSA 3QRDA 4HYZA 3UL5A 2FNQA 1QVG2 3DGMA 1GOUA 3SXXA 2O3OA 1Y4KA 1Q40B 3EHCA 3MSOA 3V99A 1R4YA 1G02A 1RCKA 4J5KA 1UGIA 2B1XB 2IA7A 3LH4A 4RNTA 2E2VA 1S5AA 4HVNA 3A76A 1MWUA 3S29A 3LTCA 1UI8A 4O8SA 3D3LA 3LYGA 3RGAA 1SPUA 3X41A 2K0MA 1FA3A 2CKFB 1BVIA 1FYSA 3NQZA 6RNTA 3OW22 2CIUA 2IMJA 3B4PA 5KP3A 4J8TA 3FLJA 3KZTA 3QK9A 2JDIH 3CC23 1IV7A 1ZGXA 7GSPA 2HMOB 1JJ22 3UJMA 2K3DA 4J5GA 1CYUA 1FUTA 1T2IA 2SARA 3LT8A 1BNJA 4NPBA 1BRNL 2D42A 2RNTA 2CX0A 1FZUA 2OOVA 5BXQA 3EBTA 4WHAA 3NUVA 5STDA 1QALA 2IYJA 5M1AA 4EXRA 4EBGA 1K41A 1IT7A 5DRVA 1UW1A 4R80A 1CEWI 2BHMA 1NU3A 3I563 5IERA 3CC73 2WGOA 1GOYA 1X1XA 4X2OA 4KFFA 1YJ93 1WNHA 7STDA 3DUKA 3LTBA 4L7KA 5BU4A 1M1XB 2OTJ3 4XDVA 3F8XA 3KIIA 2RSXA 4FR9A 1OUNA 1SIHA 3CD63 2XGNA 4LMIA 3DM8A 1ZO2A 1VQK3 4OVMA 3E99A 1QVF2 1STFI 3ZG5A 2CG1A 3CPW2 3PGBA 1NB3I 1RNTA 1ISKA 3CXC2 1W01A 1D6YA 3K5TA 1OCVA 3M8CA 1RGEA 3TDGA 2H0HA 2PZVA 1LOYA 3F8HA 3EE1A 1A2KA 3NV0A 3S67A 5M19A 1C54A 1BRIA 4HJLB 1RN7A 3AMOB 3CCE3 5RNTA 1HKXA 2L4VA 3IJEB 1IU7A 1V58A 1IK3A 1I0VA 1UCKA 2KF5A 2WO0A 3JUMA 2FXTA 5EEOA 2F56A 1SARA 1AR0A 1MGRA 4WP5A 1EKMA 3B8LA 2A15A 1E3RA 5AIHA 3CCR3 1N5PA 3PCSA 8RNTA 1RTUA 1J2BA 2Q07A 5AEWB 3KSED 1TTOA 1JBSA 2YFIB 3EF8A 5HOHA 2QA43 1KC84 4HM8B 1VQO3 1Q824 1OHSA 1BRJA 1LRAA 1RRHA 2GU1A 1LOWA 1NDOB 3AGOA 4HOHA 5IG0A 3OWSA 4WYKA 1N8QA 3HK4A 2AAEA 1JB2A 5LC6A 1K28A 1O7HB 2OOVC 4MJDA 4QWTA 1K8A4 1L5GB 2H0GA 4ZM8A 1BSDA 2MC8A 1NB5I 5BVBA 1T3BA 3OV4A 2P05A 2OTL3 3ECFA 3S5CA 1NO3A 6STDA 1DYUA 2GEYA 1IYYA
chains in the Genus database with same CATH topology
1OGZA 1CYVA 3EBYA 3MKIA 3I553 1S723 2QEX3 2F98A 3N54B 3GWRA 3MG1A 4TX4A 3LOYA 4WFOA 3WMDA 4XBXA 2E2TA 2Z76A 4NHFA 1DVCA 5IG4A 2HMJB 4JF8A 4Q53A 2GBXB 2F99A 4J9AA 4IT7A 1VQL3 2F86B 1SIIA 1W6GA 2Y74A 1SQWA 1U8CB 3G713 1Q814 1JKGB 2BMOB 3DMCA 5KP4A 1VQP3 1JN5B 1D6ZA 2CW9A 3BB9A 3BNDA 4AKYA 3EN1B 1C7HA 5AYRB 2GU3A 5D82A 3D9RA 3GZYB 4BTXA 4N6UA 2CK3H 1W6YA 3FH1A 2CWTA 3PXMA 4KVHA 4LSOA 2P0XA 2YX9A 2CFWA 2WOFA 1TUHA 5IEPA 3KE7A 2QGUA 2YFJB 5JBSA 3STDA 3EB8A 3GAXA 3OWUA 5ELUA 4WWUC 5DREA 3FZWA 2XRXB 2GBWB 5AYSC 1F8NA 3CCQ3 2GXFA 1YHQ3 1A2VA 4L8OA 4KFDA 4EV2A 5IG3A 1IQXA 5A0OB 3JVCA 3CC43 1KD14 1EQKA 3MG2A 1KSIA 1K734 2CFGA 3H51A 2LYXA 1NJI4 4PEJA 1JB5A 3X40A 4BTYA 5D81A 3G16A 3G8ZA 4K1UA 4N6NB 1ULJB 3NXJA 2YFLB 1N9JA 4KZ1A 3DGOA 4BTWA 3LT9A 1G96A 3LMLA 3UL6A 3RDEA 3HX8A 3NBRA 4R1KA 5AIIA 1GYBA 3F40A 2R4IA 2RCDA 2SBLA 1Q40A 4MMXB 2E2UA 1IVWA 1V74A 1RKYA 3F7SA 2W2CA 3LTAA 1OF5B 4KFEA 1O7PB 1VZZA 2UX0A 3BNBA 3SEDA 1GD3A 3CU3A 4G1MB 1QMAA 3EQQB 4MEIA 1TFOA 4N6OB 1W5ZA 3JUQA 3PCRA 4MMYB 1LNHA 1VQM3 4L8PA 2HMNB 2OWPA 1IVXA 3UNLA 1IQYA 3FF2A 1PU4A 4ORLA 1MNLA 1QJGA 1RRLA 2CG0A 3X3YA 4NREA 1VQ53 3JUNA 3FG4A 1Q7Y4 3WOFB 5CF2A 5LC7A 3HIGA 4H3UA 2CH9A 1E3VA 2BMQB 3WA3A 3DZLA 1DMMA 3RGRA 2M7OA 4OUQA 3X3ZA 3WDGB 4XDWA 2Y73A 1TFKA 3KFQC 5AEUB 1N9EA 4FCZA 1K9M4 1VQ63 1FGOA 5AI1A 1WTHA 4RNYA 5EVHA 5JPPA 3LTDA 2CFDA 3F7XA 3EN8A 3NHXA 4EYCA 2OQEA 3H3HA 3CCV3 2W9PA 2P0MA 1FUWA 3FCSB 1M1K4 2W56B 1O7MB 1HU9A 3AMOA 3K7CA 1GD4A 5I97A 3N8BA 1Z1SA 4O02B 1W7CA 3PS8A 4N6V0 5IENA 3BNCA 4K90B 1Q42A 3V98A 2RGQA 3MPHA 2BMRB 4FMCA 4HZBB 5CXOA 4XM4A 3PYJA 1OHOA 4HM6B 5JPUA 1E97A 1QAKA 1OHPA 3GZBA 2INXA 2MF7A 3L0RA 1DMQA 3EC9A 1AV4A 2W6JH 3HI7A 2LQVA 1WMOA 3S27A 3T8UA 1IVVA 1EG9B 3K0ZA 5IG5A 2CWVA 1OGXA 2W0QA 1ULIB 3CCM3 4XBTA 1IDPA 3F9SA 2CC3A 3DY5A 1YJN3 4EC6A 1YGEA 2BO9B 1UI7A 3OX9A 3MWZA 2K54A 1CQSA 1GY7A 3BLZA 1STDA 1YJW3 1LOXA 1W6CA 1LXEA 1M904 1LVNA 1YI23 3FF0A 4GB5A 4N6LA 1W4NA 5IW9A 1W2B2 1O7GB 4HM5B 1VQ73 2FGTA 5FGOA 3KN4A 3GZXB 5EQLA 1UUWB 3HIIA 4HM3B 3GRDA 3SLUA 2C10A 2OQEC 2BNGA 2STDA 1A90A 1TP6A 3WOEB 5AIFA 4XBYA 3SVAA 4OK0A 3T8NA 4CDLA 2JQ5A 2HMKB 3S28A 3WODG 3G4S3 3NM2A 1JKGA 2ML5A 1JN5A 1O7NB 3NBJA 1Q864 3OWYA 4RZMA 4CCVA 2ML6A 4LEHA 3MYTA 1FGMA 3Q2PA 5CK6A 3FG3A 4GL6A 3ROBA 2C11A 3DXOA 5G2GA 2XFSA 2W03A 5CF1A 3FKAA 3MHEA 1YIT3 1IT8A 4RNZA 3V92A 3F14A 4XB5A 3FSDA 4K61A 4HM0B 1GS3A 1GY5A 2CFKA 2KXGA 1FGRA 4RBNA 2XSHB 1IVUA 3OXAA 3KSPA 3NBBA 4AEQA 1R4CA 4R9LA 4H61A 3U1WA 1FGQA 3CNXA 2D1WA 4LZIA 4N6MA 2P38A 3JUPA 2Z6BA 3NV0B 3SOYA 4K1VA 3CNMA 1OH0A 2IUKA 3IPTA 4U13A 4HBRA 1OACA 2WGQA 4R9KA 1VQN3 5CLKA 3VF1A 4JRFA 3NX0A 1KQS2 4LGQA 1ROAA 2W9QA 4X2HA 3NQYA 1YVBI 3LXUX 1N8R4 2XGLA 2XF3A 1ZX2A 4EV5A 4FMBA 4O3VA 2B24B 4WYKB 5D83A 4FCMA 1VQ43 4HM1B 3B4OA 3UB1A 2P09A 3MG3A 3IMAB 4IIAA 1YIJ3 1W2ZA 1AVLA 4N6TA 3Q1CA 3EX9A 3EJVA 3ER7A 1JB4A 3LZAA 5KP1A 1OF5A 3N9HA 2CFLA 1ASKA 1TU5A 3PZWA 4HM7B 2BT3A 2XR8B 3JUOA 5ELJA 3G6E3 1RJOA 4O2HA 1IQ8A 1VQ83 3KKGA 3VGNA 1IV9A 1SJWA 3WA2X 3J7Yd 1W00A 4FCJA 1MOLA 1WQLB 1US1A 2XH9A 1DVDA 5HGRA 2IUJA 1N5HA 3CPOA 2Z77A 1UUVB 1FGTA 4I4KA 1A67A 1JRQA 3B7CA 1U5OA 3SOAA 1VQ93 2V1LA 2CHCA 3X3XA 1KWIA 3I0YA 2XFTA 2O9UX 1W02A 4STDA 2HMMB 3K9MC 2CWUA 2Z7AA 3Q90A 3CME3 4HZ9B 2WOHA 3VSYA 3X42A 1BUQA 5IEOA 1O7WB 2XSOB 3CMA3 3FG1A 5AIGA 1GY6A 2ZL8A 2W04A 3DGLA 2XEPA 3DGNA 4HM4B 1ROVA 4MMZB 3CCU3 1J2BA 5TGNA 4FMDA 4FMAA 2W56A 4N3VA 2OCTA 2KCDA 1OPYA 3O8YA 1DMNA 1D6UA 4AKZA 2RFRA 3BNEA 3G0KA 3CCJ3 1PFPA 4HKVB 3T0UA 1TIJA 2KRTA 2PNCA 3HZPA 4HM2B 1QAFA 2GEXA 3NM7A 1JNQA 3K63A 3GZRA 4IPBA 1T5YA 3U97A 2I9WA 1NWWA 1WMPA 3SX1A 2ZDJA 2HMLB 3ALAA 8CHOA 3FGYA 1JV2B 2QIYA 3CCS3 3CCL3 2OTL3 5IF6A 1WMNA 1EA2A 1M9GA 1AVKA 5FW5A 4R4KA 3QRDA 4HYZA 3UL5A 2FNQA 1QVG2 3DGMA 3SXXA 2O3OA 1Y4KA 1Q40B 3EHCA 3MSOA 3V99A 2B1XB 2IA7A 3LH4A 2E2VA 1S5AA 4HVNA 3A76A 3S29A 3LTCA 1UI8A 4O8SA 3D3LA 3LYGA 3RGAA 1SPUA 3X41A 2K0MA 1FA3A 2CKFB 3NQZA 3OW22 2CIUA 2IMJA 3B4PA 5KP3A 4J8TA 3FLJA 3KZTA 3QK9A 2JDIH 3CC23 1IV7A 2HMOB 1JJ22 3UJMA 1CYUA 3LT8A 2D42A 2OOVA 5BXQA 3EBTA 4WHAA 3NUVA 5STDA 1QALA 4EXRA 4EBGA 1K41A 1IT7A 5DRVA 1UW1A 4R80A 1CEWI 2BHMA 1NU3A 3I563 5IERA 3CC73 2WGOA 4X2OA 4KFFA 1YJ93 1WNHA 7STDA 3DUKA 3LTBA 4L7KA 1M1XB 2OTJ3 4XDVA 3F8XA 3KIIA 2RSXA 4FR9A 1OUNA 1SIHA 3CD63 2XGNA 4LMIA 3DM8A 1ZO2A 1VQK3 4OVMA 3E99A 1QVF2 1STFI 2CG1A 3CPW2 3PGBA 1NB3I 1ISKA 3CXC2 1W01A 1D6YA 3K5TA 1OCVA 3M8CA 3TDGA 2PZVA 3F8HA 3NV0A 3EE1A 1A2KA 3S67A 4HJLB 1RN7A 3AMOB 3CCE3 1HKXA 2L4VA 3IJEB 1IU7A 1IK3A 2WO0A 3JUMA 2FXTA 5EEOA 1AR0A 4WP5A 1EKMA 3B8LA 2A15A 1E3RA 5AIHA 3CCR3 1N5PA 3PCSA 2Q07A 5AEWB 3KSED 2YFIB 3EF8A 2QA43 1KC84 4HM8B 1VQO3 1Q824 1OHSA 1RRHA 5IG0A 2GU1A 1NDOB 3OWSA 4WYKA 1N8QA 3HK4A 5LC6A 1JB2A 1K28A 1O7HB 2OOVC 4MJDA 4QWTA 1K8A4 1L5GB 4ZM8A 2MC8A 1NB5I 5BVBA 3OV4A 2P05A 3ECFA 3S5CA 1NO3A 6STDA 1DYUA 2GEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGZ A;  3EBY A;  3MKI A;  2F98 A;  3GWR A;  3MG1 A;  3WMD A;  4XBX A;  2Z76 A;  5IG4 A;  2HMJ B;  4Q53 A;  2GBX B;  2F99 A;  4J9A A;  2F86 B;  1JKG B;  2BMO B;  3DMC A;  5KP4 A;  1JN5 B;  3BB9 A;  3EN1 B;  1C7H A;  5D82 A;  3D9R A;  3GZY B;  3FH1 A;  1W6Y A;  4KVH A;  1TUH A;  5IEP A;  3KE7 A;  2QGU A;  2YFJ B;  3STD A;  3OWU A;  4WWU C;  5DRE A;  3FZW A;  2XRX B;  2GBW B;  2GXF A;  4L8O A;  5IG3 A;  3MG2 A;  3H51 A;  4PEJ A;  1JB5 A;  5D81 A;  3G16 A;  3G8Z A;  4K1U A;  1ULJ B;  3NXJ A;  2YFL B;  3HX8 A;  3NBR A;  4R1K A;  5AII A;  1GYB A;  3F40 A;  2R4I A;  2RCD A;  1Q40 A;  3F7S A;  2W2C A;  1OF5 B;  1O7P B;  1VZZ A;  2UX0 A;  3SED A;  3CU3 A;  1QMA A;  3EQQ B;  3JUQ A;  4L8P A;  2HMN B;  2OWP A;  3UNL A;  3FF2 A;  4ORL A;  1QJG A;  3JUN A;  5CF2 A;  4H3U A;  1E3V A;  2BMQ B;  3DZL A;  1DMM A;  3RGR A;  4OUQ A;  4XDW A;  5AEU B;  5AI1 A;  5EVH A;  5JPP A;  3F7X A;  3EN8 A;  3NHX A;  3H3H A;  1O7M B;  3K7C A;  5IEN A;  1Z1S A;  1Q42 A;  2RGQ A;  2BMR B;  4HZB B;  5CXO A;  4XM4 A;  1OHO A;  4HM6 B;  5JPU A;  1E97 A;  1OHP A;  3GZB A;  2INX A;  1DMQ A;  3EC9 A;  3T8U A;  1EG9 B;  3K0Z A;  5IG5 A;  1OGX A;  1ULI B;  4XBT A;  1IDP A;  3F9S A;  3OX9 A;  2K54 A;  1CQS A;  1GY7 A;  3BLZ A;  1STD A;  3FF0 A;  4GB5 A;  1O7G B;  4HM5 B;  3GZX B;  1UUW B;  4HM3 B;  3GRD A;  2BNG A;  2STD A;  1TP6 A;  5AIF A;  4XBY A;  3T8N A;  4CDL A;  2JQ5 A;  2HMK B;  3NM2 A;  1JKG A;  1JN5 A;  1O7N B;  3OWY A;  4RZM A;  4LEH A;  3MYT A;  5CK6 A;  3ROB A;  3DXO A;  5G2G A;  5CF1 A;  3FKA A;  3MHE A;  3F14 A;  4XB5 A;  3FSD A;  4HM0 B;  1GS3 A;  1GY5 A;  2XSH B;  3OXA A;  3KSP A;  4R9L A;  3CNX A;  3JUP A;  3NV0 B;  3SOY A;  4K1V A;  3CNM A;  1OH0 A;  3IPT A;  4U13 A;  4R9K A;  5CLK A;  4LGQ A;  4X2H A;  1ZX2 A;  2B24 B;  4WYK B;  5D83 A;  4FCM A;  4HM1 B;  3B4O A;  3MG3 A;  4IIA A;  3EX9 A;  3EJV A;  3ER7 A;  1JB4 A;  3LZA A;  5KP1 A;  1OF5 A;  1ASK A;  4HM7 B;  2XR8 B;  3JUO A;  3KKG A;  3VGN A;  1SJW A;  1W00 A;  4FCJ A;  1WQL B;  5HGR A;  3CPO A;  2Z77 A;  1UUV B;  4I4K A;  3B7C A;  1U5O A;  3SOA A;  2CHC A;  3I0Y A;  1W02 A;  4STD A;  2HMM B;  2Z7A A;  3Q90 A;  4HZ9 B;  3VSY A;  1BUQ A;  5IEO A;  1O7W B;  2XSO B;  5AIG A;  1GY6 A;  4HM4 B;  5TGN A;  4N3V A;  1OPY A;  1DMN A;  2RFR A;  3G0K A;  4HKV B;  3HZP A;  4HM2 B;  2GEX A;  3GZR A;  2I9W A;  1NWW A;  2HML B;  8CHO A;  3FGY A;  2QIY A;  5IF6 A;  1EA2 A;  5FW5 A;  3EHC A;  1Q40 B;  3MSO A;  2B1X B;  1S5A A;  4HVN A;  3A76 A;  3LYG A;  3RGA A;  2CKF B;  2IMJ A;  3B4P A;  5KP3 A;  4J8T A;  3FLJ A;  3KZT A;  2HMO B;  3UJM A;  5BXQ A;  3EBT A;  5STD A;  3NUV A;  1K41 A;  5DRV A;  1NU3 A;  5IER A;  4X2O A;  7STD A;  3DUK A;  4L7K A;  4XDV A;  3F8X A;  1OUN A;  4LMI A;  3DM8 A;  1ZO2 A;  4OVM A;  3E99 A;  1ISK A;  1W01 A;  1OCV A;  3M8C A;  2PZV A;  3F8H A;  3NV0 A;  1A2K A;  4HJL B;  1HKX A;  3JUM A;  1AR0 A;  4WP5 A;  3B8L A;  2A15 A;  1E3R A;  5AIH A;  5AEW B;  2YFI B;  3EF8 A;  4HM8 B;  1OHS A;  5IG0 A;  1NDO B;  3OWS A;  4WYK A;  3HK4 A;  1JB2 A;  1O7H B;  4MJD A;  5BVB A;  3OV4 A;  3ECF A;  3S5C A;  6STD A;  2GEY A; 
#chains in the Genus database with same CATH topology
 1OGZ A;  1CYV A;  3EBY A;  1BRK A;  3MKI A;  3I55 3;  2QEX 3;  1S72 3;  2F98 A;  1BNR A;  3N54 B;  3GWR A;  3MG1 A;  4TX4 A;  3LOY A;  4WFO A;  3WMD A;  4XBX A;  1BUJ A;  2E2T A;  2Z76 A;  3A5E A;  4NHF A;  1DVC A;  5IG4 A;  2HMJ B;  4JF8 A;  2AAD A;  4Q53 A;  2GBX B;  2F99 A;  4J9A A;  1RN1 A;  4IT7 A;  1VQL 3;  2F86 B;  1SII A;  1FW7 A;  1W6G A;  2Y74 A;  1SQW A;  1U8C B;  3G71 3;  1Q81 4;  1JKG B;  2BMO B;  3DMC A;  5KP4 A;  1VQP 3;  1JN5 B;  1T2H A;  1D6Z A;  5G1K A;  1I0X A;  4EW5 A;  2CW9 A;  3BB9 A;  3BND A;  1I2G A;  4AKY A;  3EN1 B;  1UGH I;  4CJN A;  1C7H A;  5AYR B;  2GU3 A;  5D82 A;  3D9R A;  3GZY B;  4BTX A;  4N6U A;  2CK3 H;  1W6Y A;  3DGY A;  2CWT A;  3FH1 A;  3PXM A;  4KVH A;  2P0X A;  2YX9 A;  1GOV A;  4LSO A;  2CFW A;  2WOF A;  1I70 A;  1TUH A;  1YVS A;  5IEP A;  3KE7 A;  2QGU A;  1UUG B;  2YFJ B;  1MWS A;  2C4B A;  3STD A;  5JBS A;  3EB8 A;  3GAX A;  1X1U A;  3OWU A;  5ELU A;  4WWU C;  5DRE A;  2F5M A;  3FZW A;  2XRX B;  2GBW B;  5AYS C;  1F8N A;  3CCQ 3;  1LQG C;  2GXF A;  1YHQ 3;  1A2V A;  4L8O A;  4KFD A;  4EV2 A;  5IG3 A;  1IQX A;  5A0O B;  3JVC A;  3CC4 3;  3WHO A;  1KD1 4;  1EQK A;  3MG2 A;  1KSI A;  1TRQ A;  1K73 4;  2CFG A;  3H51 A;  2LYX A;  1NJI 4;  1RGH A;  4PEJ A;  1JB5 A;  1BSB A;  3X40 A;  4BTY A;  5D81 A;  3G16 A;  3G8Z A;  4K1U A;  4N6N B;  1ULJ B;  3NXJ A;  2YFL B;  9RNT A;  1N9J A;  4KZ1 A;  1GMQ A;  3DGO A;  4BTW A;  3LT9 A;  1G96 A;  3LML A;  3UL6 A;  1RGF A;  3RDE A;  3HX8 A;  3NBR A;  4R1K A;  1JBR A;  5AII A;  2L1S A;  1BRH A;  1GYB A;  3F40 A;  2R4I A;  2RCD A;  2SBL A;  1Q40 A;  4MMX B;  2E2U A;  1RLS A;  1IVW A;  1V74 A;  1I3F A;  1RKY A;  1BU4 A;  1BAO A;  3F7S A;  2W2C A;  3LTA A;  1OF5 B;  4KFE A;  1O7P B;  3WR2 A;  1VZZ A;  2UX0 A;  3BNB A;  3SED A;  1GD3 A;  3CU3 A;  4G1M B;  1QMA A;  3EQQ B;  4MEI A;  1TFO A;  4N6O B;  1BUQ A;  1W5Z A;  3JUQ A;  1BOX A;  3PCR A;  4MMY B;  1LNH A;  1RMS A;  6GSP A;  3BU4 A;  1VQM 3;  1G0T A;  1YNV X;  4L8P A;  1ZS7 A;  2HMN B;  1IVX A;  2OWP A;  3UNL A;  1IQY A;  3FF2 A;  1PU4 A;  4ORL A;  1MNL A;  1QJG A;  1RRL A;  2CG0 A;  1PY3 A;  1YGW A;  4BU4 A;  3X3Y A;  4NRE A;  1VQ5 3;  3JUN A;  3FG4 A;  2KAA A;  1Q7Y 4;  3WOF B;  5CF2 A;  2ZA4 A;  1HYF A;  3BIR A;  5LC7 A;  7RNT A;  3HIG A;  4H3U A;  1RCL A;  3ZG0 A;  2CH9 A;  1E3V A;  2BMQ B;  3WA3 A;  3DZL A;  1DMM A;  3RGR A;  2M7O A;  4OUQ A;  3X3Z A;  3WDG B;  4XDW A;  2Y73 A;  1TFK A;  3KFQ C;  5AEU B;  1N9E A;  4FCZ A;  1K9M 4;  1VQ6 3;  1FGO A;  5AI1 A;  1WTH A;  1Q7H A;  4RNY A;  1B2U A;  1MGW A;  5EVH A;  5JPP A;  3LTD A;  2HOH A;  2CFD A;  3F7X A;  3EN8 A;  3NHX A;  4EYC A;  2OQE A;  3H3H A;  3CCV 3;  2W9P A;  2P0M A;  1FUW A;  1I3I A;  3FCS B;  1M1K 4;  2W56 B;  2J8X B;  1GMP A;  1O7M B;  1BSC A;  1HU9 A;  3AMO A;  3K7C A;  1V57 A;  1GD4 A;  3AHS A;  5I97 A;  3N8B A;  1BNF A;  1Z1S A;  1W7C A;  3PS8 A;  4N6V 0;  4O02 B;  5IEN A;  1EUI C;  4BL3 A;  3BNC A;  3DH2 A;  1Q42 A;  4K90 B;  2RGQ A;  1BNS A;  3MPH A;  2BMR B;  4FMC A;  3V98 A;  3AGN A;  4HZB B;  5CXO A;  4XM4 A;  3PYJ A;  1OHO A;  4HM6 B;  3Q3F A;  1E97 A;  1QAK A;  4DKI A;  5JPU A;  1OHP A;  3GZB A;  2INX A;  2MF7 A;  3L0R A;  4ILF A;  1DMQ A;  3EC9 A;  1AV4 A;  2W6J H;  3HI7 A;  2LQV A;  1WMO A;  3S27 A;  3T8U A;  1IVV A;  1CH0 A;  1EG9 B;  3K0Z A;  5IG5 A;  2CWV A;  1OGX A;  3AHW A;  4GSP A;  2W0Q A;  1ULI B;  1A2P A;  3CCM 3;  4XBT A;  2KF6 A;  1IDP A;  3F9S A;  1RN4 A;  2CC3 A;  3D5I A;  3DY5 A;  5GSP A;  1YJN 3;  2GSP A;  4EC6 A;  1YGE A;  2BO9 B;  2CX1 A;  3ZFZ A;  1UI7 A;  3OX9 A;  3MWZ A;  2K54 A;  1CQS A;  1GY7 A;  3BLZ A;  1STD A;  1YJW 3;  1LOX A;  1W6C A;  1LXE A;  1M90 4;  1LVN A;  1YI2 3;  3FF0 A;  4BL2 A;  1BRS A;  4GB5 A;  1RDS A;  4N6L A;  1W4N A;  5IW9 A;  1W2B 2;  1O7G B;  2F5W A;  4HM5 B;  1VQ7 3;  2FGT A;  5FGO A;  2R41 A;  3KN4 A;  3GZX B;  5EQL A;  1UUW B;  3HII A;  4HM3 B;  3GRD A;  3SLU A;  2C10 A;  2OQE C;  4KT3 B;  2BNG A;  2STD A;  1EEJ A;  1A90 A;  1TP6 A;  3WOE B;  4I5Q A;  5AIF A;  4XBY A;  3SVA A;  4OK0 A;  3T8N A;  1B2S A;  4CDL A;  2JQ5 A;  2HMK B;  3S28 A;  3WOD G;  3G4S 3;  3NM2 A;  1JKG A;  2ML5 A;  1JN5 A;  1O7N B;  3NBJ A;  1Q86 4;  3OWY A;  4RZM A;  4CCV A;  2ML6 A;  1X1Y A;  4LEH A;  3MYT A;  1JZD A;  3URP A;  1FGM A;  1NNV A;  3Q2P A;  3FG3 A;  4GL6 A;  5CK6 A;  1BSE A;  1UCJ A;  3ROB A;  2C11 A;  3DXO A;  5M18 A;  5G2G A;  2XFS A;  2W03 A;  5CF1 A;  1RGK A;  3FKA A;  3MHE A;  1YIT 3;  1IT8 A;  4RNZ A;  3V92 A;  3F14 A;  4XB5 A;  3FSD A;  4K61 A;  5BIR A;  4HM0 B;  1B20 A;  1GS3 A;  1GY5 A;  1AY7 A;  1BRG A;  2CFK A;  2KXG A;  3X42 A;  1FGR A;  4RBN A;  1IVU A;  2XSH B;  3OXA A;  1UCI A;  3KSP A;  3NBB A;  4AEQ A;  1R4C A;  4R9L A;  3GSP A;  4H61 A;  3U1W A;  1FGQ A;  3CNX A;  2D1W A;  4LZI A;  4N6M A;  2P38 A;  3JUP A;  2Z6B A;  3NV0 B;  1DE3 A;  3SOY A;  4K1V A;  3CNM A;  1OH0 A;  1AQZ A;  2IUK A;  3IPT A;  4U13 A;  4HBR A;  1OAC A;  1RGG A;  2WGQ A;  4R9K A;  1VQN 3;  5CLK A;  3VF1 A;  4JRF A;  3NX0 A;  1KQS 2;  1MWT A;  4LGQ A;  1UCL A;  1ROA A;  1UDI I;  2W9Q A;  3RNT A;  4X2H A;  3NQY A;  1YVB I;  1B27 A;  3LXU X;  1B21 A;  1N8R 4;  2XGL A;  2XF3 A;  1ZX2 A;  1GMR A;  4GHO A;  1TJD A;  4EV5 A;  1VQQ A;  4FMB A;  4O3V A;  2B24 B;  4WYK B;  4LYL B;  5D83 A;  1I2E A;  4FCM A;  1VQ4 3;  4HM1 B;  3B4O A;  3UB1 A;  2P09 A;  3MG3 A;  3IMA B;  1RGL A;  4IIA A;  1YIJ 3;  1W2Z A;  1AVL A;  4N6T A;  2BIR A;  3Q1C A;  3EX9 A;  3EJV A;  3ER7 A;  1JB4 A;  3LZA A;  5KP1 A;  1BSA A;  2UUG C;  1OF5 A;  3N9H A;  2CFL A;  1ASK A;  1TU5 A;  3PZW A;  4HM7 B;  1BGS A;  2BT3 A;  2XR8 B;  3JUO A;  5ELJ A;  3G6E 3;  1RJO A;  1RNB A;  4O2H A;  1IQ8 A;  1VQ8 3;  5G1L A;  3D5G A;  1JZO A;  3KKG A;  3VGN A;  1RSN A;  1TRP A;  1IV9 A;  1SJW A;  3WA2 X;  3J7Y d;  1W00 A;  4FCJ A;  1MWR A;  1MOL A;  1B2M A;  1BIR A;  1WQL B;  1US1 A;  2XH9 A;  1BNG A;  1HZ1 A;  1DVD A;  2H0I A;  5HGR A;  4BIR A;  2IUJ A;  1N5H A;  1B2X A;  1RHL A;  2UGI A;  3D4A A;  3CPO A;  2Z77 A;  1UUV B;  1FGT A;  1LOV A;  4I4K A;  1A67 A;  1JRQ A;  3B7C A;  1U5O A;  4CPK A;  3SOA A;  1VQ9 3;  1PYL A;  2V1L A;  2CHC A;  3X3X A;  1KWI A;  3I0Y A;  2XFT A;  2O9U X;  1W02 A;  1B3S A;  2HMM B;  4STD A;  3K9M C;  2CWU A;  2Z7A A;  3Q90 A;  3CME 3;  2IY2 A;  4HZ9 B;  2WOH A;  1BAN A;  1BNI A;  2F4Y A;  1Q9E A;  1O7W B;  2XSO B;  5IEO A;  3VSY A;  1LQM B;  3CMA 3;  3FG1 A;  5AIG A;  1GY6 A;  2ZL8 A;  2W04 A;  3DGL A;  2XEP A;  3DGN A;  3HOH A;  1ROV A;  4HM4 B;  4MMZ B;  3CCU 3;  1DET A;  1B2Z A;  5TGN A;  2KF3 A;  4FMD A;  4FMA A;  2W56 A;  4N3V A;  2BU4 A;  2OCT A;  2KCD A;  1OPY A;  3O8Y A;  3D79 A;  1DMN A;  1D6U A;  4AKZ A;  2RFR A;  1I8V A;  3BNE A;  3G0K A;  3CCJ 3;  1RGC A;  1PFP A;  4HKV B;  3T0U A;  1TIJ A;  2KRT A;  2PNC A;  3HZP A;  4HM2 B;  1QAF A;  2GEX A;  3NM7 A;  2KF4 A;  1JNQ A;  3K63 A;  2RBI A;  3GZR A;  4IPB A;  1T5Y A;  3U97 A;  1GSP A;  2I9W A;  1X1W A;  1NWW A;  1WMP A;  3KCH A;  1I2F A;  2ZDJ A;  3SX1 A;  2HML B;  3ALA A;  1LNI A;  8CHO A;  3FGY A;  1JV2 B;  2QIY A;  3CCS 3;  2ZHX B;  3SYU A;  5IF6 A;  1WMN A;  3CCL 3;  1EA2 A;  1BNE A;  1M9G A;  1JBT A;  1AVK A;  5FW5 A;  4HAA A;  4R4K A;  1RGA A;  1FUS A;  3QRD A;  4HYZ A;  3UL5 A;  2FNQ A;  1QVG 2;  3DGM A;  1GOU A;  3SXX A;  2O3O A;  1Y4K A;  1Q40 B;  3EHC A;  3MSO A;  3V99 A;  1R4Y A;  1G02 A;  1RCK A;  4J5K A;  1UGI A;  2B1X B;  2IA7 A;  3LH4 A;  4RNT A;  2E2V A;  1S5A A;  4HVN A;  3A76 A;  1MWU A;  3S29 A;  3LTC A;  1UI8 A;  4O8S A;  3D3L A;  3LYG A;  3RGA A;  1SPU A;  3X41 A;  2K0M A;  1FA3 A;  2CKF B;  1BVI A;  1FYS A;  3NQZ A;  6RNT A;  3OW2 2;  2CIU A;  2IMJ A;  3B4P A;  5KP3 A;  4J8T A;  3FLJ A;  3KZT A;  3QK9 A;  2JDI H;  3CC2 3;  1IV7 A;  1ZGX A;  7GSP A;  2HMO B;  1JJ2 2;  3UJM A;  2K3D A;  4J5G A;  1CYU A;  1FUT A;  1T2I A;  2SAR A;  3LT8 A;  1BNJ A;  4NPB A;  1BRN L;  2D42 A;  2RNT A;  2CX0 A;  1FZU A;  2OOV A;  5BXQ A;  3EBT A;  4WHA A;  3NUV A;  5STD A;  1QAL A;  2IYJ A;  5M1A A;  4EXR A;  4EBG A;  1K41 A;  1IT7 A;  5DRV A;  1UW1 A;  4R80 A;  1CEW I;  2BHM A;  1NU3 A;  3I56 3;  5IER A;  3CC7 3;  2WGO A;  1GOY A;  1X1X A;  4X2O A;  4KFF A;  1YJ9 3;  1WNH A;  7STD A;  3DUK A;  3LTB A;  4L7K A;  5BU4 A;  1M1X B;  2OTJ 3;  4XDV A;  3F8X A;  3KII A;  2RSX A;  4FR9 A;  1OUN A;  1SIH A;  3CD6 3;  2XGN A;  4LMI A;  3DM8 A;  1ZO2 A;  1VQK 3;  4OVM A;  3E99 A;  1QVF 2;  1STF I;  3ZG5 A;  2CG1 A;  3CPW 2;  3PGB A;  1NB3 I;  1RNT A;  1ISK A;  3CXC 2;  1W01 A;  1D6Y A;  3K5T A;  1OCV A;  3M8C A;  1RGE A;  3TDG A;  2H0H A;  2PZV A;  1LOY A;  3F8H A;  3EE1 A;  1A2K A;  3NV0 A;  3S67 A;  5M19 A;  1C54 A;  1BRI A;  4HJL B;  1RN7 A;  3AMO B;  3CCE 3;  5RNT A;  1HKX A;  2L4V A;  3IJE B;  1IU7 A;  1V58 A;  1IK3 A;  1I0V A;  1UCK A;  2KF5 A;  2WO0 A;  3JUM A;  2FXT A;  5EEO A;  2F56 A;  1SAR A;  1AR0 A;  1MGR A;  4WP5 A;  1EKM A;  3B8L A;  2A15 A;  1E3R A;  5AIH A;  3CCR 3;  1N5P A;  3PCS A;  8RNT A;  1RTU A;  1J2B A;  2Q07 A;  5AEW B;  3KSE D;  1TTO A;  1JBS A;  2YFI B;  3EF8 A;  5HOH A;  2QA4 3;  1KC8 4;  4HM8 B;  1VQO 3;  1Q82 4;  1OHS A;  1BRJ A;  1LRA A;  1RRH A;  2GU1 A;  1LOW A;  1NDO B;  3AGO A;  4HOH A;  5IG0 A;  3OWS A;  4WYK A;  1N8Q A;  3HK4 A;  2AAE A;  1JB2 A;  5LC6 A;  1K28 A;  1O7H B;  2OOV C;  4MJD A;  4QWT A;  1K8A 4;  1L5G B;  2H0G A;  4ZM8 A;  1BSD A;  2MC8 A;  1NB5 I;  5BVB A;  1T3B A;  3OV4 A;  2P05 A;  2OTL 3;  3ECF A;  3S5C A;  1NO3 A;  6STD A;  1DYU A;  2GEY A;  1IYY A; 
#chains in the Genus database with same CATH homology
 1OGZ A;  1CYV A;  3EBY A;  3MKI A;  3I55 3;  1S72 3;  2QEX 3;  2F98 A;  3N54 B;  3GWR A;  3MG1 A;  4TX4 A;  3LOY A;  4WFO A;  3WMD A;  4XBX A;  2E2T A;  2Z76 A;  4NHF A;  1DVC A;  5IG4 A;  2HMJ B;  4JF8 A;  4Q53 A;  2GBX B;  2F99 A;  4J9A A;  4IT7 A;  1VQL 3;  2F86 B;  1SII A;  1W6G A;  2Y74 A;  1SQW A;  1U8C B;  3G71 3;  1Q81 4;  1JKG B;  2BMO B;  3DMC A;  5KP4 A;  1VQP 3;  1JN5 B;  1D6Z A;  2CW9 A;  3BB9 A;  3BND A;  4AKY A;  3EN1 B;  1C7H A;  5AYR B;  2GU3 A;  5D82 A;  3D9R A;  3GZY B;  4BTX A;  4N6U A;  2CK3 H;  1W6Y A;  3FH1 A;  2CWT A;  3PXM A;  4KVH A;  4LSO A;  2P0X A;  2YX9 A;  2CFW A;  2WOF A;  1TUH A;  5IEP A;  3KE7 A;  2QGU A;  2YFJ B;  5JBS A;  3STD A;  3EB8 A;  3GAX A;  3OWU A;  5ELU A;  4WWU C;  5DRE A;  3FZW A;  2XRX B;  2GBW B;  5AYS C;  1F8N A;  3CCQ 3;  2GXF A;  1YHQ 3;  1A2V A;  4L8O A;  4KFD A;  4EV2 A;  5IG3 A;  1IQX A;  5A0O B;  3JVC A;  3CC4 3;  1KD1 4;  1EQK A;  3MG2 A;  1KSI A;  1K73 4;  2CFG A;  3H51 A;  2LYX A;  1NJI 4;  4PEJ A;  1JB5 A;  3X40 A;  4BTY A;  5D81 A;  3G16 A;  3G8Z A;  4K1U A;  4N6N B;  1ULJ B;  3NXJ A;  2YFL B;  1N9J A;  4KZ1 A;  3DGO A;  4BTW A;  3LT9 A;  1G96 A;  3LML A;  3UL6 A;  3RDE A;  3HX8 A;  3NBR A;  4R1K A;  5AII A;  1GYB A;  3F40 A;  2R4I A;  2RCD A;  2SBL A;  1Q40 A;  4MMX B;  2E2U A;  1IVW A;  1V74 A;  1RKY A;  3F7S A;  2W2C A;  3LTA A;  1OF5 B;  4KFE A;  1O7P B;  1VZZ A;  2UX0 A;  3BNB A;  3SED A;  1GD3 A;  3CU3 A;  4G1M B;  1QMA A;  3EQQ B;  4MEI A;  1TFO A;  4N6O B;  1W5Z A;  3JUQ A;  3PCR A;  4MMY B;  1LNH A;  1VQM 3;  4L8P A;  2HMN B;  2OWP A;  1IVX A;  3UNL A;  1IQY A;  3FF2 A;  1PU4 A;  4ORL A;  1MNL A;  1QJG A;  1RRL A;  2CG0 A;  3X3Y A;  4NRE A;  1VQ5 3;  3JUN A;  3FG4 A;  1Q7Y 4;  3WOF B;  5CF2 A;  5LC7 A;  3HIG A;  4H3U A;  2CH9 A;  1E3V A;  2BMQ B;  3WA3 A;  3DZL A;  1DMM A;  3RGR A;  2M7O A;  4OUQ A;  3X3Z A;  3WDG B;  4XDW A;  2Y73 A;  1TFK A;  3KFQ C;  5AEU B;  1N9E A;  4FCZ A;  1K9M 4;  1VQ6 3;  1FGO A;  5AI1 A;  1WTH A;  4RNY A;  5EVH A;  5JPP A;  3LTD A;  2CFD A;  3F7X A;  3EN8 A;  3NHX A;  4EYC A;  2OQE A;  3H3H A;  3CCV 3;  2W9P A;  2P0M A;  1FUW A;  3FCS B;  1M1K 4;  2W56 B;  1O7M B;  1HU9 A;  3AMO A;  3K7C A;  1GD4 A;  5I97 A;  3N8B A;  1Z1S A;  4O02 B;  1W7C A;  3PS8 A;  4N6V 0;  5IEN A;  3BNC A;  4K90 B;  1Q42 A;  3V98 A;  2RGQ A;  3MPH A;  2BMR B;  4FMC A;  4HZB B;  5CXO A;  4XM4 A;  3PYJ A;  1OHO A;  4HM6 B;  5JPU A;  1E97 A;  1QAK A;  1OHP A;  3GZB A;  2INX A;  2MF7 A;  3L0R A;  1DMQ A;  3EC9 A;  1AV4 A;  2W6J H;  3HI7 A;  2LQV A;  1WMO A;  3S27 A;  3T8U A;  1IVV A;  1EG9 B;  3K0Z A;  5IG5 A;  2CWV A;  1OGX A;  2W0Q A;  1ULI B;  3CCM 3;  4XBT A;  1IDP A;  3F9S A;  2CC3 A;  3DY5 A;  1YJN 3;  4EC6 A;  1YGE A;  2BO9 B;  1UI7 A;  3OX9 A;  3MWZ A;  2K54 A;  1CQS A;  1GY7 A;  3BLZ A;  1STD A;  1YJW 3;  1LOX A;  1W6C A;  1LXE A;  1M90 4;  1LVN A;  1YI2 3;  3FF0 A;  4GB5 A;  4N6L A;  1W4N A;  5IW9 A;  1W2B 2;  1O7G B;  4HM5 B;  1VQ7 3;  2FGT A;  5FGO A;  3KN4 A;  3GZX B;  5EQL A;  1UUW B;  3HII A;  4HM3 B;  3GRD A;  3SLU A;  2C10 A;  2OQE C;  2BNG A;  2STD A;  1A90 A;  1TP6 A;  3WOE B;  5AIF A;  4XBY A;  3SVA A;  4OK0 A;  3T8N A;  4CDL A;  2JQ5 A;  2HMK B;  3S28 A;  3WOD G;  3G4S 3;  3NM2 A;  1JKG A;  2ML5 A;  1JN5 A;  1O7N B;  3NBJ A;  1Q86 4;  3OWY A;  4RZM A;  4CCV A;  2ML6 A;  4LEH A;  3MYT A;  1FGM A;  3Q2P A;  5CK6 A;  3FG3 A;  4GL6 A;  3ROB A;  2C11 A;  3DXO A;  5G2G A;  2XFS A;  2W03 A;  5CF1 A;  3FKA A;  3MHE A;  1YIT 3;  1IT8 A;  4RNZ A;  3V92 A;  3F14 A;  4XB5 A;  3FSD A;  4K61 A;  4HM0 B;  1GS3 A;  1GY5 A;  2CFK A;  2KXG A;  1FGR A;  4RBN A;  2XSH B;  1IVU A;  3OXA A;  3KSP A;  3NBB A;  4AEQ A;  1R4C A;  4R9L A;  4H61 A;  3U1W A;  1FGQ A;  3CNX A;  2D1W A;  4LZI A;  4N6M A;  2P38 A;  3JUP A;  2Z6B A;  3NV0 B;  3SOY A;  4K1V A;  3CNM A;  1OH0 A;  2IUK A;  3IPT A;  4U13 A;  4HBR A;  1OAC A;  2WGQ A;  4R9K A;  1VQN 3;  5CLK A;  3VF1 A;  4JRF A;  3NX0 A;  1KQS 2;  4LGQ A;  1ROA A;  2W9Q A;  4X2H A;  3NQY A;  1YVB I;  3LXU X;  1N8R 4;  2XGL A;  2XF3 A;  1ZX2 A;  4EV5 A;  4FMB A;  4O3V A;  2B24 B;  4WYK B;  5D83 A;  4FCM A;  1VQ4 3;  4HM1 B;  3B4O A;  3UB1 A;  2P09 A;  3MG3 A;  3IMA B;  4IIA A;  1YIJ 3;  1W2Z A;  1AVL A;  4N6T A;  3Q1C A;  3EX9 A;  3EJV A;  3ER7 A;  1JB4 A;  3LZA A;  5KP1 A;  1OF5 A;  3N9H A;  2CFL A;  1ASK A;  1TU5 A;  3PZW A;  4HM7 B;  2BT3 A;  2XR8 B;  3JUO A;  5ELJ A;  3G6E 3;  1RJO A;  4O2H A;  1IQ8 A;  1VQ8 3;  3KKG A;  3VGN A;  1IV9 A;  1SJW A;  3WA2 X;  3J7Y d;  1W00 A;  4FCJ A;  1MOL A;  1WQL B;  1US1 A;  2XH9 A;  1DVD A;  5HGR A;  2IUJ A;  1N5H A;  3CPO A;  2Z77 A;  1UUV B;  1FGT A;  4I4K A;  1A67 A;  1JRQ A;  3B7C A;  1U5O A;  3SOA A;  1VQ9 3;  2V1L A;  2CHC A;  3X3X A;  1KWI A;  3I0Y A;  2XFT A;  2O9U X;  1W02 A;  4STD A;  2HMM B;  3K9M C;  2CWU A;  2Z7A A;  3Q90 A;  3CME 3;  4HZ9 B;  2WOH A;  3VSY A;  3X42 A;  1BUQ A;  5IEO A;  1O7W B;  2XSO B;  3CMA 3;  3FG1 A;  5AIG A;  1GY6 A;  2ZL8 A;  2W04 A;  3DGL A;  2XEP A;  3DGN A;  4HM4 B;  1ROV A;  4MMZ B;  3CCU 3;  1J2B A;  5TGN A;  4FMD A;  4FMA A;  2W56 A;  4N3V A;  2OCT A;  2KCD A;  1OPY A;  3O8Y A;  1DMN A;  1D6U A;  4AKZ A;  2RFR A;  3BNE A;  3G0K A;  3CCJ 3;  1PFP A;  4HKV B;  3T0U A;  1TIJ A;  2KRT A;  2PNC A;  3HZP A;  4HM2 B;  1QAF A;  2GEX A;  3NM7 A;  1JNQ A;  3K63 A;  3GZR A;  4IPB A;  1T5Y A;  3U97 A;  2I9W A;  1NWW A;  1WMP A;  3SX1 A;  2ZDJ A;  2HML B;  3ALA A;  8CHO A;  3FGY A;  1JV2 B;  2QIY A;  3CCS 3;  3CCL 3;  2OTL 3;  5IF6 A;  1WMN A;  1EA2 A;  1M9G A;  1AVK A;  5FW5 A;  4R4K A;  3QRD A;  4HYZ A;  3UL5 A;  2FNQ A;  1QVG 2;  3DGM A;  3SXX A;  2O3O A;  1Y4K A;  1Q40 B;  3EHC A;  3MSO A;  3V99 A;  2B1X B;  2IA7 A;  3LH4 A;  2E2V A;  1S5A A;  4HVN A;  3A76 A;  3S29 A;  3LTC A;  1UI8 A;  4O8S A;  3D3L A;  3LYG A;  3RGA A;  1SPU A;  3X41 A;  2K0M A;  1FA3 A;  2CKF B;  3NQZ A;  3OW2 2;  2CIU A;  2IMJ A;  3B4P A;  5KP3 A;  4J8T A;  3FLJ A;  3KZT A;  3QK9 A;  2JDI H;  3CC2 3;  1IV7 A;  2HMO B;  1JJ2 2;  3UJM A;  1CYU A;  3LT8 A;  2D42 A;  2OOV A;  5BXQ A;  3EBT A;  4WHA A;  3NUV A;  5STD A;  1QAL A;  4EXR A;  4EBG A;  1K41 A;  1IT7 A;  5DRV A;  1UW1 A;  4R80 A;  1CEW I;  2BHM A;  1NU3 A;  3I56 3;  5IER A;  3CC7 3;  2WGO A;  4X2O A;  4KFF A;  1YJ9 3;  1WNH A;  7STD A;  3DUK A;  3LTB A;  4L7K A;  1M1X B;  2OTJ 3;  4XDV A;  3F8X A;  3KII A;  2RSX A;  4FR9 A;  1OUN A;  1SIH A;  3CD6 3;  2XGN A;  4LMI A;  3DM8 A;  1ZO2 A;  1VQK 3;  4OVM A;  3E99 A;  1QVF 2;  1STF I;  2CG1 A;  3CPW 2;  3PGB A;  1NB3 I;  1ISK A;  3CXC 2;  1W01 A;  1D6Y A;  3K5T A;  1OCV A;  3M8C A;  3TDG A;  2PZV A;  3F8H A;  3NV0 A;  3EE1 A;  1A2K A;  3S67 A;  4HJL B;  1RN7 A;  3AMO B;  3CCE 3;  1HKX A;  2L4V A;  3IJE B;  1IU7 A;  1IK3 A;  2WO0 A;  3JUM A;  2FXT A;  5EEO A;  1AR0 A;  4WP5 A;  1EKM A;  3B8L A;  2A15 A;  1E3R A;  5AIH A;  3CCR 3;  1N5P A;  3PCS A;  2Q07 A;  5AEW B;  3KSE D;  2YFI B;  3EF8 A;  2QA4 3;  1KC8 4;  4HM8 B;  1VQO 3;  1Q82 4;  1OHS A;  1RRH A;  5IG0 A;  2GU1 A;  1NDO B;  3OWS A;  4WYK A;  1N8Q A;  3HK4 A;  5LC6 A;  1JB2 A;  1K28 A;  1O7H B;  2OOV C;  4MJD A;  4QWT A;  1K8A 4;  1L5G B;  4ZM8 A;  2MC8 A;  1NB5 I;  5BVB A;  3OV4 A;  2P05 A;  3ECF A;  3S5C A;  1NO3 A;  6STD A;  1DYU A;  2GEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...