1VQ53

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq5300
3CMA3 2OTJ3 1VQL3 3G4S3 1N8R4 1JJ22 2QA43 1K734 1K9M4 1M904 1VQ63 3CXC2 1YHQ3 1YIT3 3CPW2 1Q7Y4 1Q864 3CCU3 1VQN3 1YJW3 3CC43 3OW22 1VQK3 1VQP3 2OTL3 1VQ93 1K8A4 1QVF2 3G713 1YI23 3CCQ3 1W2B2 1NJI4 1M1K4 1VQ43 3CCL3 1YJ93 1VQ73 1Q814 1VQ53 1VQO3 3CCV3 1KC84 2QEX3 3CC23 3CC73 1Q824 3I563 3G6E3 1YIJ3 1YJN3 1VQ83 3CD63 3I553 3CME3 1VQM3 1KD14 1S723 1QVG2 1KQS2 3CCM3 3CCE3 3CCS3 3CCR3 3CCJ3
chains in the Genus database with same CATH superfamily
1FZUA 3E99A 3HIGA 1IVXA 3N8BA 5M1AA 3GWRA 2BIRA 2GXFA 3QRDA 1D6UA 3UB1A 1M904 1S5AA 2XF3A 4HKVB 3PZWA 3NV0A 3S28A 3HIIA 1YVBI 3FF2A 4NHFA 1OH0A 1VQ93 1LNHA 1ZO2A 3GRDA 1IK3A 3CCQ3 1I2FA 1RGKA 1LOYA 1SPUA 1GS3A 3LXUX 3CNMA 1KSIA 1M9GA 3KKGA 1BRJA 1UUGB 1LOVA 1RJOA 1TFKA 1UI8A 1T2IA 2ML5A 1QVG2 4N6MA 3S27A 3LT8A 2HMOB 3L0RA 4HM8B 1IT7A 5D83A 1K41A 3DZLA 3FG4A 1CYVA 2XGLA 3DGMA 2GBWB 1JJ22 3NBRA 2F98A 4STDA 3EHCA 2ZA4A 2BHMA 1OPYA 3MYTA 5EEOA 1IVVA 1W6YA 1RHLA 3ALAA 3RDEA 1VQK3 3DGLA 1GMQA 3GZYB 1VQP3 1V74A 3SOYA 5JPUA 3BU4A 1QAKA 2OOVC 1RRHA 1NU3A 2BT3A 3F40A 5CF1A 1NO3A 1RMSA 5G1KA 3U1WA 1O7PB 3X41A 1HKXA 4HM5B 3EBTA 5DREA 5G1LA 4LSOA 3NBBA 1C7HA 5IEPA 3CCE3 1BSAA 3KE7A 1DMMA 1I2GA 1W00A 2HMNB 4J9AA 1CEWI 2CG1A 2BMOB 1AY7A 4KFDA 5D81A 4EYCA 2RFRA 1YGWA 4FMAA 1E3RA 4HM4B 1I70A 1A2KA 1K28A 1OUNA 2QIYA 3N54B 3NM2A 1OACA 3F7XA 1G0TA 2BMRB 2MC8A 3CC43 2HOHA 4HM0B 1BAOA 1ROVA 2B1XB 3B8LA 3IPTA 3Q2PA 1O7HB 2W56A 1DMNA 3Q3FA 4L7KA 4X2HA 1RGCA 1ZS7A 1L5GB 3CPOA 4GL6A 1VQ73 3OWYA 1YVSA 3DMCA 3LMLA 3BNCA 4ZM8A 5IENA 1GYBA 4WHAA 2UUGC 3EC9A 5EVHA 1FA3A 2IMJA 1JN5A 7STDA 1RGHA 1OF5A 3U97A 3LH4A 1Q40B 3I0YA 4FMDA 2O9UX 4CPKA 4CCVA 3D5GA 3MKIA 1RCLA 2E2VA 1M1XB 3A5EA 1ULJB 1BANA 4BL2A 3FG3A 3HZPA 3D5IA 1BNEA 4XBTA 4J8TA 1W7CA 1RGEA 1VQN3 4L8OA 1B3SA 1G96A 2W03A 1WNHA 3HX8A 5AEWB 3K7CA 2KF5A 2F86B 1YJN3 2KF4A 1BIRA 1DETA 4KZ1A 1VQ43 4HZ9B 5CF2A 2WGOA 3SYUA 1VQ53 1Q7HA 1V58A 3BIRA 4DKIA 2F99A 5CXOA 3KFQC 3MG3A 1TIJA 4WP5A 1I8VA 3NHXA 3QK9A 3K5TA 4O8SA 1C54A 1JRQA 4HAAA 3FZWA 1BOXA 3ZG5A 2JDIH 3BNEA 4IT7A 3SX1A 1N9EA 2BU4A 1BRGA 4U13A 1Z1SA 1IQYA 5IG5A 4J5GA 5JBSA 1N5HA 1JN5B 2KF3A 2SBLA 2OQEC 4HYZA 3F9SA 3LTCA 1NDOB 1Y4KA 1JZOA 4LMIA 2IYJA 2JQ5A 2CFGA 1UUWB 2HMKB 5HGRA 1BNFA 3S29A 2C10A 1LXEA 2XSOB 1MWTA 3CCL3 3DM8A 3DGYA 1TTOA 5IF6A 1N8QA 2Z76A 2YFJB 4O02B 3S5CA 3VSYA 3DXOA 4FCZA 3AGOA 2GU1A 4WWUC 3LT9A 3I553 3CME3 1VQM3 3H3HA 3CCM3 1IV7A 4BU4A 3EBYA 1RGAA 1D6YA 1W4NA 4N6V0 4AKZA 2L1SA 3K63A 3EN1B 4I4KA 4KT3B 1GMPA 1EG9B 3G4S3 1NB5I 1GMRA 4HBRA 1UW1A 1K734 4HOHA 1GSPA 3EE1A 1RN4A 1IYYA 5D82A 1UGHI 3FGYA 3Q90A 2CFLA 3STDA 1CYUA 1B2UA 2MF7A 2W0QA 2XGNA 4HZBB 1LOWA 1TP6A 2XR8B 4H61A 3TDGA 2P38A 4FMBA 4KVHA 1ZGXA 4MEIA 3JUQA 1IVUA 2STDA 1B2SA 2W9PA 3VF1A 1FGRA 1AQZA 4FMCA 5IW9A 1VQO3 1EA2A 2E2TA 3KSED 2CHCA 4NPBA 2BNGA 1BSEA 4LEHA 1KD14 4KFFA 3DY5A 5LC6A 2XEPA 1GOUA 3MG1A 4RBNA 4AKYA 3X42A 1UDII 3F7SA 3PCSA 2RNTA 3RGAA 1GY5A 3D9RA 1LQGC 1NB3I 5AIIA 3IJEB 5IG0A 1BUJA 1SQWA 3N9HA 1F8NA 2OOVA 3FH1A 1RRLA 1MWRA 2HMJB 1O7GB 1BNGA 1E97A 3EJVA 3SOAA 1PU4A 3CCU3 3GZBA 4L8PA 2E2UA 3KZTA 5TGNA 4XBYA 3UJMA 6STDA 2V1LA 8CHOA 1RDSA 2CFWA 2RSXA 3NXJA 1BU4A 1FYSA 1FGOA 4WYKB 4MMYB 1I3IA 1W6GA 1D6ZA 3LTAA 2ML6A 1YJ93 2XFSA 5M19A 1AVLA 2CX1A 1Q9EA 1RGFA 1HYFA 1KWIA 3CC23 3CC73 3CD63 4HM3B 2K3DA 4GHOA 3MG2A 4IIAA 3CMA3 2UGIA 1OHPA 4G1MB 3FLJA 3WDGB 3BNBA 3RGRA 2W6JH 3SLUA 1N8R4 1BNRA 1IDPA 1SARA 2C11A 2P09A 1K9M4 3NQYA 3MPHA 4RZMA 5CLKA 4EXRA 4XDVA 3CPW2 2CWVA 5I97A 3FG1A 4N3VA 1UUVB 1IU7A 3RNTA 1RNBA 3B4PA 1QVF2 4HM7B 1BRHA 1FGTA 2KCDA 4HM2B 2D1WA 2RCDA 1YI23 1I3FA 1N5PA 3AGNA 1NJI4 3D4AA 3J7Yd 1X1WA 1BVIA 4N6UA 1LQMB 1STDA 1RSNA 3AHSA 3I563 1A2VA 1O7MB 1VQ83 2C4BA 3NX0A 1LNIA 3M8CA 1KQS2 1WTHA 1S723 4K1UA 1FW7A 4OUQA 4BTYA 3LTBA 4WYKA 5RNTA 5BXQA 1AR0A 2H0HA 5DRVA 4BTXA 4I5QA 1GOYA 1B2MA 2OTJ3 5FW5A 3UL5A 2PNCA 3OV4A 5AYRB 2ZL8A 5AI1A 2L4VA 2P0XA 4K1VA 1I0VA 2CG0A 4GB5A 4Q53A 4O3VA 3VGNA 1YHQ3 1BRKA 1YNVX 1BGSA 3EF8A 1BRNL 2W9QA 4ORLA 3X3ZA 3X3YA 4EV2A 1W01A 1WQLB 3F8XA 1SIHA 4XB5A 5LC7A 1T2HA 3ZFZA 8RNTA 3LOYA 2XFTA 5BU4A 2AADA 3B4OA 2QEX3 3D79A 3KSPA 3WODG 2XH9A 3H51A 1AVKA 1MWSA 1N9JA 2YFLB 4O2HA 1RN7A 3V98A 5GSPA 3CCS3 1FGQA 1JV2B 7GSPA 4LYLB 3ECFA 5IEOA 1EQKA 3F14A 4K61A 1CQSA 3BB9A 2FGTA 2IA7A 1GY7A 3NBJA 5ELUA 1UCKA 2H0IA 3JUPA 5BIRA 1OHSA 2HMLB 3K9MC 4BL3A 1YJW3 1UCJA 4FCMA 2OTL3 5IG3A 3MWZA 1BRIA 2RGQA 5KP3A 5IG4A 5G2GA 3BNDA 3NM7A 3LZAA 2F5WA 2J8XB 2Z6BA 3WR2A 1A90A 2CFDA 3OWSA 2CKFB 1HU9A 2O3OA 3PGBA 1IT8A 1B20A 1BSBA 1FUTA 3MHEA 2CX0A 3CCR3 1TUHA 4NREA 4N6OB 5FGOA 1RN1A 3AMOA 1DVDA 2R41A 3JUMA 2F5MA 4MMZB 4MMXB 1A2PA 1BSCA 1FUSA 3D3LA 3X40A 3BLZA 1AV4A 1PYLA 4RNYA 2BO9B 3PCRA 2KAAA 4XBXA 1OCVA 3JUNA 1QAFA 1Q40A 5HOHA 1V57A 2CC3A 4H3UA 2M7OA 3CU3A 2Z7AA 2WO0A 3ROBA 3G713 1B27A 1SIIA 1I2EA 1JB5A 6GSPA 1LOXA 1I0XA 4HVNA 3JVCA 1ASKA 5ELJA 3WHOA 2CW9A 3ER7A 3A76A 2OQEA 2YX9A 2CWUA 1IQ8A 1ROAA 4QWTA 1OGXA 1MOLA 1NWWA 2P05A 2Y74A 2QGUA 1YIT3 3G16A 4LGQA 1LVNA 4CDLA 4CJNA 1GY6A 1RNTA 2ZHXB 2K0MA 1Q42A 3AHWA 1OF5B 1U5OA 1TFOA 3HOHA 2IY2A 2GBXB 4N6NB 3G0KA 3T0UA 4OVMA 1IQXA 1O7WB 2F4YA 3KCHA 3GSPA 3WOFB 1IVWA 1KC84 1T3BA 2FXTA 2INXA 4HJLB 1X1YA 3T8NA 5BVBA 3G6E3 4R1KA 1TRQA 4EW5A 3EN8A 4N6LA 4RNZA 4LZIA 1FGMA 7RNTA 1O7NB 1VZZA 1W6CA 2CH9A 1EEJA 4R4KA 2HMMB 3SXXA 3K0ZA 1TRPA 2LQVA 2A15A 4RNTA 3CXC2 4AEQA 3EB8A 3FSDA 5AYSC 1R4CA 2GSPA 4R9LA 2IUKA 1SJWA 2CFKA 3FF0A 3UL6A 2CWTA 1BNSA 3OW22 3V92A 3HI7A 5IERA 2PZVA 1W2B2 4IPBA 1B21A 1ISKA 1X1XA 2BMQB 3SEDA 3WMDA 3S67A 1M1K4 2FNQA 5M18A 1UI7A 4EC6A 2LYXA 1Q814 2GU3A 2B24B 1G02A 1US1A 1E3VA 1X1UA 2OWPA 4R9KA 2K54A 1BUQA 4PEJA 2IUJA 3WOEB 1DMQA 5A0OB 4XM4A 3O8YA 3LTDA 3WA3A 1DYUA 1T5YA 2Z77A 4KFEA 3X3XA 1IV9A 3CCJ3 1NNVA 1UCLA 3DH2A 3G8ZA 4X2OA 1DVCA 4GSPA 3DUKA 1JNQA 1PY3A 3PYJA 2SARA 1EKMA 2ZDJA 4XDWA 1MWUA 1QALA 2KRTA 2RBIA 3DGOA 1K8A4 4JRFA 3AMOB 1B2ZA 5AEUB 2UX0A 3OX9A 1VQQA 1RTUA 4J5KA 1WMOA 2GEYA 1QJGA 1YGEA 2XSHB 5AIGA 1RCKA 3CNXA 5KP4A 1BSDA 1B2XA 3GZXB 1BNJA 4JF8A 3OXAA 2GEXA 1RGGA 4FCJA 2OCTA 2Q07A 4HM6B 4K90B 3EQQB 5AIFA 1UGIA 2CK3H 3EX9A 1VQL3 1LRAA 1MNLA 1EUIC 4EV5A 1JBSA 1MGWA 6RNTA 1OHOA 1A67A 2D42A 4R80A 5KP1A 3B7CA 1GOVA 4OK0A 2WOFA 1UCIA 1CH0A 3FCSB 1HZ1A 3GAXA 1Q7Y4 1RKYA 1R4YA 1JKGB 2CIUA 4N6TA 3V99A 3WA2X 1MGRA 1RGLA 3Q1CA 1JBTA 3OWUA 1QMAA 4BIRA 3GZRA 2YFIB 3ZG0A 3NUVA 3F8HA 3IMAB 1U8CB 3UNLA 2WGQA 1YIJ3 4FR9A 3JUOA 4BTWA 1RLSA 1JBRA 3PXMA 3CCV3 1W02A 1W5ZA 3KN4A 3PS8A 1ULIB 1Q824 1WMNA 4MJDA 3NV0B 1PFPA 1WMPA 2WOHA 2W04A 1J2BA 4HM1B 4TX4A 2Y73A 5EQLA 2W2CA 1TJDA 2W56B 2KXGA 1W2ZA 2QA43 1VQ63 2P0MA 1JZDA 3NQZA 2I9WA 3FKAA 3DGNA 2H0GA 2XRXB 1JB2A 1Q864 1TU5A 5JPPA 2KF6A 3SVAA 1GD3A 5CK6A 3LYGA 3MSOA 5STDA 2F56A 2AAEA 1STFI 4ILFA 4WFOA 4EBGA 1JB4A 1ZX2A 3T8UA 1BRSA 1OGZA 3HK4A 2R4IA 3KIIA 1DE3A 3URPA 1JKGA 9RNTA 1BNIA 5AIHA 1GD4A 1FUWA
chains in the Genus database with same CATH topology
3E99A 3HIGA 1IVXA 3N8BA 3GWRA 2GXFA 3QRDA 1D6UA 3UB1A 1M904 1S5AA 2XF3A 4HKVB 3PZWA 3NV0A 3S28A 3HIIA 1YVBI 3FF2A 4NHFA 1OH0A 1VQ93 1LNHA 1ZO2A 3GRDA 1IK3A 3CCQ3 1SPUA 1GS3A 3LXUX 3CNMA 1KSIA 1M9GA 3KKGA 1RJOA 1TFKA 1UI8A 2ML5A 1QVG2 4N6MA 3S27A 3LT8A 2HMOB 3L0RA 4HM8B 1IT7A 5D83A 1K41A 3DZLA 3FG4A 1CYVA 2XGLA 3DGMA 2GBWB 1JJ22 3NBRA 2F98A 4STDA 3EHCA 2BHMA 1OPYA 3MYTA 5EEOA 1IVVA 1W6YA 3ALAA 3RDEA 1VQK3 1VQP3 3DGLA 3GZYB 1V74A 3SOYA 5JPUA 1QAKA 2OOVC 1RRHA 1NU3A 2BT3A 3F40A 5CF1A 1NO3A 3U1WA 1O7PB 3X41A 1HKXA 4HM5B 3EBTA 5DREA 4LSOA 3NBBA 1C7HA 5IEPA 3CCE3 3KE7A 1DMMA 1W00A 2HMNB 4J9AA 1CEWI 2CG1A 2BMOB 4KFDA 5D81A 4EYCA 2RFRA 4FMAA 1E3RA 4HM4B 2QIYA 1A2KA 1K28A 1OUNA 3N54B 3NM2A 1OACA 3F7XA 2BMRB 2MC8A 3CC43 4HM0B 1ROVA 2B1XB 3B8LA 3IPTA 3Q2PA 1O7HB 2W56A 1DMNA 4L7KA 4X2HA 1L5GB 1VQ73 3CPOA 4GL6A 3OWYA 3DMCA 3LMLA 3BNCA 4ZM8A 5IENA 1GYBA 4WHAA 3EC9A 5EVHA 1FA3A 2IMJA 1JN5A 7STDA 1OF5A 3U97A 3LH4A 1Q40B 3I0YA 4FMDA 2O9UX 4CCVA 3MKIA 2E2VA 1M1XB 1ULJB 3FG3A 3HZPA 4XBTA 4J8TA 1W7CA 1VQN3 4L8OA 1G96A 2W03A 1WNHA 3HX8A 5AEWB 3K7CA 2F86B 4KZ1A 1VQ43 4HZ9B 5CF2A 2WGOA 1VQ53 2F99A 5CXOA 3KFQC 3MG3A 1TIJA 4WP5A 3NHXA 3QK9A 4O8SA 3K5TA 1YJN3 1JRQA 3FZWA 2JDIH 3BNEA 4IT7A 3SX1A 1N9EA 4U13A 1Z1SA 1IQYA 5IG5A 5JBSA 1N5HA 1JN5B 2SBLA 2OQEC 4HYZA 3F9SA 3LTCA 1NDOB 1Y4KA 4LMIA 2JQ5A 2CFGA 1UUWB 2HMKB 5HGRA 3S29A 2C10A 1LXEA 2XSOB 3CCL3 3DM8A 5IF6A 1N8QA 2Z76A 2YFJB 4O02B 3S5CA 3VSYA 3DXOA 4FCZA 4WWUC 2GU1A 3I553 3LT9A 3CME3 1VQM3 1YIJ3 3H3HA 3CCM3 1IV7A 3EBYA 4AKZA 1D6YA 1W4NA 4N6V0 3K63A 3EN1B 4I4KA 3G4S3 1NB5I 1EG9B 4HBRA 1UW1A 1K734 3EE1A 5D82A 3FGYA 3Q90A 2CFLA 3STDA 1CYUA 2MF7A 2W0QA 2XGNA 4HZBB 1TP6A 2XR8B 4H61A 3TDGA 2P38A 4FMBA 4KVHA 4MEIA 3JUQA 1IVUA 2STDA 2W9PA 3VF1A 1FGRA 5IW9A 4FMCA 1VQO3 1EA2A 2E2TA 3KSED 2CHCA 2BNGA 4LEHA 1KD14 4KFFA 3DY5A 5LC6A 2XEPA 3MG1A 4RBNA 4AKYA 3X42A 3F7SA 3PCSA 3RGAA 1GY5A 3D9RA 1NB3I 5AIIA 5IG0A 3IJEB 1SQWA 3N9HA 1F8NA 2OOVA 3FH1A 1RRLA 2HMJB 1O7GB 1E97A 3EJVA 3SOAA 1PU4A 3CCU3 3GZBA 4L8PA 2E2UA 3KZTA 5TGNA 4XBYA 3UJMA 6STDA 2V1LA 8CHOA 2CFWA 2RSXA 4WYKB 3NXJA 1FGOA 4MMYB 1W6GA 1D6ZA 3LTAA 2ML6A 1YJ93 2XFSA 1AVLA 1KWIA 3CC23 3CC73 3CD63 4HM3B 3MG2A 4IIAA 3CMA3 1OHPA 4G1MB 3FLJA 3WDGB 3BNBA 3RGRA 2W6JH 3SLUA 1N8R4 1IDPA 2C11A 2P09A 1K9M4 3NQYA 3MPHA 4RZMA 5CLKA 4EXRA 4XDVA 3CPW2 2CWVA 5I97A 3FG1A 4N3VA 1UUVB 1IU7A 3B4PA 1QVF2 4HM7B 1FGTA 1NJI4 2KCDA 4HM2B 2D1WA 2RCDA 1YI23 1N5PA 3J7Yd 4N6UA 1STDA 1VQ83 3I563 1A2VA 1O7MB 3NX0A 3M8CA 1KQS2 1WTHA 1S723 4K1UA 4OUQA 4BTYA 3LTBA 4WYKA 5BXQA 1AR0A 5DRVA 4BTXA 2OTJ3 5FW5A 3UL5A 2PNCA 3OV4A 5AYRB 2ZL8A 5AI1A 2L4VA 2P0XA 4K1VA 4GB5A 2CG0A 4Q53A 4O3VA 3VGNA 1YHQ3 3EF8A 2W9QA 4ORLA 3X3ZA 3X3YA 4EV2A 1W01A 1WQLB 3F8XA 1SIHA 4XB5A 5LC7A 3LOYA 2XFTA 3B4OA 2QEX3 3KSPA 3WODG 2XH9A 3H51A 1AVKA 1N9JA 2YFLB 4O2HA 1RN7A 3V98A 3CCS3 1JV2B 1FGQA 3ECFA 5IEOA 1EQKA 3F14A 4K61A 1CQSA 3BB9A 2FGTA 2IA7A 1GY7A 3NBJA 5ELUA 3JUPA 1OHSA 2HMLB 3K9MC 1YJW3 4FCMA 2OTL3 5IG3A 3MWZA 2RGQA 5KP3A 5IG4A 5G2GA 3BNDA 3NM7A 3LZAA 2Z6BA 1A90A 2CFDA 3OWSA 2CKFB 1HU9A 2O3OA 3PGBA 1IT8A 3MHEA 3CCR3 1TUHA 4NREA 4N6OB 5FGOA 1DVDA 3AMOA 3JUMA 4MMZB 4MMXB 3X40A 3D3LA 3BLZA 1AV4A 4RNYA 2BO9B 3PCRA 4XBXA 1OCVA 3JUNA 1QAFA 1Q40A 2CC3A 4H3UA 2M7OA 3CU3A 2Z7AA 2WO0A 3ROBA 3G713 1SIIA 1JB5A 1LOXA 4HVNA 3JVCA 1ASKA 5ELJA 2CW9A 3ER7A 3A76A 2OQEA 2YX9A 2CWUA 1IQ8A 1ROAA 4QWTA 1OGXA 1MOLA 1NWWA 2P05A 2Y74A 2QGUA 1YIT3 3G16A 4LGQA 1LVNA 4CDLA 1GY6A 2K0MA 1Q42A 1OF5B 1U5OA 1TFOA 2GBXB 4N6NB 3G0KA 3T0UA 4OVMA 1IQXA 1O7WB 3WOFB 1IVWA 1KC84 4HJLB 2FXTA 2INXA 3T8NA 5BVBA 3G6E3 4R1KA 3EN8A 4N6LA 4RNZA 4LZIA 1FGMA 1O7NB 1VZZA 1W6CA 2CH9A 4R4KA 3SXXA 2HMMB 3K0ZA 2LQVA 2A15A 3CXC2 4AEQA 3EB8A 3FSDA 5AYSC 1R4CA 4R9LA 2IUKA 1SJWA 2CFKA 3FF0A 3UL6A 2CWTA 3OW22 3V92A 3HI7A 5IERA 2PZVA 1W2B2 4IPBA 1ISKA 2BMQB 1M1K4 3SEDA 3WMDA 3S67A 2FNQA 1UI7A 4EC6A 2LYXA 1Q814 2GU3A 2B24B 2OWPA 1US1A 1E3VA 4R9KA 1BUQA 2K54A 4PEJA 2IUJA 3WOEB 1DMQA 5A0OB 4XM4A 3O8YA 3LTDA 3WA3A 1DYUA 1T5YA 2Z77A 4KFEA 3X3XA 1IV9A 3CCJ3 3G8ZA 4X2OA 1DVCA 3DUKA 1JNQA 3PYJA 1EKMA 2ZDJA 4XDWA 1QALA 2KRTA 3DGOA 1K8A4 4JRFA 3AMOB 5AEUB 2UX0A 3OX9A 1WMOA 2GEYA 1QJGA 1YGEA 2XSHB 5AIGA 3CNXA 5KP4A 3GZXB 4JF8A 3OXAA 2GEXA 4FCJA 2OCTA 2Q07A 4HM6B 4K90B 3EQQB 5AIFA 2CK3H 3EX9A 1VQL3 1MNLA 4EV5A 1OHOA 1A67A 2D42A 4R80A 5KP1A 3B7CA 4OK0A 2WOFA 3FCSB 1Q7Y4 3GAXA 1RKYA 2CIUA 1JKGB 3V99A 4N6TA 3WA2X 3Q1CA 3OWUA 1QMAA 3GZRA 2YFIB 3NUVA 3F8HA 3IMAB 1U8CB 3UNLA 2WGQA 4FR9A 3JUOA 4BTWA 3PXMA 3CCV3 1W02A 1W5ZA 3KN4A 3PS8A 1ULIB 1Q824 1WMNA 4MJDA 3NV0B 1PFPA 1WMPA 2WOHA 2W04A 1J2BA 4HM1B 4TX4A 2Y73A 5EQLA 2W2CA 2W56B 2KXGA 1W2ZA 2QA43 1VQ63 2P0MA 3NQZA 2I9WA 3FKAA 3DGNA 2XRXB 1JB2A 1Q864 1TU5A 5JPPA 3SVAA 1GD3A 5CK6A 3LYGA 3MSOA 5STDA 4WFOA 1STFI 4EBGA 1JB4A 1ZX2A 3T8UA 1OGZA 3HK4A 2R4IA 3KIIA 1JKGA 5AIHA 1GD4A 1FUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA 3;  2OTJ 3;  1VQL 3;  3G4S 3;  1N8R 4;  1JJ2 2;  2QA4 3;  1K73 4;  1K9M 4;  1M90 4;  1VQ6 3;  3CXC 2;  1YHQ 3;  1YIT 3;  3CPW 2;  1Q7Y 4;  1Q86 4;  3CCU 3;  1VQN 3;  1YJW 3;  3CC4 3;  3OW2 2;  1VQK 3;  1VQP 3;  2OTL 3;  1VQ9 3;  1K8A 4;  1QVF 2;  3G71 3;  1YI2 3;  3CCQ 3;  1W2B 2;  1NJI 4;  1M1K 4;  1VQ4 3;  3CCL 3;  1YJ9 3;  1VQ7 3;  1Q81 4;  1VQ5 3;  1VQO 3;  3CCV 3;  1KC8 4;  2QEX 3;  3CC2 3;  3CC7 3;  1Q82 4;  3I56 3;  3G6E 3;  1YIJ 3;  1YJN 3;  1VQ8 3;  3CD6 3;  3I55 3;  3CME 3;  1VQM 3;  1KD1 4;  1S72 3;  1QVG 2;  1KQS 2;  3CCM 3;  3CCE 3;  3CCS 3;  3CCR 3;  3CCJ 3; 
#chains in the Genus database with same CATH topology
 1FZU A;  3E99 A;  3HIG A;  1IVX A;  3N8B A;  5M1A A;  3GWR A;  2BIR A;  2GXF A;  3QRD A;  1D6U A;  3UB1 A;  1M90 4;  1S5A A;  2XF3 A;  4HKV B;  3PZW A;  3NV0 A;  3S28 A;  3HII A;  1YVB I;  3FF2 A;  4NHF A;  1OH0 A;  1VQ9 3;  1LNH A;  1ZO2 A;  3GRD A;  1IK3 A;  3CCQ 3;  1I2F A;  1RGK A;  1LOY A;  1SPU A;  1GS3 A;  3LXU X;  3CNM A;  1KSI A;  1M9G A;  3KKG A;  1BRJ A;  1UUG B;  1LOV A;  1RJO A;  1TFK A;  1UI8 A;  1T2I A;  2ML5 A;  1QVG 2;  4N6M A;  3S27 A;  3LT8 A;  2HMO B;  3L0R A;  4HM8 B;  1IT7 A;  5D83 A;  1K41 A;  3DZL A;  3FG4 A;  1CYV A;  2XGL A;  3DGM A;  2GBW B;  1JJ2 2;  3NBR A;  2F98 A;  4STD A;  3EHC A;  2ZA4 A;  2BHM A;  1OPY A;  3MYT A;  5EEO A;  1IVV A;  1W6Y A;  1RHL A;  3ALA A;  3RDE A;  1VQK 3;  3DGL A;  1GMQ A;  3GZY B;  1VQP 3;  1V74 A;  3SOY A;  5JPU A;  3BU4 A;  1QAK A;  2OOV C;  1RRH A;  1NU3 A;  2BT3 A;  3F40 A;  5CF1 A;  1NO3 A;  1RMS A;  5G1K A;  3U1W A;  1O7P B;  3X41 A;  1HKX A;  4HM5 B;  3EBT A;  5DRE A;  5G1L A;  4LSO A;  3NBB A;  1C7H A;  5IEP A;  3CCE 3;  1BSA A;  3KE7 A;  1DMM A;  1I2G A;  1W00 A;  2HMN B;  4J9A A;  1CEW I;  2CG1 A;  2BMO B;  1AY7 A;  4KFD A;  5D81 A;  4EYC A;  2RFR A;  1YGW A;  4FMA A;  1E3R A;  4HM4 B;  1I70 A;  1A2K A;  1K28 A;  1OUN A;  2QIY A;  3N54 B;  3NM2 A;  1OAC A;  3F7X A;  1G0T A;  2BMR B;  2MC8 A;  3CC4 3;  2HOH A;  4HM0 B;  1BAO A;  1ROV A;  2B1X B;  3B8L A;  3IPT A;  3Q2P A;  1O7H B;  2W56 A;  1DMN A;  3Q3F A;  4L7K A;  4X2H A;  1RGC A;  1ZS7 A;  1L5G B;  3CPO A;  4GL6 A;  1VQ7 3;  3OWY A;  1YVS A;  3DMC A;  3LML A;  3BNC A;  4ZM8 A;  5IEN A;  1GYB A;  4WHA A;  2UUG C;  3EC9 A;  5EVH A;  1FA3 A;  2IMJ A;  1JN5 A;  7STD A;  1RGH A;  1OF5 A;  3U97 A;  3LH4 A;  1Q40 B;  3I0Y A;  4FMD A;  2O9U X;  4CPK A;  4CCV A;  3D5G A;  3MKI A;  1RCL A;  2E2V A;  1M1X B;  3A5E A;  1ULJ B;  1BAN A;  4BL2 A;  3FG3 A;  3HZP A;  3D5I A;  1BNE A;  4XBT A;  4J8T A;  1W7C A;  1RGE A;  1VQN 3;  4L8O A;  1B3S A;  1G96 A;  2W03 A;  1WNH A;  3HX8 A;  5AEW B;  3K7C A;  2KF5 A;  2F86 B;  1YJN 3;  2KF4 A;  1BIR A;  1DET A;  4KZ1 A;  1VQ4 3;  4HZ9 B;  5CF2 A;  2WGO A;  3SYU A;  1VQ5 3;  1Q7H A;  1V58 A;  3BIR A;  4DKI A;  2F99 A;  5CXO A;  3KFQ C;  3MG3 A;  1TIJ A;  4WP5 A;  1I8V A;  3NHX A;  3QK9 A;  3K5T A;  4O8S A;  1C54 A;  1JRQ A;  4HAA A;  3FZW A;  1BOX A;  3ZG5 A;  2JDI H;  3BNE A;  4IT7 A;  3SX1 A;  1N9E A;  2BU4 A;  1BRG A;  4U13 A;  1Z1S A;  1IQY A;  5IG5 A;  4J5G A;  5JBS A;  1N5H A;  1JN5 B;  2KF3 A;  2SBL A;  2OQE C;  4HYZ A;  3F9S A;  3LTC A;  1NDO B;  1Y4K A;  1JZO A;  4LMI A;  2IYJ A;  2JQ5 A;  2CFG A;  1UUW B;  2HMK B;  5HGR A;  1BNF A;  3S29 A;  2C10 A;  1LXE A;  2XSO B;  1MWT A;  3CCL 3;  3DM8 A;  3DGY A;  1TTO A;  5IF6 A;  1N8Q A;  2Z76 A;  2YFJ B;  4O02 B;  3S5C A;  3VSY A;  3DXO A;  4FCZ A;  3AGO A;  2GU1 A;  4WWU C;  3LT9 A;  3I55 3;  3CME 3;  1VQM 3;  3H3H A;  3CCM 3;  1IV7 A;  4BU4 A;  3EBY A;  1RGA A;  1D6Y A;  1W4N A;  4N6V 0;  4AKZ A;  2L1S A;  3K63 A;  3EN1 B;  4I4K A;  4KT3 B;  1GMP A;  1EG9 B;  3G4S 3;  1NB5 I;  1GMR A;  4HBR A;  1UW1 A;  1K73 4;  4HOH A;  1GSP A;  3EE1 A;  1RN4 A;  1IYY A;  5D82 A;  1UGH I;  3FGY A;  3Q90 A;  2CFL A;  3STD A;  1CYU A;  1B2U A;  2MF7 A;  2W0Q A;  2XGN A;  4HZB B;  1LOW A;  1TP6 A;  2XR8 B;  4H61 A;  3TDG A;  2P38 A;  4FMB A;  4KVH A;  1ZGX A;  4MEI A;  3JUQ A;  1IVU A;  2STD A;  1B2S A;  2W9P A;  3VF1 A;  1FGR A;  1AQZ A;  4FMC A;  5IW9 A;  1VQO 3;  1EA2 A;  2E2T A;  3KSE D;  2CHC A;  4NPB A;  2BNG A;  1BSE A;  4LEH A;  1KD1 4;  4KFF A;  3DY5 A;  5LC6 A;  2XEP A;  1GOU A;  3MG1 A;  4RBN A;  4AKY A;  3X42 A;  1UDI I;  3F7S A;  3PCS A;  2RNT A;  3RGA A;  1GY5 A;  3D9R A;  1LQG C;  1NB3 I;  5AII A;  3IJE B;  5IG0 A;  1BUJ A;  1SQW A;  3N9H A;  1F8N A;  2OOV A;  3FH1 A;  1RRL A;  1MWR A;  2HMJ B;  1O7G B;  1BNG A;  1E97 A;  3EJV A;  3SOA A;  1PU4 A;  3CCU 3;  3GZB A;  4L8P A;  2E2U A;  3KZT A;  5TGN A;  4XBY A;  3UJM A;  6STD A;  2V1L A;  8CHO A;  1RDS A;  2CFW A;  2RSX A;  3NXJ A;  1BU4 A;  1FYS A;  1FGO A;  4WYK B;  4MMY B;  1I3I A;  1W6G A;  1D6Z A;  3LTA A;  2ML6 A;  1YJ9 3;  2XFS A;  5M19 A;  1AVL A;  2CX1 A;  1Q9E A;  1RGF A;  1HYF A;  1KWI A;  3CC2 3;  3CC7 3;  3CD6 3;  4HM3 B;  2K3D A;  4GHO A;  3MG2 A;  4IIA A;  3CMA 3;  2UGI A;  1OHP A;  4G1M B;  3FLJ A;  3WDG B;  3BNB A;  3RGR A;  2W6J H;  3SLU A;  1N8R 4;  1BNR A;  1IDP A;  1SAR A;  2C11 A;  2P09 A;  1K9M 4;  3NQY A;  3MPH A;  4RZM A;  5CLK A;  4EXR A;  4XDV A;  3CPW 2;  2CWV A;  5I97 A;  3FG1 A;  4N3V A;  1UUV B;  1IU7 A;  3RNT A;  1RNB A;  3B4P A;  1QVF 2;  4HM7 B;  1BRH A;  1FGT A;  2KCD A;  4HM2 B;  2D1W A;  2RCD A;  1YI2 3;  1I3F A;  1N5P A;  3AGN A;  1NJI 4;  3D4A A;  3J7Y d;  1X1W A;  1BVI A;  4N6U A;  1LQM B;  1STD A;  1RSN A;  3AHS A;  3I56 3;  1A2V A;  1O7M B;  1VQ8 3;  2C4B A;  3NX0 A;  1LNI A;  3M8C A;  1KQS 2;  1WTH A;  1S72 3;  4K1U A;  1FW7 A;  4OUQ A;  4BTY A;  3LTB A;  4WYK A;  5RNT A;  5BXQ A;  1AR0 A;  2H0H A;  5DRV A;  4BTX A;  4I5Q A;  1GOY A;  1B2M A;  2OTJ 3;  5FW5 A;  3UL5 A;  2PNC A;  3OV4 A;  5AYR B;  2ZL8 A;  5AI1 A;  2L4V A;  2P0X A;  4K1V A;  1I0V A;  2CG0 A;  4GB5 A;  4Q53 A;  4O3V A;  3VGN A;  1YHQ 3;  1BRK A;  1YNV X;  1BGS A;  3EF8 A;  1BRN L;  2W9Q A;  4ORL A;  3X3Z A;  3X3Y A;  4EV2 A;  1W01 A;  1WQL B;  3F8X A;  1SIH A;  4XB5 A;  5LC7 A;  1T2H A;  3ZFZ A;  8RNT A;  3LOY A;  2XFT A;  5BU4 A;  2AAD A;  3B4O A;  2QEX 3;  3D79 A;  3KSP A;  3WOD G;  2XH9 A;  3H51 A;  1AVK A;  1MWS A;  1N9J A;  2YFL B;  4O2H A;  1RN7 A;  3V98 A;  5GSP A;  3CCS 3;  1FGQ A;  1JV2 B;  7GSP A;  4LYL B;  3ECF A;  5IEO A;  1EQK A;  3F14 A;  4K61 A;  1CQS A;  3BB9 A;  2FGT A;  2IA7 A;  1GY7 A;  3NBJ A;  5ELU A;  1UCK A;  2H0I A;  3JUP A;  5BIR A;  1OHS A;  2HML B;  3K9M C;  4BL3 A;  1YJW 3;  1UCJ A;  4FCM A;  2OTL 3;  5IG3 A;  3MWZ A;  1BRI A;  2RGQ A;  5KP3 A;  5IG4 A;  5G2G A;  3BND A;  3NM7 A;  3LZA A;  2F5W A;  2J8X B;  2Z6B A;  3WR2 A;  1A90 A;  2CFD A;  3OWS A;  2CKF B;  1HU9 A;  2O3O A;  3PGB A;  1IT8 A;  1B20 A;  1BSB A;  1FUT A;  3MHE A;  2CX0 A;  3CCR 3;  1TUH A;  4NRE A;  4N6O B;  5FGO A;  1RN1 A;  3AMO A;  1DVD A;  2R41 A;  3JUM A;  2F5M A;  4MMZ B;  4MMX B;  1A2P A;  1BSC A;  1FUS A;  3D3L A;  3X40 A;  3BLZ A;  1AV4 A;  1PYL A;  4RNY A;  2BO9 B;  3PCR A;  2KAA A;  4XBX A;  1OCV A;  3JUN A;  1QAF A;  1Q40 A;  5HOH A;  1V57 A;  2CC3 A;  4H3U A;  2M7O A;  3CU3 A;  2Z7A A;  2WO0 A;  3ROB A;  3G71 3;  1B27 A;  1SII A;  1I2E A;  1JB5 A;  6GSP A;  1LOX A;  1I0X A;  4HVN A;  3JVC A;  1ASK A;  5ELJ A;  3WHO A;  2CW9 A;  3ER7 A;  3A76 A;  2OQE A;  2YX9 A;  2CWU A;  1IQ8 A;  1ROA A;  4QWT A;  1OGX A;  1MOL A;  1NWW A;  2P05 A;  2Y74 A;  2QGU A;  1YIT 3;  3G16 A;  4LGQ A;  1LVN A;  4CDL A;  4CJN A;  1GY6 A;  1RNT A;  2ZHX B;  2K0M A;  1Q42 A;  3AHW A;  1OF5 B;  1U5O A;  1TFO A;  3HOH A;  2IY2 A;  2GBX B;  4N6N B;  3G0K A;  3T0U A;  4OVM A;  1IQX A;  1O7W B;  2F4Y A;  3KCH A;  3GSP A;  3WOF B;  1IVW A;  1KC8 4;  1T3B A;  2FXT A;  2INX A;  4HJL B;  1X1Y A;  3T8N A;  5BVB A;  3G6E 3;  4R1K A;  1TRQ A;  4EW5 A;  3EN8 A;  4N6L A;  4RNZ A;  4LZI A;  1FGM A;  7RNT A;  1O7N B;  1VZZ A;  1W6C A;  2CH9 A;  1EEJ A;  4R4K A;  2HMM B;  3SXX A;  3K0Z A;  1TRP A;  2LQV A;  2A15 A;  4RNT A;  3CXC 2;  4AEQ A;  3EB8 A;  3FSD A;  5AYS C;  1R4C A;  2GSP A;  4R9L A;  2IUK A;  1SJW A;  2CFK A;  3FF0 A;  3UL6 A;  2CWT A;  1BNS A;  3OW2 2;  3V92 A;  3HI7 A;  5IER A;  2PZV A;  1W2B 2;  4IPB A;  1B21 A;  1ISK A;  1X1X A;  2BMQ B;  3SED A;  3WMD A;  3S67 A;  1M1K 4;  2FNQ A;  5M18 A;  1UI7 A;  4EC6 A;  2LYX A;  1Q81 4;  2GU3 A;  2B24 B;  1G02 A;  1US1 A;  1E3V A;  1X1U A;  2OWP A;  4R9K A;  2K54 A;  1BUQ A;  4PEJ A;  2IUJ A;  3WOE B;  1DMQ A;  5A0O B;  4XM4 A;  3O8Y A;  3LTD A;  3WA3 A;  1DYU A;  1T5Y A;  2Z77 A;  4KFE A;  3X3X A;  1IV9 A;  3CCJ 3;  1NNV A;  1UCL A;  3DH2 A;  3G8Z A;  4X2O A;  1DVC A;  4GSP A;  3DUK A;  1JNQ A;  1PY3 A;  3PYJ A;  2SAR A;  1EKM A;  2ZDJ A;  4XDW A;  1MWU A;  1QAL A;  2KRT A;  2RBI A;  3DGO A;  1K8A 4;  4JRF A;  3AMO B;  1B2Z A;  5AEU B;  2UX0 A;  3OX9 A;  1VQQ A;  1RTU A;  4J5K A;  1WMO A;  2GEY A;  1QJG A;  1YGE A;  2XSH B;  5AIG A;  1RCK A;  3CNX A;  5KP4 A;  1BSD A;  1B2X A;  3GZX B;  1BNJ A;  4JF8 A;  3OXA A;  2GEX A;  1RGG A;  4FCJ A;  2OCT A;  2Q07 A;  4HM6 B;  4K90 B;  3EQQ B;  5AIF A;  1UGI A;  2CK3 H;  3EX9 A;  1VQL 3;  1LRA A;  1MNL A;  1EUI C;  4EV5 A;  1JBS A;  1MGW A;  6RNT A;  1OHO A;  1A67 A;  2D42 A;  4R80 A;  5KP1 A;  3B7C A;  1GOV A;  4OK0 A;  2WOF A;  1UCI A;  1CH0 A;  3FCS B;  1HZ1 A;  3GAX A;  1Q7Y 4;  1RKY A;  1R4Y A;  1JKG B;  2CIU A;  4N6T A;  3V99 A;  3WA2 X;  1MGR A;  1RGL A;  3Q1C A;  1JBT A;  3OWU A;  1QMA A;  4BIR A;  3GZR A;  2YFI B;  3ZG0 A;  3NUV A;  3F8H A;  3IMA B;  1U8C B;  3UNL A;  2WGQ A;  1YIJ 3;  4FR9 A;  3JUO A;  4BTW A;  1RLS A;  1JBR A;  3PXM A;  3CCV 3;  1W02 A;  1W5Z A;  3KN4 A;  3PS8 A;  1ULI B;  1Q82 4;  1WMN A;  4MJD A;  3NV0 B;  1PFP A;  1WMP A;  2WOH A;  2W04 A;  1J2B A;  4HM1 B;  4TX4 A;  2Y73 A;  5EQL A;  2W2C A;  1TJD A;  2W56 B;  2KXG A;  1W2Z A;  2QA4 3;  1VQ6 3;  2P0M A;  1JZD A;  3NQZ A;  2I9W A;  3FKA A;  3DGN A;  2H0G A;  2XRX B;  1JB2 A;  1Q86 4;  1TU5 A;  5JPP A;  2KF6 A;  3SVA A;  1GD3 A;  5CK6 A;  3LYG A;  3MSO A;  5STD A;  2F56 A;  2AAE A;  1STF I;  4ILF A;  4WFO A;  4EBG A;  1JB4 A;  1ZX2 A;  3T8U A;  1BRS A;  1OGZ A;  3HK4 A;  2R4I A;  3KII A;  1DE3 A;  3URP A;  1JKG A;  9RNT A;  1BNI A;  5AIH A;  1GD4 A;  1FUW A; 
#chains in the Genus database with same CATH homology
 3E99 A;  3HIG A;  1IVX A;  3N8B A;  3GWR A;  2GXF A;  3QRD A;  1D6U A;  3UB1 A;  1M90 4;  1S5A A;  2XF3 A;  4HKV B;  3PZW A;  3NV0 A;  3S28 A;  3HII A;  1YVB I;  3FF2 A;  4NHF A;  1OH0 A;  1VQ9 3;  1LNH A;  1ZO2 A;  3GRD A;  1IK3 A;  3CCQ 3;  1SPU A;  1GS3 A;  3LXU X;  3CNM A;  1KSI A;  1M9G A;  3KKG A;  1RJO A;  1TFK A;  1UI8 A;  2ML5 A;  1QVG 2;  4N6M A;  3S27 A;  3LT8 A;  2HMO B;  3L0R A;  4HM8 B;  1IT7 A;  5D83 A;  1K41 A;  3DZL A;  3FG4 A;  1CYV A;  2XGL A;  3DGM A;  2GBW B;  1JJ2 2;  3NBR A;  2F98 A;  4STD A;  3EHC A;  2BHM A;  1OPY A;  3MYT A;  5EEO A;  1IVV A;  1W6Y A;  3ALA A;  3RDE A;  1VQK 3;  1VQP 3;  3DGL A;  3GZY B;  1V74 A;  3SOY A;  5JPU A;  1QAK A;  2OOV C;  1RRH A;  1NU3 A;  2BT3 A;  3F40 A;  5CF1 A;  1NO3 A;  3U1W A;  1O7P B;  3X41 A;  1HKX A;  4HM5 B;  3EBT A;  5DRE A;  4LSO A;  3NBB A;  1C7H A;  5IEP A;  3CCE 3;  3KE7 A;  1DMM A;  1W00 A;  2HMN B;  4J9A A;  1CEW I;  2CG1 A;  2BMO B;  4KFD A;  5D81 A;  4EYC A;  2RFR A;  4FMA A;  1E3R A;  4HM4 B;  2QIY A;  1A2K A;  1K28 A;  1OUN A;  3N54 B;  3NM2 A;  1OAC A;  3F7X A;  2BMR B;  2MC8 A;  3CC4 3;  4HM0 B;  1ROV A;  2B1X B;  3B8L A;  3IPT A;  3Q2P A;  1O7H B;  2W56 A;  1DMN A;  4L7K A;  4X2H A;  1L5G B;  1VQ7 3;  3CPO A;  4GL6 A;  3OWY A;  3DMC A;  3LML A;  3BNC A;  4ZM8 A;  5IEN A;  1GYB A;  4WHA A;  3EC9 A;  5EVH A;  1FA3 A;  2IMJ A;  1JN5 A;  7STD A;  1OF5 A;  3U97 A;  3LH4 A;  1Q40 B;  3I0Y A;  4FMD A;  2O9U X;  4CCV A;  3MKI A;  2E2V A;  1M1X B;  1ULJ B;  3FG3 A;  3HZP A;  4XBT A;  4J8T A;  1W7C A;  1VQN 3;  4L8O A;  1G96 A;  2W03 A;  1WNH A;  3HX8 A;  5AEW B;  3K7C A;  2F86 B;  4KZ1 A;  1VQ4 3;  4HZ9 B;  5CF2 A;  2WGO A;  1VQ5 3;  2F99 A;  5CXO A;  3KFQ C;  3MG3 A;  1TIJ A;  4WP5 A;  3NHX A;  3QK9 A;  4O8S A;  3K5T A;  1YJN 3;  1JRQ A;  3FZW A;  2JDI H;  3BNE A;  4IT7 A;  3SX1 A;  1N9E A;  4U13 A;  1Z1S A;  1IQY A;  5IG5 A;  5JBS A;  1N5H A;  1JN5 B;  2SBL A;  2OQE C;  4HYZ A;  3F9S A;  3LTC A;  1NDO B;  1Y4K A;  4LMI A;  2JQ5 A;  2CFG A;  1UUW B;  2HMK B;  5HGR A;  3S29 A;  2C10 A;  1LXE A;  2XSO B;  3CCL 3;  3DM8 A;  5IF6 A;  1N8Q A;  2Z76 A;  2YFJ B;  4O02 B;  3S5C A;  3VSY A;  3DXO A;  4FCZ A;  4WWU C;  2GU1 A;  3I55 3;  3LT9 A;  3CME 3;  1VQM 3;  1YIJ 3;  3H3H A;  3CCM 3;  1IV7 A;  3EBY A;  4AKZ A;  1D6Y A;  1W4N A;  4N6V 0;  3K63 A;  3EN1 B;  4I4K A;  3G4S 3;  1NB5 I;  1EG9 B;  4HBR A;  1UW1 A;  1K73 4;  3EE1 A;  5D82 A;  3FGY A;  3Q90 A;  2CFL A;  3STD A;  1CYU A;  2MF7 A;  2W0Q A;  2XGN A;  4HZB B;  1TP6 A;  2XR8 B;  4H61 A;  3TDG A;  2P38 A;  4FMB A;  4KVH A;  4MEI A;  3JUQ A;  1IVU A;  2STD A;  2W9P A;  3VF1 A;  1FGR A;  5IW9 A;  4FMC A;  1VQO 3;  1EA2 A;  2E2T A;  3KSE D;  2CHC A;  2BNG A;  4LEH A;  1KD1 4;  4KFF A;  3DY5 A;  5LC6 A;  2XEP A;  3MG1 A;  4RBN A;  4AKY A;  3X42 A;  3F7S A;  3PCS A;  3RGA A;  1GY5 A;  3D9R A;  1NB3 I;  5AII A;  5IG0 A;  3IJE B;  1SQW A;  3N9H A;  1F8N A;  2OOV A;  3FH1 A;  1RRL A;  2HMJ B;  1O7G B;  1E97 A;  3EJV A;  3SOA A;  1PU4 A;  3CCU 3;  3GZB A;  4L8P A;  2E2U A;  3KZT A;  5TGN A;  4XBY A;  3UJM A;  6STD A;  2V1L A;  8CHO A;  2CFW A;  2RSX A;  4WYK B;  3NXJ A;  1FGO A;  4MMY B;  1W6G A;  1D6Z A;  3LTA A;  2ML6 A;  1YJ9 3;  2XFS A;  1AVL A;  1KWI A;  3CC2 3;  3CC7 3;  3CD6 3;  4HM3 B;  3MG2 A;  4IIA A;  3CMA 3;  1OHP A;  4G1M B;  3FLJ A;  3WDG B;  3BNB A;  3RGR A;  2W6J H;  3SLU A;  1N8R 4;  1IDP A;  2C11 A;  2P09 A;  1K9M 4;  3NQY A;  3MPH A;  4RZM A;  5CLK A;  4EXR A;  4XDV A;  3CPW 2;  2CWV A;  5I97 A;  3FG1 A;  4N3V A;  1UUV B;  1IU7 A;  3B4P A;  1QVF 2;  4HM7 B;  1FGT A;  1NJI 4;  2KCD A;  4HM2 B;  2D1W A;  2RCD A;  1YI2 3;  1N5P A;  3J7Y d;  4N6U A;  1STD A;  1VQ8 3;  3I56 3;  1A2V A;  1O7M B;  3NX0 A;  3M8C A;  1KQS 2;  1WTH A;  1S72 3;  4K1U A;  4OUQ A;  4BTY A;  3LTB A;  4WYK A;  5BXQ A;  1AR0 A;  5DRV A;  4BTX A;  2OTJ 3;  5FW5 A;  3UL5 A;  2PNC A;  3OV4 A;  5AYR B;  2ZL8 A;  5AI1 A;  2L4V A;  2P0X A;  4K1V A;  4GB5 A;  2CG0 A;  4Q53 A;  4O3V A;  3VGN A;  1YHQ 3;  3EF8 A;  2W9Q A;  4ORL A;  3X3Z A;  3X3Y A;  4EV2 A;  1W01 A;  1WQL B;  3F8X A;  1SIH A;  4XB5 A;  5LC7 A;  3LOY A;  2XFT A;  3B4O A;  2QEX 3;  3KSP A;  3WOD G;  2XH9 A;  3H51 A;  1AVK A;  1N9J A;  2YFL B;  4O2H A;  1RN7 A;  3V98 A;  3CCS 3;  1JV2 B;  1FGQ A;  3ECF A;  5IEO A;  1EQK A;  3F14 A;  4K61 A;  1CQS A;  3BB9 A;  2FGT A;  2IA7 A;  1GY7 A;  3NBJ A;  5ELU A;  3JUP A;  1OHS A;  2HML B;  3K9M C;  1YJW 3;  4FCM A;  2OTL 3;  5IG3 A;  3MWZ A;  2RGQ A;  5KP3 A;  5IG4 A;  5G2G A;  3BND A;  3NM7 A;  3LZA A;  2Z6B A;  1A90 A;  2CFD A;  3OWS A;  2CKF B;  1HU9 A;  2O3O A;  3PGB A;  1IT8 A;  3MHE A;  3CCR 3;  1TUH A;  4NRE A;  4N6O B;  5FGO A;  1DVD A;  3AMO A;  3JUM A;  4MMZ B;  4MMX B;  3X40 A;  3D3L A;  3BLZ A;  1AV4 A;  4RNY A;  2BO9 B;  3PCR A;  4XBX A;  1OCV A;  3JUN A;  1QAF A;  1Q40 A;  2CC3 A;  4H3U A;  2M7O A;  3CU3 A;  2Z7A A;  2WO0 A;  3ROB A;  3G71 3;  1SII A;  1JB5 A;  1LOX A;  4HVN A;  3JVC A;  1ASK A;  5ELJ A;  2CW9 A;  3ER7 A;  3A76 A;  2OQE A;  2YX9 A;  2CWU A;  1IQ8 A;  1ROA A;  4QWT A;  1OGX A;  1MOL A;  1NWW A;  2P05 A;  2Y74 A;  2QGU A;  1YIT 3;  3G16 A;  4LGQ A;  1LVN A;  4CDL A;  1GY6 A;  2K0M A;  1Q42 A;  1OF5 B;  1U5O A;  1TFO A;  2GBX B;  4N6N B;  3G0K A;  3T0U A;  4OVM A;  1IQX A;  1O7W B;  3WOF B;  1IVW A;  1KC8 4;  4HJL B;  2FXT A;  2INX A;  3T8N A;  5BVB A;  3G6E 3;  4R1K A;  3EN8 A;  4N6L A;  4RNZ A;  4LZI A;  1FGM A;  1O7N B;  1VZZ A;  1W6C A;  2CH9 A;  4R4K A;  3SXX A;  2HMM B;  3K0Z A;  2LQV A;  2A15 A;  3CXC 2;  4AEQ A;  3EB8 A;  3FSD A;  5AYS C;  1R4C A;  4R9L A;  2IUK A;  1SJW A;  2CFK A;  3FF0 A;  3UL6 A;  2CWT A;  3OW2 2;  3V92 A;  3HI7 A;  5IER A;  2PZV A;  1W2B 2;  4IPB A;  1ISK A;  2BMQ B;  1M1K 4;  3SED A;  3WMD A;  3S67 A;  2FNQ A;  1UI7 A;  4EC6 A;  2LYX A;  1Q81 4;  2GU3 A;  2B24 B;  2OWP A;  1US1 A;  1E3V A;  4R9K A;  1BUQ A;  2K54 A;  4PEJ A;  2IUJ A;  3WOE B;  1DMQ A;  5A0O B;  4XM4 A;  3O8Y A;  3LTD A;  3WA3 A;  1DYU A;  1T5Y A;  2Z77 A;  4KFE A;  3X3X A;  1IV9 A;  3CCJ 3;  3G8Z A;  4X2O A;  1DVC A;  3DUK A;  1JNQ A;  3PYJ A;  1EKM A;  2ZDJ A;  4XDW A;  1QAL A;  2KRT A;  3DGO A;  1K8A 4;  4JRF A;  3AMO B;  5AEU B;  2UX0 A;  3OX9 A;  1WMO A;  2GEY A;  1QJG A;  1YGE A;  2XSH B;  5AIG A;  3CNX A;  5KP4 A;  3GZX B;  4JF8 A;  3OXA A;  2GEX A;  4FCJ A;  2OCT A;  2Q07 A;  4HM6 B;  4K90 B;  3EQQ B;  5AIF A;  2CK3 H;  3EX9 A;  1VQL 3;  1MNL A;  4EV5 A;  1OHO A;  1A67 A;  2D42 A;  4R80 A;  5KP1 A;  3B7C A;  4OK0 A;  2WOF A;  3FCS B;  1Q7Y 4;  3GAX A;  1RKY A;  2CIU A;  1JKG B;  3V99 A;  4N6T A;  3WA2 X;  3Q1C A;  3OWU A;  1QMA A;  3GZR A;  2YFI B;  3NUV A;  3F8H A;  3IMA B;  1U8C B;  3UNL A;  2WGQ A;  4FR9 A;  3JUO A;  4BTW A;  3PXM A;  3CCV 3;  1W02 A;  1W5Z A;  3KN4 A;  3PS8 A;  1ULI B;  1Q82 4;  1WMN A;  4MJD A;  3NV0 B;  1PFP A;  1WMP A;  2WOH A;  2W04 A;  1J2B A;  4HM1 B;  4TX4 A;  2Y73 A;  5EQL A;  2W2C A;  2W56 B;  2KXG A;  1W2Z A;  2QA4 3;  1VQ6 3;  2P0M A;  3NQZ A;  2I9W A;  3FKA A;  3DGN A;  2XRX B;  1JB2 A;  1Q86 4;  1TU5 A;  5JPP A;  3SVA A;  1GD3 A;  5CK6 A;  3LYG A;  3MSO A;  5STD A;  4WFO A;  1STF I;  4EBG A;  1JB4 A;  1ZX2 A;  3T8U A;  1OGZ A;  3HK4 A;  2R4I A;  3KII A;  1JKG A;  5AIH A;  1GD4 A;  1FUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...