1VQ53

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq5300
1QVF2 3CCM3 1VQ73 1VQO3 1S723 3CCQ3 3CMA3 1Q864 1JJ22 1VQ63 1KC84 1M904 1VQN3 3CCL3 3I553 2OTL3 2OTJ3 3CXC2 2QA43 1VQP3 3CC73 1Q814 1VQ93 3CC43 1KD14 1K8A4 3G4S3 1Q7Y4 1YJ93 3G713 3CPW2 3CCJ3 1Q824 3CCU3 1YI23 3CC23 1YHQ3 1NJI4 1N8R4 1K9M4 1M1K4 3CCR3 1YJN3 3G6E3 1K734 1KQS2 1YJW3 1VQ83 1VQ53 1YIT3 3CCV3 3CD63 2QEX3 3I563 3CME3 3CCE3 1VQ43 1YIJ3 1W2B2 1VQL3 1QVG2 1VQM3 1VQK3 3CCS3 3OW22
chains in the Genus database with same CATH superfamily
1KSIA 1TFKA 2J8XB 1W7CA 4U13A 2CX0A 1BRGA 1N9EA 2YX9A 3U97A 1Q40A 4FCJA 3T0UA 1WTHA 1KC84 1B2UA 1RGFA 3MYTA 3V98A 3FZWA 1I2EA 1Q40B 3SXXA 5AYSC 4NREA 5EQLA 4EV5A 5KP1A 4O3VA 2HOHA 3HI7A 3K63A 4N6LA 2XH9A 3UL6A 3CPW2 1YJ93 2BNGA 2E2UA 3O8YA 5G1KA 3ZG0A 4OK0A 1WMPA 3WOFB 3CCR3 1K734 1VQ83 1I70A 1ZS7A 4RBNA 3CNMA 3WR2A 2GU1A 1BUQA 1K41A 1CYVA 1OF5A 3BIRA 2KF5A 4O2HA 3JUNA 4X2OA 4IIAA 1OF5B 3FG4A 2CFDA 1GS3A 3B8LA 2F5WA 4CPKA 3NXJA 3CCQ3 1TIJA 2INXA 3NUVA 1CEWI 2F99A 4OVMA 5ELJA 4TX4A 4XBYA 1MWSA 1AQZA 2FGTA 3KZTA 3G16A 8RNTA 3PYJA 5M1AA 4EYCA 5BIRA 1D6YA 4I4KA 3G4S3 4FMDA 3MG2A 3D9RA 1WQLB 1YGEA 1GMRA 5G1LA 1U5OA 2E2TA 4RZMA 1RCKA 3FG1A 3ECFA 1DETA 3WA3A 3CCV3 5BXQA 2KRTA 2L4VA 4K61A 1IT7A 2UUGC 2CHCA 1M9GA 2PNCA 4NHFA 1JBRA 1FUSA 2WGOA 3NQYA 4XB5A 1QVF2 2RSXA 2E2VA 1R4CA 1B3SA 5IG3A 1B2MA 4AKZA 5IEOA 5STDA 1US1A 1N8QA 1JJ22 1Q9EA 1OHSA 2FNQA 2BU4A 1LVNA 1FUTA 1VQN3 2KAAA 2ML5A 4HM5B 3A5EA 2OWPA 4N6V0 2XGNA 2GBXB 2ZHXB 5JPPA 5ELUA 3CC43 1UUVB 3FF0A 4WYKA 1GD3A 4XM4A 3G713 1JBTA 1FW7A 3HIGA 4FCZA 1NB3I 4WYKB 1OPYA 3BU4A 3SOYA 1YHQ3 1NJI4 3GZYB 1HKXA 3IJEB 1UGIA 1VQQA 1W6YA 2H0HA 3LOYA 1VQL3 3N8BA 4EW5A 5IW9A 4N3VA 1RNTA 1JB2A 2KF3A 4HYZA 4BL2A 2YFIB 3LTDA 3NBBA 4I5QA 1IV7A 3IMAB 4J5GA 2CFLA 2HMKB 2W9PA 1Q864 1W01A 2O9UX 1BUJA 3S29A 1GY5A 3MWZA 4EC6A 4R9KA 1QALA 4N6MA 5RNTA 4N6UA 4HM6B 1ROAA 2C4BA 1B27A 2HMNB 3BB9A 3DY5A 2XFTA 2GBWB 2RGQA 3STDA 1C7HA 1YVBI 3PGBA 4N6NB 1BNJA 1OCVA 3MPHA 1OGXA 1MWTA 4HM7B 1E3RA 1I3FA 1HYFA 3DXOA 1RKYA 1MWUA 2CK3H 1VQ53 3KSED 4ORLA 1FGOA 1T2HA 4LSOA 5EEOA 2I9WA 4KVHA 3RNTA 1S723 3PCRA 4BU4A 1K9M4 4HZ9B 3T8UA 2K3DA 1IYYA 5I97A 3FG3A 1BU4A 4J5KA 1X1YA 1IVVA 3NHXA 1GOVA 1BGSA 1ULJB 2WOHA 1RLSA 1LOXA 3TDGA 2LYXA 2OQEA 1MWRA 1VQP3 5CXOA 1T3BA 5CF2A 1E97A 2KCDA 1GMQA 4HOHA 4XDVA 1TP6A 2HMLB 5AEWB 3AHWA 1JBSA 3GZRA 5IF6A 2GEYA 3S28A 2L1SA 1QMAA 4K1VA 1LOVA 5BVBA 3CME3 3EF8A 2OQEC 3DGOA 1T2IA 4FMAA 2QIYA 3GRDA 3KIIA 3AMOA 3LH4A 3ALAA 1RMSA 3AMOB 2P38A 1W5ZA 1FZUA 3F8HA 3EBTA 3OWYA 5D81A 3BNDA 4GL6A 1ZO2A 3EC9A 4L7KA 3GWRA 4CJNA 1B21A 2CW9A 2CWUA 2BMOB 5KP3A 3K0ZA 4G1MB 3OXAA 5CK6A 3LTAA 1SIIA 2CIUA 3UB1A 3CNXA 1STFI 4R80A 3MSOA 2UGIA 1ULIB 1NDOB 1BOXA 3FF2A 1O7WB 4MMZB 3MG1A 1BANA 1BRKA 1UI8A 2W03A 4KFDA 1A90A 1OH0A 4FMBA 3K5TA 5D82A 3F7SA 4BTYA 1V58A 1ISKA 3BNBA 1A2VA 2FXTA 1O7MB 1BRNL 1BSCA 3FH1A 1U8CB 1N5PA 5FGOA 3DGNA 1BSBA 1T5YA 1NWWA 3JUPA 2ZDJA 1RGLA 1OGZA 1I2FA 2Z7AA 3Q90A 2XR8B 1LNHA 2P0MA 1BRHA 3DM8A 4LEHA 1QAFA 1GOYA 1YNVX 1IVUA 2OTL3 3OWSA 2C11A 4HZBB 5KP4A 1UCLA 1Z1SA 1VQ93 3NBJA 3EJVA 1K8A4 1N9JA 1RDSA 1I2GA 5FW5A 3MKIA 4K1UA 1G96A 4J8TA 1EG9B 3X3ZA 1EKMA 1IQ8A 1TRPA 5AIFA 1SJWA 4FR9A 3SX1A 3F7XA 3F8XA 1QAKA 1UCIA 3Q3FA 4FCMA 1RN7A 3LXUX 1JNQA 1WMNA 4HM0B 2IA7A 1FGQA 1LRAA 1LNIA 1W6CA 2HMMB 3UJMA 3VSYA 3H51A 5IEPA 3V92A 3KN4A 3OW22 6GSPA 5GSPA 4HJLB 3J7Yd 3KKGA 3LTBA 1UW1A 1BNSA 1BRSA 3VGNA 4MMXB 3DGYA 2W2CA 3CXC2 5AIGA 5AIHA 1Q814 3SEDA 2R4IA 5IENA 1V57A 7GSPA 4HVNA 3U1WA 3V99A 2CFGA 1MGWA 2B24B 1IQXA 3F14A 3X42A 3CCU3 2BO9B 3HX8A 4BL3A 1YJN3 4BIRA 1STDA 1BNGA 1AV4A 4GHOA 2SBLA 3RGAA 3OWUA 1LQMB 3NV0A 1NNVA 1V74A 3LT8A 1UUWB 3NBRA 4IT7A 2XGLA 4RNTA 3D3LA 1IU7A 3NV0B 3VF1A 1YIT3 2KF4A 1UUGB 1BNFA 1CQSA 1MGRA 2JDIH 3BLZA 1BSEA 3RGRA 1O7NB 1RRLA 1TFOA 2F56A 2MC8A 3H3HA 3UL5A 3WHOA 3WOEB 3ZFZA 9RNTA 1PY3A 2WOFA 3BNEA 3PS8A 2CG0A 1OHPA 3HK4A 3D4AA 2RBIA 3SOAA 1IVXA 3CU3A 5JBSA 4XBXA 2IUKA 3ZG5A 1VQ63 4ILFA 1LOYA 1RRHA 1EQKA 1Q42A 1PFPA 4STDA 3GAXA 5JPUA 3L0RA 1JV2B 1GY7A 1BRJA 1YIJ3 2W0QA 3SYUA 1D6ZA 1UDII 2BHMA 1B2SA 1SQWA 4N6OB 2BMRB 2JQ5A 5EVHA 1ASKA 3A76A 6STDA 3WMDA 1E3VA 1GYBA 1N5HA 2Q07A 3X40A 1CH0A 1EUIC 2Z6BA 1UGHI 1W4NA 5G2GA 2BIRA 2M7OA 4H61A 3X41A 1M904 1JN5A 1X1UA 2OTJ3 2W56A 3FGYA 7RNTA 2R41A 3FLJA 3KE7A 2W56B 3MG3A 1ROVA 1W2ZA 2XFSA 2CH9A 3KFQC 2RFRA 4ZM8A 1BNRA 2ZA4A 4HM4B 1JZOA 2WGQA 1Q7HA 1L5GB 3NX0A 2PZVA 3LMLA 4L8PA 5AYRB 3B4OA 4KT3B 4R4KA 4JRFA 3HOHA 1TU5A 3LT9A 2XSOB 2CC3A 1W6GA 2GXFA 3WA2X 3KCHA 1F8NA 2XSHB 4GB5A 1RNBA 2CKFB 3EBYA 2OOVA 3D5IA 2D1WA 3FKAA 2O3OA 3WDGB 1RTUA 3I553 4KZ1A 5M18A 1SIHA 5IG5A 3ER7A 3CC73 1RGCA 4H3UA 2K0MA 4RNYA 2Z76A 1DVCA 3PCSA 4LMIA 5LC6A 4EBGA 1FYSA 2YFLB 3RDEA 2CWVA 4HBRA 3D79A 3X3YA 1C54A 1MNLA 1RGKA 3LTCA 7STDA 2OOVC 3IPTA 3NQZA 2RNTA 3T8NA 1DMQA 2IMJA 3GZXB 3DUKA 4O02B 4DKIA 4RNZA 3G8ZA 1DE3A 1UCJA 1NU3A 3CCE3 1LXEA 3B4PA 3GSPA 1JB5A 1RN4A 3CCS3 2XRXB 2W6JH 1VQ73 1AVKA 2RCDA 4QWTA 3Q1CA 1NB5I 1HZ1A 1RSNA 1IQYA 4NPBA 2P0XA 2IUJA 3CPOA 3HZPA 3UNLA 1DVDA 1DMNA 5TGNA 2GU3A 3AGNA 8CHOA 3EX9A 2MF7A 1FGTA 3KSPA 3JVCA 4X2HA 3AHSA 1OUNA 3JUMA 1OHOA 1BAOA 2CWTA 4MJDA 1RJOA 2CG1A 5AEUB 1M1K4 1IK3A 3G6E3 2F4YA 1YJW3 1RGHA 2WO0A 4N6TA 1VQ43 1BRIA 2F98A 1DMMA 1BSDA 4FMCA 3F40A 1WMOA 1G02A 6RNTA 1TUHA 2C10A 5IG0A 3OV4A 4GSPA 2CFWA 3LZAA 1O7PB 2YFJB 1I3IA 1AVLA 2BT3A 4IPBA 4CCVA 2AAEA 2F86B 1LOWA 1O7HB 4OUQA 1BSAA 1SARA 1YVSA 1LQGC 1FGRA 1BNEA 3E99A 2QA43 2ML6A 1AR0A 2Y74A 4L8OA 4MEIA 3SLUA 2CX1A 3EN8A 5HGRA 1GY6A 3AGOA 3PZWA 3I0YA 3S27A 2K54A 2Y73A 1I8VA 1N8R4 5BU4A 1B2ZA 1IT8A 1B20A 3G0KA 2P09A 5AIIA 4WWUC 5IG4A 2GSPA 2LQVA 3PXMA 1W2B2 1K28A 1QVG2 5DREA 2STDA 1UI7A 4WP5A 4LGQA 4HM8B 4CDLA 1X1XA 5AI1A 1GD4A 2HMOB 1CYUA 1W00A 2D42A 2H0IA 4AEQA 3CMA3 1SPUA 1OACA 3S67A 1EA2A 3BNCA 3HIIA 1GMPA 4BTWA 2AADA 3Q2PA 1I0XA 2KXGA 5D83A 1IDPA 3X3XA 1WNHA 5CLKA 3NM7A 1O7GB 1IVWA 4XDWA 3S5CA 1RGGA 1Q824 1YI23 1R4YA 2F5MA 2V1LA 2OCTA 3DH2A 3OX9A 1X1WA 2W9QA 3FCSB 4J9AA 2B1XB 1ZX2A 2Z77A 2SARA 1YGWA 1M1XB 2IYJA 1BNIA 1B2XA 3CCM3 1VQK3 1RGAA 4KFFA 1VQO3 2P05A 1S5AA 3EB8A 1Y4KA 1FA3A 3NM2A 1VZZA 4BTXA 1J2BA 2W04A 4HAAA 3QRDA 3EQQB 2XEPA 2IY2A 2BMQB 4K90B 4WHAA 3JUOA 1BIRA 4O8SA 1JN5B 4R1KA 4MMYB 3DZLA 1IV9A 3FSDA 3SVAA 2A15A 1JZDA 4JF8A 1Q7Y4 1TRQA 1PU4A 3CCJ3 3EHCA 2UX0A 1GSPA 1JB4A 1TTOA 1KQS2 5CF1A 3DGLA 3MHEA 1HU9A 4EXRA 1AY7A 1JKGA 1EEJA 5DRVA 4Q53A 2QEX3 3I563 2QGUA 5LC7A 1JKGB 4KFEA 3URPA 1W02A 1DYUA 5A0OB 1A67A 1D6UA 4HM2B 1JRQA 2HMJB 3WODG 4AKYA 1NO3A 1MOLA 3K7CA 1FGMA 2ZL8A 3ROBA 4EV2A 2XF3A 1FUWA 4PEJA 5HOHA 1KWIA 1BVIA 1TJDA 1RHLA 1A2KA 1G0TA 3CCL3 4HKVB 1RN1A 1ZGXA 3F9SA 3M8CA 4LYLB 5M19A 1KD14 3N9HA 2H0GA 1RCLA 3LYGA 3DGMA 1PYLA 4HM3B 3N54B 3B7CA 3EN1B 3D5GA 3CC23 3EE1A 4WFOA 1GOUA 3CD63 1A2PA 3QK9A 4LZIA 2KF6A 1UCKA 4XBTA 1I0VA 3JUQA 4R9LA 2GEXA 1QJGA 3GZBA 4HM1B 5IERA 3DMCA 1VQM3 1RGEA 2CFKA 3K9MC
chains in the Genus database with same CATH topology
1KSIA 1TFKA 1W7CA 4U13A 1N9EA 2YX9A 3U97A 1Q40A 4FCJA 3T0UA 1WTHA 1KC84 3MYTA 3V98A 3FZWA 1Q40B 3SXXA 5AYSC 4NREA 5EQLA 4EV5A 5KP1A 4O3VA 3HI7A 3K63A 4N6LA 2XH9A 3UL6A 3CPW2 1YJ93 2BNGA 2E2UA 3O8YA 4OK0A 1WMPA 3WOFB 3CCR3 1K734 1VQ83 4RBNA 3CNMA 2GU1A 1BUQA 1K41A 1CYVA 1OF5A 4O2HA 3JUNA 4X2OA 4IIAA 1OF5B 3FG4A 2CFDA 1GS3A 3B8LA 3NXJA 3CCQ3 1TIJA 2INXA 3NUVA 1CEWI 2F99A 4OVMA 5ELJA 4TX4A 4XBYA 2FGTA 3KZTA 3G16A 3PYJA 4EYCA 1D6YA 4I4KA 3G4S3 4FMDA 3MG2A 3D9RA 1WQLB 1YGEA 1U5OA 2E2TA 4RZMA 3FG1A 3ECFA 3WA3A 3CCV3 5BXQA 2KRTA 2L4VA 4K61A 1IT7A 2CHCA 1M9GA 2PNCA 4NHFA 2WGOA 3NQYA 4XB5A 1QVF2 2RSXA 2E2VA 1R4CA 5IG3A 4AKZA 5IEOA 5STDA 1US1A 1N8QA 1JJ22 1OHSA 2FNQA 1LVNA 1VQN3 4HM5B 2ML5A 2OWPA 4N6V0 2XGNA 2GBXB 5JPPA 5ELUA 3CC43 1UUVB 3FF0A 4WYKA 1GD3A 4XM4A 3G713 3HIGA 4FCZA 1NB3I 4WYKB 1OPYA 3SOYA 1YHQ3 1NJI4 3GZYB 1HKXA 3IJEB 1W6YA 3LOYA 1VQL3 3N8BA 5IW9A 4N3VA 1JB2A 4HYZA 2YFIB 3LTDA 3NBBA 1IV7A 3IMAB 2CFLA 2HMKB 2W9PA 1Q864 1W01A 2O9UX 3S29A 1GY5A 3MWZA 4EC6A 4R9KA 1QALA 4N6MA 4N6UA 4HM6B 1ROAA 2HMNB 3BB9A 3DY5A 2XFTA 2GBWB 2RGQA 3STDA 1C7HA 1YVBI 3PGBA 4N6NB 1OCVA 3MPHA 1OGXA 4HM7B 1E3RA 1VQ53 3DXOA 1RKYA 2CK3H 3KSED 4ORLA 1FGOA 4LSOA 5EEOA 2I9WA 4KVHA 1S723 1K9M4 3PCRA 4HZ9B 3T8UA 5I97A 3FG3A 1IVVA 3NHXA 1ULJB 2WOHA 1LOXA 3TDGA 2LYXA 2OQEA 1VQP3 5CXOA 5CF2A 1E97A 2KCDA 4XDVA 1TP6A 2HMLB 5AEWB 3GZRA 5IF6A 2GEYA 3S28A 1QMAA 4K1VA 5BVBA 3CME3 3EF8A 2OQEC 3DGOA 4FMAA 2QIYA 3GRDA 3KIIA 3AMOA 3LH4A 3ALAA 3AMOB 2P38A 1W5ZA 3F8HA 3EBTA 3OWYA 5D81A 3BNDA 4GL6A 1ZO2A 3EC9A 4L7KA 3GWRA 2CW9A 2CWUA 2BMOB 5KP3A 3K0ZA 4G1MB 3OXAA 5CK6A 3LTAA 1SIIA 2CIUA 3UB1A 3CNXA 1STFI 4R80A 3MSOA 1ULIB 1NDOB 4MMZB 3FF2A 1O7WB 3MG1A 1UI8A 2W03A 4KFDA 1A90A 1OH0A 4FMBA 3K5TA 5D82A 3F7SA 4BTYA 1ISKA 3BNBA 1A2VA 2FXTA 1O7MB 3FH1A 1U8CB 1N5PA 5FGOA 3DGNA 1T5YA 1NWWA 3JUPA 2ZDJA 1OGZA 2Z7AA 3Q90A 2XR8B 1LNHA 2P0MA 3DM8A 4LEHA 1QAFA 1IVUA 2OTL3 3OWSA 2C11A 4HZBB 5KP4A 1Z1SA 1VQ93 3NBJA 3EJVA 1K8A4 1N9JA 5FW5A 3MKIA 4K1UA 1G96A 4J8TA 1EG9B 3X3ZA 1EKMA 1IQ8A 5AIFA 1SJWA 4FR9A 3SX1A 3F7XA 3F8XA 1QAKA 4FCMA 1RN7A 3LXUX 1JNQA 1WMNA 4HM0B 2IA7A 1FGQA 2HMMB 1W6CA 3VSYA 3UJMA 3H51A 5IEPA 3V92A 3KN4A 3OW22 4HJLB 3J7Yd 3KKGA 3LTBA 1UW1A 3VGNA 4MMXB 2W2CA 3CXC2 5AIGA 5AIHA 1Q814 3SEDA 2R4IA 5IENA 4HVNA 3U1WA 3V99A 2CFGA 2B24B 3F14A 1IQXA 3X42A 3CCU3 2BO9B 3HX8A 1YJN3 1STDA 1AV4A 2SBLA 3RGAA 3OWUA 3NV0A 1VQK3 1V74A 3LT8A 1UUWB 3NBRA 4IT7A 2XGLA 3VF1A 3D3LA 1IU7A 3NV0B 1YIT3 1CQSA 2JDIH 3BLZA 3RGRA 1O7NB 1RRLA 1TFOA 2MC8A 3UL5A 3H3HA 3WOEB 2WOFA 3BNEA 3PS8A 2CG0A 1OHPA 3HK4A 3SOAA 1IVXA 3CU3A 5JBSA 4XBXA 2IUKA 1VQ63 1RRHA 1EQKA 1Q42A 1PFPA 4STDA 3GAXA 5JPUA 3L0RA 1JV2B 1GY7A 1YIJ3 2W0QA 1D6ZA 2BHMA 4N6OB 1SQWA 2BMRB 2JQ5A 5EVHA 1ASKA 3A76A 6STDA 3WMDA 1E3VA 1GYBA 1N5HA 2Q07A 3X40A 2Z6BA 1W4NA 5G2GA 2M7OA 4H61A 3X41A 2OTJ3 1M904 1JN5A 2W56A 3FGYA 3FLJA 3KE7A 2W56B 3MG3A 1ROVA 1W2ZA 2XFSA 2CH9A 3KFQC 2RFRA 4ZM8A 4HM4B 2WGQA 1L5GB 3NX0A 2PZVA 3LMLA 4L8PA 5AYRB 3B4OA 4R4KA 4JRFA 1TU5A 3LT9A 2XSOB 2CC3A 1W6GA 2GXFA 3WA2X 1F8NA 2XSHB 4GB5A 2CKFB 3EBYA 2OOVA 2D1WA 3FKAA 2O3OA 2CFKA 3WDGB 3I553 4KZ1A 1SIHA 5IG5A 3ER7A 3CC73 4H3UA 2K0MA 4RNYA 2Z76A 1DVCA 3PCSA 4LMIA 5LC6A 4EBGA 2YFLB 3RDEA 2CWVA 4HBRA 3X3YA 1MNLA 3LTCA 7STDA 2OOVC 3IPTA 3NQZA 3T8NA 1DMQA 2IMJA 3GZXB 3DUKA 4O02B 4RNZA 3G8ZA 3CCE3 1NU3A 1LXEA 3B4PA 1JB5A 3CCS3 2XRXB 2W6JH 1VQ73 1AVKA 2RCDA 4QWTA 3Q1CA 1NB5I 1IQYA 2IUJA 2P0XA 3UNLA 3CPOA 3HZPA 1DVDA 1DMNA 5TGNA 2GU3A 8CHOA 3EX9A 2MF7A 1FGTA 3KSPA 3JVCA 4X2HA 1OUNA 3JUMA 1OHOA 2CWTA 4MJDA 1RJOA 2CG1A 5AEUB 1M1K4 1IK3A 3G6E3 1YJW3 2WO0A 4N6TA 1VQ43 2F98A 1DMMA 4FMCA 3F40A 1WMOA 1TUHA 2C10A 5IG0A 3OV4A 2CFWA 3LZAA 1O7PB 2YFJB 1AVLA 2BT3A 4IPBA 4CCVA 2F86B 1O7HB 4OUQA 1FGRA 3E99A 2QA43 2ML6A 1AR0A 2Y74A 4L8OA 4MEIA 3SLUA 3EN8A 5HGRA 1GY6A 3PZWA 3I0YA 3S27A 2K54A 2Y73A 1N8R4 1IT8A 3G0KA 2P09A 5AIIA 4WWUC 5IG4A 2LQVA 3PXMA 1W2B2 1K28A 1QVG2 5DREA 2STDA 1UI7A 4WP5A 4LGQA 4HM8B 4CDLA 5AI1A 1GD4A 2HMOB 1CYUA 1W00A 2D42A 4AEQA 3CMA3 1SPUA 1OACA 3S67A 1EA2A 3BNCA 3HIIA 4BTWA 3Q2PA 2KXGA 5D83A 1IDPA 3X3XA 1WNHA 5CLKA 3NM7A 1O7GB 1IVWA 4XDWA 3S5CA 1Q824 1YI23 2V1LA 2OCTA 3OX9A 3FCSB 2W9QA 4J9AA 2B1XB 1ZX2A 2Z77A 1M1XB 3CCM3 4KFFA 1VQO3 2P05A 1S5AA 3EB8A 1Y4KA 1FA3A 3NM2A 1VZZA 4BTXA 1J2BA 3QRDA 3EQQB 2XEPA 4K90B 2BMQB 4WHAA 3JUOA 4O8SA 1JN5B 4R1KA 4MMYB 3DZLA 1IV9A 3FSDA 3SVAA 2A15A 1Q7Y4 4JF8A 1PU4A 3CCJ3 3EHCA 2UX0A 1JB4A 1KQS2 5CF1A 3DGLA 3MHEA 1HU9A 4EXRA 1JKGA 5DRVA 4Q53A 2QEX3 3I563 2QGUA 5LC7A 1JKGB 4KFEA 1W02A 1DYUA 5A0OB 1A67A 1D6UA 4HM2B 1JRQA 2HMJB 3WODG 4AKYA 1NO3A 1MOLA 3K7CA 1FGMA 2ZL8A 3ROBA 4EV2A 2XF3A 1FUWA 4PEJA 1KWIA 1A2KA 3CCL3 4HKVB 3F9SA 3M8CA 1KD14 3N9HA 3LYGA 3DGMA 4HM3B 3N54B 3B7CA 3EN1B 3CC23 3EE1A 4WFOA 3CD63 3QK9A 4LZIA 4XBTA 3JUQA 4R9LA 2GEXA 1QJGA 3GZBA 4HM1B 5IERA 3DMCA 1VQM3 2W04A 3K9MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF 2;  3CCM 3;  1VQ7 3;  1VQO 3;  1S72 3;  3CCQ 3;  3CMA 3;  1Q86 4;  1JJ2 2;  1VQ6 3;  1KC8 4;  1M90 4;  1VQN 3;  3CCL 3;  3I55 3;  2OTL 3;  2OTJ 3;  3CXC 2;  2QA4 3;  1VQP 3;  3CC7 3;  1Q81 4;  1VQ9 3;  3CC4 3;  1KD1 4;  1K8A 4;  3G4S 3;  1Q7Y 4;  1YJ9 3;  3G71 3;  3CPW 2;  3CCJ 3;  1Q82 4;  3CCU 3;  1YI2 3;  3CC2 3;  1YHQ 3;  1NJI 4;  1N8R 4;  1K9M 4;  1M1K 4;  3CCR 3;  1YJN 3;  3G6E 3;  1K73 4;  1KQS 2;  1YJW 3;  1VQ8 3;  1VQ5 3;  1YIT 3;  3CCV 3;  3CD6 3;  2QEX 3;  3I56 3;  3CME 3;  3CCE 3;  1VQ4 3;  1YIJ 3;  1W2B 2;  1VQL 3;  1QVG 2;  1VQM 3;  1VQK 3;  3CCS 3;  3OW2 2; 
#chains in the Genus database with same CATH topology
 1KSI A;  1TFK A;  2J8X B;  1W7C A;  4U13 A;  2CX0 A;  1BRG A;  1N9E A;  2YX9 A;  3U97 A;  1Q40 A;  4FCJ A;  3T0U A;  1WTH A;  1KC8 4;  1B2U A;  1RGF A;  3MYT A;  3V98 A;  3FZW A;  1I2E A;  1Q40 B;  3SXX A;  5AYS C;  4NRE A;  5EQL A;  4EV5 A;  5KP1 A;  4O3V A;  2HOH A;  3HI7 A;  3K63 A;  4N6L A;  2XH9 A;  3UL6 A;  3CPW 2;  1YJ9 3;  2BNG A;  2E2U A;  3O8Y A;  5G1K A;  3ZG0 A;  4OK0 A;  1WMP A;  3WOF B;  3CCR 3;  1K73 4;  1VQ8 3;  1I70 A;  1ZS7 A;  4RBN A;  3CNM A;  3WR2 A;  2GU1 A;  1BUQ A;  1K41 A;  1CYV A;  1OF5 A;  3BIR A;  2KF5 A;  4O2H A;  3JUN A;  4X2O A;  4IIA A;  1OF5 B;  3FG4 A;  2CFD A;  1GS3 A;  3B8L A;  2F5W A;  4CPK A;  3NXJ A;  3CCQ 3;  1TIJ A;  2INX A;  3NUV A;  1CEW I;  2F99 A;  4OVM A;  5ELJ A;  4TX4 A;  4XBY A;  1MWS A;  1AQZ A;  2FGT A;  3KZT A;  3G16 A;  8RNT A;  3PYJ A;  5M1A A;  4EYC A;  5BIR A;  1D6Y A;  4I4K A;  3G4S 3;  4FMD A;  3MG2 A;  3D9R A;  1WQL B;  1YGE A;  1GMR A;  5G1L A;  1U5O A;  2E2T A;  4RZM A;  1RCK A;  3FG1 A;  3ECF A;  1DET A;  3WA3 A;  3CCV 3;  5BXQ A;  2KRT A;  2L4V A;  4K61 A;  1IT7 A;  2UUG C;  2CHC A;  1M9G A;  2PNC A;  4NHF A;  1JBR A;  1FUS A;  2WGO A;  3NQY A;  4XB5 A;  1QVF 2;  2RSX A;  2E2V A;  1R4C A;  1B3S A;  5IG3 A;  1B2M A;  4AKZ A;  5IEO A;  5STD A;  1US1 A;  1N8Q A;  1JJ2 2;  1Q9E A;  1OHS A;  2FNQ A;  2BU4 A;  1LVN A;  1FUT A;  1VQN 3;  2KAA A;  2ML5 A;  4HM5 B;  3A5E A;  2OWP A;  4N6V 0;  2XGN A;  2GBX B;  2ZHX B;  5JPP A;  5ELU A;  3CC4 3;  1UUV B;  3FF0 A;  4WYK A;  1GD3 A;  4XM4 A;  3G71 3;  1JBT A;  1FW7 A;  3HIG A;  4FCZ A;  1NB3 I;  4WYK B;  1OPY A;  3BU4 A;  3SOY A;  1YHQ 3;  1NJI 4;  3GZY B;  1HKX A;  3IJE B;  1UGI A;  1VQQ A;  1W6Y A;  2H0H A;  3LOY A;  1VQL 3;  3N8B A;  4EW5 A;  5IW9 A;  4N3V A;  1RNT A;  1JB2 A;  2KF3 A;  4HYZ A;  4BL2 A;  2YFI B;  3LTD A;  3NBB A;  4I5Q A;  1IV7 A;  3IMA B;  4J5G A;  2CFL A;  2HMK B;  2W9P A;  1Q86 4;  1W01 A;  2O9U X;  1BUJ A;  3S29 A;  1GY5 A;  3MWZ A;  4EC6 A;  4R9K A;  1QAL A;  4N6M A;  5RNT A;  4N6U A;  4HM6 B;  1ROA A;  2C4B A;  1B27 A;  2HMN B;  3BB9 A;  3DY5 A;  2XFT A;  2GBW B;  2RGQ A;  3STD A;  1C7H A;  1YVB I;  3PGB A;  4N6N B;  1BNJ A;  1OCV A;  3MPH A;  1OGX A;  1MWT A;  4HM7 B;  1E3R A;  1I3F A;  1HYF A;  3DXO A;  1RKY A;  1MWU A;  2CK3 H;  1VQ5 3;  3KSE D;  4ORL A;  1FGO A;  1T2H A;  4LSO A;  5EEO A;  2I9W A;  4KVH A;  3RNT A;  1S72 3;  3PCR A;  4BU4 A;  1K9M 4;  4HZ9 B;  3T8U A;  2K3D A;  1IYY A;  5I97 A;  3FG3 A;  1BU4 A;  4J5K A;  1X1Y A;  1IVV A;  3NHX A;  1GOV A;  1BGS A;  1ULJ B;  2WOH A;  1RLS A;  1LOX A;  3TDG A;  2LYX A;  2OQE A;  1MWR A;  1VQP 3;  5CXO A;  1T3B A;  5CF2 A;  1E97 A;  2KCD A;  1GMQ A;  4HOH A;  4XDV A;  1TP6 A;  2HML B;  5AEW B;  3AHW A;  1JBS A;  3GZR A;  5IF6 A;  2GEY A;  3S28 A;  2L1S A;  1QMA A;  4K1V A;  1LOV A;  5BVB A;  3CME 3;  3EF8 A;  2OQE C;  3DGO A;  1T2I A;  4FMA A;  2QIY A;  3GRD A;  3KII A;  3AMO A;  3LH4 A;  3ALA A;  1RMS A;  3AMO B;  2P38 A;  1W5Z A;  1FZU A;  3F8H A;  3EBT A;  3OWY A;  5D81 A;  3BND A;  4GL6 A;  1ZO2 A;  3EC9 A;  4L7K A;  3GWR A;  4CJN A;  1B21 A;  2CW9 A;  2CWU A;  2BMO B;  5KP3 A;  3K0Z A;  4G1M B;  3OXA A;  5CK6 A;  3LTA A;  1SII A;  2CIU A;  3UB1 A;  3CNX A;  1STF I;  4R80 A;  3MSO A;  2UGI A;  1ULI B;  1NDO B;  1BOX A;  3FF2 A;  1O7W B;  4MMZ B;  3MG1 A;  1BAN A;  1BRK A;  1UI8 A;  2W03 A;  4KFD A;  1A90 A;  1OH0 A;  4FMB A;  3K5T A;  5D82 A;  3F7S A;  4BTY A;  1V58 A;  1ISK A;  3BNB A;  1A2V A;  2FXT A;  1O7M B;  1BRN L;  1BSC A;  3FH1 A;  1U8C B;  1N5P A;  5FGO A;  3DGN A;  1BSB A;  1T5Y A;  1NWW A;  3JUP A;  2ZDJ A;  1RGL A;  1OGZ A;  1I2F A;  2Z7A A;  3Q90 A;  2XR8 B;  1LNH A;  2P0M A;  1BRH A;  3DM8 A;  4LEH A;  1QAF A;  1GOY A;  1YNV X;  1IVU A;  2OTL 3;  3OWS A;  2C11 A;  4HZB B;  5KP4 A;  1UCL A;  1Z1S A;  1VQ9 3;  3NBJ A;  3EJV A;  1K8A 4;  1N9J A;  1RDS A;  1I2G A;  5FW5 A;  3MKI A;  4K1U A;  1G96 A;  4J8T A;  1EG9 B;  3X3Z A;  1EKM A;  1IQ8 A;  1TRP A;  5AIF A;  1SJW A;  4FR9 A;  3SX1 A;  3F7X A;  3F8X A;  1QAK A;  1UCI A;  3Q3F A;  4FCM A;  1RN7 A;  3LXU X;  1JNQ A;  1WMN A;  4HM0 B;  2IA7 A;  1FGQ A;  1LRA A;  1LNI A;  1W6C A;  2HMM B;  3UJM A;  3VSY A;  3H51 A;  5IEP A;  3V92 A;  3KN4 A;  3OW2 2;  6GSP A;  5GSP A;  4HJL B;  3J7Y d;  3KKG A;  3LTB A;  1UW1 A;  1BNS A;  1BRS A;  3VGN A;  4MMX B;  3DGY A;  2W2C A;  3CXC 2;  5AIG A;  5AIH A;  1Q81 4;  3SED A;  2R4I A;  5IEN A;  1V57 A;  7GSP A;  4HVN A;  3U1W A;  3V99 A;  2CFG A;  1MGW A;  2B24 B;  1IQX A;  3F14 A;  3X42 A;  3CCU 3;  2BO9 B;  3HX8 A;  4BL3 A;  1YJN 3;  4BIR A;  1STD A;  1BNG A;  1AV4 A;  4GHO A;  2SBL A;  3RGA A;  3OWU A;  1LQM B;  3NV0 A;  1NNV A;  1V74 A;  3LT8 A;  1UUW B;  3NBR A;  4IT7 A;  2XGL A;  4RNT A;  3D3L A;  1IU7 A;  3NV0 B;  3VF1 A;  1YIT 3;  2KF4 A;  1UUG B;  1BNF A;  1CQS A;  1MGR A;  2JDI H;  3BLZ A;  1BSE A;  3RGR A;  1O7N B;  1RRL A;  1TFO A;  2F56 A;  2MC8 A;  3H3H A;  3UL5 A;  3WHO A;  3WOE B;  3ZFZ A;  9RNT A;  1PY3 A;  2WOF A;  3BNE A;  3PS8 A;  2CG0 A;  1OHP A;  3HK4 A;  3D4A A;  2RBI A;  3SOA A;  1IVX A;  3CU3 A;  5JBS A;  4XBX A;  2IUK A;  3ZG5 A;  1VQ6 3;  4ILF A;  1LOY A;  1RRH A;  1EQK A;  1Q42 A;  1PFP A;  4STD A;  3GAX A;  5JPU A;  3L0R A;  1JV2 B;  1GY7 A;  1BRJ A;  1YIJ 3;  2W0Q A;  3SYU A;  1D6Z A;  1UDI I;  2BHM A;  1B2S A;  1SQW A;  4N6O B;  2BMR B;  2JQ5 A;  5EVH A;  1ASK A;  3A76 A;  6STD A;  3WMD A;  1E3V A;  1GYB A;  1N5H A;  2Q07 A;  3X40 A;  1CH0 A;  1EUI C;  2Z6B A;  1UGH I;  1W4N A;  5G2G A;  2BIR A;  2M7O A;  4H61 A;  3X41 A;  1M90 4;  1JN5 A;  1X1U A;  2OTJ 3;  2W56 A;  3FGY A;  7RNT A;  2R41 A;  3FLJ A;  3KE7 A;  2W56 B;  3MG3 A;  1ROV A;  1W2Z A;  2XFS A;  2CH9 A;  3KFQ C;  2RFR A;  4ZM8 A;  1BNR A;  2ZA4 A;  4HM4 B;  1JZO A;  2WGQ A;  1Q7H A;  1L5G B;  3NX0 A;  2PZV A;  3LML A;  4L8P A;  5AYR B;  3B4O A;  4KT3 B;  4R4K A;  4JRF A;  3HOH A;  1TU5 A;  3LT9 A;  2XSO B;  2CC3 A;  1W6G A;  2GXF A;  3WA2 X;  3KCH A;  1F8N A;  2XSH B;  4GB5 A;  1RNB A;  2CKF B;  3EBY A;  2OOV A;  3D5I A;  2D1W A;  3FKA A;  2O3O A;  3WDG B;  1RTU A;  3I55 3;  4KZ1 A;  5M18 A;  1SIH A;  5IG5 A;  3ER7 A;  3CC7 3;  1RGC A;  4H3U A;  2K0M A;  4RNY A;  2Z76 A;  1DVC A;  3PCS A;  4LMI A;  5LC6 A;  4EBG A;  1FYS A;  2YFL B;  3RDE A;  2CWV A;  4HBR A;  3D79 A;  3X3Y A;  1C54 A;  1MNL A;  1RGK A;  3LTC A;  7STD A;  2OOV C;  3IPT A;  3NQZ A;  2RNT A;  3T8N A;  1DMQ A;  2IMJ A;  3GZX B;  3DUK A;  4O02 B;  4DKI A;  4RNZ A;  3G8Z A;  1DE3 A;  1UCJ A;  1NU3 A;  3CCE 3;  1LXE A;  3B4P A;  3GSP A;  1JB5 A;  1RN4 A;  3CCS 3;  2XRX B;  2W6J H;  1VQ7 3;  1AVK A;  2RCD A;  4QWT A;  3Q1C A;  1NB5 I;  1HZ1 A;  1RSN A;  1IQY A;  4NPB A;  2P0X A;  2IUJ A;  3CPO A;  3HZP A;  3UNL A;  1DVD A;  1DMN A;  5TGN A;  2GU3 A;  3AGN A;  8CHO A;  3EX9 A;  2MF7 A;  1FGT A;  3KSP A;  3JVC A;  4X2H A;  3AHS A;  1OUN A;  3JUM A;  1OHO A;  1BAO A;  2CWT A;  4MJD A;  1RJO A;  2CG1 A;  5AEU B;  1M1K 4;  1IK3 A;  3G6E 3;  2F4Y A;  1YJW 3;  1RGH A;  2WO0 A;  4N6T A;  1VQ4 3;  1BRI A;  2F98 A;  1DMM A;  1BSD A;  4FMC A;  3F40 A;  1WMO A;  1G02 A;  6RNT A;  1TUH A;  2C10 A;  5IG0 A;  3OV4 A;  4GSP A;  2CFW A;  3LZA A;  1O7P B;  2YFJ B;  1I3I A;  1AVL A;  2BT3 A;  4IPB A;  4CCV A;  2AAE A;  2F86 B;  1LOW A;  1O7H B;  4OUQ A;  1BSA A;  1SAR A;  1YVS A;  1LQG C;  1FGR A;  1BNE A;  3E99 A;  2QA4 3;  2ML6 A;  1AR0 A;  2Y74 A;  4L8O A;  4MEI A;  3SLU A;  2CX1 A;  3EN8 A;  5HGR A;  1GY6 A;  3AGO A;  3PZW A;  3I0Y A;  3S27 A;  2K54 A;  2Y73 A;  1I8V A;  1N8R 4;  5BU4 A;  1B2Z A;  1IT8 A;  1B20 A;  3G0K A;  2P09 A;  5AII A;  4WWU C;  5IG4 A;  2GSP A;  2LQV A;  3PXM A;  1W2B 2;  1K28 A;  1QVG 2;  5DRE A;  2STD A;  1UI7 A;  4WP5 A;  4LGQ A;  4HM8 B;  4CDL A;  1X1X A;  5AI1 A;  1GD4 A;  2HMO B;  1CYU A;  1W00 A;  2D42 A;  2H0I A;  4AEQ A;  3CMA 3;  1SPU A;  1OAC A;  3S67 A;  1EA2 A;  3BNC A;  3HII A;  1GMP A;  4BTW A;  2AAD A;  3Q2P A;  1I0X A;  2KXG A;  5D83 A;  1IDP A;  3X3X A;  1WNH A;  5CLK A;  3NM7 A;  1O7G B;  1IVW A;  4XDW A;  3S5C A;  1RGG A;  1Q82 4;  1YI2 3;  1R4Y A;  2F5M A;  2V1L A;  2OCT A;  3DH2 A;  3OX9 A;  1X1W A;  2W9Q A;  3FCS B;  4J9A A;  2B1X B;  1ZX2 A;  2Z77 A;  2SAR A;  1YGW A;  1M1X B;  2IYJ A;  1BNI A;  1B2X A;  3CCM 3;  1VQK 3;  1RGA A;  4KFF A;  1VQO 3;  2P05 A;  1S5A A;  3EB8 A;  1Y4K A;  1FA3 A;  3NM2 A;  1VZZ A;  4BTX A;  1J2B A;  2W04 A;  4HAA A;  3QRD A;  3EQQ B;  2XEP A;  2IY2 A;  2BMQ B;  4K90 B;  4WHA A;  3JUO A;  1BIR A;  4O8S A;  1JN5 B;  4R1K A;  4MMY B;  3DZL A;  1IV9 A;  3FSD A;  3SVA A;  2A15 A;  1JZD A;  4JF8 A;  1Q7Y 4;  1TRQ A;  1PU4 A;  3CCJ 3;  3EHC A;  2UX0 A;  1GSP A;  1JB4 A;  1TTO A;  1KQS 2;  5CF1 A;  3DGL A;  3MHE A;  1HU9 A;  4EXR A;  1AY7 A;  1JKG A;  1EEJ A;  5DRV A;  4Q53 A;  2QEX 3;  3I56 3;  2QGU A;  5LC7 A;  1JKG B;  4KFE A;  3URP A;  1W02 A;  1DYU A;  5A0O B;  1A67 A;  1D6U A;  4HM2 B;  1JRQ A;  2HMJ B;  3WOD G;  4AKY A;  1NO3 A;  1MOL A;  3K7C A;  1FGM A;  2ZL8 A;  3ROB A;  4EV2 A;  2XF3 A;  1FUW A;  4PEJ A;  5HOH A;  1KWI A;  1BVI A;  1TJD A;  1RHL A;  1A2K A;  1G0T A;  3CCL 3;  4HKV B;  1RN1 A;  1ZGX A;  3F9S A;  3M8C A;  4LYL B;  5M19 A;  1KD1 4;  3N9H A;  2H0G A;  1RCL A;  3LYG A;  3DGM A;  1PYL A;  4HM3 B;  3N54 B;  3B7C A;  3EN1 B;  3D5G A;  3CC2 3;  3EE1 A;  4WFO A;  1GOU A;  3CD6 3;  1A2P A;  3QK9 A;  4LZI A;  2KF6 A;  1UCK A;  4XBT A;  1I0V A;  3JUQ A;  4R9L A;  2GEX A;  1QJG A;  3GZB A;  4HM1 B;  5IER A;  3DMC A;  1VQM 3;  1RGE A;  2CFK A;  3K9M C; 
#chains in the Genus database with same CATH homology
 1KSI A;  1TFK A;  1W7C A;  4U13 A;  1N9E A;  2YX9 A;  3U97 A;  1Q40 A;  4FCJ A;  3T0U A;  1WTH A;  1KC8 4;  3MYT A;  3V98 A;  3FZW A;  1Q40 B;  3SXX A;  5AYS C;  4NRE A;  5EQL A;  4EV5 A;  5KP1 A;  4O3V A;  3HI7 A;  3K63 A;  4N6L A;  2XH9 A;  3UL6 A;  3CPW 2;  1YJ9 3;  2BNG A;  2E2U A;  3O8Y A;  4OK0 A;  1WMP A;  3WOF B;  3CCR 3;  1K73 4;  1VQ8 3;  4RBN A;  3CNM A;  2GU1 A;  1BUQ A;  1K41 A;  1CYV A;  1OF5 A;  4O2H A;  3JUN A;  4X2O A;  4IIA A;  1OF5 B;  3FG4 A;  2CFD A;  1GS3 A;  3B8L A;  3NXJ A;  3CCQ 3;  1TIJ A;  2INX A;  3NUV A;  1CEW I;  2F99 A;  4OVM A;  5ELJ A;  4TX4 A;  4XBY A;  2FGT A;  3KZT A;  3G16 A;  3PYJ A;  4EYC A;  1D6Y A;  4I4K A;  3G4S 3;  4FMD A;  3MG2 A;  3D9R A;  1WQL B;  1YGE A;  1U5O A;  2E2T A;  4RZM A;  3FG1 A;  3ECF A;  3WA3 A;  3CCV 3;  5BXQ A;  2KRT A;  2L4V A;  4K61 A;  1IT7 A;  2CHC A;  1M9G A;  2PNC A;  4NHF A;  2WGO A;  3NQY A;  4XB5 A;  1QVF 2;  2RSX A;  2E2V A;  1R4C A;  5IG3 A;  4AKZ A;  5IEO A;  5STD A;  1US1 A;  1N8Q A;  1JJ2 2;  1OHS A;  2FNQ A;  1LVN A;  1VQN 3;  4HM5 B;  2ML5 A;  2OWP A;  4N6V 0;  2XGN A;  2GBX B;  5JPP A;  5ELU A;  3CC4 3;  1UUV B;  3FF0 A;  4WYK A;  1GD3 A;  4XM4 A;  3G71 3;  3HIG A;  4FCZ A;  1NB3 I;  4WYK B;  1OPY A;  3SOY A;  1YHQ 3;  1NJI 4;  3GZY B;  1HKX A;  3IJE B;  1W6Y A;  3LOY A;  1VQL 3;  3N8B A;  5IW9 A;  4N3V A;  1JB2 A;  4HYZ A;  2YFI B;  3LTD A;  3NBB A;  1IV7 A;  3IMA B;  2CFL A;  2HMK B;  2W9P A;  1Q86 4;  1W01 A;  2O9U X;  3S29 A;  1GY5 A;  3MWZ A;  4EC6 A;  4R9K A;  1QAL A;  4N6M A;  4N6U A;  4HM6 B;  1ROA A;  2HMN B;  3BB9 A;  3DY5 A;  2XFT A;  2GBW B;  2RGQ A;  3STD A;  1C7H A;  1YVB I;  3PGB A;  4N6N B;  1OCV A;  3MPH A;  1OGX A;  4HM7 B;  1E3R A;  1VQ5 3;  3DXO A;  1RKY A;  2CK3 H;  3KSE D;  4ORL A;  1FGO A;  4LSO A;  5EEO A;  2I9W A;  4KVH A;  1S72 3;  1K9M 4;  3PCR A;  4HZ9 B;  3T8U A;  5I97 A;  3FG3 A;  1IVV A;  3NHX A;  1ULJ B;  2WOH A;  1LOX A;  3TDG A;  2LYX A;  2OQE A;  1VQP 3;  5CXO A;  5CF2 A;  1E97 A;  2KCD A;  4XDV A;  1TP6 A;  2HML B;  5AEW B;  3GZR A;  5IF6 A;  2GEY A;  3S28 A;  1QMA A;  4K1V A;  5BVB A;  3CME 3;  3EF8 A;  2OQE C;  3DGO A;  4FMA A;  2QIY A;  3GRD A;  3KII A;  3AMO A;  3LH4 A;  3ALA A;  3AMO B;  2P38 A;  1W5Z A;  3F8H A;  3EBT A;  3OWY A;  5D81 A;  3BND A;  4GL6 A;  1ZO2 A;  3EC9 A;  4L7K A;  3GWR A;  2CW9 A;  2CWU A;  2BMO B;  5KP3 A;  3K0Z A;  4G1M B;  3OXA A;  5CK6 A;  3LTA A;  1SII A;  2CIU A;  3UB1 A;  3CNX A;  1STF I;  4R80 A;  3MSO A;  1ULI B;  1NDO B;  4MMZ B;  3FF2 A;  1O7W B;  3MG1 A;  1UI8 A;  2W03 A;  4KFD A;  1A90 A;  1OH0 A;  4FMB A;  3K5T A;  5D82 A;  3F7S A;  4BTY A;  1ISK A;  3BNB A;  1A2V A;  2FXT A;  1O7M B;  3FH1 A;  1U8C B;  1N5P A;  5FGO A;  3DGN A;  1T5Y A;  1NWW A;  3JUP A;  2ZDJ A;  1OGZ A;  2Z7A A;  3Q90 A;  2XR8 B;  1LNH A;  2P0M A;  3DM8 A;  4LEH A;  1QAF A;  1IVU A;  2OTL 3;  3OWS A;  2C11 A;  4HZB B;  5KP4 A;  1Z1S A;  1VQ9 3;  3NBJ A;  3EJV A;  1K8A 4;  1N9J A;  5FW5 A;  3MKI A;  4K1U A;  1G96 A;  4J8T A;  1EG9 B;  3X3Z A;  1EKM A;  1IQ8 A;  5AIF A;  1SJW A;  4FR9 A;  3SX1 A;  3F7X A;  3F8X A;  1QAK A;  4FCM A;  1RN7 A;  3LXU X;  1JNQ A;  1WMN A;  4HM0 B;  2IA7 A;  1FGQ A;  2HMM B;  1W6C A;  3VSY A;  3UJM A;  3H51 A;  5IEP A;  3V92 A;  3KN4 A;  3OW2 2;  4HJL B;  3J7Y d;  3KKG A;  3LTB A;  1UW1 A;  3VGN A;  4MMX B;  2W2C A;  3CXC 2;  5AIG A;  5AIH A;  1Q81 4;  3SED A;  2R4I A;  5IEN A;  4HVN A;  3U1W A;  3V99 A;  2CFG A;  2B24 B;  3F14 A;  1IQX A;  3X42 A;  3CCU 3;  2BO9 B;  3HX8 A;  1YJN 3;  1STD A;  1AV4 A;  2SBL A;  3RGA A;  3OWU A;  3NV0 A;  1VQK 3;  1V74 A;  3LT8 A;  1UUW B;  3NBR A;  4IT7 A;  2XGL A;  3VF1 A;  3D3L A;  1IU7 A;  3NV0 B;  1YIT 3;  1CQS A;  2JDI H;  3BLZ A;  3RGR A;  1O7N B;  1RRL A;  1TFO A;  2MC8 A;  3UL5 A;  3H3H A;  3WOE B;  2WOF A;  3BNE A;  3PS8 A;  2CG0 A;  1OHP A;  3HK4 A;  3SOA A;  1IVX A;  3CU3 A;  5JBS A;  4XBX A;  2IUK A;  1VQ6 3;  1RRH A;  1EQK A;  1Q42 A;  1PFP A;  4STD A;  3GAX A;  5JPU A;  3L0R A;  1JV2 B;  1GY7 A;  1YIJ 3;  2W0Q A;  1D6Z A;  2BHM A;  4N6O B;  1SQW A;  2BMR B;  2JQ5 A;  5EVH A;  1ASK A;  3A76 A;  6STD A;  3WMD A;  1E3V A;  1GYB A;  1N5H A;  2Q07 A;  3X40 A;  2Z6B A;  1W4N A;  5G2G A;  2M7O A;  4H61 A;  3X41 A;  2OTJ 3;  1M90 4;  1JN5 A;  2W56 A;  3FGY A;  3FLJ A;  3KE7 A;  2W56 B;  3MG3 A;  1ROV A;  1W2Z A;  2XFS A;  2CH9 A;  3KFQ C;  2RFR A;  4ZM8 A;  4HM4 B;  2WGQ A;  1L5G B;  3NX0 A;  2PZV A;  3LML A;  4L8P A;  5AYR B;  3B4O A;  4R4K A;  4JRF A;  1TU5 A;  3LT9 A;  2XSO B;  2CC3 A;  1W6G A;  2GXF A;  3WA2 X;  1F8N A;  2XSH B;  4GB5 A;  2CKF B;  3EBY A;  2OOV A;  2D1W A;  3FKA A;  2O3O A;  2CFK A;  3WDG B;  3I55 3;  4KZ1 A;  1SIH A;  5IG5 A;  3ER7 A;  3CC7 3;  4H3U A;  2K0M A;  4RNY A;  2Z76 A;  1DVC A;  3PCS A;  4LMI A;  5LC6 A;  4EBG A;  2YFL B;  3RDE A;  2CWV A;  4HBR A;  3X3Y A;  1MNL A;  3LTC A;  7STD A;  2OOV C;  3IPT A;  3NQZ A;  3T8N A;  1DMQ A;  2IMJ A;  3GZX B;  3DUK A;  4O02 B;  4RNZ A;  3G8Z A;  3CCE 3;  1NU3 A;  1LXE A;  3B4P A;  1JB5 A;  3CCS 3;  2XRX B;  2W6J H;  1VQ7 3;  1AVK A;  2RCD A;  4QWT A;  3Q1C A;  1NB5 I;  1IQY A;  2IUJ A;  2P0X A;  3UNL A;  3CPO A;  3HZP A;  1DVD A;  1DMN A;  5TGN A;  2GU3 A;  8CHO A;  3EX9 A;  2MF7 A;  1FGT A;  3KSP A;  3JVC A;  4X2H A;  1OUN A;  3JUM A;  1OHO A;  2CWT A;  4MJD A;  1RJO A;  2CG1 A;  5AEU B;  1M1K 4;  1IK3 A;  3G6E 3;  1YJW 3;  2WO0 A;  4N6T A;  1VQ4 3;  2F98 A;  1DMM A;  4FMC A;  3F40 A;  1WMO A;  1TUH A;  2C10 A;  5IG0 A;  3OV4 A;  2CFW A;  3LZA A;  1O7P B;  2YFJ B;  1AVL A;  2BT3 A;  4IPB A;  4CCV A;  2F86 B;  1O7H B;  4OUQ A;  1FGR A;  3E99 A;  2QA4 3;  2ML6 A;  1AR0 A;  2Y74 A;  4L8O A;  4MEI A;  3SLU A;  3EN8 A;  5HGR A;  1GY6 A;  3PZW A;  3I0Y A;  3S27 A;  2K54 A;  2Y73 A;  1N8R 4;  1IT8 A;  3G0K A;  2P09 A;  5AII A;  4WWU C;  5IG4 A;  2LQV A;  3PXM A;  1W2B 2;  1K28 A;  1QVG 2;  5DRE A;  2STD A;  1UI7 A;  4WP5 A;  4LGQ A;  4HM8 B;  4CDL A;  5AI1 A;  1GD4 A;  2HMO B;  1CYU A;  1W00 A;  2D42 A;  4AEQ A;  3CMA 3;  1SPU A;  1OAC A;  3S67 A;  1EA2 A;  3BNC A;  3HII A;  4BTW A;  3Q2P A;  2KXG A;  5D83 A;  1IDP A;  3X3X A;  1WNH A;  5CLK A;  3NM7 A;  1O7G B;  1IVW A;  4XDW A;  3S5C A;  1Q82 4;  1YI2 3;  2V1L A;  2OCT A;  3OX9 A;  3FCS B;  2W9Q A;  4J9A A;  2B1X B;  1ZX2 A;  2Z77 A;  1M1X B;  3CCM 3;  4KFF A;  1VQO 3;  2P05 A;  1S5A A;  3EB8 A;  1Y4K A;  1FA3 A;  3NM2 A;  1VZZ A;  4BTX A;  1J2B A;  3QRD A;  3EQQ B;  2XEP A;  4K90 B;  2BMQ B;  4WHA A;  3JUO A;  4O8S A;  1JN5 B;  4R1K A;  4MMY B;  3DZL A;  1IV9 A;  3FSD A;  3SVA A;  2A15 A;  1Q7Y 4;  4JF8 A;  1PU4 A;  3CCJ 3;  3EHC A;  2UX0 A;  1JB4 A;  1KQS 2;  5CF1 A;  3DGL A;  3MHE A;  1HU9 A;  4EXR A;  1JKG A;  5DRV A;  4Q53 A;  2QEX 3;  3I56 3;  2QGU A;  5LC7 A;  1JKG B;  4KFE A;  1W02 A;  1DYU A;  5A0O B;  1A67 A;  1D6U A;  4HM2 B;  1JRQ A;  2HMJ B;  3WOD G;  4AKY A;  1NO3 A;  1MOL A;  3K7C A;  1FGM A;  2ZL8 A;  3ROB A;  4EV2 A;  2XF3 A;  1FUW A;  4PEJ A;  1KWI A;  1A2K A;  3CCL 3;  4HKV B;  3F9S A;  3M8C A;  1KD1 4;  3N9H A;  3LYG A;  3DGM A;  4HM3 B;  3N54 B;  3B7C A;  3EN1 B;  3CC2 3;  3EE1 A;  4WFO A;  3CD6 3;  3QK9 A;  4LZI A;  4XBT A;  3JUQ A;  4R9L A;  2GEX A;  1QJG A;  3GZB A;  4HM1 B;  5IER A;  3DMC A;  1VQM 3;  2W04 A;  3K9M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...