1VQ53

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq5300
1M1K4 1VQM3 3CMA3 3CCV3 1KC84 3CCR3 1QVF2 3CC73 1VQO3 1M904 1YJ93 1Q824 2OTL3 2OTJ3 1YJN3 2QA43 3G4S3 1VQK3 1YIJ3 1K734 1NJI4 1KQS2 1JJ22 3CCS3 1Q814 1QVG2 1KD14 3G6E3 3I553 1VQ93 1VQ63 2QEX3 3CCU3 1W2B2 1Q864 3CCJ3 1YJW3 3CC43 3CCE3 3CCM3 3CCQ3 3CME3 1S723 1VQ53 3CPW2 1YIT3 3G713 1VQL3 3OW22 1K8A4 3CD63 1YI23 3CCL3 1VQP3 1YHQ3 1N8R4 1VQN3 3CC23 1Q7Y4 3CXC2 1VQ73 1K9M4 1VQ43 3I563 1VQ83
chains in the Genus database with same CATH superfamily
1KC84 1UCIA 4FMAA 1RHLA 1D6ZA 1RGCA 4GB5A 2OTJ3 2CWUA 4GL6A 4GSPA 1VQK3 3UL6A 1RN1A 1OPYA 2R4IA 4KFFA 1YGWA 3MG3A 1B2XA 4BL3A 1O7NB 5JPUA 3F9SA 5CK6A 1B2UA 4HM6B 4N6OB 2OQEC 3N54B 3V99A 1UUGB 2R41A 1B27A 3OW22 1SIIA 1MGRA 3DH2A 4KVHA 2KXGA 3ZG0A 2CKFB 3O8YA 1FA3A 1TJDA 1U5OA 2M7OA 3DUKA 1G96A 1QAKA 3JVCA 3ER7A 1GS3A 1BIRA 2K54A 3DGOA 4BTXA 3BNBA 2CX1A 3CCR3 3UB1A 1MGWA 5G1KA 3V98A 1SIHA 2SBLA 4HOHA 2IA7A 1NB3I 1GYBA 3KSPA 3WMDA 1GMQA 4XDWA 3X3YA 2CFDA 2PZVA 2CFKA 3MKIA 4K90B 4WYKA 4WFOA 2IUJA 1U8CB 3WA3A 1VQ63 1TIJA 3CCJ3 1MNLA 5AIFA 3NHXA 4K61A 1YVSA 3G0KA 1UI7A 3EB8A 1NWWA 4I5QA 3CCM3 1RGKA 1BNEA 4WWUC 3MWZA 2V1LA 3SEDA 4R9LA 3UJMA 2C11A 3S67A 1BSEA 4HM3B 3OV4A 2GEXA 4HAAA 4IPBA 1QVF2 4MMYB 1O7PB 1JN5B 2H0HA 4MJDA 1QALA 1BGSA 1TRQA 2B24B 1I8VA 2F98A 2HMLB 3H51A 5EQLA 1PFPA 3D4AA 4FMDA 1BNRA 4ZM8A 3TDGA 2ML6A 2RBIA 2QIYA 1W00A 2WOFA 4KFDA 1B3SA 1FUSA 4OUQA 5EEOA 3UNLA 1W6GA 3I0YA 4WHAA 1W5ZA 5EVHA 4HM7B 5KP3A 4J8TA 1BNSA 2CH9A 3X40A 4EW5A 2QEX3 1Q864 1YJW3 1R4YA 5M18A 3AMOB 3CCE3 3VGNA 1S723 3S5CA 5BXQA 1N8QA 4HM4B 3AGNA 1NB5I 1YI23 2HMKB 1M1XB 2RGQA 3HK4A 1V57A 1OHPA 2CFWA 3KE7A 3PXMA 5AIIA 1I0VA 3KZTA 3S27A 1IK3A 1A2VA 4J5KA 2CC3A 4BU4A 1D6UA 1DMNA 2KRTA 5HGRA 3WDGB 3LYGA 5M19A 5IG4A 1T2HA 4JRFA 1IQXA 5CLKA 2GU3A 1OGZA 1SJWA 3BLZA 1A2KA 4EXRA 4HJLB 1GD4A 1ROVA 2XEPA 3K0ZA 3GAXA 1VQ53 4XBXA 1RGLA 3LTAA 1ISKA 3CNMA 3LXUX 2QGUA 1GY6A 3G713 3OWYA 4HM0B 3SYUA 3MHEA 5RNTA 5G1LA 2YFIB 1W01A 3NQYA 1UI8A 1KWIA 1ZGXA 1BRHA 4JF8A 1BAOA 4LEHA 3EE1A 4CDLA 3KIIA 4K1VA 1BUQA 2C10A 2F99A 4FCMA 1YJ93 1BUJA 1N9JA 5CF1A 1JN5A 1FUTA 1JZOA 4HBRA 4RZMA 5IEPA 1HZ1A 4EC6A 1IV9A 2L4VA 2WO0A 3H3HA 1M9GA 2XGNA 1PY3A 8RNTA 3CCS3 1BSCA 5AIGA 2XFTA 4DKIA 1VQ93 1X1WA 3KN4A 3EX9A 1Q42A 1WMNA 3U97A 2UGIA 3Q2PA 8CHOA 1JB4A 4LGQA 1LNIA 2A15A 2GXFA 2XGLA 6STDA 3STDA 3Q90A 1AV4A 5JPPA 2H0GA 3BNCA 3OWSA 1Q7Y4 3G16A 1V58A 4FMCA 4Q53A 3A76A 5G2GA 5AYSC 1WMPA 2LQVA 1B2ZA 3BB9A 3NM2A 3WA2X 4BTWA 1VQ83 3KCHA 1N5HA 3MPHA 3FG4A 3SX1A 1VQO3 2OCTA 3B4OA 3GSPA 4STDA 4R1KA 5CXOA 5ELJA 4X2OA 1RGEA 3IMAB 1RSNA 2E2UA 3D5IA 2XSOB 5IENA 1LNHA 1O7WB 2XH9A 1JBRA 4H3UA 3DZLA 1A2PA 1S5AA 2D42A 2BU4A 1UUWB 1NDOB 4CPKA 1MWTA 1MWUA 1GOYA 1Q7HA 5BU4A 1G02A 3LZAA 2LYXA 3RDEA 2BMQB 1RNTA 3CD63 2FGTA 3K9MC 1AY7A 4L8OA 1LRAA 3KSED 3T8UA 2W56B 4CJNA 2W9QA 4XM4A 2KF3A 1L5GB 1BRGA 1VQM3 3CMA3 1OACA 1OH0A 2HMMB 3OWUA 3BNDA 3ALAA 2CHCA 2CWTA 1EG9B 2KF6A 2OOVC 3WOFB 5FW5A 2QA43 2IUKA 4NREA 3EN1B 4RNTA 1JRQA 5HOHA 1IT7A 3EQQB 1IVUA 2L1SA 5JBSA 1BRNL 5D82A 1N9EA 1W2B2 1V74A 1VZZA 1AVKA 2JQ5A 2W04A 5AI1A 1BSAA 1B21A 4FCJA 4OK0A 3WOEB 4HZ9B 3ROBA 4AEQA 1EKMA 1OCVA 6RNTA 1BNIA 2RNTA 1K9M4 1VQ43 4FMBA 2FXTA 1BNJA 2XR8B 1X1YA 3D9RA 1FGOA 3D79A 1SPUA 4H61A 3URPA 1LXEA 2ZHXB 3U1WA 2GSPA 3JUQA 3ZFZA 4ILFA 1SARA 4R9KA 4O02B 1YJN3 1C54A 3LTCA 4GHOA 4HKVB 3FG1A 3JUNA 1I3IA 3DY5A 3GWRA 6GSPA 1QVG2 1B2MA 3FGYA 3EHCA 1DVDA 2ML5A 3S29A 1RN7A 3NBJA 3GZYB 2F4YA 1JV2B 1JBTA 3F40A 3GRDA 4N6V0 1BVIA 1UDII 1WQLB 3GZBA 4K1UA 1IYYA 4KFEA 4IIAA 3DXOA 3SLUA 2Z7AA 4EYCA 1RN4A 5M1AA 3E99A 3FZWA 3LMLA 1AR0A 4G1MB 2OQEA 7RNTA 3SOAA 5BIRA 4BIRA 1SQWA 2IMJA 2RSXA 2Z76A 1M1K4 3PCRA 1RGAA 2W56A 3KFQC 7STDA 3CC73 1G0TA 2F86B 1I0XA 1W6CA 1I70A 2GEYA 1Y4KA 1UGIA 3FCSB 3NQZA 3M8CA 1IU7A 3NX0A 1Q824 3FF0A 1I2EA 3D5GA 1W4NA 2H0IA 1KQS2 1STFI 4HM2B 3JUOA 3NUVA 3X3XA 4EBGA 2C4BA 3AGOA 1E97A 1Q40B 1OHOA 3LT8A 3MSOA 2Y73A 1GMPA 2W9PA 2WGQA 3ZG5A 1FGQA 1DYUA 1NNVA 1JKGB 3WODG 3HX8A 1BNGA 1LOXA 3BNEA 2YX9A 1JNQA 1N8R4 4LMIA 3QK9A 3PYJA 1IDPA 2P0XA 3J7Yd 3CC23 4XB5A 1ZO2A 1E3RA 1GD3A 2ZL8A 4HM5B 2OTL3 5LC6A 1YVBI 3QRDA 3CCV3 2KF5A 1BRJA 1HYFA 1QMAA 4I4KA 1M904 4U13A 2W6JH 1IQ8A 3FSDA 1RKYA 3BIRA 3PGBA 3UL5A 3LH4A 4N6TA 1I2GA 4NHFA 1RCKA 4J5GA 1R4CA 1WTHA 3HIGA 4ORLA 1TU5A 3OX9A 1E3VA 1I2FA 1LQMB 2B1XB 2CFLA 3F8XA 1DETA 4BTYA 3F14A 2CG1A 3RNTA 1GOUA 1ASKA 2BMOB 2BT3A 4XBYA 1LOWA 4MEIA 5KP4A 3CCQ3 3DM8A 3ECFA 3FKAA 1YGEA 3CCL3 1NO3A 1GY5A 1W02A 1ZX2A 1BRSA 1K28A 1DMMA 1VQ73 4CCVA 1RGGA 1ULJB 2O3OA 3MYTA 7GSPA 1F8NA 3A5EA 3FLJA 2CK3H 2I9WA 2P09A 3SXXA 4N3VA 3DGMA 1BRIA 2AADA 2E2VA 1JBSA 3EF8A 1FGTA 2XRXB 1X1UA 2Y74A 1N5PA 2GBWB 4HVNA 4R80A 3I553 1W2ZA 3PZWA 1TP6A 3B4PA 1UGHI 1RGHA 5IG5A 2F56A 1UCKA 1A90A 3DGNA 1UCLA 3EN8A 4XBTA 1RMSA 1Q40A 3NBBA 1C7HA 1RNBA 3RGAA 1FW7A 4HYZA 3MG1A 1K8A4 5AEUB 3V92A 1VQP3 1TRPA 1BSDA 1K41A 1JKGA 5IG3A 1OF5B 3G8ZA 3X41A 1BNFA 3JUPA 1IVVA 3LT9A 3B8LA 1A67A 2CX0A 1ZS7A 2GU1A 3GZRA 3HZPA 1B20A 1BU4A 1NU3A 2RFRA 3Q1CA 1KSIA 1W6YA 1WNHA 2CWVA 1T2IA 1NJI4 1O7HB 3DGLA 1YIJ3 2UUGC 2GBXB 3HIIA 4LYLB 1Q814 4RBNA 3T8NA 2RCDA 1T3BA 5A0OB 4EV2A 3CCU3 5AIHA 1IVXA 1RRHA 2BIRA 2BNGA 2P0MA 3F8HA 3PCSA 3CME3 4LSOA 2WGOA 3L0RA 4RNZA 4QWTA 1VQL3 2HMNB 1HKXA 3X3ZA 1I3FA 1QJGA 3N8BA 5STDA 4L7KA 2FNQA 3WHOA 1PYLA 2ZDJA 3CXC2 5IG0A 2MF7A 1MWSA 4KZ1A 3AHSA 1ULIB 4WP5A 1UCJA 3LTDA 1CYVA 3EBYA 1J2BA 2JDIH 2K0MA 3NXJA 4AKZA 3JUMA 2E2TA 1CQSA 1JB5A 3LTBA 5GSPA 1IT8A 1DVCA 9RNTA 1DMQA 3MG2A 2XFSA 1KD14 4N6UA 3T0UA 3G6E3 4FCZA 4EV5A 3OXAA 2PNCA 1UUVB 3DGYA 1RRLA 1YNVX 1O7GB 2HMJB 3EC9A 3HI7A 2D1WA 1T5YA 1QAFA 3NV0B 1OHSA 2CFGA 2P38A 1IV7A 1VQN3 4RNYA 5TGNA 2INXA 2CIUA 4AKYA 1FGMA 4FR9A 1GOVA 1RDSA 2BHMA 2W03A 5I97A 1GY7A 1OF5A 1ROAA 1W7CA 5AEWB 5ELUA 1HU9A 4MMXB 1TFOA 3G4S3 2Z6BA 1EA2A 2YFJB 3PS8A 3F7SA 3NBRA 4N6LA 1JJ22 1LOVA 3CU3A 2W2CA 2BMRB 1OGXA 5DRVA 1EQKA 2OOVA 2OWPA 2J8XB 2W0QA 2IY2A 1BANA 2KAAA 2WOHA 4NPBA 1O7MB 1IVWA 1GSPA 5BVBA 2CW9A 1CYUA 1FZUA 4HM8B 4KT3B 2HMOB 1JZDA 1AVLA 1FGRA 4PEJA 1YHQ3 1LQGC 1TFKA 4TX4A 5IERA 3X42A 1X1XA 1MWRA 2F5WA 3CNXA 1TUHA 1JB2A 2XSHB 2YFLB 3I563 3IPTA 3WR2A 1PU4A 3AHWA 3SVAA 3SOYA 1US1A 2O9UX 2CG0A 3DMCA 3EJVA 4N6NB 2MC8A 1EEJA 1B2SA 2BO9B 3BU4A 2SARA 4J9AA 3F7XA 3NM7A 5IEOA 2UX0A 3VSYA 4LZIA 1K734 4MMZB 4HM1B 3EBTA 2AAEA 5FGOA 3RGRA 1UW1A 2XF3A 3FF2A 1BRKA 1FYSA 2Q07A 5IW9A 3IJEB 5D81A 1TTOA 3LOYA 4N6MA 2KF4A 3K5TA 3FG3A 4R4KA 1D6YA 4HZBB 1LOYA 1BOXA 1RLSA 2P05A 5IF6A 1RJOA 3NV0A 4IT7A 5DREA 1CH0A 1IQYA 1BSBA 4O2HA 5KP1A 4BL2A 1STDA 1CEWI 2K3DA 1LVNA 3FH1A 2Z77A 2KCDA 1RCLA 2IYJA 1GMRA 5AYRB 1VQQA 1Z1SA 4WYKB 5LC7A 1RGFA 3KKGA 3S28A 2F5MA 3HOHA 3Q3FA 3VF1A 4O3VA 4L8PA 2STDA 5CF2A 1EUIC 2HOHA 2ZA4A 3B7CA 1WMOA 3GZXB 4X2HA 3CC43 3CPOA 1OUNA 3CPW2 1YIT3 1RTUA 3AMOA 4XDVA 5D83A 1DE3A 3D3LA 3K63A 1FUWA 1Q9EA 4O8SA 1MOLA 1AQZA 3K7CA 4OVMA 3N9HA
chains in the Genus database with same CATH topology
1KC84 4FMAA 1D6ZA 4GB5A 2OTJ3 2CWUA 4GL6A 1VQK3 3UL6A 1OPYA 2R4IA 4KFFA 3MG3A 1O7NB 5JPUA 3F9SA 5CK6A 4N6OB 4HM6B 2OQEC 3N54B 3V99A 3OW22 1SIIA 4KVHA 2KXGA 2CKFB 3O8YA 1FA3A 1U5OA 2M7OA 3DUKA 1G96A 1QAKA 3JVCA 3ER7A 1GS3A 2K54A 3DGOA 4BTXA 3BNBA 3CCR3 3UB1A 3V98A 1SIHA 2SBLA 2IA7A 1NB3I 1GYBA 3KSPA 3WMDA 4XDWA 3X3YA 2CFDA 2PZVA 2CFKA 3MKIA 4K90B 4WYKA 4WFOA 2IUJA 1U8CB 1VQ63 1TIJA 3CCJ3 1MNLA 5AIFA 3NHXA 4K61A 3G0KA 1UI7A 3EB8A 1NWWA 3CCM3 4WWUC 3MWZA 2V1LA 3SEDA 4R9LA 3UJMA 2C11A 3S67A 4HM3B 3OV4A 2GEXA 4IPBA 1QVF2 4MMYB 1O7PB 1JN5B 4MJDA 1QALA 2B24B 2HMLB 5EQLA 2F98A 3H51A 1PFPA 4FMDA 4ZM8A 3TDGA 2ML6A 2QIYA 1W00A 2WOFA 4KFDA 4OUQA 5EEOA 3UNLA 1W6GA 3I0YA 4WHAA 1W5ZA 5EVHA 4HM7B 5KP3A 4J8TA 2CH9A 3X40A 2QEX3 1Q864 1YJW3 3AMOB 3CCE3 3VGNA 1S723 3S5CA 5BXQA 1N8QA 4HM4B 1NB5I 1YI23 2HMKB 1M1XB 2RGQA 3HK4A 5AIIA 1OHPA 2CFWA 3KE7A 3PXMA 3S27A 3KZTA 1IK3A 1A2VA 2CC3A 1D6UA 1DMNA 2KRTA 5HGRA 3WDGB 3LYGA 5IG4A 4JRFA 1IQXA 5CLKA 2GU3A 1OGZA 1SJWA 3BLZA 1A2KA 4EXRA 4HJLB 1GD4A 1ROVA 2XEPA 3K0ZA 3GAXA 1VQ53 4XBXA 3LTAA 1ISKA 3CNMA 3LXUX 2QGUA 1GY6A 3G713 3OWYA 4HM0B 3MHEA 2YFIB 1W01A 3NQYA 1UI8A 1KWIA 4JF8A 4LEHA 3EE1A 4CDLA 3KIIA 4K1VA 1BUQA 2C10A 2F99A 4FCMA 1YJ93 1N9JA 5CF1A 1JN5A 4HBRA 4RZMA 5IEPA 4EC6A 1IV9A 2L4VA 2WO0A 3H3HA 1M9GA 2XGNA 3CCS3 5AIGA 2XFTA 1VQ93 3KN4A 3EX9A 1Q42A 1WMNA 3U97A 3Q2PA 8CHOA 1JB4A 4LGQA 2A15A 2GXFA 2XGLA 6STDA 3STDA 3Q90A 1AV4A 5JPPA 3BNCA 3OWSA 1Q7Y4 3G16A 5G2GA 4FMCA 4Q53A 3A76A 5AYSC 3WA2X 1WMPA 2LQVA 3NM2A 3BB9A 3J7Yd 4BTWA 1VQ83 1N5HA 3MPHA 3FG4A 3SX1A 1VQO3 2OCTA 3B4OA 4STDA 5CXOA 4R1KA 5ELJA 4X2OA 3IMAB 2E2UA 2XSOB 5IENA 1LNHA 1O7WB 2XH9A 4H3UA 3DZLA 1S5AA 2D42A 1UUWB 1NDOB 3LZAA 2LYXA 3RDEA 2BMQB 3CD63 2FGTA 3K9MC 4L8OA 3KSED 3T8UA 2W56B 2W9QA 4XM4A 1L5GB 1VQM3 3CMA3 1OACA 1OH0A 2HMMB 3OWUA 3BNDA 3ALAA 2CHCA 2CWTA 1EG9B 2OOVC 3WOFB 5FW5A 2QA43 2IUKA 4NREA 3EN1B 1JRQA 1IT7A 3EQQB 1IVUA 5JBSA 5D82A 1N9EA 1W2B2 1V74A 1VZZA 1AVKA 2JQ5A 2W04A 5AI1A 4FCJA 4OK0A 3WOEB 4HZ9B 3ROBA 4AEQA 1EKMA 1OCVA 1K9M4 1VQ43 4FMBA 2FXTA 2XR8B 3D9RA 1FGOA 1SPUA 4H61A 1LXEA 3U1WA 3JUQA 4R9KA 4O02B 1YJN3 3LTCA 4HKVB 3FG1A 3JUNA 3DY5A 1QVG2 3GWRA 3FGYA 3EHCA 1DVDA 2ML5A 3S29A 1RN7A 3NBJA 3GZYB 1JV2B 3F40A 3GRDA 4N6V0 3GZBA 1WQLB 4K1UA 4KFEA 4IIAA 3DXOA 3SLUA 2Z7AA 4EYCA 3E99A 3FZWA 3LMLA 1AR0A 4G1MB 2OQEA 3SOAA 2RSXA 2Z76A 2IMJA 1SQWA 1M1K4 3PCRA 2W56A 3KFQC 7STDA 3CC73 2F86B 1W6CA 2GEYA 3NX0A 3FCSB 1Y4KA 3NQZA 1PU4A 1Q824 3M8CA 1IU7A 3FF0A 1W4NA 1KQS2 1STFI 4HM2B 3JUOA 3NUVA 3X3XA 4EBGA 1E97A 1Q40B 1OHOA 3LT8A 3MSOA 2Y73A 2W9PA 2WGQA 1FGQA 1DYUA 1JKGB 3WODG 3HX8A 1LOXA 3BNEA 2YX9A 1JNQA 1N8R4 4LMIA 3QK9A 3PYJA 1IDPA 2P0XA 3CC23 4XB5A 1ZO2A 1E3RA 2ZL8A 1GD3A 4HM5B 2OTL3 5LC6A 1YVBI 3QRDA 3CCV3 4I4KA 1QMAA 1M904 4U13A 2W6JH 1IQ8A 3FSDA 1RKYA 3UL5A 3PGBA 3LH4A 4N6TA 4NHFA 1R4CA 1WTHA 3HIGA 4ORLA 1TU5A 3OX9A 1E3VA 2CFLA 2B1XB 3F8XA 4BTYA 3F14A 2CG1A 1ASKA 2BMOB 2BT3A 4XBYA 4MEIA 5KP4A 3CCQ3 3DM8A 3ECFA 3FKAA 1YGEA 3CCL3 1NO3A 1GY5A 1W02A 1ZX2A 1K28A 1DMMA 1VQ73 4CCVA 1ULJB 2O3OA 3MYTA 1F8NA 3FLJA 2CK3H 2I9WA 2P09A 3SXXA 4N3VA 3DGMA 2E2VA 3EF8A 1FGTA 2XRXB 4HVNA 2Y74A 1N5PA 2GBWB 4R80A 3I553 1W2ZA 3PZWA 1TP6A 3B4PA 5IG5A 1A90A 3DGNA 3EN8A 4XBTA 1Q40A 3NBBA 1C7HA 3RGAA 4HYZA 3MG1A 1K8A4 5AEUB 3V92A 1VQP3 1K41A 1JKGA 5IG3A 1OF5B 3G8ZA 3X41A 3JUPA 1IVVA 3LT9A 3B8LA 1A67A 2GU1A 3GZRA 3HZPA 1NU3A 2RFRA 3Q1CA 1KSIA 1W6YA 1WNHA 2CWVA 1NJI4 1O7HB 3DGLA 1YIJ3 2GBXB 3HIIA 1Q814 4RBNA 3T8NA 2RCDA 3CCU3 5A0OB 4EV2A 5AIHA 1IVXA 1RRHA 2BNGA 2P0MA 3F8HA 3PCSA 3CME3 4LSOA 2WGOA 3L0RA 4RNZA 4QWTA 1VQL3 2HMNB 1HKXA 3X3ZA 1QJGA 3N8BA 5STDA 4L7KA 2FNQA 3CXC2 2ZDJA 5IG0A 2MF7A 4KZ1A 1ULIB 4WP5A 3LTDA 1CYVA 3EBYA 1J2BA 2JDIH 2K0MA 3NXJA 4AKZA 3JUMA 2E2TA 1CQSA 1JB5A 3LTBA 3WA3A 1IT8A 1DVCA 1DMQA 3MG2A 2XFSA 1KD14 4N6UA 3T0UA 3G6E3 4FCZA 4EV5A 3OXAA 2PNCA 1UUVB 1RRLA 1O7GB 2HMJB 3EC9A 3HI7A 2D1WA 1T5YA 1QAFA 3NV0B 1OHSA 2CFGA 2P38A 1IV7A 1VQN3 4RNYA 5TGNA 2INXA 2CIUA 4AKYA 1FGMA 4FR9A 2BHMA 2W03A 5I97A 1GY7A 1OF5A 1ROAA 1W7CA 5AEWB 5ELUA 1HU9A 4MMXB 1TFOA 3G4S3 2Z6BA 1EA2A 2YFJB 3PS8A 3F7SA 3NBRA 4N6LA 1JJ22 3CU3A 2W2CA 2BMRB 1OGXA 5DRVA 1EQKA 2OOVA 2OWPA 2W0QA 5BVBA 2WOHA 1CYUA 1O7MB 1IVWA 2CW9A 4HM8B 2HMOB 1AVLA 1FGRA 4PEJA 1YHQ3 1TFKA 4TX4A 5IERA 3X42A 3CNXA 1TUHA 1JB2A 2XSHB 2YFLB 3I563 3IPTA 3SVAA 3SOYA 1US1A 2O9UX 2CG0A 3DMCA 3EJVA 4N6NB 2MC8A 2BO9B 4J9AA 1K734 3VSYA 3F7XA 3NM7A 5IEOA 2UX0A 4LZIA 4MMZB 4HM1B 3EBTA 5FGOA 3RGRA 1UW1A 2XF3A 3FF2A 2Q07A 5IW9A 3IJEB 5D81A 3LOYA 4N6MA 3K5TA 3FG3A 4R4KA 1D6YA 4HZBB 2P05A 5IF6A 1RJOA 3NV0A 4IT7A 5DREA 1IQYA 4O2HA 5KP1A 1STDA 1CEWI 1LVNA 3FH1A 2Z77A 2KCDA 5AYRB 1Z1SA 4WYKB 5LC7A 3KKGA 3S28A 3VF1A 4O3VA 4L8PA 2STDA 5CF2A 3B7CA 1WMOA 3GZXB 4X2HA 3CC43 3CPOA 1OUNA 3CPW2 1YIT3 4XDVA 3AMOA 5D83A 3D3LA 3K63A 1FUWA 4O8SA 1MOLA 3K7CA 4OVMA 3N9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 4;  1VQM 3;  3CMA 3;  3CCV 3;  1KC8 4;  3CCR 3;  1QVF 2;  3CC7 3;  1VQO 3;  1M90 4;  1YJ9 3;  1Q82 4;  2OTL 3;  2OTJ 3;  1YJN 3;  2QA4 3;  3G4S 3;  1VQK 3;  1YIJ 3;  1K73 4;  1NJI 4;  1KQS 2;  1JJ2 2;  3CCS 3;  1Q81 4;  1QVG 2;  1KD1 4;  3G6E 3;  3I55 3;  1VQ9 3;  1VQ6 3;  2QEX 3;  3CCU 3;  1W2B 2;  1Q86 4;  3CCJ 3;  1YJW 3;  3CC4 3;  3CCE 3;  3CCM 3;  3CCQ 3;  3CME 3;  1S72 3;  1VQ5 3;  3CPW 2;  1YIT 3;  3G71 3;  1VQL 3;  3OW2 2;  1K8A 4;  3CD6 3;  1YI2 3;  3CCL 3;  1VQP 3;  1YHQ 3;  1N8R 4;  1VQN 3;  3CC2 3;  1Q7Y 4;  3CXC 2;  1VQ7 3;  1K9M 4;  1VQ4 3;  3I56 3;  1VQ8 3; 
#chains in the Genus database with same CATH topology
 1KC8 4;  1UCI A;  4FMA A;  1RHL A;  1D6Z A;  1RGC A;  4GB5 A;  2OTJ 3;  2CWU A;  4GL6 A;  4GSP A;  1VQK 3;  3UL6 A;  1RN1 A;  1OPY A;  2R4I A;  4KFF A;  1YGW A;  3MG3 A;  1B2X A;  4BL3 A;  1O7N B;  5JPU A;  3F9S A;  5CK6 A;  1B2U A;  4HM6 B;  4N6O B;  2OQE C;  3N54 B;  3V99 A;  1UUG B;  2R41 A;  1B27 A;  3OW2 2;  1SII A;  1MGR A;  3DH2 A;  4KVH A;  2KXG A;  3ZG0 A;  2CKF B;  3O8Y A;  1FA3 A;  1TJD A;  1U5O A;  2M7O A;  3DUK A;  1G96 A;  1QAK A;  3JVC A;  3ER7 A;  1GS3 A;  1BIR A;  2K54 A;  3DGO A;  4BTX A;  3BNB A;  2CX1 A;  3CCR 3;  3UB1 A;  1MGW A;  5G1K A;  3V98 A;  1SIH A;  2SBL A;  4HOH A;  2IA7 A;  1NB3 I;  1GYB A;  3KSP A;  3WMD A;  1GMQ A;  4XDW A;  3X3Y A;  2CFD A;  2PZV A;  2CFK A;  3MKI A;  4K90 B;  4WYK A;  4WFO A;  2IUJ A;  1U8C B;  3WA3 A;  1VQ6 3;  1TIJ A;  3CCJ 3;  1MNL A;  5AIF A;  3NHX A;  4K61 A;  1YVS A;  3G0K A;  1UI7 A;  3EB8 A;  1NWW A;  4I5Q A;  3CCM 3;  1RGK A;  1BNE A;  4WWU C;  3MWZ A;  2V1L A;  3SED A;  4R9L A;  3UJM A;  2C11 A;  3S67 A;  1BSE A;  4HM3 B;  3OV4 A;  2GEX A;  4HAA A;  4IPB A;  1QVF 2;  4MMY B;  1O7P B;  1JN5 B;  2H0H A;  4MJD A;  1QAL A;  1BGS A;  1TRQ A;  2B24 B;  1I8V A;  2F98 A;  2HML B;  3H51 A;  5EQL A;  1PFP A;  3D4A A;  4FMD A;  1BNR A;  4ZM8 A;  3TDG A;  2ML6 A;  2RBI A;  2QIY A;  1W00 A;  2WOF A;  4KFD A;  1B3S A;  1FUS A;  4OUQ A;  5EEO A;  3UNL A;  1W6G A;  3I0Y A;  4WHA A;  1W5Z A;  5EVH A;  4HM7 B;  5KP3 A;  4J8T A;  1BNS A;  2CH9 A;  3X40 A;  4EW5 A;  2QEX 3;  1Q86 4;  1YJW 3;  1R4Y A;  5M18 A;  3AMO B;  3CCE 3;  3VGN A;  1S72 3;  3S5C A;  5BXQ A;  1N8Q A;  4HM4 B;  3AGN A;  1NB5 I;  1YI2 3;  2HMK B;  1M1X B;  2RGQ A;  3HK4 A;  1V57 A;  1OHP A;  2CFW A;  3KE7 A;  3PXM A;  5AII A;  1I0V A;  3KZT A;  3S27 A;  1IK3 A;  1A2V A;  4J5K A;  2CC3 A;  4BU4 A;  1D6U A;  1DMN A;  2KRT A;  5HGR A;  3WDG B;  3LYG A;  5M19 A;  5IG4 A;  1T2H A;  4JRF A;  1IQX A;  5CLK A;  2GU3 A;  1OGZ A;  1SJW A;  3BLZ A;  1A2K A;  4EXR A;  4HJL B;  1GD4 A;  1ROV A;  2XEP A;  3K0Z A;  3GAX A;  1VQ5 3;  4XBX A;  1RGL A;  3LTA A;  1ISK A;  3CNM A;  3LXU X;  2QGU A;  1GY6 A;  3G71 3;  3OWY A;  4HM0 B;  3SYU A;  3MHE A;  5RNT A;  5G1L A;  2YFI B;  1W01 A;  3NQY A;  1UI8 A;  1KWI A;  1ZGX A;  1BRH A;  4JF8 A;  1BAO A;  4LEH A;  3EE1 A;  4CDL A;  3KII A;  4K1V A;  1BUQ A;  2C10 A;  2F99 A;  4FCM A;  1YJ9 3;  1BUJ A;  1N9J A;  5CF1 A;  1JN5 A;  1FUT A;  1JZO A;  4HBR A;  4RZM A;  5IEP A;  1HZ1 A;  4EC6 A;  1IV9 A;  2L4V A;  2WO0 A;  3H3H A;  1M9G A;  2XGN A;  1PY3 A;  8RNT A;  3CCS 3;  1BSC A;  5AIG A;  2XFT A;  4DKI A;  1VQ9 3;  1X1W A;  3KN4 A;  3EX9 A;  1Q42 A;  1WMN A;  3U97 A;  2UGI A;  3Q2P A;  8CHO A;  1JB4 A;  4LGQ A;  1LNI A;  2A15 A;  2GXF A;  2XGL A;  6STD A;  3STD A;  3Q90 A;  1AV4 A;  5JPP A;  2H0G A;  3BNC A;  3OWS A;  1Q7Y 4;  3G16 A;  1V58 A;  4FMC A;  4Q53 A;  3A76 A;  5G2G A;  5AYS C;  1WMP A;  2LQV A;  1B2Z A;  3BB9 A;  3NM2 A;  3WA2 X;  4BTW A;  1VQ8 3;  3KCH A;  1N5H A;  3MPH A;  3FG4 A;  3SX1 A;  1VQO 3;  2OCT A;  3B4O A;  3GSP A;  4STD A;  4R1K A;  5CXO A;  5ELJ A;  4X2O A;  1RGE A;  3IMA B;  1RSN A;  2E2U A;  3D5I A;  2XSO B;  5IEN A;  1LNH A;  1O7W B;  2XH9 A;  1JBR A;  4H3U A;  3DZL A;  1A2P A;  1S5A A;  2D42 A;  2BU4 A;  1UUW B;  1NDO B;  4CPK A;  1MWT A;  1MWU A;  1GOY A;  1Q7H A;  5BU4 A;  1G02 A;  3LZA A;  2LYX A;  3RDE A;  2BMQ B;  1RNT A;  3CD6 3;  2FGT A;  3K9M C;  1AY7 A;  4L8O A;  1LRA A;  3KSE D;  3T8U A;  2W56 B;  4CJN A;  2W9Q A;  4XM4 A;  2KF3 A;  1L5G B;  1BRG A;  1VQM 3;  3CMA 3;  1OAC A;  1OH0 A;  2HMM B;  3OWU A;  3BND A;  3ALA A;  2CHC A;  2CWT A;  1EG9 B;  2KF6 A;  2OOV C;  3WOF B;  5FW5 A;  2QA4 3;  2IUK A;  4NRE A;  3EN1 B;  4RNT A;  1JRQ A;  5HOH A;  1IT7 A;  3EQQ B;  1IVU A;  2L1S A;  5JBS A;  1BRN L;  5D82 A;  1N9E A;  1W2B 2;  1V74 A;  1VZZ A;  1AVK A;  2JQ5 A;  2W04 A;  5AI1 A;  1BSA A;  1B21 A;  4FCJ A;  4OK0 A;  3WOE B;  4HZ9 B;  3ROB A;  4AEQ A;  1EKM A;  1OCV A;  6RNT A;  1BNI A;  2RNT A;  1K9M 4;  1VQ4 3;  4FMB A;  2FXT A;  1BNJ A;  2XR8 B;  1X1Y A;  3D9R A;  1FGO A;  3D79 A;  1SPU A;  4H61 A;  3URP A;  1LXE A;  2ZHX B;  3U1W A;  2GSP A;  3JUQ A;  3ZFZ A;  4ILF A;  1SAR A;  4R9K A;  4O02 B;  1YJN 3;  1C54 A;  3LTC A;  4GHO A;  4HKV B;  3FG1 A;  3JUN A;  1I3I A;  3DY5 A;  3GWR A;  6GSP A;  1QVG 2;  1B2M A;  3FGY A;  3EHC A;  1DVD A;  2ML5 A;  3S29 A;  1RN7 A;  3NBJ A;  3GZY B;  2F4Y A;  1JV2 B;  1JBT A;  3F40 A;  3GRD A;  4N6V 0;  1BVI A;  1UDI I;  1WQL B;  3GZB A;  4K1U A;  1IYY A;  4KFE A;  4IIA A;  3DXO A;  3SLU A;  2Z7A A;  4EYC A;  1RN4 A;  5M1A A;  3E99 A;  3FZW A;  3LML A;  1AR0 A;  4G1M B;  2OQE A;  7RNT A;  3SOA A;  5BIR A;  4BIR A;  1SQW A;  2IMJ A;  2RSX A;  2Z76 A;  1M1K 4;  3PCR A;  1RGA A;  2W56 A;  3KFQ C;  7STD A;  3CC7 3;  1G0T A;  2F86 B;  1I0X A;  1W6C A;  1I70 A;  2GEY A;  1Y4K A;  1UGI A;  3FCS B;  3NQZ A;  3M8C A;  1IU7 A;  3NX0 A;  1Q82 4;  3FF0 A;  1I2E A;  3D5G A;  1W4N A;  2H0I A;  1KQS 2;  1STF I;  4HM2 B;  3JUO A;  3NUV A;  3X3X A;  4EBG A;  2C4B A;  3AGO A;  1E97 A;  1Q40 B;  1OHO A;  3LT8 A;  3MSO A;  2Y73 A;  1GMP A;  2W9P A;  2WGQ A;  3ZG5 A;  1FGQ A;  1DYU A;  1NNV A;  1JKG B;  3WOD G;  3HX8 A;  1BNG A;  1LOX A;  3BNE A;  2YX9 A;  1JNQ A;  1N8R 4;  4LMI A;  3QK9 A;  3PYJ A;  1IDP A;  2P0X A;  3J7Y d;  3CC2 3;  4XB5 A;  1ZO2 A;  1E3R A;  1GD3 A;  2ZL8 A;  4HM5 B;  2OTL 3;  5LC6 A;  1YVB I;  3QRD A;  3CCV 3;  2KF5 A;  1BRJ A;  1HYF A;  1QMA A;  4I4K A;  1M90 4;  4U13 A;  2W6J H;  1IQ8 A;  3FSD A;  1RKY A;  3BIR A;  3PGB A;  3UL5 A;  3LH4 A;  4N6T A;  1I2G A;  4NHF A;  1RCK A;  4J5G A;  1R4C A;  1WTH A;  3HIG A;  4ORL A;  1TU5 A;  3OX9 A;  1E3V A;  1I2F A;  1LQM B;  2B1X B;  2CFL A;  3F8X A;  1DET A;  4BTY A;  3F14 A;  2CG1 A;  3RNT A;  1GOU A;  1ASK A;  2BMO B;  2BT3 A;  4XBY A;  1LOW A;  4MEI A;  5KP4 A;  3CCQ 3;  3DM8 A;  3ECF A;  3FKA A;  1YGE A;  3CCL 3;  1NO3 A;  1GY5 A;  1W02 A;  1ZX2 A;  1BRS A;  1K28 A;  1DMM A;  1VQ7 3;  4CCV A;  1RGG A;  1ULJ B;  2O3O A;  3MYT A;  7GSP A;  1F8N A;  3A5E A;  3FLJ A;  2CK3 H;  2I9W A;  2P09 A;  3SXX A;  4N3V A;  3DGM A;  1BRI A;  2AAD A;  2E2V A;  1JBS A;  3EF8 A;  1FGT A;  2XRX B;  1X1U A;  2Y74 A;  1N5P A;  2GBW B;  4HVN A;  4R80 A;  3I55 3;  1W2Z A;  3PZW A;  1TP6 A;  3B4P A;  1UGH I;  1RGH A;  5IG5 A;  2F56 A;  1UCK A;  1A90 A;  3DGN A;  1UCL A;  3EN8 A;  4XBT A;  1RMS A;  1Q40 A;  3NBB A;  1C7H A;  1RNB A;  3RGA A;  1FW7 A;  4HYZ A;  3MG1 A;  1K8A 4;  5AEU B;  3V92 A;  1VQP 3;  1TRP A;  1BSD A;  1K41 A;  1JKG A;  5IG3 A;  1OF5 B;  3G8Z A;  3X41 A;  1BNF A;  3JUP A;  1IVV A;  3LT9 A;  3B8L A;  1A67 A;  2CX0 A;  1ZS7 A;  2GU1 A;  3GZR A;  3HZP A;  1B20 A;  1BU4 A;  1NU3 A;  2RFR A;  3Q1C A;  1KSI A;  1W6Y A;  1WNH A;  2CWV A;  1T2I A;  1NJI 4;  1O7H B;  3DGL A;  1YIJ 3;  2UUG C;  2GBX B;  3HII A;  4LYL B;  1Q81 4;  4RBN A;  3T8N A;  2RCD A;  1T3B A;  5A0O B;  4EV2 A;  3CCU 3;  5AIH A;  1IVX A;  1RRH A;  2BIR A;  2BNG A;  2P0M A;  3F8H A;  3PCS A;  3CME 3;  4LSO A;  2WGO A;  3L0R A;  4RNZ A;  4QWT A;  1VQL 3;  2HMN B;  1HKX A;  3X3Z A;  1I3F A;  1QJG A;  3N8B A;  5STD A;  4L7K A;  2FNQ A;  3WHO A;  1PYL A;  2ZDJ A;  3CXC 2;  5IG0 A;  2MF7 A;  1MWS A;  4KZ1 A;  3AHS A;  1ULI B;  4WP5 A;  1UCJ A;  3LTD A;  1CYV A;  3EBY A;  1J2B A;  2JDI H;  2K0M A;  3NXJ A;  4AKZ A;  3JUM A;  2E2T A;  1CQS A;  1JB5 A;  3LTB A;  5GSP A;  1IT8 A;  1DVC A;  9RNT A;  1DMQ A;  3MG2 A;  2XFS A;  1KD1 4;  4N6U A;  3T0U A;  3G6E 3;  4FCZ A;  4EV5 A;  3OXA A;  2PNC A;  1UUV B;  3DGY A;  1RRL A;  1YNV X;  1O7G B;  2HMJ B;  3EC9 A;  3HI7 A;  2D1W A;  1T5Y A;  1QAF A;  3NV0 B;  1OHS A;  2CFG A;  2P38 A;  1IV7 A;  1VQN 3;  4RNY A;  5TGN A;  2INX A;  2CIU A;  4AKY A;  1FGM A;  4FR9 A;  1GOV A;  1RDS A;  2BHM A;  2W03 A;  5I97 A;  1GY7 A;  1OF5 A;  1ROA A;  1W7C A;  5AEW B;  5ELU A;  1HU9 A;  4MMX B;  1TFO A;  3G4S 3;  2Z6B A;  1EA2 A;  2YFJ B;  3PS8 A;  3F7S A;  3NBR A;  4N6L A;  1JJ2 2;  1LOV A;  3CU3 A;  2W2C A;  2BMR B;  1OGX A;  5DRV A;  1EQK A;  2OOV A;  2OWP A;  2J8X B;  2W0Q A;  2IY2 A;  1BAN A;  2KAA A;  2WOH A;  4NPB A;  1O7M B;  1IVW A;  1GSP A;  5BVB A;  2CW9 A;  1CYU A;  1FZU A;  4HM8 B;  4KT3 B;  2HMO B;  1JZD A;  1AVL A;  1FGR A;  4PEJ A;  1YHQ 3;  1LQG C;  1TFK A;  4TX4 A;  5IER A;  3X42 A;  1X1X A;  1MWR A;  2F5W A;  3CNX A;  1TUH A;  1JB2 A;  2XSH B;  2YFL B;  3I56 3;  3IPT A;  3WR2 A;  1PU4 A;  3AHW A;  3SVA A;  3SOY A;  1US1 A;  2O9U X;  2CG0 A;  3DMC A;  3EJV A;  4N6N B;  2MC8 A;  1EEJ A;  1B2S A;  2BO9 B;  3BU4 A;  2SAR A;  4J9A A;  3F7X A;  3NM7 A;  5IEO A;  2UX0 A;  3VSY A;  4LZI A;  1K73 4;  4MMZ B;  4HM1 B;  3EBT A;  2AAE A;  5FGO A;  3RGR A;  1UW1 A;  2XF3 A;  3FF2 A;  1BRK A;  1FYS A;  2Q07 A;  5IW9 A;  3IJE B;  5D81 A;  1TTO A;  3LOY A;  4N6M A;  2KF4 A;  3K5T A;  3FG3 A;  4R4K A;  1D6Y A;  4HZB B;  1LOY A;  1BOX A;  1RLS A;  2P05 A;  5IF6 A;  1RJO A;  3NV0 A;  4IT7 A;  5DRE A;  1CH0 A;  1IQY A;  1BSB A;  4O2H A;  5KP1 A;  4BL2 A;  1STD A;  1CEW I;  2K3D A;  1LVN A;  3FH1 A;  2Z77 A;  2KCD A;  1RCL A;  2IYJ A;  1GMR A;  5AYR B;  1VQQ A;  1Z1S A;  4WYK B;  5LC7 A;  1RGF A;  3KKG A;  3S28 A;  2F5M A;  3HOH A;  3Q3F A;  3VF1 A;  4O3V A;  4L8P A;  2STD A;  5CF2 A;  1EUI C;  2HOH A;  2ZA4 A;  3B7C A;  1WMO A;  3GZX B;  4X2H A;  3CC4 3;  3CPO A;  1OUN A;  3CPW 2;  1YIT 3;  1RTU A;  3AMO A;  4XDV A;  5D83 A;  1DE3 A;  3D3L A;  3K63 A;  1FUW A;  1Q9E A;  4O8S A;  1MOL A;  1AQZ A;  3K7C A;  4OVM A;  3N9H A; 
#chains in the Genus database with same CATH homology
 1KC8 4;  4FMA A;  1D6Z A;  4GB5 A;  2OTJ 3;  2CWU A;  4GL6 A;  1VQK 3;  3UL6 A;  1OPY A;  2R4I A;  4KFF A;  3MG3 A;  1O7N B;  5JPU A;  3F9S A;  5CK6 A;  4N6O B;  4HM6 B;  2OQE C;  3N54 B;  3V99 A;  3OW2 2;  1SII A;  4KVH A;  2KXG A;  2CKF B;  3O8Y A;  1FA3 A;  1U5O A;  2M7O A;  3DUK A;  1G96 A;  1QAK A;  3JVC A;  3ER7 A;  1GS3 A;  2K54 A;  3DGO A;  4BTX A;  3BNB A;  3CCR 3;  3UB1 A;  3V98 A;  1SIH A;  2SBL A;  2IA7 A;  1NB3 I;  1GYB A;  3KSP A;  3WMD A;  4XDW A;  3X3Y A;  2CFD A;  2PZV A;  2CFK A;  3MKI A;  4K90 B;  4WYK A;  4WFO A;  2IUJ A;  1U8C B;  1VQ6 3;  1TIJ A;  3CCJ 3;  1MNL A;  5AIF A;  3NHX A;  4K61 A;  3G0K A;  1UI7 A;  3EB8 A;  1NWW A;  3CCM 3;  4WWU C;  3MWZ A;  2V1L A;  3SED A;  4R9L A;  3UJM A;  2C11 A;  3S67 A;  4HM3 B;  3OV4 A;  2GEX A;  4IPB A;  1QVF 2;  4MMY B;  1O7P B;  1JN5 B;  4MJD A;  1QAL A;  2B24 B;  2HML B;  5EQL A;  2F98 A;  3H51 A;  1PFP A;  4FMD A;  4ZM8 A;  3TDG A;  2ML6 A;  2QIY A;  1W00 A;  2WOF A;  4KFD A;  4OUQ A;  5EEO A;  3UNL A;  1W6G A;  3I0Y A;  4WHA A;  1W5Z A;  5EVH A;  4HM7 B;  5KP3 A;  4J8T A;  2CH9 A;  3X40 A;  2QEX 3;  1Q86 4;  1YJW 3;  3AMO B;  3CCE 3;  3VGN A;  1S72 3;  3S5C A;  5BXQ A;  1N8Q A;  4HM4 B;  1NB5 I;  1YI2 3;  2HMK B;  1M1X B;  2RGQ A;  3HK4 A;  5AII A;  1OHP A;  2CFW A;  3KE7 A;  3PXM A;  3S27 A;  3KZT A;  1IK3 A;  1A2V A;  2CC3 A;  1D6U A;  1DMN A;  2KRT A;  5HGR A;  3WDG B;  3LYG A;  5IG4 A;  4JRF A;  1IQX A;  5CLK A;  2GU3 A;  1OGZ A;  1SJW A;  3BLZ A;  1A2K A;  4EXR A;  4HJL B;  1GD4 A;  1ROV A;  2XEP A;  3K0Z A;  3GAX A;  1VQ5 3;  4XBX A;  3LTA A;  1ISK A;  3CNM A;  3LXU X;  2QGU A;  1GY6 A;  3G71 3;  3OWY A;  4HM0 B;  3MHE A;  2YFI B;  1W01 A;  3NQY A;  1UI8 A;  1KWI A;  4JF8 A;  4LEH A;  3EE1 A;  4CDL A;  3KII A;  4K1V A;  1BUQ A;  2C10 A;  2F99 A;  4FCM A;  1YJ9 3;  1N9J A;  5CF1 A;  1JN5 A;  4HBR A;  4RZM A;  5IEP A;  4EC6 A;  1IV9 A;  2L4V A;  2WO0 A;  3H3H A;  1M9G A;  2XGN A;  3CCS 3;  5AIG A;  2XFT A;  1VQ9 3;  3KN4 A;  3EX9 A;  1Q42 A;  1WMN A;  3U97 A;  3Q2P A;  8CHO A;  1JB4 A;  4LGQ A;  2A15 A;  2GXF A;  2XGL A;  6STD A;  3STD A;  3Q90 A;  1AV4 A;  5JPP A;  3BNC A;  3OWS A;  1Q7Y 4;  3G16 A;  5G2G A;  4FMC A;  4Q53 A;  3A76 A;  5AYS C;  3WA2 X;  1WMP A;  2LQV A;  3NM2 A;  3BB9 A;  3J7Y d;  4BTW A;  1VQ8 3;  1N5H A;  3MPH A;  3FG4 A;  3SX1 A;  1VQO 3;  2OCT A;  3B4O A;  4STD A;  5CXO A;  4R1K A;  5ELJ A;  4X2O A;  3IMA B;  2E2U A;  2XSO B;  5IEN A;  1LNH A;  1O7W B;  2XH9 A;  4H3U A;  3DZL A;  1S5A A;  2D42 A;  1UUW B;  1NDO B;  3LZA A;  2LYX A;  3RDE A;  2BMQ B;  3CD6 3;  2FGT A;  3K9M C;  4L8O A;  3KSE D;  3T8U A;  2W56 B;  2W9Q A;  4XM4 A;  1L5G B;  1VQM 3;  3CMA 3;  1OAC A;  1OH0 A;  2HMM B;  3OWU A;  3BND A;  3ALA A;  2CHC A;  2CWT A;  1EG9 B;  2OOV C;  3WOF B;  5FW5 A;  2QA4 3;  2IUK A;  4NRE A;  3EN1 B;  1JRQ A;  1IT7 A;  3EQQ B;  1IVU A;  5JBS A;  5D82 A;  1N9E A;  1W2B 2;  1V74 A;  1VZZ A;  1AVK A;  2JQ5 A;  2W04 A;  5AI1 A;  4FCJ A;  4OK0 A;  3WOE B;  4HZ9 B;  3ROB A;  4AEQ A;  1EKM A;  1OCV A;  1K9M 4;  1VQ4 3;  4FMB A;  2FXT A;  2XR8 B;  3D9R A;  1FGO A;  1SPU A;  4H61 A;  1LXE A;  3U1W A;  3JUQ A;  4R9K A;  4O02 B;  1YJN 3;  3LTC A;  4HKV B;  3FG1 A;  3JUN A;  3DY5 A;  1QVG 2;  3GWR A;  3FGY A;  3EHC A;  1DVD A;  2ML5 A;  3S29 A;  1RN7 A;  3NBJ A;  3GZY B;  1JV2 B;  3F40 A;  3GRD A;  4N6V 0;  3GZB A;  1WQL B;  4K1U A;  4KFE A;  4IIA A;  3DXO A;  3SLU A;  2Z7A A;  4EYC A;  3E99 A;  3FZW A;  3LML A;  1AR0 A;  4G1M B;  2OQE A;  3SOA A;  2RSX A;  2Z76 A;  2IMJ A;  1SQW A;  1M1K 4;  3PCR A;  2W56 A;  3KFQ C;  7STD A;  3CC7 3;  2F86 B;  1W6C A;  2GEY A;  3NX0 A;  3FCS B;  1Y4K A;  3NQZ A;  1PU4 A;  1Q82 4;  3M8C A;  1IU7 A;  3FF0 A;  1W4N A;  1KQS 2;  1STF I;  4HM2 B;  3JUO A;  3NUV A;  3X3X A;  4EBG A;  1E97 A;  1Q40 B;  1OHO A;  3LT8 A;  3MSO A;  2Y73 A;  2W9P A;  2WGQ A;  1FGQ A;  1DYU A;  1JKG B;  3WOD G;  3HX8 A;  1LOX A;  3BNE A;  2YX9 A;  1JNQ A;  1N8R 4;  4LMI A;  3QK9 A;  3PYJ A;  1IDP A;  2P0X A;  3CC2 3;  4XB5 A;  1ZO2 A;  1E3R A;  2ZL8 A;  1GD3 A;  4HM5 B;  2OTL 3;  5LC6 A;  1YVB I;  3QRD A;  3CCV 3;  4I4K A;  1QMA A;  1M90 4;  4U13 A;  2W6J H;  1IQ8 A;  3FSD A;  1RKY A;  3UL5 A;  3PGB A;  3LH4 A;  4N6T A;  4NHF A;  1R4C A;  1WTH A;  3HIG A;  4ORL A;  1TU5 A;  3OX9 A;  1E3V A;  2CFL A;  2B1X B;  3F8X A;  4BTY A;  3F14 A;  2CG1 A;  1ASK A;  2BMO B;  2BT3 A;  4XBY A;  4MEI A;  5KP4 A;  3CCQ 3;  3DM8 A;  3ECF A;  3FKA A;  1YGE A;  3CCL 3;  1NO3 A;  1GY5 A;  1W02 A;  1ZX2 A;  1K28 A;  1DMM A;  1VQ7 3;  4CCV A;  1ULJ B;  2O3O A;  3MYT A;  1F8N A;  3FLJ A;  2CK3 H;  2I9W A;  2P09 A;  3SXX A;  4N3V A;  3DGM A;  2E2V A;  3EF8 A;  1FGT A;  2XRX B;  4HVN A;  2Y74 A;  1N5P A;  2GBW B;  4R80 A;  3I55 3;  1W2Z A;  3PZW A;  1TP6 A;  3B4P A;  5IG5 A;  1A90 A;  3DGN A;  3EN8 A;  4XBT A;  1Q40 A;  3NBB A;  1C7H A;  3RGA A;  4HYZ A;  3MG1 A;  1K8A 4;  5AEU B;  3V92 A;  1VQP 3;  1K41 A;  1JKG A;  5IG3 A;  1OF5 B;  3G8Z A;  3X41 A;  3JUP A;  1IVV A;  3LT9 A;  3B8L A;  1A67 A;  2GU1 A;  3GZR A;  3HZP A;  1NU3 A;  2RFR A;  3Q1C A;  1KSI A;  1W6Y A;  1WNH A;  2CWV A;  1NJI 4;  1O7H B;  3DGL A;  1YIJ 3;  2GBX B;  3HII A;  1Q81 4;  4RBN A;  3T8N A;  2RCD A;  3CCU 3;  5A0O B;  4EV2 A;  5AIH A;  1IVX A;  1RRH A;  2BNG A;  2P0M A;  3F8H A;  3PCS A;  3CME 3;  4LSO A;  2WGO A;  3L0R A;  4RNZ A;  4QWT A;  1VQL 3;  2HMN B;  1HKX A;  3X3Z A;  1QJG A;  3N8B A;  5STD A;  4L7K A;  2FNQ A;  3CXC 2;  2ZDJ A;  5IG0 A;  2MF7 A;  4KZ1 A;  1ULI B;  4WP5 A;  3LTD A;  1CYV A;  3EBY A;  1J2B A;  2JDI H;  2K0M A;  3NXJ A;  4AKZ A;  3JUM A;  2E2T A;  1CQS A;  1JB5 A;  3LTB A;  3WA3 A;  1IT8 A;  1DVC A;  1DMQ A;  3MG2 A;  2XFS A;  1KD1 4;  4N6U A;  3T0U A;  3G6E 3;  4FCZ A;  4EV5 A;  3OXA A;  2PNC A;  1UUV B;  1RRL A;  1O7G B;  2HMJ B;  3EC9 A;  3HI7 A;  2D1W A;  1T5Y A;  1QAF A;  3NV0 B;  1OHS A;  2CFG A;  2P38 A;  1IV7 A;  1VQN 3;  4RNY A;  5TGN A;  2INX A;  2CIU A;  4AKY A;  1FGM A;  4FR9 A;  2BHM A;  2W03 A;  5I97 A;  1GY7 A;  1OF5 A;  1ROA A;  1W7C A;  5AEW B;  5ELU A;  1HU9 A;  4MMX B;  1TFO A;  3G4S 3;  2Z6B A;  1EA2 A;  2YFJ B;  3PS8 A;  3F7S A;  3NBR A;  4N6L A;  1JJ2 2;  3CU3 A;  2W2C A;  2BMR B;  1OGX A;  5DRV A;  1EQK A;  2OOV A;  2OWP A;  2W0Q A;  5BVB A;  2WOH A;  1CYU A;  1O7M B;  1IVW A;  2CW9 A;  4HM8 B;  2HMO B;  1AVL A;  1FGR A;  4PEJ A;  1YHQ 3;  1TFK A;  4TX4 A;  5IER A;  3X42 A;  3CNX A;  1TUH A;  1JB2 A;  2XSH B;  2YFL B;  3I56 3;  3IPT A;  3SVA A;  3SOY A;  1US1 A;  2O9U X;  2CG0 A;  3DMC A;  3EJV A;  4N6N B;  2MC8 A;  2BO9 B;  4J9A A;  1K73 4;  3VSY A;  3F7X A;  3NM7 A;  5IEO A;  2UX0 A;  4LZI A;  4MMZ B;  4HM1 B;  3EBT A;  5FGO A;  3RGR A;  1UW1 A;  2XF3 A;  3FF2 A;  2Q07 A;  5IW9 A;  3IJE B;  5D81 A;  3LOY A;  4N6M A;  3K5T A;  3FG3 A;  4R4K A;  1D6Y A;  4HZB B;  2P05 A;  5IF6 A;  1RJO A;  3NV0 A;  4IT7 A;  5DRE A;  1IQY A;  4O2H A;  5KP1 A;  1STD A;  1CEW I;  1LVN A;  3FH1 A;  2Z77 A;  2KCD A;  5AYR B;  1Z1S A;  4WYK B;  5LC7 A;  3KKG A;  3S28 A;  3VF1 A;  4O3V A;  4L8P A;  2STD A;  5CF2 A;  3B7C A;  1WMO A;  3GZX B;  4X2H A;  3CC4 3;  3CPO A;  1OUN A;  3CPW 2;  1YIT 3;  4XDV A;  3AMO A;  5D83 A;  3D3L A;  3K63 A;  1FUW A;  4O8S A;  1MOL A;  3K7C A;  4OVM A;  3N9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...